F487551

General Info

Members Datasets Scaffolds Average Seq Length
987 389 972 439

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0056318|Ga0495603_0056318_935_2182
Length 410
Sequence MSEFKRRRFLKTSAGVAAAAAVGPMIWVKDANAQWRNTPEKGAKLRVLRWSRFVQGDIDQYMKNVAKFTEKTGIEVRIDNEGWEDVRPKAAVAANTGAGPDIILSTNDDANLYPEKLVDVTDVCTYLGAKYGGWYPVCDQYLKPDGKKWIGVPLGCAGNALVYRASMLKAAGFDKVPRDTDGFLKLCKALKEKNTPVGFALGNNKVVIDSPETIKALEYAKDLYATFVPGTLSWLDPNNNKAFLDSQISLTSNGISIYFAAKNATDPKVKELEADIFHSNFPIGPVGRPTEFNLFFNQMIFKYSKYPKAAKEFLRFMMEDEQVNPWVTASLGYVTPALTAYEKHPVWNDPKATPYRDSMKIMLPSGYAGKMGYASAGALADFIMVNMVAEAASGSKSPKEAKRAERYYKV

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
6 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
7 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
8 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
9 2738543013 Variovorax sp. BT01 Isolate Unclassified
10 2842733646 Variovorax sp. R-72446 Isolate Unclassified
11 2842747753 Variovorax sp. R-72060 Isolate Unclassified
12 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
13 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
14 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
15 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
16 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
17 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
18 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
90 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
91 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
92 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
93 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
131 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
134 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
135 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
137 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
216 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
217 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
218 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
219 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
220 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
221 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
222 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
223 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
224 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
225 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
226 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
227 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
228 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
229 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
230 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
231 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
232 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
233 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
234 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
235 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
236 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
237 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
238 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
239 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
240 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
241 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
242 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
243 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
244 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
245 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
246 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
247 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
248 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
249 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
250 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
251 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
252 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
253 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
254 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
255 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
256 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
257 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
258 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
259 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
260 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
261 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
262 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
263 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
264 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
265 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
266 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
267 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
268 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
269 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
270 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
271 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
272 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
273 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
274 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
275 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
276 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
277 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
278 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
279 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
280 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
281 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
282 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
283 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
284 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
285 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
286 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
287 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
288 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
289 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
290 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
291 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
292 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
293 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
294 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
295 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
296 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
297 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
298 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
299 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
300 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
301 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
302 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
303 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
304 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
305 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
306 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
307 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
308 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
309 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
310 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
311 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
312 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
313 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
314 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
315 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
316 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
317 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
318 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
319 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
320 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
321 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
322 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
323 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
324 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
325 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
326 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
327 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
328 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
329 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
330 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
331 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
332 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
333 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
334 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
335 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
336 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
337 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
338 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
339 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
340 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
341 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
348 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
349 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
350 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
353 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
354 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
355 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
356 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
357 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
358 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
359 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
360 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
361 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
362 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
363 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
364 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
365 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
366 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
367 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
368 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
369 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
370 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
371 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
372 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
373 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
374 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
375 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
376 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
377 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
378 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
379 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
380 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
381 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
382 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
383 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
384 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
385 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
386 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
387 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
388 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
389 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.48
Metatranscriptomes 0
Isolates 1.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.31
Nodule 0
Rhizoplane 2.43
Rhizosphere 84.8
Stem 0
Stem Tuber 0
Unclassified 4.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1008017 3300001977 Bacteria 1603
2 JGI24743J22301_10001202 3300001991 Bacteria 3498
3 JGI25152J39213_1002959 3300002773 Bacteria 6045
4 JGI25153J46596_10009620 3300003215 Bacteria 4461
5 Ga0055526_1007227 3300003771 Bacteria 5828
6 Ga0055534_1002873 3300003784 Bacteria 5719
7 Ga0055530_10003423 3300003791 Bacteria 9029
8 Ga0065165_1001929 3300005262 Bacteria 19792
9 Ga0070658_10142806 3300005327 Bacteria 2000
10 Ga0070658_10175498 3300005327 Bacteria 1802
11 Ga0070676_10002428 3300005328 Bacteria 9558
12 Ga0070676_10076270 3300005328 Bacteria 2023
13 Ga0070683_100026839 3300005329 Bacteria 5190
14 Ga0070690_100002891 3300005330 Bacteria 9263
15 Ga0070690_100051374 3300005330 Bacteria 2631
16 Ga0070690_100126919 3300005330 Bacteria 1718
17 Ga0070670_100000403 3300005331 Bacteria 35526
18 Ga0070670_100002168 3300005331 Bacteria 16128
19 Ga0070670_100012532 3300005331 Bacteria 7257
20 Ga0070670_100109983 3300005331 Bacteria 2374
21 Ga0070670_100170861 3300005331 Bacteria 1885
22 Ga0070677_10002422 3300005333 Bacteria 5953
23 Ga0070677_10031267 3300005333 Bacteria 2034
24 Ga0068869_100044762 3300005334 Bacteria 3183
25 Ga0068869_100053189 3300005334 Bacteria 2942
26 Ga0068869_100054919 3300005334 Bacteria 2901
27 Ga0070666_10001963 3300005335 Bacteria 12523
28 Ga0070666_10003434 3300005335 Bacteria 9596
29 Ga0070666_10028929 3300005335 Bacteria 3640
30 Ga0070666_10037161 3300005335 Bacteria 3236
31 Ga0070680_100004529 3300005336 Bacteria 10465
32 Ga0070680_100009735 3300005336 Bacteria 7396
33 Ga0070680_100049187 3300005336 Bacteria 3436
34 Ga0068868_100005341 3300005338 Bacteria 9019
35 Ga0068868_100005830 3300005338 Bacteria 8686
36 Ga0068868_100055798 3300005338 Bacteria 3118
37 Ga0068868_100063437 3300005338 Bacteria 2931
38 Ga0068868_100063898 3300005338 Bacteria 2921
39 Ga0068868_100121061 3300005338 Bacteria 2135
40 Ga0068868_100157985 3300005338 Bacteria 1871
41 Ga0068868_100176585 3300005338 Bacteria 1770
42 Ga0070660_100027463 3300005339 Bacteria 4247
43 Ga0070660_100040343 3300005339 Bacteria 3552
44 Ga0070660_100043813 3300005339 Bacteria 3420
45 Ga0070660_100193411 3300005339 Bacteria 1648
46 Ga0070689_100001549 3300005340 Bacteria 14642
47 Ga0070689_100029731 3300005340 Bacteria 4139
48 Ga0070689_100040119 3300005340 Bacteria 3588
49 Ga0070687_100021134 3300005343 Bacteria 3053
50 Ga0070687_100026415 3300005343 Bacteria 2795
51 Ga0070661_100004818 3300005344 Bacteria 9289
52 Ga0070661_100026491 3300005344 Bacteria 4170
53 Ga0070661_100048573 3300005344 Bacteria 3106
54 Ga0070661_100059702 3300005344 Bacteria 2797
55 Ga0070661_100149226 3300005344 Bacteria 1766
56 Ga0070692_10075970 3300005345 Bacteria 1800
57 Ga0070668_100032908 3300005347 Bacteria 3946
58 Ga0070669_100001676 3300005353 Bacteria 16040
59 Ga0070669_100036531 3300005353 Bacteria 3560
60 Ga0070675_100000815 3300005354 Bacteria 21956
61 Ga0070675_100001022 3300005354 Bacteria 20130
62 Ga0070675_100015525 3300005354 Bacteria 6023
63 Ga0070675_100031242 3300005354 Bacteria 4304
64 Ga0070675_100151237 3300005354 Bacteria 1990
65 Ga0070671_100006677 3300005355 Bacteria 9227
66 Ga0070671_100007060 3300005355 Bacteria 8994
67 Ga0070671_100014895 3300005355 Bacteria 6282
68 Ga0070671_100016498 3300005355 Bacteria 5970
69 Ga0070671_100019739 3300005355 Bacteria 5489
70 Ga0070671_100026363 3300005355 Bacteria 4776
71 Ga0070674_100001557 3300005356 Bacteria 12284
72 Ga0070674_100003570 3300005356 Bacteria 8746
73 Ga0070674_100009857 3300005356 Bacteria 5746
74 Ga0070674_100013348 3300005356 Bacteria 5076
75 Ga0070673_100001934 3300005364 Bacteria 12463
76 Ga0070673_100014070 3300005364 Bacteria 5558
77 Ga0070673_100015567 3300005364 Bacteria 5348
78 Ga0070673_100032868 3300005364 Bacteria 3911
79 Ga0070673_100034495 3300005364 Bacteria 3830
80 Ga0070688_100001074 3300005365 Bacteria 13707
81 Ga0070688_100009209 3300005365 Bacteria 5389
82 Ga0070659_100002847 3300005366 Bacteria 12313
83 Ga0070659_100019546 3300005366 Bacteria 5135
84 Ga0070659_100028640 3300005366 Bacteria 4303
85 Ga0070667_100012710 3300005367 Bacteria 6960
86 Ga0070667_100014862 3300005367 Bacteria 6431
87 Ga0070667_100032704 3300005367 Bacteria 4339
88 Ga0070667_100083367 3300005367 Bacteria 2738
89 Ga0070709_10013191 3300005434 Bacteria 4638
90 Ga0070709_10016788 3300005434 Bacteria 4187
91 Ga0070709_10027608 3300005434 Bacteria 3376
92 Ga0070714_100244019 3300005435 Bacteria 1658
93 Ga0070713_100000662 3300005436 Bacteria 22020
94 Ga0070713_100038438 3300005436 Bacteria 3878
95 Ga0070713_100144532 3300005436 Bacteria 2110
96 Ga0070713_100167906 3300005436 Bacteria 1963
97 Ga0070701_10006091 3300005438 Bacteria 5046
98 Ga0070701_10047622 3300005438 Bacteria 2208
99 Ga0070701_10063306 3300005438 Bacteria 1957
100 Ga0070711_100016266 3300005439 Bacteria 4722
101 Ga0070705_100100322 3300005440 Bacteria 1826
102 Ga0070663_100024405 3300005455 Bacteria 4070
103 Ga0070678_100001980 3300005456 Bacteria 11070
104 Ga0070678_100005836 3300005456 Bacteria 7163
105 Ga0070678_100013439 3300005456 Bacteria 5133
106 Ga0070678_100028162 3300005456 Bacteria 3827
107 Ga0070678_100058303 3300005456 Bacteria 2833
108 Ga0070678_100158819 3300005456 Bacteria 1829
109 Ga0070662_100001732 3300005457 Bacteria 13425
110 Ga0070662_100004864 3300005457 Bacteria 8520
111 Ga0070662_100010906 3300005457 Bacteria 5987
112 Ga0070681_10009151 3300005458 Bacteria 9731
113 Ga0070681_10226107 3300005458 Bacteria 1786
114 Ga0068867_100011138 3300005459 Bacteria 6343
115 Ga0068867_100026482 3300005459 Bacteria 4164
116 Ga0068867_100038864 3300005459 Bacteria 3466
117 Ga0068867_100047964 3300005459 Bacteria 3141
118 Ga0068867_100065748 3300005459 Bacteria 2699
119 Ga0070685_10001710 3300005466 Bacteria 11511
120 Ga0070685_10002286 3300005466 Bacteria 9886
121 Ga0070685_10010239 3300005466 Bacteria 4867
122 Ga0070706_100001321 3300005467 Bacteria 26375
123 Ga0070706_100046470 3300005467 Bacteria 4007
124 Ga0070698_100100992 3300005471 Bacteria 2857
125 Ga0070699_100010858 3300005518 Bacteria 7881
126 Ga0070699_100034555 3300005518 Bacteria 4370
127 Ga0070679_100002199 3300005530 Bacteria 17619
128 Ga0070679_100034907 3300005530 Bacteria 4987
129 Ga0070684_100087136 3300005535 Bacteria 2772
130 Ga0070684_100182835 3300005535 Bacteria 1906
131 Ga0068853_100016438 3300005539 Bacteria 6089
132 Ga0068853_100062500 3300005539 Bacteria 3223
133 Ga0068853_100069432 3300005539 Bacteria 3065
134 Ga0068853_100291457 3300005539 Bacteria 1506
135 Ga0070672_100001412 3300005543 Bacteria 14833
136 Ga0070672_100001817 3300005543 Bacteria 13320
137 Ga0070672_100008785 3300005543 Bacteria 6936
138 Ga0070672_100013430 3300005543 Bacteria 5785
139 Ga0070672_100016427 3300005543 Bacteria 5300
140 Ga0070672_100031008 3300005543 Bacteria 4021
141 Ga0070672_100066695 3300005543 Bacteria 2850
142 Ga0070672_100066775 3300005543 Bacteria 2848
143 Ga0070672_100097636 3300005543 Bacteria 2378
144 Ga0070672_100173256 3300005543 Bacteria 1795
145 Ga0070686_100051659 3300005544 Bacteria 2618
146 Ga0070696_100001069 3300005546 Bacteria 17701
147 Ga0070693_100005196 3300005547 Bacteria 6229
148 Ga0070693_100034738 3300005547 Bacteria 2791
149 Ga0070693_100035112 3300005547 Bacteria 2778
150 Ga0070693_100092527 3300005547 Bacteria 1826
151 Ga0070665_100003498 3300005548 Bacteria 16718
152 Ga0070665_100006314 3300005548 Bacteria 12097
153 Ga0070665_100029079 3300005548 Bacteria 5563
154 Ga0070665_100030832 3300005548 Bacteria 5396
155 Ga0070665_100041342 3300005548 Bacteria 4633
156 Ga0070704_100030185 3300005549 Bacteria 3630
157 Ga0070704_100084272 3300005549 Bacteria 2349
158 Ga0068855_100001539 3300005563 Bacteria 28980
159 Ga0068855_100007145 3300005563 Bacteria 13553
160 Ga0068855_100036094 3300005563 Bacteria 5885
161 Ga0068855_100061675 3300005563 Bacteria 4380
162 Ga0070664_100004354 3300005564 Bacteria 11375
163 Ga0070664_100019498 3300005564 Bacteria 5581
164 Ga0070664_100020289 3300005564 Bacteria 5471
165 Ga0070664_100020987 3300005564 Bacteria 5381
166 Ga0070664_100035837 3300005564 Bacteria 4166
167 Ga0070664_100054372 3300005564 Bacteria 3396
168 Ga0070664_100073314 3300005564 Bacteria 2937
169 Ga0070664_100199930 3300005564 Bacteria 1783
170 Ga0068857_100035640 3300005577 Bacteria 4407
171 Ga0068857_100130386 3300005577 Bacteria 2267
172 Ga0068854_100003803 3300005578 Bacteria 9439
173 Ga0068854_100006013 3300005578 Bacteria 7688
174 Ga0068854_100022163 3300005578 Bacteria 4322
175 Ga0068854_100035336 3300005578 Bacteria 3496
176 Ga0068854_100037496 3300005578 Bacteria 3403
177 Ga0068856_100000246 3300005614 Bacteria 59117
178 Ga0068856_100041781 3300005614 Bacteria 4508
179 Ga0068856_100046294 3300005614 Bacteria 4285
180 Ga0068856_100053277 3300005614 Bacteria 3989
181 Ga0068856_100057174 3300005614 Bacteria 3850
182 Ga0068856_100092988 3300005614 Bacteria 3001
183 Ga0068856_100167638 3300005614 Bacteria 2207
184 Ga0070702_100003579 3300005615 Bacteria 6975
185 Ga0070702_100008689 3300005615 Bacteria 4933
186 Ga0070702_100116143 3300005615 Bacteria 1668
187 Ga0068852_100018994 3300005616 Bacteria 5429
188 Ga0068852_100099242 3300005616 Bacteria 2624
189 Ga0068852_100114988 3300005616 Bacteria 2452
190 Ga0068852_100118610 3300005616 Bacteria 2418
191 Ga0068852_100260912 3300005616 Bacteria 1664
192 Ga0068852_100262944 3300005616 Bacteria 1657
193 Ga0068859_100000631 3300005617 Bacteria 35209
194 Ga0068859_100002547 3300005617 Bacteria 18508
195 Ga0068859_100054348 3300005617 Bacteria 4027
196 Ga0068859_100178980 3300005617 Bacteria 2203
197 Ga0068864_100000761 3300005618 Bacteria 27089
198 Ga0068864_100001006 3300005618 Bacteria 23586
199 Ga0068864_100015902 3300005618 Bacteria 6262
200 Ga0068864_100032182 3300005618 Bacteria 4454
201 Ga0068864_100084703 3300005618 Bacteria 2786
202 Ga0068864_100097316 3300005618 Bacteria 2605
203 Ga0068864_100100358 3300005618 Bacteria 2565
204 Ga0068864_100137963 3300005618 Bacteria 2197
205 Ga0068864_100208279 3300005618 Bacteria 1799
206 Ga0068866_10001391 3300005718 Bacteria 10429
207 Ga0068866_10005562 3300005718 Bacteria 5209
208 Ga0068861_100003340 3300005719 Bacteria 10628
209 Ga0068861_100021335 3300005719 Bacteria 4654
210 Ga0068861_100233909 3300005719 Bacteria 1560
211 Ga0068851_10003782 3300005834 Bacteria 6771
212 Ga0068851_10014649 3300005834 Bacteria 3724
213 Ga0068851_10016960 3300005834 Bacteria 3491
214 Ga0068851_10020500 3300005834 Bacteria 3203
215 Ga0068851_10028117 3300005834 Bacteria 2775
216 Ga0068851_10051482 3300005834 Bacteria 2093
217 Ga0068870_10004781 3300005840 Bacteria 5857
218 Ga0068863_100001520 3300005841 Bacteria 22917
219 Ga0068863_100028533 3300005841 Bacteria 5329
220 Ga0068863_100071725 3300005841 Bacteria 3277
221 Ga0068863_100074661 3300005841 Bacteria 3208
222 Ga0068863_100110582 3300005841 Bacteria 2617
223 Ga0068863_100110598 3300005841 Bacteria 2616
224 Ga0068858_100001003 3300005842 Bacteria 29188
225 Ga0068858_100002479 3300005842 Bacteria 18626
226 Ga0068858_100004428 3300005842 Bacteria 13776
227 Ga0068858_100006624 3300005842 Bacteria 11271
228 Ga0068858_100026455 3300005842 Bacteria 5389
229 Ga0068860_100008652 3300005843 Bacteria 10141
230 Ga0068860_100011471 3300005843 Bacteria 8732
231 Ga0068860_100012688 3300005843 Bacteria 8289
232 Ga0068860_100022329 3300005843 Bacteria 6122
233 Ga0068860_100147030 3300005843 Bacteria 2268
234 Ga0068860_100221933 3300005843 Bacteria 1835
235 Ga0068862_100033069 3300005844 Bacteria 4368
236 Ga0081539_10007328 3300005985 Bacteria 10119
237 Ga0081539_10028541 3300005985 Bacteria 3506
238 Ga0075365_10013462 3300006038 Bacteria 4894
239 Ga0075365_10013860 3300006038 Bacteria 4835
240 Ga0075368_10003480 3300006042 Bacteria 5264
241 Ga0075363_100002634 3300006048 Bacteria 7396
242 Ga0075432_10018964 3300006058 Bacteria 2348
243 Ga0070712_100005788 3300006175 Bacteria 7641
244 Ga0070712_100070848 3300006175 Bacteria 2492
245 Ga0075362_10027810 3300006177 Bacteria 2423
246 Ga0075367_10002281 3300006178 Bacteria 8698
247 Ga0075367_10073532 3300006178 Bacteria 2060
248 Ga0075366_10002262 3300006195 Bacteria 9834
249 Ga0075366_10023241 3300006195 Bacteria 3611
250 Ga0075366_10069410 3300006195 Bacteria 2097
251 Ga0075366_10102696 3300006195 Bacteria 1716
252 Ga0097621_100007405 3300006237 Bacteria 7850
253 Ga0097621_100013201 3300006237 Bacteria 6146
254 Ga0097621_100031564 3300006237 Bacteria 4205
255 Ga0097621_100049274 3300006237 Bacteria 3421
256 Ga0097621_100057987 3300006237 Bacteria 3168
257 Ga0097621_100059916 3300006237 Bacteria 3118
258 Ga0097621_100312814 3300006237 Bacteria 1389
259 Ga0075370_10001313 3300006353 Bacteria 10640
260 Ga0075370_10016975 3300006353 Bacteria 3926
261 Ga0075370_10037289 3300006353 Bacteria 2732
262 Ga0068871_100004805 3300006358 Bacteria 9449
263 Ga0068871_100023358 3300006358 Bacteria 4781
264 Ga0068871_100058376 3300006358 Bacteria 3141
265 Ga0068871_100097150 3300006358 Bacteria 2462
266 Ga0068871_100105397 3300006358 Bacteria 2366
267 Ga0075428_100116605 3300006844 Bacteria 2908
268 Ga0068865_100003331 3300006881 Bacteria 9618
269 Ga0068865_100074351 3300006881 Bacteria 2419
270 Ga0068865_100080660 3300006881 Bacteria 2334
271 Ga0075436_100068140 3300006914 Bacteria 2459
272 Ga0097620_100000631 3300006931 Bacteria 35209
273 Ga0097620_100002547 3300006931 Bacteria 18508
274 Ga0097620_100054342 3300006931 Bacteria 4027
275 Ga0097620_100178976 3300006931 Bacteria 2203
276 Ga0099794_10004769 3300007265 Bacteria 5375
277 Ga0105240_10009479 3300009093 Bacteria 13784
278 Ga0105240_10010648 3300009093 Bacteria 12915
279 Ga0105240_10044820 3300009093 Bacteria 5616
280 Ga0105240_10053996 3300009093 Bacteria 5038
281 Ga0105240_10153052 3300009093 Bacteria 2745
282 Ga0105245_10013089 3300009098 Bacteria 7227
283 Ga0105245_10016169 3300009098 Bacteria 6502
284 Ga0105245_10118727 3300009098 Bacteria 2468
285 Ga0105245_10133467 3300009098 Bacteria 2331
286 Ga0105245_10348823 3300009098 Bacteria 1466
287 Ga0105241_10007643 3300009174 Bacteria 7946
288 Ga0105241_10011568 3300009174 Bacteria 6470
289 Ga0105242_10033379 3300009176 Bacteria 4120
290 Ga0105242_10034458 3300009176 Bacteria 4058
291 Ga0105248_10007014 3300009177 Bacteria 12338
292 Ga0105248_10079735 3300009177 Bacteria 3679
293 Ga0105248_10194288 3300009177 Bacteria 2286
294 Ga0105248_10200385 3300009177 Bacteria 2249
295 Ga0105248_10241428 3300009177 Bacteria 2034
296 Ga0105237_10110770 3300009545 Bacteria 2737
297 Ga0105237_10129281 3300009545 Bacteria 2520
298 Ga0105238_10006338 3300009551 Bacteria 11764
299 Ga0105238_10012746 3300009551 Bacteria 8486
300 Ga0105238_10018081 3300009551 Bacteria 7166
301 Ga0105249_10080759 3300009553 Bacteria 3022
302 Ga0105249_10102216 3300009553 Bacteria 2697
303 Ga0105239_10121432 3300010375 Bacteria 2902
304 Ga0157373_10013160 3300013100 Bacteria 6072
305 Ga0157373_10030428 3300013100 Bacteria 3885
306 Ga0157373_10038402 3300013100 Bacteria 3432
307 Ga0157371_10002555 3300013102 Bacteria 17267
308 Ga0157370_10004306 3300013104 Bacteria 16359
309 Ga0157370_10009815 3300013104 Bacteria 10150
310 Ga0157370_10096408 3300013104 Bacteria 2775
311 Ga0157370_10108106 3300013104 Bacteria 2601
312 Ga0157369_10008064 3300013105 Bacteria 12076
313 Ga0157369_10097638 3300013105 Bacteria 3134
314 Ga0157369_10104750 3300013105 Bacteria 3012
315 Ga0157369_10152905 3300013105 Bacteria 2439
316 Ga0157374_10001315 3300013296 Bacteria 21157
317 Ga0157374_10008118 3300013296 Bacteria 8972
318 Ga0157374_10030270 3300013296 Bacteria 4912
319 Ga0157378_10006295 3300013297 Bacteria 10398
320 Ga0157378_10014395 3300013297 Bacteria 6925
321 Ga0157378_10146599 3300013297 Bacteria 2196
322 Ga0157378_10186571 3300013297 Bacteria 1954
323 Ga0157378_10236891 3300013297 Bacteria 1742
324 Ga0163162_10003915 3300013306 Bacteria 14297
325 Ga0163162_10006607 3300013306 Bacteria 11234
326 Ga0163162_10016098 3300013306 Bacteria 7309
327 Ga0163162_10100693 3300013306 Bacteria 2981
328 Ga0163162_10102649 3300013306 Bacteria 2953
329 Ga0163162_10140260 3300013306 Bacteria 2530
330 Ga0157372_10000342 3300013307 Bacteria 51414
331 Ga0157372_10104769 3300013307 Bacteria 3234
332 Ga0157372_10121816 3300013307 Bacteria 2997
333 Ga0157372_10286269 3300013307 Bacteria 1916
334 Ga0157375_10003025 3300013308 Bacteria 14585
335 Ga0157375_10100843 3300013308 Bacteria 2969
336 Ga0157375_10124421 3300013308 Bacteria 2692
337 Ga0157375_10156839 3300013308 Bacteria 2415
338 Ga0163163_10000467 3300014325 Bacteria 36905
339 Ga0163163_10004530 3300014325 Bacteria 11864
340 Ga0163163_10007271 3300014325 Bacteria 9765
341 Ga0157380_10011483 3300014326 Bacteria 6402
342 Ga0157380_10080513 3300014326 Bacteria 2662
343 Ga0182008_10000654 3300014497 Bacteria 25278
344 Ga0182008_10001019 3300014497 Bacteria 19443
345 Ga0182008_10026911 3300014497 Bacteria 2915
346 Ga0157377_10001599 3300014745 Bacteria 9860
347 Ga0157379_10001988 3300014968 Bacteria 16918
348 Ga0157379_10006045 3300014968 Bacteria 10426
349 Ga0157379_10009277 3300014968 Bacteria 8565
350 Ga0157379_10052111 3300014968 Bacteria 3655
351 Ga0157379_10072578 3300014968 Bacteria 3080
352 Ga0157379_10079548 3300014968 Bacteria 2935
353 Ga0157379_10151461 3300014968 Bacteria 2092
354 Ga0157376_10011104 3300014969 Bacteria 6624
355 Ga0157376_10016382 3300014969 Bacteria 5626
356 Ga0157376_10079159 3300014969 Bacteria 2817
357 Ga0157376_10107010 3300014969 Bacteria 2454
358 Ga0157376_10111753 3300014969 Bacteria 2406
359 Ga0182007_10001610 3300015262 Bacteria 11983
360 Ga0183362_10001 3300015683 Bacteria 2046624
361 Ga0163161_10000606 3300017792 Bacteria 28652
362 Ga0163161_10019038 3300017792 Bacteria 4813
363 Ga0163161_10046116 3300017792 Bacteria 3144
364 Ga0163161_10057062 3300017792 Bacteria 2837
365 Ga0163161_10106728 3300017792 Bacteria 2090
366 Ga0207425_1000448 3300025245 Bacteria 26903
367 Ga0209129_1000124 3300025258 Bacteria 133610
368 Ga0209673_1004568 3300025273 Bacteria 7350
369 Ga0209673_1024574 3300025273 Bacteria 2021
370 Ga0209130_1005106 3300025284 Bacteria 4677
371 Ga0209675_1001148 3300025291 Bacteria 16132
372 Ga0209676_1006751 3300025292 Bacteria 5580
373 Ga0209564_1000057 3300025295 Bacteria 340400
374 Ga0209758_1000214 3300025297 Bacteria 126364
375 Ga0209758_1000232 3300025297 Bacteria 117382
376 Ga0209050_1000268 3300025298 Bacteria 111281
377 Ga0209051_1010377 3300025303 Bacteria 4714
378 Ga0209051_1012907 3300025303 Bacteria 4010
379 Ga0209257_1007196 3300025304 Bacteria 6828
380 Ga0207697_10008831 3300025315 Bacteria 4385
381 Ga0207656_10004085 3300025321 Bacteria 5064
382 Ga0207656_10008628 3300025321 Bacteria 3758
383 Ga0207656_10063340 3300025321 Bacteria 1627
384 Ga0207682_10000068 3300025893 Bacteria 45481
385 Ga0207682_10001129 3300025893 Bacteria 12342
386 Ga0207682_10001755 3300025893 Bacteria 9950
387 Ga0207682_10017681 3300025893 Bacteria 2784
388 Ga0207688_10022024 3300025901 Bacteria 3486
389 Ga0207688_10042276 3300025901 Bacteria 2537
390 Ga0207688_10060234 3300025901 Bacteria 2138
391 Ga0207680_10000777 3300025903 Bacteria 15079
392 Ga0207680_10003229 3300025903 Bacteria 7672
393 Ga0207680_10041827 3300025903 Bacteria 2677
394 Ga0207680_10042713 3300025903 Bacteria 2654
395 Ga0207645_10001270 3300025907 Bacteria 20763
396 Ga0207645_10001926 3300025907 Bacteria 16746
397 Ga0207645_10003904 3300025907 Bacteria 11142
398 Ga0207645_10049844 3300025907 Bacteria 2674
399 Ga0207645_10148028 3300025907 Bacteria 1532
400 Ga0207643_10000298 3300025908 Bacteria 34305
401 Ga0207643_10015505 3300025908 Bacteria 4148
402 Ga0207643_10143358 3300025908 Bacteria 1428
403 Ga0207705_10108792 3300025909 Bacteria 2046
404 Ga0207705_10134555 3300025909 Bacteria 1842
405 Ga0207684_10040849 3300025910 Bacteria 3932
406 Ga0207654_10008668 3300025911 Bacteria 5154
407 Ga0207654_10009118 3300025911 Bacteria 5033
408 Ga0207707_10014602 3300025912 Bacteria 6842
409 Ga0207707_10092742 3300025912 Bacteria 2639
410 Ga0207707_10130569 3300025912 Bacteria 2197
411 Ga0207707_10167325 3300025912 Bacteria 1921
412 Ga0207695_10049214 3300025913 Bacteria 4445
413 Ga0207695_10077536 3300025913 Bacteria 3375
414 Ga0207695_10106163 3300025913 Bacteria 2795
415 Ga0207695_10110776 3300025913 Bacteria 2725
416 Ga0207671_10163484 3300025914 Bacteria 1725
417 Ga0207693_10028327 3300025915 Bacteria 4426
418 Ga0207693_10172725 3300025915 Bacteria 1701
419 Ga0207663_10014144 3300025916 Bacteria 4362
420 Ga0207660_10007424 3300025917 Bacteria 7092
421 Ga0207660_10010630 3300025917 Bacteria 5980
422 Ga0207660_10187497 3300025917 Bacteria 1609
423 Ga0207662_10000764 3300025918 Bacteria 14771
424 Ga0207662_10005747 3300025918 Bacteria 6638
425 Ga0207662_10060376 3300025918 Bacteria 2274
426 Ga0207662_10061703 3300025918 Bacteria 2251
427 Ga0207657_10000738 3300025919 Bacteria 34692
428 Ga0207657_10000884 3300025919 Bacteria 31683
429 Ga0207657_10004460 3300025919 Bacteria 14814
430 Ga0207657_10013043 3300025919 Bacteria 8167
431 Ga0207657_10152786 3300025919 Bacteria 1879
432 Ga0207649_10013416 3300025920 Bacteria 4575
433 Ga0207649_10044347 3300025920 Bacteria 2722
434 Ga0207649_10104174 3300025920 Bacteria 1883
435 Ga0207652_10005535 3300025921 Bacteria 10239
436 Ga0207652_10023610 3300025921 Bacteria 5096
437 Ga0207652_10046991 3300025921 Bacteria 3686
438 Ga0207646_10111752 3300025922 Bacteria 2452
439 Ga0207646_10178582 3300025922 Bacteria 1917
440 Ga0207681_10000771 3300025923 Bacteria 21062
441 Ga0207681_10025743 3300025923 Bacteria 3787
442 Ga0207681_10032191 3300025923 Bacteria 3431
443 Ga0207681_10049263 3300025923 Bacteria 2847
444 Ga0207681_10063287 3300025923 Bacteria 2550
445 Ga0207681_10086338 3300025923 Bacteria 2229
446 Ga0207694_10036099 3300025924 Bacteria 3792
447 Ga0207694_10040036 3300025924 Bacteria 3608
448 Ga0207650_10000408 3300025925 Bacteria 38515
449 Ga0207650_10000560 3300025925 Bacteria 30230
450 Ga0207650_10000654 3300025925 Bacteria 27396
451 Ga0207650_10001998 3300025925 Bacteria 14283
452 Ga0207650_10041784 3300025925 Bacteria 3361
453 Ga0207650_10047393 3300025925 Bacteria 3167
454 Ga0207650_10088947 3300025925 Bacteria 2356
455 Ga0207659_10000256 3300025926 Bacteria 32624
456 Ga0207659_10002052 3300025926 Bacteria 11958
457 Ga0207659_10006382 3300025926 Bacteria 7222
458 Ga0207659_10022714 3300025926 Bacteria 4179
459 Ga0207687_10007275 3300025927 Bacteria 7300
460 Ga0207687_10014865 3300025927 Bacteria 5098
461 Ga0207687_10083957 3300025927 Bacteria 2307
462 Ga0207700_10107854 3300025928 Bacteria 2235
463 Ga0207664_10008503 3300025929 Bacteria 7166
464 Ga0207664_10016442 3300025929 Bacteria 5397
465 Ga0207664_10032639 3300025929 Bacteria 3994
466 Ga0207644_10000392 3300025931 Bacteria 28471
467 Ga0207644_10000817 3300025931 Bacteria 19790
468 Ga0207644_10002297 3300025931 Bacteria 12399
469 Ga0207644_10004537 3300025931 Bacteria 9023
470 Ga0207644_10014072 3300025931 Bacteria 5349
471 Ga0207644_10015516 3300025931 Bacteria 5115
472 Ga0207644_10022491 3300025931 Bacteria 4308
473 Ga0207644_10035393 3300025931 Bacteria 3498
474 Ga0207644_10073669 3300025931 Bacteria 2504
475 Ga0207644_10104303 3300025931 Bacteria 2134
476 Ga0207644_10184693 3300025931 Bacteria 1636
477 Ga0207690_10000479 3300025932 Bacteria 25747
478 Ga0207690_10008231 3300025932 Bacteria 6185
479 Ga0207706_10011643 3300025933 Bacteria 8017
480 Ga0207706_10012558 3300025933 Bacteria 7712
481 Ga0207706_10033969 3300025933 Bacteria 4539
482 Ga0207706_10072621 3300025933 Bacteria 3026
483 Ga0207686_10005871 3300025934 Bacteria 6589
484 Ga0207686_10008914 3300025934 Bacteria 5428
485 Ga0207686_10040244 3300025934 Bacteria 2841
486 Ga0207686_10102922 3300025934 Bacteria 1910
487 Ga0207709_10013260 3300025935 Bacteria 4547
488 Ga0207709_10111637 3300025935 Bacteria 1829
489 Ga0207670_10001589 3300025936 Bacteria 11878
490 Ga0207670_10066152 3300025936 Bacteria 2482
491 Ga0207670_10105824 3300025936 Bacteria 2017
492 Ga0207669_10007148 3300025937 Bacteria 5141
493 Ga0207669_10049261 3300025937 Bacteria 2509
494 Ga0207669_10074826 3300025937 Bacteria 2143
495 Ga0207669_10104194 3300025937 Bacteria 1883
496 Ga0207704_10006681 3300025938 Bacteria 5403
497 Ga0207704_10014938 3300025938 Bacteria 3941
498 Ga0207665_10046917 3300025939 Bacteria 2895
499 Ga0207691_10000360 3300025940 Bacteria 45895
500 Ga0207691_10010241 3300025940 Bacteria 8995
501 Ga0207691_10012083 3300025940 Bacteria 8281
502 Ga0207691_10037913 3300025940 Bacteria 4461
503 Ga0207691_10055015 3300025940 Bacteria 3628
504 Ga0207691_10058242 3300025940 Bacteria 3514
505 Ga0207691_10065131 3300025940 Bacteria 3300
506 Ga0207691_10065404 3300025940 Bacteria 3291
507 Ga0207711_10000260 3300025941 Bacteria 57379
508 Ga0207711_10012387 3300025941 Bacteria 7089
509 Ga0207711_10032815 3300025941 Bacteria 4392
510 Ga0207711_10055528 3300025941 Bacteria 3400
511 Ga0207711_10108107 3300025941 Bacteria 2470
512 Ga0207711_10220736 3300025941 Bacteria 1734
513 Ga0207689_10002446 3300025942 Bacteria 17304
514 Ga0207689_10007734 3300025942 Bacteria 9407
515 Ga0207689_10067369 3300025942 Bacteria 2942
516 Ga0207689_10131192 3300025942 Bacteria 2062
517 Ga0207661_10055317 3300025944 Bacteria 3182
518 Ga0207661_10241976 3300025944 Bacteria 1601
519 Ga0207679_10001523 3300025945 Bacteria 14496
520 Ga0207679_10011900 3300025945 Bacteria 5655
521 Ga0207679_10092066 3300025945 Bacteria 2348
522 Ga0207679_10092234 3300025945 Bacteria 2346
523 Ga0207679_10158499 3300025945 Bacteria 1850
524 Ga0207679_10203714 3300025945 Bacteria 1654
525 Ga0207667_10005313 3300025949 Bacteria 15693
526 Ga0207667_10045267 3300025949 Bacteria 4661
527 Ga0207667_10106192 3300025949 Bacteria 2897
528 Ga0207667_10177740 3300025949 Bacteria 2186
529 Ga0207667_10191303 3300025949 Bacteria 2100
530 Ga0207651_10000554 3300025960 Bacteria 15685
531 Ga0207651_10008778 3300025960 Bacteria 5484
532 Ga0207651_10013533 3300025960 Bacteria 4672
533 Ga0207651_10013580 3300025960 Bacteria 4667
534 Ga0207651_10020777 3300025960 Bacteria 3971
535 Ga0207651_10025601 3300025960 Bacteria 3670
536 Ga0207651_10094781 3300025960 Bacteria 2196
537 Ga0207651_10115487 3300025960 Bacteria 2024
538 Ga0207651_10176429 3300025960 Bacteria 1690
539 Ga0207712_10054459 3300025961 Bacteria 2810
540 Ga0207668_10008779 3300025972 Bacteria 6038
541 Ga0207668_10020784 3300025972 Bacteria 4178
542 Ga0207668_10025745 3300025972 Bacteria 3811
543 Ga0207668_10027421 3300025972 Bacteria 3709
544 Ga0207668_10078678 3300025972 Bacteria 2382
545 Ga0207668_10196923 3300025972 Bacteria 1601
546 Ga0207640_10024716 3300025981 Bacteria 3629
547 Ga0207640_10059192 3300025981 Bacteria 2527
548 Ga0207640_10090010 3300025981 Bacteria 2122
549 Ga0207640_10225607 3300025981 Bacteria 1437
550 Ga0207658_10000818 3300025986 Bacteria 25979
551 Ga0207658_10001915 3300025986 Bacteria 15548
552 Ga0207658_10002797 3300025986 Bacteria 12556
553 Ga0207658_10003185 3300025986 Bacteria 11693
554 Ga0207658_10016161 3300025986 Bacteria 5128
555 Ga0207658_10020728 3300025986 Bacteria 4554
556 Ga0207658_10042139 3300025986 Bacteria 3309
557 Ga0207658_10051485 3300025986 Bacteria 3035
558 Ga0207658_10072467 3300025986 Bacteria 2611
559 Ga0207658_10080115 3300025986 Bacteria 2500
560 Ga0207677_10000160 3300026023 Bacteria 53532
561 Ga0207677_10006603 3300026023 Bacteria 6364
562 Ga0207677_10018163 3300026023 Bacteria 4215
563 Ga0207677_10022471 3300026023 Bacteria 3877
564 Ga0207677_10089631 3300026023 Bacteria 2233
565 Ga0207677_10121386 3300026023 Bacteria 1966
566 Ga0207703_10000668 3300026035 Bacteria 34245
567 Ga0207703_10001037 3300026035 Bacteria 26605
568 Ga0207703_10003675 3300026035 Bacteria 12785
569 Ga0207703_10017240 3300026035 Bacteria 5637
570 Ga0207703_10040845 3300026035 Bacteria 3714
571 Ga0207703_10098713 3300026035 Bacteria 2470
572 Ga0207639_10007516 3300026041 Bacteria 7432
573 Ga0207639_10076337 3300026041 Bacteria 2638
574 Ga0207639_10082999 3300026041 Bacteria 2542
575 Ga0207678_10004104 3300026067 Bacteria 13098
576 Ga0207678_10024482 3300026067 Bacteria 5273
577 Ga0207678_10065216 3300026067 Bacteria 3128
578 Ga0207678_10073364 3300026067 Bacteria 2933
579 Ga0207678_10086238 3300026067 Bacteria 2683
580 Ga0207708_10002209 3300026075 Bacteria 14387
581 Ga0207708_10129850 3300026075 Bacteria 1970
582 Ga0207708_10156639 3300026075 Bacteria 1796
583 Ga0207702_10008513 3300026078 Bacteria 8649
584 Ga0207702_10013149 3300026078 Bacteria 6882
585 Ga0207702_10014823 3300026078 Bacteria 6465
586 Ga0207702_10021062 3300026078 Bacteria 5396
587 Ga0207702_10036335 3300026078 Bacteria 4120
588 Ga0207702_10048102 3300026078 Bacteria 3596
589 Ga0207641_10015742 3300026088 Bacteria 6196
590 Ga0207641_10016641 3300026088 Bacteria 6020
591 Ga0207641_10020425 3300026088 Bacteria 5439
592 Ga0207641_10064469 3300026088 Bacteria 3131
593 Ga0207648_10002249 3300026089 Bacteria 20879
594 Ga0207648_10003985 3300026089 Bacteria 15326
595 Ga0207648_10010108 3300026089 Bacteria 8971
596 Ga0207648_10010271 3300026089 Bacteria 8890
597 Ga0207648_10017630 3300026089 Bacteria 6485
598 Ga0207648_10023261 3300026089 Bacteria 5557
599 Ga0207648_10047650 3300026089 Bacteria 3755
600 Ga0207676_10000460 3300026095 Bacteria 34103
601 Ga0207676_10000684 3300026095 Bacteria 26910
602 Ga0207676_10003822 3300026095 Bacteria 10636
603 Ga0207676_10004373 3300026095 Bacteria 9990
604 Ga0207676_10016045 3300026095 Bacteria 5419
605 Ga0207676_10040865 3300026095 Bacteria 3557
606 Ga0207676_10083224 3300026095 Bacteria 2605
607 Ga0207676_10110582 3300026095 Bacteria 2298
608 Ga0207676_10181939 3300026095 Bacteria 1841
609 Ga0207676_10276977 3300026095 Bacteria 1521
610 Ga0207674_10011720 3300026116 Bacteria 9839
611 Ga0207674_10012883 3300026116 Bacteria 9331
612 Ga0207674_10026949 3300026116 Bacteria 6094
613 Ga0207675_100013782 3300026118 Bacteria 7540
614 Ga0207675_100014357 3300026118 Bacteria 7385
615 Ga0207675_100020315 3300026118 Bacteria 6193
616 Ga0207675_100029124 3300026118 Bacteria 5146
617 Ga0207675_100275251 3300026118 Bacteria 1634
618 Ga0207683_10001906 3300026121 Bacteria 18449
619 Ga0207683_10003032 3300026121 Bacteria 14676
620 Ga0207683_10003821 3300026121 Bacteria 13050
621 Ga0207683_10012871 3300026121 Bacteria 7140
622 Ga0207683_10045899 3300026121 Bacteria 3821
623 Ga0207683_10094445 3300026121 Bacteria 2665
624 Ga0207683_10111836 3300026121 Bacteria 2446
625 Ga0207683_10199709 3300026121 Bacteria 1817
626 Ga0207683_10243245 3300026121 Bacteria 1641
627 Ga0207698_10005874 3300026142 Bacteria 7626
628 Ga0207698_10014584 3300026142 Bacteria 5231
629 Ga0207698_10025173 3300026142 Bacteria 4187
630 Ga0207698_10057249 3300026142 Bacteria 3015
631 Ga0207698_10166728 3300026142 Bacteria 1934
632 Ga0209995_1006264 3300027471 Bacteria 1911
633 Ga0209983_1008037 3300027665 Bacteria 2157
634 Ga0209588_1009283 3300027671 Bacteria 2937
635 Ga0209971_1001832 3300027682 Bacteria 5205
636 Ga0209966_1007433 3300027695 Bacteria 1921
637 Ga0209998_10006525 3300027717 Bacteria 2425
638 Ga0209974_10003602 3300027876 Bacteria 5563
639 Ga0209974_10006207 3300027876 Bacteria 4183
640 Ga0268266_10005919 3300028379 Bacteria 11311
641 Ga0268266_10007969 3300028379 Bacteria 9471
642 Ga0268266_10025799 3300028379 Bacteria 5000
643 Ga0268266_10035623 3300028379 Bacteria 4234
644 Ga0268266_10073026 3300028379 Bacteria 2976
645 Ga0268266_10239306 3300028379 Bacteria 1674
646 Ga0268265_10009900 3300028380 Bacteria 6441
647 Ga0268265_10079904 3300028380 Bacteria 2577
648 Ga0268264_10007353 3300028381 Bacteria 9200
649 Ga0268264_10008990 3300028381 Bacteria 8289
650 Ga0268264_10017628 3300028381 Bacteria 5847
651 Ga0268264_10019355 3300028381 Bacteria 5564
652 Ga0268264_10020240 3300028381 Bacteria 5438
653 Ga0268264_10115365 3300028381 Bacteria 2359
654 Ga0307517_10006989 3300028786 Bacteria 16571
655 Ga0307517_10106480 3300028786 Bacteria 2168
656 Ga0307515_10000034 3300028794 Bacteria 344640
657 Ga0307515_10000221 3300028794 Bacteria 141099
658 Ga0307515_10000525 3300028794 Bacteria 91297
659 Ga0307515_10006043 3300028794 Bacteria 24341
660 Ga0307515_10022638 3300028794 Bacteria 11062
661 Ga0307515_10065230 3300028794 Bacteria 5072
662 Ga0307515_10229727 3300028794 Bacteria 1651
663 Ga0307511_10005456 3300030521 Bacteria 12934
664 Ga0265332_10013905 3300031238 Bacteria 3564
665 Ga0265331_10072293 3300031250 Bacteria 1612
666 Ga0265327_10000851 3300031251 Bacteria 45640
667 Ga0265327_10039548 3300031251 Bacteria 2560
668 Ga0307509_10005306 3300031507 Bacteria 18025
669 Ga0307509_10048038 3300031507 Bacteria 4586
670 Ga0307509_10115106 3300031507 Bacteria 2682
671 Ga0307509_10131190 3300031507 Bacteria 2461
672 Ga0307408_100012538 3300031548 Bacteria 5619
673 Ga0307408_100014530 3300031548 Bacteria 5231
674 Ga0307408_100065328 3300031548 Bacteria 2668
675 Ga0307408_100076205 3300031548 Bacteria 2494
676 Ga0307508_10000141 3300031616 Bacteria 85739
677 Ga0307508_10004610 3300031616 Bacteria 13396
678 Ga0307508_10058845 3300031616 Bacteria 3399
679 Ga0307508_10131020 3300031616 Bacteria 2111
680 Ga0307514_10002352 3300031649 Bacteria 19825
681 Ga0307514_10144343 3300031649 Bacteria 1611
682 Ga0265314_10005818 3300031711 Bacteria 11042
683 Ga0265314_10102411 3300031711 Bacteria 1837
684 Ga0307516_10008188 3300031730 Bacteria 11874
685 Ga0307516_10018003 3300031730 Bacteria 7350
686 Ga0307516_10058949 3300031730 Bacteria 3735
687 Ga0307405_10021076 3300031731 Bacteria 3658
688 Ga0307405_10022909 3300031731 Bacteria 3539
689 Ga0307405_10023337 3300031731 Bacteria 3515
690 Ga0307405_10046588 3300031731 Bacteria 2665
691 Ga0307413_10114075 3300031824 Bacteria 1815
692 Ga0307410_10000433 3300031852 Bacteria 16724
693 Ga0307410_10003577 3300031852 Bacteria 7827
694 Ga0307410_10007774 3300031852 Bacteria 5894
695 Ga0307410_10077848 3300031852 Bacteria 2319
696 Ga0307410_10165241 3300031852 Bacteria 1662
697 Ga0307406_10004541 3300031901 Bacteria 7563
698 Ga0307406_10004966 3300031901 Bacteria 7246
699 Ga0307406_10179622 3300031901 Bacteria 1539
700 Ga0307407_10011742 3300031903 Bacteria 4184
701 Ga0307407_10015952 3300031903 Bacteria 3729
702 Ga0307407_10105787 3300031903 Bacteria 1756
703 Ga0307412_10002089 3300031911 Bacteria 11099
704 Ga0307412_10004567 3300031911 Bacteria 7713
705 Ga0307412_10011920 3300031911 Bacteria 5048
706 Ga0307412_10231271 3300031911 Bacteria 1424
707 Ga0307409_100002278 3300031995 Bacteria 9942
708 Ga0307409_100002393 3300031995 Bacteria 9778
709 Ga0307409_100030184 3300031995 Bacteria 3891
710 Ga0307409_100088458 3300031995 Bacteria 2529
711 Ga0307416_100003419 3300032002 Bacteria 9319
712 Ga0307416_100003982 3300032002 Bacteria 8809
713 Ga0307416_100007289 3300032002 Bacteria 7013
714 Ga0307416_100069457 3300032002 Bacteria 2915
715 Ga0307414_10011253 3300032004 Bacteria 5239
716 Ga0307414_10014216 3300032004 Bacteria 4763
717 Ga0307414_10089861 3300032004 Bacteria 2278
718 Ga0307414_10111480 3300032004 Bacteria 2084
719 Ga0307411_10015181 3300032005 Bacteria 4317
720 Ga0307411_10065824 3300032005 Bacteria 2432
721 Ga0307411_10131735 3300032005 Bacteria 1828
722 Ga0307415_100001060 3300032126 Bacteria 12787
723 Ga0307415_100152720 3300032126 Bacteria 1779
724 Ga0307507_10026219 3300033179 Bacteria 6291
725 Ga0307507_10047478 3300033179 Bacteria 4193
726 Ga0307507_10094496 3300033179 Bacteria 2541
727 Ga0307510_10015777 3300033180 Bacteria 8931
728 Ga0307510_10092443 3300033180 Bacteria 2861
729 Ga0373934_0002811 3300035086 Bacteria 6376
730 Ga0373923_0051629 3300035111 Bacteria 1726
731 Ga0373923_0063009 3300035111 Bacteria 1578
732 Ga0373936_0007078 3300035113 Bacteria 4219
733 Ga0373936_0038128 3300035113 Bacteria 1921
734 Ga0373936_0044861 3300035113 Bacteria 1779
735 Ga0373956_0002885 3300035119 Bacteria 6956
736 Ga0373956_0023220 3300035119 Bacteria 2660
737 Ga0373956_0031478 3300035119 Bacteria 2325
738 Ga0373957_0000970 3300035120 Bacteria 7527
739 Ga0373946_0016344 3300035171 Bacteria 2826
740 Ga0373946_0045327 3300035171 Bacteria 1819
741 Ga0373955_0003124 3300035172 Bacteria 7249
742 Ga0373955_0005751 3300035172 Bacteria 5591
743 Ga0373955_0099524 3300035172 Bacteria 1667
744 Ga0373942_0007240 3300035207 Bacteria 2571
745 Ga0373924_0034965 3300035410 Bacteria 2036
746 Ga0373931_0021096 3300035691 Bacteria 3267
747 Ga0373931_0026920 3300035691 Bacteria 2931
748 Ga0373935_0006980 3300035692 Bacteria 6744
749 Ga0373935_0078989 3300035692 Bacteria 2135
750 Ga0373935_0093869 3300035692 Bacteria 1968
751 Ga0373935_0108013 3300035692 Bacteria 1843
752 Ga0373927_0017083 3300035695 Bacteria 4781
753 Ga0373927_0017512 3300035695 Bacteria 4714
754 Ga0373927_0110842 3300035695 Bacteria 1788
755 Ga0373927_0148757 3300035695 Bacteria 1533
756 Ga0373927_0171831 3300035695 Bacteria 1421
757 Ga0373933_0012042 3300035724 Bacteria 4776
758 Ga0373933_0018091 3300035724 Bacteria 3959
759 Ga0373947_0135755 3300035725 Bacteria 1574
760 Ga0373937_0012460 3300036401 Bacteria 7482
761 Ga0373937_0021385 3300036401 Bacteria 5807
762 Ga0373937_0148550 3300036401 Bacteria 2195
763 Ga0373937_0180351 3300036401 Bacteria 1983
764 Ga0373937_0232254 3300036401 Bacteria 1737
765 Ga0373925_0005088 3300037068 Bacteria 9841
766 Ga0373925_0009135 3300037068 Bacteria 7213
767 Ga0373925_0012993 3300037068 Bacteria 6029
768 Ga0373925_0019343 3300037068 Bacteria 4953
769 Ga0373925_0023450 3300037068 Bacteria 4502
770 Ga0373925_0160324 3300037068 Bacteria 1771
771 Ga0395899_0003984 3300037312 Bacteria 11638
772 Ga0395899_0052574 3300037312 Bacteria 3019
773 Ga0395900_0007847 3300037418 Bacteria 11003
774 Ga0395900_0037654 3300037418 Bacteria 4986
775 Ga0395900_0147704 3300037418 Bacteria 2403
776 Ga0395898_0013040 3300037466 Bacteria 8563
777 Ga0395898_0025436 3300037466 Bacteria 5965
778 Ga0395905_0000042 3300037471 Bacteria 247894
779 Ga0395905_0000377 3300037471 Bacteria 63595
780 Ga0395905_0030359 3300037471 Bacteria 5093
781 Ga0395905_0037027 3300037471 Bacteria 4582
782 Ga0395905_0103955 3300037471 Bacteria 2666
783 Ga0395905_0222069 3300037471 Bacteria 1768
784 Ga0395905_0268013 3300037471 Bacteria 1593
785 Ga0395901_0019515 3300038443 Bacteria 6930
786 Ga0395901_0039104 3300038443 Bacteria 4908
787 Ga0395901_0088482 3300038443 Bacteria 3239
788 Ga0395901_0151691 3300038443 Bacteria 2435
789 Ga0439436_0000623 3300041404 Bacteria 9405
790 Ga0439447_005430 3300041407 Bacteria 4243
791 Ga0439465_0006271 3300041413 Bacteria 3775
792 Ga0451789_0113349 3300041443 Bacteria 3586
793 Ga0451798_0184898 3300041458 Bacteria 3042
794 Ga0439445_0010562 3300042004 Bacteria 2188
795 Ga0439432_003265 3300042006 Bacteria 6029
796 Ga0439449_0001905 3300042007 Bacteria 8206
797 Ga0439450_003762 3300042008 Bacteria 2539
798 Ga0439452_003048 3300042010 Bacteria 5957
799 Ga0439457_001347 3300042014 Bacteria 7382
800 Ga0439462_0000901 3300042015 Bacteria 6262
801 Ga0450911_000152 3300042115 Bacteria 27922
802 Ga0451577_0013112 3300042876 Bacteria 7769
803 Ga0466966_0024785 3300044684 Bacteria 3924
804 Ga0466961_0007100 3300044693 Bacteria 7124
805 Ga0453684_0265829 3300044712 Bacteria 1963
806 Ga0466970_0012828 3300044765 Bacteria 4290
807 Ga0466957_0030344 3300044842 Bacteria 3227
808 Ga0451576_0009738 3300045051 Bacteria 11112
809 Ga0451576_0014003 3300045051 Bacteria 8942
810 Ga0451576_0246585 3300045051 Bacteria 1867
811 Ga0466967_0000292 3300045976 Bacteria 22396
812 Ga0466967_0134305 3300045976 Bacteria 2300
813 Ga0495627_004132 3300046453 Bacteria 6159
814 Ga0495627_015990 3300046453 Bacteria 2579
815 Ga0495592_0000142 3300046454 Bacteria 63571
816 Ga0495592_0030716 3300046454 Bacteria 4063
817 Ga0495603_0056318 3300046455 Bacteria 2328
818 Ga0495590_0023016 3300046457 Bacteria 2202
819 Ga0495629_0050996 3300046459 Bacteria 2896
820 Ga0495629_0153359 3300046459 Bacteria 1601
821 Ga0495638_0008762 3300046460 Bacteria 7147
822 Ga0495653_0016870 3300046463 Bacteria 5942
823 Ga0495653_0091666 3300046463 Bacteria 2221
824 Ga0495639_0001883 3300046475 Bacteria 9302
825 Ga0495639_0011546 3300046475 Bacteria 3810
826 Ga0495664_0058074 3300046477 Bacteria 2301
827 Ga0495594_0111545 3300046499 Bacteria 1542
828 Ga0495628_0004819 3300046516 Bacteria 11867
829 Ga0495628_0048048 3300046516 Bacteria 3383
830 Ga0495628_0091453 3300046516 Bacteria 2355
831 Ga0495630_0003398 3300046517 Bacteria 11090
832 Ga0495632_0008357 3300046519 Bacteria 6363
833 Ga0495632_0017325 3300046519 Bacteria 3980
834 Ga0495637_0014207 3300046520 Bacteria 3759
835 Ga0495642_0013638 3300046528 Bacteria 3147
836 Ga0495652_0007395 3300046529 Bacteria 10126
837 Ga0495665_0016464 3300046531 Bacteria 3984
838 Ga0495587_0039982 3300046536 Bacteria 2804
839 Ga0495621_0033415 3300046539 Bacteria 1773
840 Ga0495645_0000419 3300046543 Bacteria 29318
841 Ga0495645_0069507 3300046543 Bacteria 2542
842 Ga0495656_0004699 3300046615 Bacteria 4691
843 Ga0495656_0011267 3300046615 Bacteria 3279
844 Ga0495625_0014315 3300046660 Bacteria 6337
845 Ga0495625_0035602 3300046660 Bacteria 3668
846 Ga0495635_0008428 3300046663 Bacteria 7198
847 Ga0495599_0000476 3300046678 Bacteria 22901
848 Ga0495646_0027738 3300046680 Bacteria 3550
849 Ga0495646_0086397 3300046680 Bacteria 1819
850 Ga0495647_0007029 3300046681 Bacteria 3751
851 Ga0495647_0017865 3300046681 Bacteria 2516
852 Ga0495647_0057571 3300046681 Bacteria 1526
853 Ga0495658_0010519 3300046683 Bacteria 4629
854 Ga0495613_0005723 3300046689 Bacteria 9314
855 Ga0495613_0123637 3300046689 Bacteria 1856
856 Ga0495624_0013649 3300046690 Bacteria 5534
857 Ga0495671_0007807 3300046692 Bacteria 6057
858 Ga0495649_0006612 3300046694 Bacteria 7204
859 Ga0495600_0100556 3300046809 Bacteria 1885
860 Ga0495660_0026540 3300046810 Bacteria 3283
861 Ga0495581_0017958 3300047315 Bacteria 4110
862 Ga0495581_0104486 3300047315 Bacteria 1646
863 Ga0495675_0013490 3300047444 Bacteria 5158
864 Ga0495684_0003384 3300047471 Bacteria 12521
865 Ga0495684_0212860 3300047471 Bacteria 1420
866 Ga0495686_0003768 3300047472 Bacteria 12886
867 Ga0495614_0035198 3300048089 Bacteria 2152
868 Ga0495626_0075851 3300048091 Bacteria 1502
869 Ga0496100_0068773 3300048903 Bacteria 2356
870 Ga0496100_0119886 3300048903 Bacteria 1839
871 Ga0496101_0219051 3300048904 Bacteria 1476
872 Ga0496102_0000940 3300048905 Bacteria 27514
873 Ga0496102_0014300 3300048905 Bacteria 6896
874 Ga0496102_0025725 3300048905 Bacteria 5241
875 Ga0496102_0138011 3300048905 Bacteria 2285
876 Ga0496104_0021309 3300048907 Bacteria 5948
877 Ga0496104_0038484 3300048907 Bacteria 4475
878 Ga0496105_0090658 3300048908 Bacteria 2525
879 Ga0496106_0011519 3300048909 Bacteria 6540
880 Ga0496106_0026338 3300048909 Bacteria 4329
881 Ga0496107_0011010 3300048910 Bacteria 6292
882 Ga0496107_0052863 3300048910 Bacteria 2930
883 Ga0496108_0073528 3300048911 Bacteria 2885
884 Ga0496109_0001844 3300048912 Bacteria 17571
885 Ga0496109_0317604 3300048912 Bacteria 1470
886 Ga0496110_0003683 3300048913 Bacteria 11796
887 Ga0496112_0103179 3300048915 Bacteria 2821
888 Ga0496114_0022149 3300048917 Bacteria 5176
889 Ga0496114_0062393 3300048917 Bacteria 3119
890 Ga0496115_0011956 3300048918 Bacteria 6520
891 Ga0496117_0108491 3300048920 Bacteria 1736
892 Ga0496121_0009076 3300048924 Bacteria 11515
893 Ga0496122_0002676 3300048925 Bacteria 24814
894 Ga0496123_0004397 3300048926 Bacteria 14858
895 Ga0496124_0105373 3300048927 Bacteria 2278
896 Ga0496125_0025776 3300048928 Bacteria 5376
897 Ga0496125_0044090 3300048928 Bacteria 3777
898 Ga0496125_0099388 3300048928 Bacteria 2149
899 Ga0496126_0103421 3300048929 Bacteria 2489
900 Ga0501034_0092920 3300049571 Bacteria 3013
901 Ga0501036_0092234 3300049572 Bacteria 2559
902 Ga0501036_0124164 3300049572 Bacteria 2180
903 Ga0501043_0000072 3300049579 Bacteria 89021
904 Ga0501046_0000112 3300049580 Bacteria 86313
905 Ga0501046_0080956 3300049580 Bacteria 2508
906 Ga0501047_0000138 3300049581 Bacteria 89028
907 Ga0501047_0071256 3300049581 Bacteria 3345
908 Ga0501048_0016360 3300049582 Bacteria 5465
909 Ga0501073_0043590 3300049589 Bacteria 3164
910 Ga0501075_0013598 3300049591 Bacteria 5813
911 Ga0501076_0250471 3300049592 Bacteria 1449
912 Ga0501035_0075918 3300049822 Bacteria 2972
913 Ga0501044_0044351 3300049823 Bacteria 4614
914 Ga0501045_0034681 3300049824 Bacteria 3664
915 Ga0501045_0036945 3300049824 Bacteria 3549
916 nmdc:mga03683_47083_c1 3300050489 Bacteria 1789
917 nmdc:mga03683_56211_c1 3300050489 Bacteria 1654
918 nmdc:mga03n38_1080_c1 3300050490 Bacteria 7528
919 nmdc:mga00v17_31683_c1 3300050491 Bacteria 3120
920 nmdc:mga0yw44_102264_c1 3300050492 Bacteria 1827
921 nmdc:mga0yw44_30902_c1 3300050492 Bacteria 3110
922 nmdc:mga0k408_137005_c1 3300050493 Bacteria 1455
923 nmdc:mga0k408_2556_c1 3300050493 Bacteria 9253
924 nmdc:mga0k408_30899_c1 3300050493 Bacteria 3056
925 nmdc:mga0k408_32800_c1 3300050493 Bacteria 2967
926 nmdc:mga0k408_3535_c1 3300050493 Bacteria 8252
927 nmdc:mga0k408_48073_c1 3300050493 Bacteria 2467
928 nmdc:mga0k408_54223_c1 3300050493 Bacteria 2324
929 nmdc:mga06z11_18083_c1 3300050494 Bacteria 3213
930 nmdc:mga07m45_2012_c1 3300050496 Bacteria 9421
931 nmdc:mga07m45_2789_c1 3300050496 Bacteria 8259
932 nmdc:mga07m45_334_c1 3300050496 Bacteria 19102
933 nmdc:mga07m45_919_c1 3300050496 Bacteria 12885
934 nmdc:mga09592_244702_c1 3300050508 Bacteria 1554
935 nmdc:mga09592_34460_c1 3300050508 Bacteria 4232
936 nmdc:mga0qj67_93086_c1 3300050509 Bacteria 2423
937 nmdc:mga06r32_260272_c1 3300050510 Bacteria 1722
938 Ga0495601_0131874 3300053077 Bacteria 1628
939 Ga0495612_0055714 3300053078 Bacteria 1631
940 Ga0500610_0000785 3300053079 Bacteria 10017
941 Ga0500610_0007879 3300053079 Bacteria 4600
942 Ga0495595_0022721 3300053084 Bacteria 2755
943 Ga0495595_0140471 3300053084 Bacteria 1185
944 Ga0500578_0000442 3300053086 Bacteria 50642
945 Ga0500578_0115508 3300053086 Bacteria 1689
946 Ga0500644_0010323 3300053088 Bacteria 2526
947 Ga0500644_0015006 3300053088 Bacteria 2198
948 Ga0500646_0008511 3300053090 Bacteria 2624
949 Ga0500583_0001132 3300053092 Bacteria 7615
950 Ga0500651_0133576 3300053093 Bacteria 1499
951 Ga0500650_0060740 3300053098 Bacteria 1765
952 Ga0500593_004410 3300053117 Bacteria 5445
953 Ga0500594_0012252 3300053118 Bacteria 2017
954 Ga0500607_002882 3300053121 Bacteria 13231
955 Ga0500642_0019885 3300053130 Bacteria 2628
956 Ga0500652_008087 3300053131 Bacteria 3484
957 Ga0500658_0007229 3300053134 Bacteria 4101
958 Ga0500559_0000014 3300053136 Bacteria 160139
959 Ga0500559_0001094 3300053136 Bacteria 16435
960 Ga0500568_0016368 3300053139 Bacteria 3299
961 Ga0500568_0037026 3300053139 Bacteria 1981
962 Ga0500577_0027114 3300053142 Bacteria 1958
963 Ga0500579_099088 3300053143 Bacteria 1529
964 Ga0500590_021314 3300053148 Bacteria 3364
965 Ga0500604_0027661 3300053151 Bacteria 1642
966 Ga0500616_0029527 3300053153 Bacteria 3016
967 Ga0500622_0000866 3300053156 Bacteria 25758
968 Ga0500622_0006682 3300053156 Bacteria 6647
969 Ga0500622_0036982 3300053156 Bacteria 2551
970 Ga0500627_0000632 3300053158 Bacteria 9372
971 Ga0500645_007944 3300053730 Bacteria 3658
972 Ga0530510_0114470 3300061734 Bacteria 1977

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013102 Ga0157371_10002555 Ga0157371_1000255515 371
2 3300053084 Ga0495595_0140471 Ga0495595_0140471_12_1151 378
3 3300053086 Ga0500578_0115508 Ga0500578_0115508_24_1241 404
4 3300027665 Ga0209983_1008037 Ga0209983_10080372 410
5 3300046455 Ga0495603_0056318 Ga0495603_0056318_935_2182 410
6 3300033179 Ga0307507_10047478 Ga0307507_100474782 412
7 3300025934 Ga0207686_10102922 Ga0207686_101029222 413
8 3300025940 Ga0207691_10065404 Ga0207691_100654042 413
9 3300050489 nmdc:mga03683_56211_c1 nmdc:mga03683_56211_c1_91_1341 414
10 3300053143 Ga0500579_099088 Ga0500579_099088_11_1270 414
11 3300005841 Ga0068863_100110598 Ga0068863_1001105983 415
12 3300009093 Ga0105240_10053996 Ga0105240_100539963 415
13 3300013104 Ga0157370_10009815 Ga0157370_100098157 415
14 3300013307 Ga0157372_10121816 Ga0157372_101218162 415
15 3300025960 Ga0207651_10094781 Ga0207651_100947812 416
16 3300048904 Ga0496101_0219051 Ga0496101_0219051_215_1465 416
17 3300031731 Ga0307405_10023337 Ga0307405_100233372 418
18 3300031995 Ga0307409_100002278 Ga0307409_1000022784 418
19 3300032002 Ga0307416_100003982 Ga0307416_1000039824 418
20 3300032005 Ga0307411_10065824 Ga0307411_100658241 418
21 3300005564 Ga0070664_100020289 Ga0070664_1000202893 419
22 3300046516 Ga0495628_0091453 Ga0495628_0091453_996_2330 419
23 3300046681 Ga0495647_0057571 Ga0495647_0057571_106_1440 419
24 3300047315 Ga0495581_0017958 Ga0495581_0017958_1520_2794 419
25 3300005355 Ga0070671_100019739 Ga0070671_1000197394 420
26 3300005618 Ga0068864_100208279 Ga0068864_1002082791 420
27 3300006237 Ga0097621_100049274 Ga0097621_1000492742 420
28 3300006358 Ga0068871_100058376 Ga0068871_1000583763 420
29 3300009177 Ga0105248_10241428 Ga0105248_102414282 420
30 3300025931 Ga0207644_10000392 Ga0207644_100003926 420
31 3300025941 Ga0207711_10220736 Ga0207711_102207362 420
32 3300026095 Ga0207676_10016045 Ga0207676_100160454 420
33 3300026121 Ga0207683_10094445 Ga0207683_100944452 420
34 3300007265 Ga0099794_10004769 Ga0099794_100047694 421
35 3300027671 Ga0209588_1009283 Ga0209588_10092832 421
36 3300028794 Ga0307515_10000525 Ga0307515_1000052565 421
37 3300033180 Ga0307510_10015777 Ga0307510_100157773 421
38 3300045976 Ga0466967_0134305 Ga0466967_0134305_505_1833 422
39 3300046528 Ga0495642_0013638 Ga0495642_0013638_1027_2343 422
40 3300046615 Ga0495656_0011267 Ga0495656_0011267_1066_2382 422
41 3300035113 Ga0373936_0044861 Ga0373936_0044861_374_1690 424
42 3300035692 Ga0373935_0006980 Ga0373935_0006980_2289_3605 424
43 3300037068 Ga0373925_0005088 Ga0373925_0005088_3567_4883 424
44 3300033179 Ga0307507_10026219 Ga0307507_100262192 425
45 3300053078 Ga0495612_0055714 Ga0495612_0055714_98_1378 425
46 3300037418 Ga0395900_0147704 Ga0395900_0147704_257_1573 426
47 3300037471 Ga0395905_0268013 Ga0395905_0268013_112_1428 426
48 3300005331 Ga0070670_100002168 Ga0070670_10000216813 427
49 3300005354 Ga0070675_100031242 Ga0070675_1000312422 427
50 3300005543 Ga0070672_100066695 Ga0070672_1000666952 427
51 3300009177 Ga0105248_10200385 Ga0105248_102003852 427
52 3300025925 Ga0207650_10000560 Ga0207650_1000056015 427
53 3300025926 Ga0207659_10006382 Ga0207659_100063822 427
54 3300025941 Ga0207711_10108107 Ga0207711_101081072 427
55 3300053139 Ga0500568_0016368 Ga0500568_0016368_602_1915 427
56 iso_pu_bacteria 2585428057 2587727857 429
57 iso_pu_bacteria 2585428058 2587733829 429
58 iso_pu_bacteria 2588253510 2588291634 429
59 iso_pu_bacteria 2643221592 2643972533 429
60 iso_pu_bacteria 2643221625 2644138459 429
61 iso_pu_bacteria 2643221648 2644273041 429
62 3300005355 Ga0070671_100026363 Ga0070671_1000263633 430
63 3300015683 Ga0183362_10001 Ga0183362_10001262 430
64 3300025931 Ga0207644_10004537 Ga0207644_100045373 430
65 3300031711 Ga0265314_10102411 Ga0265314_101024111 431
66 3300035695 Ga0373927_0017083 Ga0373927_0017083_2903_4228 431
67 3300037068 Ga0373925_0012993 Ga0373925_0012993_1788_3113 431
68 3300028794 Ga0307515_10065230 Ga0307515_100652302 432
69 3300031507 Ga0307509_10131190 Ga0307509_101311902 432
70 3300031616 Ga0307508_10058845 Ga0307508_100588453 432
71 3300031616 Ga0307508_10131020 Ga0307508_101310202 432
72 3300035691 Ga0373931_0021096 Ga0373931_0021096_956_2263 432
73 3300045051 Ga0451576_0009738 Ga0451576_0009738_9141_10451 432
74 3300046457 Ga0495590_0023016 Ga0495590_0023016_435_1748 432
75 3300046690 Ga0495624_0013649 Ga0495624_0013649_1115_2422 432
76 3300046694 Ga0495649_0006612 Ga0495649_0006612_4329_5642 432
77 3300046810 Ga0495660_0026540 Ga0495660_0026540_1202_2515 432
78 3300050508 nmdc:mga09592_244702_c1 nmdc:mga09592_244702_c1_11_1321 432
79 3300002773 JGI25152J39213_1002959 JGI25152J39213_10029595 433
80 3300003215 JGI25153J46596_10009620 JGI25153J46596_100096203 433
81 3300003771 Ga0055526_1007227 Ga0055526_10072274 433
82 3300003791 Ga0055530_10003423 Ga0055530_100034238 433
83 3300005262 Ga0065165_1001929 Ga0065165_10019293 433
84 3300005330 Ga0070690_100002891 Ga0070690_1000028915 433
85 3300005334 Ga0068869_100044762 Ga0068869_1000447623 433
86 3300005334 Ga0068869_100053189 Ga0068869_1000531892 433
87 3300005335 Ga0070666_10003434 Ga0070666_100034348 433
88 3300005336 Ga0070680_100004529 Ga0070680_1000045297 433
89 3300005338 Ga0068868_100005341 Ga0068868_1000053415 433
90 3300005338 Ga0068868_100063437 Ga0068868_1000634371 433
91 3300005340 Ga0070689_100001549 Ga0070689_10000154912 433
92 3300005355 Ga0070671_100007060 Ga0070671_1000070605 433
93 3300005356 Ga0070674_100013348 Ga0070674_1000133482 433
94 3300005364 Ga0070673_100001934 Ga0070673_1000019349 433
95 3300005365 Ga0070688_100001074 Ga0070688_1000010748 433
96 3300005434 Ga0070709_10016788 Ga0070709_100167882 433
97 3300005434 Ga0070709_10027608 Ga0070709_100276082 433
98 3300005436 Ga0070713_100000662 Ga0070713_10000066219 433
99 3300005436 Ga0070713_100038438 Ga0070713_1000384382 433
100 3300005438 Ga0070701_10047622 Ga0070701_100476222 433
101 3300005439 Ga0070711_100016266 Ga0070711_1000162663 433
102 3300005440 Ga0070705_100100322 Ga0070705_1001003221 433
103 3300005456 Ga0070678_100001980 Ga0070678_10000198011 433
104 3300005459 Ga0068867_100065748 Ga0068867_1000657482 433
105 3300005466 Ga0070685_10001710 Ga0070685_100017102 433
106 3300005467 Ga0070706_100046470 Ga0070706_1000464702 433
107 3300005518 Ga0070699_100034555 Ga0070699_1000345554 433
108 3300005544 Ga0070686_100051659 Ga0070686_1000516592 433
109 3300005547 Ga0070693_100005196 Ga0070693_1000051962 433
110 3300005547 Ga0070693_100034738 Ga0070693_1000347382 433
111 3300005548 Ga0070665_100003498 Ga0070665_1000034985 433
112 3300005549 Ga0070704_100084272 Ga0070704_1000842721 433
113 3300005578 Ga0068854_100022163 Ga0068854_1000221635 433
114 3300005578 Ga0068854_100037496 Ga0068854_1000374963 433
115 3300005614 Ga0068856_100046294 Ga0068856_1000462944 433
116 3300005614 Ga0068856_100167638 Ga0068856_1001676382 433
117 3300005615 Ga0070702_100008689 Ga0070702_1000086895 433
118 3300005617 Ga0068859_100002547 Ga0068859_10000254711 433
119 3300005618 Ga0068864_100000761 Ga0068864_10000076114 433
120 3300005718 Ga0068866_10005562 Ga0068866_100055622 433
121 3300005834 Ga0068851_10051482 Ga0068851_100514822 433
122 3300005841 Ga0068863_100001520 Ga0068863_1000015206 433
123 3300005842 Ga0068858_100002479 Ga0068858_1000024796 433
124 3300005843 Ga0068860_100022329 Ga0068860_1000223293 433
125 3300006175 Ga0070712_100005788 Ga0070712_1000057885 433
126 3300006175 Ga0070712_100070848 Ga0070712_1000708482 433
127 3300006237 Ga0097621_100013201 Ga0097621_1000132012 433
128 3300006358 Ga0068871_100023358 Ga0068871_1000233582 433
129 3300006914 Ga0075436_100068140 Ga0075436_1000681402 433
130 3300006931 Ga0097620_100002547 Ga0097620_10000254711 433
131 3300009093 Ga0105240_10153052 Ga0105240_101530522 433
132 3300009098 Ga0105245_10013089 Ga0105245_100130895 433
133 3300009098 Ga0105245_10016169 Ga0105245_100161695 433
134 3300009098 Ga0105245_10133467 Ga0105245_101334672 433
135 3300009174 Ga0105241_10011568 Ga0105241_100115686 433
136 3300009176 Ga0105242_10034458 Ga0105242_100344583 433
137 3300009177 Ga0105248_10007014 Ga0105248_100070142 433
138 3300009545 Ga0105237_10110770 Ga0105237_101107702 433
139 3300013104 Ga0157370_10108106 Ga0157370_101081062 433
140 3300013296 Ga0157374_10001315 Ga0157374_100013159 433
141 3300013297 Ga0157378_10014395 Ga0157378_100143955 433
142 3300013297 Ga0157378_10146599 Ga0157378_101465992 433
143 3300013306 Ga0163162_10016098 Ga0163162_100160983 433
144 3300013306 Ga0163162_10100693 Ga0163162_101006932 433
145 3300013308 Ga0157375_10003025 Ga0157375_100030252 433
146 3300014325 Ga0163163_10000467 Ga0163163_1000046720 433
147 3300014968 Ga0157379_10001988 Ga0157379_1000198810 433
148 3300014969 Ga0157376_10011104 Ga0157376_100111043 433
149 3300014969 Ga0157376_10016382 Ga0157376_100163822 433
150 3300025245 Ga0207425_1000448 Ga0207425_100044814 433
151 3300025258 Ga0209129_1000124 Ga0209129_100012451 433
152 3300025273 Ga0209673_1004568 Ga0209673_10045682 433
153 3300025295 Ga0209564_1000057 Ga0209564_100005770 433
154 3300025297 Ga0209758_1000214 Ga0209758_100021440 433
155 3300025297 Ga0209758_1000232 Ga0209758_100023237 433
156 3300025298 Ga0209050_1000268 Ga0209050_100026810 433
157 3300025303 Ga0209051_1012907 Ga0209051_10129073 433
158 3300025909 Ga0207705_10134555 Ga0207705_101345552 433
159 3300025942 Ga0207689_10067369 Ga0207689_100673692 433
160 3300025986 Ga0207658_10003185 Ga0207658_100031857 433
161 3300026023 Ga0207677_10022471 Ga0207677_100224711 433
162 3300026067 Ga0207678_10065216 Ga0207678_100652163 433
163 3300028794 Ga0307515_10006043 Ga0307515_1000604318 433
164 3300031911 Ga0307412_10231271 Ga0307412_102312711 433
165 3300037068 Ga0373925_0019343 Ga0373925_0019343_1051_2367 433
166 3300041443 Ga0451789_0113349 Ga0451789_0113349_442_1758 433
167 3300041458 Ga0451798_0184898 Ga0451798_0184898_1534_2850 433
168 3300046460 Ga0495638_0008762 Ga0495638_0008762_1494_2810 433
169 3300046519 Ga0495632_0017325 Ga0495632_0017325_901_2217 433
170 3300053086 Ga0500578_0000442 Ga0500578_0000442_15100_16416 433
171 3300053093 Ga0500651_0133576 Ga0500651_0133576_21_1337 433
172 3300053098 Ga0500650_0060740 Ga0500650_0060740_408_1724 433
173 3300053130 Ga0500642_0019885 Ga0500642_0019885_112_1428 433
174 3300053131 Ga0500652_008087 Ga0500652_008087_149_1465 433
175 3300053139 Ga0500568_0037026 Ga0500568_0037026_44_1360 433
176 3300053142 Ga0500577_0027114 Ga0500577_0027114_453_1769 433
177 3300053156 Ga0500622_0000866 Ga0500622_0000866_21811_23127 433
178 3300053156 Ga0500622_0036982 Ga0500622_0036982_532_1848 433
179 iso_pu_bacteria 2585428062 2587754399 433
180 iso_pu_bacteria 2643221654 2644302449 433
181 iso_pu_bacteria 2738543013 2739248454 433
182 iso_pu_bacteria 2842733646 2842733772 433
183 iso_pu_bacteria 2842747753 2842752278 433
184 iso_pu_bacteria 2885192300 2885194576 433
185 iso_pu_bacteria 2945909444 2945909489 433
186 iso_pu_bacteria 2945984333 2945988530 433
187 3300005328 Ga0070676_10002428 Ga0070676_100024285 434
188 3300005331 Ga0070670_100000403 Ga0070670_10000040321 434
189 3300005333 Ga0070677_10002422 Ga0070677_100024222 434
190 3300005333 Ga0070677_10031267 Ga0070677_100312672 434
191 3300005338 Ga0068868_100005830 Ga0068868_1000058305 434
192 3300005354 Ga0070675_100001022 Ga0070675_10000102215 434
193 3300005354 Ga0070675_100015525 Ga0070675_1000155254 434
194 3300005355 Ga0070671_100014895 Ga0070671_1000148955 434
195 3300005355 Ga0070671_100016498 Ga0070671_1000164984 434
196 3300005356 Ga0070674_100001557 Ga0070674_1000015575 434
197 3300005364 Ga0070673_100014070 Ga0070673_1000140705 434
198 3300005364 Ga0070673_100015567 Ga0070673_1000155674 434
199 3300005367 Ga0070667_100083367 Ga0070667_1000833672 434
200 3300005456 Ga0070678_100005836 Ga0070678_1000058364 434
201 3300005456 Ga0070678_100013439 Ga0070678_1000134394 434
202 3300005459 Ga0068867_100011138 Ga0068867_1000111385 434
203 3300005459 Ga0068867_100047964 Ga0068867_1000479642 434
204 3300005543 Ga0070672_100001817 Ga0070672_10000181714 434
205 3300005543 Ga0070672_100013430 Ga0070672_1000134302 434
206 3300005548 Ga0070665_100006314 Ga0070665_10000631410 434
207 3300005615 Ga0070702_100116143 Ga0070702_1001161431 434
208 3300005616 Ga0068852_100118610 Ga0068852_1001186102 434
209 3300005618 Ga0068864_100015902 Ga0068864_1000159025 434
210 3300005834 Ga0068851_10028117 Ga0068851_100281172 434
211 3300005841 Ga0068863_100071725 Ga0068863_1000717253 434
212 3300005842 Ga0068858_100004428 Ga0068858_1000044284 434
213 3300005843 Ga0068860_100011471 Ga0068860_1000114714 434
214 3300006237 Ga0097621_100031564 Ga0097621_1000315642 434
215 3300006237 Ga0097621_100059916 Ga0097621_1000599162 434
216 3300006358 Ga0068871_100097150 Ga0068871_1000971502 434
217 3300006881 Ga0068865_100074351 Ga0068865_1000743512 434
218 3300013297 Ga0157378_10186571 Ga0157378_101865712 434
219 3300013306 Ga0163162_10140260 Ga0163162_101402602 434
220 3300013308 Ga0157375_10124421 Ga0157375_101244212 434
221 3300014326 Ga0157380_10011483 Ga0157380_100114834 434
222 3300014968 Ga0157379_10009277 Ga0157379_100092774 434
223 3300014969 Ga0157376_10079159 Ga0157376_100791592 434
224 3300014969 Ga0157376_10111753 Ga0157376_101117532 434
225 3300017792 Ga0163161_10046116 Ga0163161_100461162 434
226 3300017792 Ga0163161_10057062 Ga0163161_100570622 434
227 3300025321 Ga0207656_10008628 Ga0207656_100086283 434
228 3300025893 Ga0207682_10001129 Ga0207682_1000112911 434
229 3300025893 Ga0207682_10001755 Ga0207682_100017554 434
230 3300025901 Ga0207688_10042276 Ga0207688_100422762 434
231 3300025903 Ga0207680_10003229 Ga0207680_100032293 434
232 3300025907 Ga0207645_10001270 Ga0207645_1000127017 434
233 3300025907 Ga0207645_10003904 Ga0207645_100039042 434
234 3300025907 Ga0207645_10049844 Ga0207645_100498442 434
235 3300025907 Ga0207645_10148028 Ga0207645_101480282 434
236 3300025908 Ga0207643_10015505 Ga0207643_100155052 434
237 3300025908 Ga0207643_10143358 Ga0207643_101433581 434
238 3300025911 Ga0207654_10009118 Ga0207654_100091185 434
239 3300025913 Ga0207695_10106163 Ga0207695_101061632 434
240 3300025915 Ga0207693_10028327 Ga0207693_100283273 434
241 3300025916 Ga0207663_10014144 Ga0207663_100141443 434
242 3300025918 Ga0207662_10060376 Ga0207662_100603762 434
243 3300025918 Ga0207662_10061703 Ga0207662_100617032 434
244 3300025919 Ga0207657_10004460 Ga0207657_1000446014 434
245 3300025922 Ga0207646_10111752 Ga0207646_101117522 434
246 3300025923 Ga0207681_10049263 Ga0207681_100492632 434
247 3300025925 Ga0207650_10000408 Ga0207650_1000040813 434
248 3300025925 Ga0207650_10041784 Ga0207650_100417842 434
249 3300025926 Ga0207659_10000256 Ga0207659_1000025610 434
250 3300025927 Ga0207687_10007275 Ga0207687_100072753 434
251 3300025927 Ga0207687_10014865 Ga0207687_100148652 434
252 3300025929 Ga0207664_10008503 Ga0207664_100085038 434
253 3300025931 Ga0207644_10000817 Ga0207644_1000081710 434
254 3300025931 Ga0207644_10002297 Ga0207644_100022977 434
255 3300025931 Ga0207644_10015516 Ga0207644_100155165 434
256 3300025931 Ga0207644_10104303 Ga0207644_101043032 434
257 3300025933 Ga0207706_10033969 Ga0207706_100339695 434
258 3300025934 Ga0207686_10005871 Ga0207686_100058715 434
259 3300025934 Ga0207686_10008914 Ga0207686_100089142 434
260 3300025936 Ga0207670_10001589 Ga0207670_100015894 434
261 3300025937 Ga0207669_10007148 Ga0207669_100071485 434
262 3300025937 Ga0207669_10104194 Ga0207669_101041942 434
263 3300025939 Ga0207665_10046917 Ga0207665_100469171 434
264 3300025940 Ga0207691_10000360 Ga0207691_1000036023 434
265 3300025940 Ga0207691_10010241 Ga0207691_100102414 434
266 3300025941 Ga0207711_10000260 Ga0207711_1000026035 434
267 3300025942 Ga0207689_10007734 Ga0207689_100077343 434
268 3300025945 Ga0207679_10158499 Ga0207679_101584992 434
269 3300025949 Ga0207667_10177740 Ga0207667_101777401 434
270 3300025960 Ga0207651_10000554 Ga0207651_100005543 434
271 3300025960 Ga0207651_10013533 Ga0207651_100135334 434
272 3300025960 Ga0207651_10020777 Ga0207651_100207772 434
273 3300025972 Ga0207668_10020784 Ga0207668_100207842 434
274 3300025981 Ga0207640_10090010 Ga0207640_100900102 434
275 3300025986 Ga0207658_10001915 Ga0207658_100019153 434
276 3300025986 Ga0207658_10002797 Ga0207658_100027976 434
277 3300025986 Ga0207658_10072467 Ga0207658_100724672 434
278 3300026023 Ga0207677_10000160 Ga0207677_1000016035 434
279 3300026023 Ga0207677_10018163 Ga0207677_100181632 434
280 3300026035 Ga0207703_10001037 Ga0207703_1000103714 434
281 3300026035 Ga0207703_10017240 Ga0207703_100172402 434
282 3300026041 Ga0207639_10082999 Ga0207639_100829991 434
283 3300026067 Ga0207678_10024482 Ga0207678_100244822 434
284 3300026078 Ga0207702_10021062 Ga0207702_100210624 434
285 3300026088 Ga0207641_10016641 Ga0207641_100166413 434
286 3300026088 Ga0207641_10020425 Ga0207641_100204253 434
287 3300026089 Ga0207648_10003985 Ga0207648_1000398516 434
288 3300026089 Ga0207648_10010108 Ga0207648_100101084 434
289 3300026089 Ga0207648_10017630 Ga0207648_100176303 434
290 3300026089 Ga0207648_10023261 Ga0207648_100232614 434
291 3300026095 Ga0207676_10000684 Ga0207676_1000068418 434
292 3300026095 Ga0207676_10004373 Ga0207676_100043734 434
293 3300026121 Ga0207683_10001906 Ga0207683_100019065 434
294 3300026121 Ga0207683_10003821 Ga0207683_100038212 434
295 3300026121 Ga0207683_10012871 Ga0207683_100128714 434
296 3300028379 Ga0268266_10005919 Ga0268266_100059198 434
297 3300028379 Ga0268266_10007969 Ga0268266_100079695 434
298 3300028381 Ga0268264_10007353 Ga0268264_100073537 434
299 3300028381 Ga0268264_10008990 Ga0268264_100089905 434
300 3300028381 Ga0268264_10019355 Ga0268264_100193552 434
301 3300031548 Ga0307408_100065328 Ga0307408_1000653283 434
302 3300031731 Ga0307405_10046588 Ga0307405_100465882 434
303 3300031824 Ga0307413_10114075 Ga0307413_101140751 434
304 3300031852 Ga0307410_10077848 Ga0307410_100778482 434
305 3300031901 Ga0307406_10004966 Ga0307406_100049662 434
306 3300031903 Ga0307407_10105787 Ga0307407_101057871 434
307 3300031911 Ga0307412_10011920 Ga0307412_100119203 434
308 3300032002 Ga0307416_100069457 Ga0307416_1000694572 434
309 3300032004 Ga0307414_10014216 Ga0307414_100142162 434
310 3300032004 Ga0307414_10111480 Ga0307414_101114802 434
311 3300032005 Ga0307411_10015181 Ga0307411_100151813 434
312 3300032126 Ga0307415_100152720 Ga0307415_1001527202 434
313 3300035086 Ga0373934_0002811 Ga0373934_0002811_1909_3228 434
314 3300035111 Ga0373923_0063009 Ga0373923_0063009_54_1373 434
315 3300035113 Ga0373936_0038128 Ga0373936_0038128_178_1497 434
316 3300035119 Ga0373956_0002885 Ga0373956_0002885_3264_4583 434
317 3300035119 Ga0373956_0031478 Ga0373956_0031478_893_2212 434
318 3300035120 Ga0373957_0000970 Ga0373957_0000970_4148_5467 434
319 3300035171 Ga0373946_0016344 Ga0373946_0016344_761_2080 434
320 3300035172 Ga0373955_0005751 Ga0373955_0005751_157_1476 434
321 3300035692 Ga0373935_0078989 Ga0373935_0078989_744_2063 434
322 3300035695 Ga0373927_0148757 Ga0373927_0148757_91_1410 434
323 3300035724 Ga0373933_0018091 Ga0373933_0018091_2109_3428 434
324 3300036401 Ga0373937_0232254 Ga0373937_0232254_65_1384 434
325 3300037068 Ga0373925_0009135 Ga0373925_0009135_651_1970 434
326 3300037068 Ga0373925_0160324 Ga0373925_0160324_313_1632 434
327 3300037471 Ga0395905_0030359 Ga0395905_0030359_2345_3664 434
328 3300046459 Ga0495629_0050996 Ga0495629_0050996_1270_2589 434
329 3300046475 Ga0495639_0011546 Ga0495639_0011546_463_1782 434
330 3300046499 Ga0495594_0111545 Ga0495594_0111545_189_1508 434
331 3300046531 Ga0495665_0016464 Ga0495665_0016464_1233_2552 434
332 3300046543 Ga0495645_0069507 Ga0495645_0069507_293_1612 434
333 3300046663 Ga0495635_0008428 Ga0495635_0008428_2208_3527 434
334 3300046681 Ga0495647_0007029 Ga0495647_0007029_291_1610 434
335 3300046683 Ga0495658_0010519 Ga0495658_0010519_1072_2391 434
336 3300046689 Ga0495613_0005723 Ga0495613_0005723_2032_3351 434
337 3300047471 Ga0495684_0003384 Ga0495684_0003384_7837_9156 434
338 3300048091 Ga0495626_0075851 Ga0495626_0075851_28_1350 434
339 3300048905 Ga0496102_0138011 Ga0496102_0138011_197_1516 434
340 3300048907 Ga0496104_0038484 Ga0496104_0038484_220_1539 434
341 3300048910 Ga0496107_0052863 Ga0496107_0052863_102_1421 434
342 3300048912 Ga0496109_0317604 Ga0496109_0317604_130_1449 434
343 3300048915 Ga0496112_0103179 Ga0496112_0103179_45_1364 434
344 3300048917 Ga0496114_0062393 Ga0496114_0062393_1670_2989 434
345 3300048918 Ga0496115_0011956 Ga0496115_0011956_181_1500 434
346 3300053134 Ga0500658_0007229 Ga0500658_0007229_1612_2934 434
347 iso_pu_bacteria 2945945610 2945945643 434
348 3300005457 Ga0070662_100004864 Ga0070662_1000048648 435
349 3300005467 Ga0070706_100001321 Ga0070706_1000013212 435
350 3300005616 Ga0068852_100260912 Ga0068852_1002609122 435
351 3300006177 Ga0075362_10027810 Ga0075362_100278102 435
352 3300006178 Ga0075367_10073532 Ga0075367_100735322 435
353 3300006353 Ga0075370_10016975 Ga0075370_100169752 435
354 3300013297 Ga0157378_10236891 Ga0157378_102368912 435
355 3300014326 Ga0157380_10080513 Ga0157380_100805132 435
356 3300025910 Ga0207684_10040849 Ga0207684_100408491 435
357 3300025922 Ga0207646_10178582 Ga0207646_101785822 435
358 3300025933 Ga0207706_10011643 Ga0207706_100116432 435
359 3300026116 Ga0207674_10011720 Ga0207674_100117209 435
360 3300028786 Ga0307517_10106480 Ga0307517_101064802 435
361 3300031730 Ga0307516_10058949 Ga0307516_100589492 435
362 3300046660 Ga0495625_0014315 Ga0495625_0014315_2587_3909 435
363 3300048903 Ga0496100_0119886 Ga0496100_0119886_205_1527 435
364 3300050489 nmdc:mga03683_47083_c1 nmdc:mga03683_47083_c1_52_1374 435
365 3300050493 nmdc:mga0k408_30899_c1 nmdc:mga0k408_30899_c1_1508_2830 435
366 3300050496 nmdc:mga07m45_2012_c1 nmdc:mga07m45_2012_c1_7760_9151 435
367 3300050496 nmdc:mga07m45_334_c1 nmdc:mga07m45_334_c1_1680_3002 435
368 3300005335 Ga0070666_10028929 Ga0070666_100289292 436
369 3300005338 Ga0068868_100157985 Ga0068868_1001579852 436
370 3300005356 Ga0070674_100009857 Ga0070674_1000098574 436
371 3300005367 Ga0070667_100014862 Ga0070667_1000148625 436
372 3300005456 Ga0070678_100028162 Ga0070678_1000281623 436
373 3300005548 Ga0070665_100029079 Ga0070665_1000290792 436
374 3300005548 Ga0070665_100041342 Ga0070665_1000413423 436
375 3300005618 Ga0068864_100032182 Ga0068864_1000321824 436
376 3300005719 Ga0068861_100003340 Ga0068861_1000033409 436
377 3300005841 Ga0068863_100074661 Ga0068863_1000746613 436
378 3300005843 Ga0068860_100008652 Ga0068860_1000086522 436
379 3300006038 Ga0075365_10013462 Ga0075365_100134624 436
380 3300006195 Ga0075366_10069410 Ga0075366_100694101 436
381 3300006358 Ga0068871_100105397 Ga0068871_1001053972 436
382 3300006881 Ga0068865_100003331 Ga0068865_1000033318 436
383 3300009098 Ga0105245_10348823 Ga0105245_103488231 436
384 3300009177 Ga0105248_10079735 Ga0105248_100797354 436
385 3300013297 Ga0157378_10006295 Ga0157378_100062952 436
386 3300013306 Ga0163162_10006607 Ga0163162_100066075 436
387 3300013308 Ga0157375_10100843 Ga0157375_101008433 436
388 3300014968 Ga0157379_10072578 Ga0157379_100725782 436
389 3300014968 Ga0157379_10151461 Ga0157379_101514612 436
390 3300025937 Ga0207669_10049261 Ga0207669_100492612 436
391 3300025938 Ga0207704_10006681 Ga0207704_100066813 436
392 3300025940 Ga0207691_10065131 Ga0207691_100651313 436
393 3300025960 Ga0207651_10115487 Ga0207651_101154872 436
394 3300025972 Ga0207668_10008779 Ga0207668_100087792 436
395 3300025981 Ga0207640_10059192 Ga0207640_100591922 436
396 3300025986 Ga0207658_10051485 Ga0207658_100514853 436
397 3300026023 Ga0207677_10089631 Ga0207677_100896312 436
398 3300026088 Ga0207641_10064469 Ga0207641_100644691 436
399 3300026089 Ga0207648_10002249 Ga0207648_1000224914 436
400 3300026118 Ga0207675_100020315 Ga0207675_1000203156 436
401 3300026121 Ga0207683_10045899 Ga0207683_100458992 436
402 3300028379 Ga0268266_10025799 Ga0268266_100257994 436
403 3300028379 Ga0268266_10073026 Ga0268266_100730262 436
404 3300028380 Ga0268265_10009900 Ga0268265_100099003 436
405 3300028381 Ga0268264_10115365 Ga0268264_101153652 436
406 3300032004 Ga0307414_10089861 Ga0307414_100898612 436
407 3300036401 Ga0373937_0180351 Ga0373937_0180351_597_1922 436
408 3300042008 Ga0439450_003762 Ga0439450_003762_300_1634 436
409 3300045051 Ga0451576_0014003 Ga0451576_0014003_6857_8185 436
410 3300050492 nmdc:mga0yw44_30902_c1 nmdc:mga0yw44_30902_c1_1113_2438 436
411 3300050493 nmdc:mga0k408_32800_c1 nmdc:mga0k408_32800_c1_932_2260 436
412 3300053148 Ga0500590_021314 Ga0500590_021314_1491_2816 436
413 3300003784 Ga0055534_1002873 Ga0055534_10028734 437
414 3300005330 Ga0070690_100051374 Ga0070690_1000513742 437
415 3300005331 Ga0070670_100012532 Ga0070670_1000125322 437
416 3300005331 Ga0070670_100109983 Ga0070670_1001099832 437
417 3300005331 Ga0070670_100170861 Ga0070670_1001708612 437
418 3300005335 Ga0070666_10001963 Ga0070666_100019634 437
419 3300005335 Ga0070666_10037161 Ga0070666_100371612 437
420 3300005336 Ga0070680_100009735 Ga0070680_1000097354 437
421 3300005338 Ga0068868_100055798 Ga0068868_1000557981 437
422 3300005338 Ga0068868_100063898 Ga0068868_1000638982 437
423 3300005339 Ga0070660_100043813 Ga0070660_1000438133 437
424 3300005340 Ga0070689_100040119 Ga0070689_1000401193 437
425 3300005343 Ga0070687_100026415 Ga0070687_1000264152 437
426 3300005344 Ga0070661_100004818 Ga0070661_1000048186 437
427 3300005344 Ga0070661_100149226 Ga0070661_1001492261 437
428 3300005347 Ga0070668_100032908 Ga0070668_1000329082 437
429 3300005353 Ga0070669_100001676 Ga0070669_10000167611 437
430 3300005353 Ga0070669_100036531 Ga0070669_1000365312 437
431 3300005354 Ga0070675_100000815 Ga0070675_1000008153 437
432 3300005354 Ga0070675_100151237 Ga0070675_1001512372 437
433 3300005356 Ga0070674_100003570 Ga0070674_1000035709 437
434 3300005364 Ga0070673_100032868 Ga0070673_1000328682 437
435 3300005365 Ga0070688_100009209 Ga0070688_1000092092 437
436 3300005367 Ga0070667_100012710 Ga0070667_1000127105 437
437 3300005438 Ga0070701_10063306 Ga0070701_100633062 437
438 3300005456 Ga0070678_100058303 Ga0070678_1000583032 437
439 3300005457 Ga0070662_100010906 Ga0070662_1000109066 437
440 3300005458 Ga0070681_10226107 Ga0070681_102261071 437
441 3300005459 Ga0068867_100026482 Ga0068867_1000264823 437
442 3300005459 Ga0068867_100038864 Ga0068867_1000388642 437
443 3300005466 Ga0070685_10010239 Ga0070685_100102394 437
444 3300005530 Ga0070679_100002199 Ga0070679_1000021994 437
445 3300005535 Ga0070684_100087136 Ga0070684_1000871362 437
446 3300005539 Ga0068853_100062500 Ga0068853_1000625002 437
447 3300005539 Ga0068853_100291457 Ga0068853_1002914571 437
448 3300005543 Ga0070672_100001412 Ga0070672_10000141213 437
449 3300005543 Ga0070672_100008785 Ga0070672_1000087852 437
450 3300005543 Ga0070672_100031008 Ga0070672_1000310082 437
451 3300005543 Ga0070672_100097636 Ga0070672_1000976362 437
452 3300005543 Ga0070672_100173256 Ga0070672_1001732562 437
453 3300005547 Ga0070693_100035112 Ga0070693_1000351123 437
454 3300005548 Ga0070665_100030832 Ga0070665_1000308326 437
455 3300005563 Ga0068855_100007145 Ga0068855_1000071455 437
456 3300005564 Ga0070664_100004354 Ga0070664_1000043549 437
457 3300005577 Ga0068857_100035640 Ga0068857_1000356403 437
458 3300005577 Ga0068857_100130386 Ga0068857_1001303862 437
459 3300005578 Ga0068854_100006013 Ga0068854_1000060132 437
460 3300005578 Ga0068854_100035336 Ga0068854_1000353364 437
461 3300005614 Ga0068856_100041781 Ga0068856_1000417813 437
462 3300005614 Ga0068856_100057174 Ga0068856_1000571741 437
463 3300005616 Ga0068852_100018994 Ga0068852_1000189943 437
464 3300005616 Ga0068852_100099242 Ga0068852_1000992422 437
465 3300005616 Ga0068852_100262944 Ga0068852_1002629441 437
466 3300005617 Ga0068859_100000631 Ga0068859_10000063120 437
467 3300005618 Ga0068864_100001006 Ga0068864_10000100616 437
468 3300005618 Ga0068864_100100358 Ga0068864_1001003582 437
469 3300005618 Ga0068864_100137963 Ga0068864_1001379632 437
470 3300005719 Ga0068861_100021335 Ga0068861_1000213352 437
471 3300005834 Ga0068851_10014649 Ga0068851_100146493 437
472 3300005834 Ga0068851_10016960 Ga0068851_100169601 437
473 3300005841 Ga0068863_100028533 Ga0068863_1000285334 437
474 3300005841 Ga0068863_100110582 Ga0068863_1001105822 437
475 3300005842 Ga0068858_100001003 Ga0068858_10000100311 437
476 3300005842 Ga0068858_100006624 Ga0068858_1000066242 437
477 3300005842 Ga0068858_100026455 Ga0068858_1000264555 437
478 3300005843 Ga0068860_100012688 Ga0068860_1000126884 437
479 3300005843 Ga0068860_100147030 Ga0068860_1001470302 437
480 3300005844 Ga0068862_100033069 Ga0068862_1000330693 437
481 3300006038 Ga0075365_10013860 Ga0075365_100138602 437
482 3300006058 Ga0075432_10018964 Ga0075432_100189642 437
483 3300006195 Ga0075366_10002262 Ga0075366_100022622 437
484 3300006195 Ga0075366_10023241 Ga0075366_100232412 437
485 3300006195 Ga0075366_10102696 Ga0075366_101026962 437
486 3300006237 Ga0097621_100007405 Ga0097621_1000074052 437
487 3300006237 Ga0097621_100057987 Ga0097621_1000579872 437
488 3300006237 Ga0097621_100312814 Ga0097621_1003128141 437
489 3300006353 Ga0075370_10001313 Ga0075370_1000131312 437
490 3300006358 Ga0068871_100004805 Ga0068871_10000480510 437
491 3300006844 Ga0075428_100116605 Ga0075428_1001166052 437
492 3300006931 Ga0097620_100000631 Ga0097620_10000063120 437
493 3300009093 Ga0105240_10009479 Ga0105240_100094798 437
494 3300009093 Ga0105240_10010648 Ga0105240_100106487 437
495 3300009176 Ga0105242_10033379 Ga0105242_100333793 437
496 3300009551 Ga0105238_10006338 Ga0105238_100063384 437
497 3300009551 Ga0105238_10012746 Ga0105238_100127467 437
498 3300009553 Ga0105249_10080759 Ga0105249_100807592 437
499 3300013100 Ga0157373_10030428 Ga0157373_100304283 437
500 3300013104 Ga0157370_10004306 Ga0157370_1000430612 437
501 3300013105 Ga0157369_10008064 Ga0157369_100080644 437
502 3300013306 Ga0163162_10003915 Ga0163162_100039152 437
503 3300013307 Ga0157372_10104769 Ga0157372_101047692 437
504 3300013307 Ga0157372_10286269 Ga0157372_102862692 437
505 3300014325 Ga0163163_10007271 Ga0163163_100072719 437
506 3300014497 Ga0182008_10000654 Ga0182008_1000065425 437
507 3300014497 Ga0182008_10001019 Ga0182008_100010199 437
508 3300014497 Ga0182008_10026911 Ga0182008_100269112 437
509 3300014968 Ga0157379_10052111 Ga0157379_100521113 437
510 3300014968 Ga0157379_10079548 Ga0157379_100795482 437
511 3300014969 Ga0157376_10107010 Ga0157376_101070102 437
512 3300015262 Ga0182007_10001610 Ga0182007_1000161011 437
513 3300017792 Ga0163161_10000606 Ga0163161_100006065 437
514 3300017792 Ga0163161_10106728 Ga0163161_101067282 437
515 3300025273 Ga0209673_1024574 Ga0209673_10245742 437
516 3300025284 Ga0209130_1005106 Ga0209130_10051062 437
517 3300025291 Ga0209675_1001148 Ga0209675_100114814 437
518 3300025292 Ga0209676_1006751 Ga0209676_10067513 437
519 3300025303 Ga0209051_1010377 Ga0209051_10103772 437
520 3300025304 Ga0209257_1007196 Ga0209257_10071965 437
521 3300025321 Ga0207656_10063340 Ga0207656_100633401 437
522 3300025893 Ga0207682_10017681 Ga0207682_100176812 437
523 3300025901 Ga0207688_10060234 Ga0207688_100602342 437
524 3300025903 Ga0207680_10000777 Ga0207680_1000077714 437
525 3300025903 Ga0207680_10041827 Ga0207680_100418272 437
526 3300025912 Ga0207707_10167325 Ga0207707_101673251 437
527 3300025913 Ga0207695_10049214 Ga0207695_100492144 437
528 3300025917 Ga0207660_10010630 Ga0207660_100106304 437
529 3300025917 Ga0207660_10187497 Ga0207660_101874971 437
530 3300025918 Ga0207662_10000764 Ga0207662_1000076413 437
531 3300025920 Ga0207649_10013416 Ga0207649_100134161 437
532 3300025920 Ga0207649_10104174 Ga0207649_101041742 437
533 3300025921 Ga0207652_10005535 Ga0207652_100055352 437
534 3300025923 Ga0207681_10000771 Ga0207681_1000077111 437
535 3300025923 Ga0207681_10025743 Ga0207681_100257432 437
536 3300025923 Ga0207681_10063287 Ga0207681_100632872 437
537 3300025923 Ga0207681_10086338 Ga0207681_100863382 437
538 3300025924 Ga0207694_10040036 Ga0207694_100400362 437
539 3300025925 Ga0207650_10001998 Ga0207650_1000199811 437
540 3300025925 Ga0207650_10047393 Ga0207650_100473932 437
541 3300025925 Ga0207650_10088947 Ga0207650_100889472 437
542 3300025926 Ga0207659_10022714 Ga0207659_100227144 437
543 3300025927 Ga0207687_10083957 Ga0207687_100839572 437
544 3300025931 Ga0207644_10073669 Ga0207644_100736692 437
545 3300025931 Ga0207644_10184693 Ga0207644_101846932 437
546 3300025932 Ga0207690_10008231 Ga0207690_100082313 437
547 3300025933 Ga0207706_10072621 Ga0207706_100726212 437
548 3300025934 Ga0207686_10040244 Ga0207686_100402443 437
549 3300025935 Ga0207709_10013260 Ga0207709_100132602 437
550 3300025936 Ga0207670_10066152 Ga0207670_100661522 437
551 3300025937 Ga0207669_10074826 Ga0207669_100748262 437
552 3300025940 Ga0207691_10012083 Ga0207691_100120839 437
553 3300025940 Ga0207691_10055015 Ga0207691_100550152 437
554 3300025941 Ga0207711_10012387 Ga0207711_100123872 437
555 3300025941 Ga0207711_10032815 Ga0207711_100328152 437
556 3300025942 Ga0207689_10131192 Ga0207689_101311921 437
557 3300025944 Ga0207661_10055317 Ga0207661_100553172 437
558 3300025944 Ga0207661_10241976 Ga0207661_102419761 437
559 3300025945 Ga0207679_10203714 Ga0207679_102037142 437
560 3300025960 Ga0207651_10008778 Ga0207651_100087784 437
561 3300025960 Ga0207651_10013580 Ga0207651_100135804 437
562 3300025960 Ga0207651_10025601 Ga0207651_100256012 437
563 3300025972 Ga0207668_10025745 Ga0207668_100257452 437
564 3300025972 Ga0207668_10196923 Ga0207668_101969232 437
565 3300025981 Ga0207640_10024716 Ga0207640_100247164 437
566 3300025981 Ga0207640_10225607 Ga0207640_102256071 437
567 3300025986 Ga0207658_10000818 Ga0207658_1000081811 437
568 3300025986 Ga0207658_10016161 Ga0207658_100161613 437
569 3300025986 Ga0207658_10080115 Ga0207658_100801152 437
570 3300026023 Ga0207677_10006603 Ga0207677_100066033 437
571 3300026023 Ga0207677_10121386 Ga0207677_101213861 437
572 3300026035 Ga0207703_10000668 Ga0207703_1000066816 437
573 3300026035 Ga0207703_10003675 Ga0207703_100036752 437
574 3300026035 Ga0207703_10098713 Ga0207703_100987132 437
575 3300026067 Ga0207678_10073364 Ga0207678_100733642 437
576 3300026075 Ga0207708_10129850 Ga0207708_101298502 437
577 3300026075 Ga0207708_10156639 Ga0207708_101566392 437
578 3300026078 Ga0207702_10008513 Ga0207702_100085139 437
579 3300026088 Ga0207641_10015742 Ga0207641_100157424 437
580 3300026089 Ga0207648_10047650 Ga0207648_100476502 437
581 3300026095 Ga0207676_10000460 Ga0207676_1000046015 437
582 3300026095 Ga0207676_10083224 Ga0207676_100832242 437
583 3300026095 Ga0207676_10110582 Ga0207676_101105822 437
584 3300026095 Ga0207676_10181939 Ga0207676_101819392 437
585 3300026095 Ga0207676_10276977 Ga0207676_102769772 437
586 3300026118 Ga0207675_100014357 Ga0207675_1000143577 437
587 3300026118 Ga0207675_100029124 Ga0207675_1000291244 437
588 3300026118 Ga0207675_100275251 Ga0207675_1002752512 437
589 3300026121 Ga0207683_10111836 Ga0207683_101118362 437
590 3300026121 Ga0207683_10199709 Ga0207683_101997092 437
591 3300026142 Ga0207698_10057249 Ga0207698_100572492 437
592 3300026142 Ga0207698_10166728 Ga0207698_101667282 437
593 3300028379 Ga0268266_10035623 Ga0268266_100356234 437
594 3300028380 Ga0268265_10079904 Ga0268265_100799042 437
595 3300028381 Ga0268264_10017628 Ga0268264_100176284 437
596 3300028381 Ga0268264_10020240 Ga0268264_100202402 437
597 3300028786 Ga0307517_10006989 Ga0307517_1000698910 437
598 3300028794 Ga0307515_10000034 Ga0307515_1000003460 437
599 3300028794 Ga0307515_10000221 Ga0307515_1000022110 437
600 3300028794 Ga0307515_10022638 Ga0307515_100226387 437
601 3300028794 Ga0307515_10229727 Ga0307515_102297272 437
602 3300031238 Ga0265332_10013905 Ga0265332_100139052 437
603 3300031250 Ga0265331_10072293 Ga0265331_100722932 437
604 3300031251 Ga0265327_10000851 Ga0265327_1000085118 437
605 3300031251 Ga0265327_10039548 Ga0265327_100395482 437
606 3300031507 Ga0307509_10005306 Ga0307509_1000530614 437
607 3300031507 Ga0307509_10048038 Ga0307509_100480384 437
608 3300031507 Ga0307509_10115106 Ga0307509_101151062 437
609 3300031548 Ga0307408_100076205 Ga0307408_1000762052 437
610 3300031616 Ga0307508_10000141 Ga0307508_1000014170 437
611 3300031616 Ga0307508_10004610 Ga0307508_100046108 437
612 3300031649 Ga0307514_10002352 Ga0307514_1000235213 437
613 3300031649 Ga0307514_10144343 Ga0307514_101443432 437
614 3300031711 Ga0265314_10005818 Ga0265314_1000581810 437
615 3300031730 Ga0307516_10008188 Ga0307516_1000818811 437
616 3300031730 Ga0307516_10018003 Ga0307516_100180031 437
617 3300031911 Ga0307412_10004567 Ga0307412_100045676 437
618 3300033180 Ga0307510_10092443 Ga0307510_100924431 437
619 3300035111 Ga0373923_0051629 Ga0373923_0051629_231_1565 437
620 3300035119 Ga0373956_0023220 Ga0373956_0023220_316_1632 437
621 3300035172 Ga0373955_0003124 Ga0373955_0003124_713_2029 437
622 3300035691 Ga0373931_0026920 Ga0373931_0026920_1268_2584 437
623 3300035695 Ga0373927_0171831 Ga0373927_0171831_65_1399 437
624 3300035724 Ga0373933_0012042 Ga0373933_0012042_1142_2458 437
625 3300036401 Ga0373937_0021385 Ga0373937_0021385_3673_4989 437
626 3300037068 Ga0373925_0023450 Ga0373925_0023450_781_2115 437
627 3300037312 Ga0395899_0003984 Ga0395899_0003984_4756_6084 437
628 3300037312 Ga0395899_0052574 Ga0395899_0052574_1232_2560 437
629 3300037418 Ga0395900_0007847 Ga0395900_0007847_1102_2430 437
630 3300037418 Ga0395900_0037654 Ga0395900_0037654_2316_3644 437
631 3300037466 Ga0395898_0013040 Ga0395898_0013040_4503_5831 437
632 3300037471 Ga0395905_0000042 Ga0395905_0000042_28852_30180 437
633 3300037471 Ga0395905_0000377 Ga0395905_0000377_39378_40706 437
634 3300037471 Ga0395905_0037027 Ga0395905_0037027_1977_3305 437
635 3300037471 Ga0395905_0103955 Ga0395905_0103955_877_2205 437
636 3300038443 Ga0395901_0019515 Ga0395901_0019515_4392_5720 437
637 3300038443 Ga0395901_0039104 Ga0395901_0039104_812_2140 437
638 3300038443 Ga0395901_0088482 Ga0395901_0088482_718_2046 437
639 3300041404 Ga0439436_0000623 Ga0439436_0000623_3824_5152 437
640 3300041407 Ga0439447_005430 Ga0439447_005430_2453_3781 437
641 3300041413 Ga0439465_0006271 Ga0439465_0006271_943_2271 437
642 3300042004 Ga0439445_0010562 Ga0439445_0010562_211_1545 437
643 3300042006 Ga0439432_003265 Ga0439432_003265_2392_3720 437
644 3300042007 Ga0439449_0001905 Ga0439449_0001905_4094_5422 437
645 3300042010 Ga0439452_003048 Ga0439452_003048_3102_4430 437
646 3300042014 Ga0439457_001347 Ga0439457_001347_4798_6126 437
647 3300042015 Ga0439462_0000901 Ga0439462_0000901_3077_4405 437
648 3300042115 Ga0450911_000152 Ga0450911_000152_14380_15714 437
649 3300042876 Ga0451577_0013112 Ga0451577_0013112_3955_5283 437
650 3300044684 Ga0466966_0024785 Ga0466966_0024785_1556_2884 437
651 3300044693 Ga0466961_0007100 Ga0466961_0007100_434_1762 437
652 3300044712 Ga0453684_0265829 Ga0453684_0265829_556_1884 437
653 3300044765 Ga0466970_0012828 Ga0466970_0012828_2879_4207 437
654 3300044842 Ga0466957_0030344 Ga0466957_0030344_1528_2856 437
655 3300045976 Ga0466967_0000292 Ga0466967_0000292_14626_15942 437
656 3300046453 Ga0495627_004132 Ga0495627_004132_3179_4507 437
657 3300046453 Ga0495627_015990 Ga0495627_015990_861_2189 437
658 3300046454 Ga0495592_0000142 Ga0495592_0000142_25946_27274 437
659 3300046459 Ga0495629_0153359 Ga0495629_0153359_90_1424 437
660 3300046463 Ga0495653_0091666 Ga0495653_0091666_164_1492 437
661 3300046516 Ga0495628_0004819 Ga0495628_0004819_9442_10758 437
662 3300046519 Ga0495632_0008357 Ga0495632_0008357_2342_3670 437
663 3300046520 Ga0495637_0014207 Ga0495637_0014207_2004_3332 437
664 3300046529 Ga0495652_0007395 Ga0495652_0007395_177_1493 437
665 3300046539 Ga0495621_0033415 Ga0495621_0033415_421_1749 437
666 3300046543 Ga0495645_0000419 Ga0495645_0000419_19039_20355 437
667 3300046615 Ga0495656_0004699 Ga0495656_0004699_1738_3066 437
668 3300046660 Ga0495625_0035602 Ga0495625_0035602_1192_2520 437
669 3300046678 Ga0495599_0000476 Ga0495599_0000476_5094_6410 437
670 3300046680 Ga0495646_0027738 Ga0495646_0027738_1724_3052 437
671 3300046692 Ga0495671_0007807 Ga0495671_0007807_3312_4640 437
672 3300046809 Ga0495600_0100556 Ga0495600_0100556_224_1552 437
673 3300047471 Ga0495684_0212860 Ga0495684_0212860_50_1384 437
674 3300048905 Ga0496102_0014300 Ga0496102_0014300_500_1828 437
675 3300048909 Ga0496106_0011519 Ga0496106_0011519_4620_5948 437
676 3300048917 Ga0496114_0022149 Ga0496114_0022149_3178_4506 437
677 3300048920 Ga0496117_0108491 Ga0496117_0108491_20_1348 437
678 3300048924 Ga0496121_0009076 Ga0496121_0009076_7664_8998 437
679 3300048925 Ga0496122_0002676 Ga0496122_0002676_7449_8777 437
680 3300048926 Ga0496123_0004397 Ga0496123_0004397_8030_9358 437
681 3300048927 Ga0496124_0105373 Ga0496124_0105373_464_1798 437
682 3300048928 Ga0496125_0025776 Ga0496125_0025776_3407_4741 437
683 3300048928 Ga0496125_0044090 Ga0496125_0044090_1227_2561 437
684 3300048928 Ga0496125_0099388 Ga0496125_0099388_593_1927 437
685 3300048929 Ga0496126_0103421 Ga0496126_0103421_472_1806 437
686 3300049571 Ga0501034_0092920 Ga0501034_0092920_244_1635 437
687 3300049572 Ga0501036_0092234 Ga0501036_0092234_601_1992 437
688 3300049579 Ga0501043_0000072 Ga0501043_0000072_83634_84962 437
689 3300049580 Ga0501046_0000112 Ga0501046_0000112_80985_82313 437
690 3300049580 Ga0501046_0080956 Ga0501046_0080956_938_2329 437
691 3300049581 Ga0501047_0000138 Ga0501047_0000138_4060_5388 437
692 3300049581 Ga0501047_0071256 Ga0501047_0071256_1403_2794 437
693 3300049582 Ga0501048_0016360 Ga0501048_0016360_2618_3946 437
694 3300049589 Ga0501073_0043590 Ga0501073_0043590_1538_2929 437
695 3300049822 Ga0501035_0075918 Ga0501035_0075918_1164_2555 437
696 3300049823 Ga0501044_0044351 Ga0501044_0044351_1550_2941 437
697 3300050493 nmdc:mga0k408_137005_c1 nmdc:mga0k408_137005_c1_80_1408 437
698 3300050493 nmdc:mga0k408_2556_c1 nmdc:mga0k408_2556_c1_691_2019 437
699 3300050493 nmdc:mga0k408_3535_c1 nmdc:mga0k408_3535_c1_6590_7921 437
700 3300050493 nmdc:mga0k408_48073_c1 nmdc:mga0k408_48073_c1_770_2098 437
701 3300050496 nmdc:mga07m45_2789_c1 nmdc:mga07m45_2789_c1_722_2053 437
702 3300050496 nmdc:mga07m45_919_c1 nmdc:mga07m45_919_c1_10788_12116 437
703 3300050508 nmdc:mga09592_34460_c1 nmdc:mga09592_34460_c1_1548_2876 437
704 3300050509 nmdc:mga0qj67_93086_c1 nmdc:mga0qj67_93086_c1_603_1931 437
705 3300050510 nmdc:mga06r32_260272_c1 nmdc:mga06r32_260272_c1_138_1472 437
706 3300053077 Ga0495601_0131874 Ga0495601_0131874_283_1611 437
707 3300053079 Ga0500610_0000785 Ga0500610_0000785_2799_4127 437
708 3300053079 Ga0500610_0007879 Ga0500610_0007879_2799_4127 437
709 3300053088 Ga0500644_0010323 Ga0500644_0010323_1096_2424 437
710 3300053088 Ga0500644_0015006 Ga0500644_0015006_625_1953 437
711 3300053117 Ga0500593_004410 Ga0500593_004410_1480_2808 437
712 3300053118 Ga0500594_0012252 Ga0500594_0012252_566_1894 437
713 3300053121 Ga0500607_002882 Ga0500607_002882_676_2004 437
714 3300053136 Ga0500559_0000014 Ga0500559_0000014_146358_147686 437
715 3300053136 Ga0500559_0001094 Ga0500559_0001094_3771_5099 437
716 3300053153 Ga0500616_0029527 Ga0500616_0029527_1067_2395 437
717 3300053156 Ga0500622_0006682 Ga0500622_0006682_3194_4522 437
718 3300053158 Ga0500627_0000632 Ga0500627_0000632_2946_4274 437
719 3300053730 Ga0500645_007944 Ga0500645_007944_655_2088 437
720 3300005547 Ga0070693_100092527 Ga0070693_1000925271 438
721 3300006042 Ga0075368_10003480 Ga0075368_100034805 438
722 3300006048 Ga0075363_100002634 Ga0075363_1000026343 438
723 3300006178 Ga0075367_10002281 Ga0075367_100022814 438
724 3300006353 Ga0075370_10037289 Ga0075370_100372892 438
725 3300030521 Ga0307511_10005456 Ga0307511_100054563 438
726 3300033179 Ga0307507_10094496 Ga0307507_100944962 438
727 3300035113 Ga0373936_0007078 Ga0373936_0007078_505_1827 438
728 3300035171 Ga0373946_0045327 Ga0373946_0045327_269_1591 438
729 3300035207 Ga0373942_0007240 Ga0373942_0007240_1039_2358 438
730 3300035410 Ga0373924_0034965 Ga0373924_0034965_550_1872 438
731 3300035695 Ga0373927_0017512 Ga0373927_0017512_3195_4517 438
732 3300035725 Ga0373947_0135755 Ga0373947_0135755_22_1344 438
733 3300046454 Ga0495592_0030716 Ga0495592_0030716_1196_2518 438
734 3300046463 Ga0495653_0016870 Ga0495653_0016870_3896_5215 438
735 3300046475 Ga0495639_0001883 Ga0495639_0001883_7002_8324 438
736 3300046477 Ga0495664_0058074 Ga0495664_0058074_717_2036 438
737 3300046516 Ga0495628_0048048 Ga0495628_0048048_579_1901 438
738 3300046517 Ga0495630_0003398 Ga0495630_0003398_6232_7554 438
739 3300046536 Ga0495587_0039982 Ga0495587_0039982_208_1527 438
740 3300046680 Ga0495646_0086397 Ga0495646_0086397_306_1628 438
741 3300046681 Ga0495647_0017865 Ga0495647_0017865_142_1464 438
742 3300046689 Ga0495613_0123637 Ga0495613_0123637_112_1434 438
743 3300047315 Ga0495581_0104486 Ga0495581_0104486_202_1524 438
744 3300047444 Ga0495675_0013490 Ga0495675_0013490_3541_4863 438
745 3300047472 Ga0495686_0003768 Ga0495686_0003768_9099_10427 438
746 3300048089 Ga0495614_0035198 Ga0495614_0035198_612_1934 438
747 3300049592 Ga0501076_0250471 Ga0501076_0250471_12_1331 438
748 3300049824 Ga0501045_0034681 Ga0501045_0034681_2018_3337 438
749 3300050490 nmdc:mga03n38_1080_c1 nmdc:mga03n38_1080_c1_4290_5612 438
750 3300050491 nmdc:mga00v17_31683_c1 nmdc:mga00v17_31683_c1_1619_2941 438
751 3300050492 nmdc:mga0yw44_102264_c1 nmdc:mga0yw44_102264_c1_180_1502 438
752 3300050493 nmdc:mga0k408_54223_c1 nmdc:mga0k408_54223_c1_454_1776 438
753 3300050494 nmdc:mga06z11_18083_c1 nmdc:mga06z11_18083_c1_203_1525 438
754 3300053084 Ga0495595_0022721 Ga0495595_0022721_953_2275 438
755 3300053090 Ga0500646_0008511 Ga0500646_0008511_217_1539 438
756 3300053092 Ga0500583_0001132 Ga0500583_0001132_1720_3042 438
757 3300053151 Ga0500604_0027661 Ga0500604_0027661_71_1393 438
758 3300005434 Ga0070709_10013191 Ga0070709_100131913 439
759 3300005436 Ga0070713_100167906 Ga0070713_1001679062 439
760 3300005471 Ga0070698_100100992 Ga0070698_1001009923 439
761 3300005518 Ga0070699_100010858 Ga0070699_1000108583 439
762 3300005546 Ga0070696_100001069 Ga0070696_1000010694 439
763 3300005549 Ga0070704_100030185 Ga0070704_1000301853 439
764 3300005563 Ga0068855_100061675 Ga0068855_1000616753 439
765 3300005564 Ga0070664_100019498 Ga0070664_1000194984 439
766 3300005614 Ga0068856_100053277 Ga0068856_1000532772 439
767 3300005617 Ga0068859_100178980 Ga0068859_1001789802 439
768 3300005618 Ga0068864_100084703 Ga0068864_1000847032 439
769 3300005985 Ga0081539_10028541 Ga0081539_100285412 439
770 3300006931 Ga0097620_100178976 Ga0097620_1001789762 439
771 3300009098 Ga0105245_10118727 Ga0105245_101187272 439
772 3300025913 Ga0207695_10110776 Ga0207695_101107762 439
773 3300025949 Ga0207667_10191303 Ga0207667_101913031 439
774 3300026078 Ga0207702_10048102 Ga0207702_100481022 439
775 3300026095 Ga0207676_10040865 Ga0207676_100408653 439
776 3300031548 Ga0307408_100012538 Ga0307408_1000125381 439
777 3300031731 Ga0307405_10021076 Ga0307405_100210762 439
778 3300031731 Ga0307405_10022909 Ga0307405_100229091 439
779 3300031852 Ga0307410_10000433 Ga0307410_100004334 439
780 3300031852 Ga0307410_10007774 Ga0307410_100077743 439
781 3300031852 Ga0307410_10165241 Ga0307410_101652412 439
782 3300031901 Ga0307406_10179622 Ga0307406_101796221 439
783 3300031903 Ga0307407_10011742 Ga0307407_100117421 439
784 3300031995 Ga0307409_100030184 Ga0307409_1000301844 439
785 3300031995 Ga0307409_100088458 Ga0307409_1000884582 439
786 3300032002 Ga0307416_100007289 Ga0307416_1000072892 439
787 3300032004 Ga0307414_10011253 Ga0307414_100112531 439
788 3300032005 Ga0307411_10131735 Ga0307411_101317352 439
789 3300035172 Ga0373955_0099524 Ga0373955_0099524_313_1635 439
790 3300035692 Ga0373935_0093869 Ga0373935_0093869_194_1516 439
791 3300035692 Ga0373935_0108013 Ga0373935_0108013_249_1571 439
792 3300036401 Ga0373937_0012460 Ga0373937_0012460_3482_4804 439
793 3300036401 Ga0373937_0148550 Ga0373937_0148550_789_2111 439
794 3300049572 Ga0501036_0124164 Ga0501036_0124164_116_1444 439
795 3300049591 Ga0501075_0013598 Ga0501075_0013598_686_2014 439
796 3300049824 Ga0501045_0036945 Ga0501045_0036945_1939_3267 439
797 3300061734 Ga0530510_0114470 Ga0530510_0114470_446_1774 439
798 3300001977 JGI24746J21847_1008017 JGI24746J21847_10080172 440
799 3300001991 JGI24743J22301_10001202 JGI24743J22301_100012023 440
800 3300005327 Ga0070658_10142806 Ga0070658_101428062 440
801 3300005327 Ga0070658_10175498 Ga0070658_101754982 440
802 3300005328 Ga0070676_10076270 Ga0070676_100762702 440
803 3300005329 Ga0070683_100026839 Ga0070683_1000268394 440
804 3300005330 Ga0070690_100126919 Ga0070690_1001269192 440
805 3300005334 Ga0068869_100054919 Ga0068869_1000549192 440
806 3300005336 Ga0070680_100049187 Ga0070680_1000491873 440
807 3300005338 Ga0068868_100121061 Ga0068868_1001210612 440
808 3300005338 Ga0068868_100176585 Ga0068868_1001765851 440
809 3300005339 Ga0070660_100027463 Ga0070660_1000274632 440
810 3300005339 Ga0070660_100040343 Ga0070660_1000403433 440
811 3300005339 Ga0070660_100193411 Ga0070660_1001934112 440
812 3300005340 Ga0070689_100029731 Ga0070689_1000297312 440
813 3300005343 Ga0070687_100021134 Ga0070687_1000211342 440
814 3300005344 Ga0070661_100026491 Ga0070661_1000264914 440
815 3300005344 Ga0070661_100048573 Ga0070661_1000485732 440
816 3300005344 Ga0070661_100059702 Ga0070661_1000597022 440
817 3300005345 Ga0070692_10075970 Ga0070692_100759702 440
818 3300005355 Ga0070671_100006677 Ga0070671_1000066779 440
819 3300005364 Ga0070673_100034495 Ga0070673_1000344954 440
820 3300005366 Ga0070659_100002847 Ga0070659_1000028473 440
821 3300005366 Ga0070659_100019546 Ga0070659_1000195462 440
822 3300005366 Ga0070659_100028640 Ga0070659_1000286403 440
823 3300005367 Ga0070667_100032704 Ga0070667_1000327043 440
824 3300005435 Ga0070714_100244019 Ga0070714_1002440192 440
825 3300005436 Ga0070713_100144532 Ga0070713_1001445322 440
826 3300005438 Ga0070701_10006091 Ga0070701_100060912 440
827 3300005455 Ga0070663_100024405 Ga0070663_1000244052 440
828 3300005456 Ga0070678_100158819 Ga0070678_1001588192 440
829 3300005457 Ga0070662_100001732 Ga0070662_1000017329 440
830 3300005458 Ga0070681_10009151 Ga0070681_100091514 440
831 3300005466 Ga0070685_10002286 Ga0070685_100022867 440
832 3300005530 Ga0070679_100034907 Ga0070679_1000349071 440
833 3300005535 Ga0070684_100182835 Ga0070684_1001828352 440
834 3300005539 Ga0068853_100016438 Ga0068853_1000164384 440
835 3300005539 Ga0068853_100069432 Ga0068853_1000694323 440
836 3300005543 Ga0070672_100016427 Ga0070672_1000164272 440
837 3300005543 Ga0070672_100066775 Ga0070672_1000667752 440
838 3300005563 Ga0068855_100001539 Ga0068855_10000153915 440
839 3300005563 Ga0068855_100036094 Ga0068855_1000360942 440
840 3300005564 Ga0070664_100020987 Ga0070664_1000209875 440
841 3300005564 Ga0070664_100035837 Ga0070664_1000358373 440
842 3300005564 Ga0070664_100054372 Ga0070664_1000543722 440
843 3300005564 Ga0070664_100073314 Ga0070664_1000733142 440
844 3300005564 Ga0070664_100199930 Ga0070664_1001999302 440
845 3300005578 Ga0068854_100003803 Ga0068854_10000380310 440
846 3300005614 Ga0068856_100000246 Ga0068856_10000024654 440
847 3300005614 Ga0068856_100092988 Ga0068856_1000929882 440
848 3300005615 Ga0070702_100003579 Ga0070702_1000035797 440
849 3300005616 Ga0068852_100114988 Ga0068852_1001149882 440
850 3300005617 Ga0068859_100054348 Ga0068859_1000543483 440
851 3300005618 Ga0068864_100097316 Ga0068864_1000973162 440
852 3300005718 Ga0068866_10001391 Ga0068866_1000139110 440
853 3300005719 Ga0068861_100233909 Ga0068861_1002339091 440
854 3300005834 Ga0068851_10003782 Ga0068851_100037823 440
855 3300005834 Ga0068851_10020500 Ga0068851_100205002 440
856 3300005840 Ga0068870_10004781 Ga0068870_100047812 440
857 3300005843 Ga0068860_100221933 Ga0068860_1002219332 440
858 3300005985 Ga0081539_10007328 Ga0081539_100073281 440
859 3300006881 Ga0068865_100080660 Ga0068865_1000806602 440
860 3300006931 Ga0097620_100054342 Ga0097620_1000543423 440
861 3300009093 Ga0105240_10044820 Ga0105240_100448202 440
862 3300009174 Ga0105241_10007643 Ga0105241_100076432 440
863 3300009177 Ga0105248_10194288 Ga0105248_101942882 440
864 3300009545 Ga0105237_10129281 Ga0105237_101292812 440
865 3300009551 Ga0105238_10018081 Ga0105238_100180816 440
866 3300009553 Ga0105249_10102216 Ga0105249_101022162 440
867 3300010375 Ga0105239_10121432 Ga0105239_101214322 440
868 3300013100 Ga0157373_10013160 Ga0157373_100131602 440
869 3300013100 Ga0157373_10038402 Ga0157373_100384022 440
870 3300013104 Ga0157370_10096408 Ga0157370_100964082 440
871 3300013105 Ga0157369_10097638 Ga0157369_100976382 440
872 3300013105 Ga0157369_10104750 Ga0157369_101047502 440
873 3300013105 Ga0157369_10152905 Ga0157369_101529052 440
874 3300013296 Ga0157374_10008118 Ga0157374_100081189 440
875 3300013296 Ga0157374_10030270 Ga0157374_100302704 440
876 3300013306 Ga0163162_10102649 Ga0163162_101026492 440
877 3300013307 Ga0157372_10000342 Ga0157372_1000034243 440
878 3300013308 Ga0157375_10156839 Ga0157375_101568392 440
879 3300014325 Ga0163163_10004530 Ga0163163_1000453010 440
880 3300014745 Ga0157377_10001599 Ga0157377_100015996 440
881 3300014968 Ga0157379_10006045 Ga0157379_100060459 440
882 3300017792 Ga0163161_10019038 Ga0163161_100190383 440
883 3300025315 Ga0207697_10008831 Ga0207697_100088312 440
884 3300025321 Ga0207656_10004085 Ga0207656_100040854 440
885 3300025893 Ga0207682_10000068 Ga0207682_1000006831 440
886 3300025901 Ga0207688_10022024 Ga0207688_100220242 440
887 3300025903 Ga0207680_10042713 Ga0207680_100427132 440
888 3300025907 Ga0207645_10001926 Ga0207645_100019263 440
889 3300025908 Ga0207643_10000298 Ga0207643_100002985 440
890 3300025909 Ga0207705_10108792 Ga0207705_101087922 440
891 3300025911 Ga0207654_10008668 Ga0207654_100086685 440
892 3300025912 Ga0207707_10014602 Ga0207707_100146024 440
893 3300025912 Ga0207707_10092742 Ga0207707_100927422 440
894 3300025912 Ga0207707_10130569 Ga0207707_101305692 440
895 3300025913 Ga0207695_10077536 Ga0207695_100775362 440
896 3300025914 Ga0207671_10163484 Ga0207671_101634841 440
897 3300025915 Ga0207693_10172725 Ga0207693_101727252 440
898 3300025917 Ga0207660_10007424 Ga0207660_100074243 440
899 3300025918 Ga0207662_10005747 Ga0207662_100057477 440
900 3300025919 Ga0207657_10000738 Ga0207657_100007384 440
901 3300025919 Ga0207657_10000884 Ga0207657_1000088424 440
902 3300025919 Ga0207657_10013043 Ga0207657_100130435 440
903 3300025919 Ga0207657_10152786 Ga0207657_101527861 440
904 3300025920 Ga0207649_10044347 Ga0207649_100443472 440
905 3300025921 Ga0207652_10023610 Ga0207652_100236101 440
906 3300025921 Ga0207652_10046991 Ga0207652_100469913 440
907 3300025923 Ga0207681_10032191 Ga0207681_100321912 440
908 3300025924 Ga0207694_10036099 Ga0207694_100360993 440
909 3300025925 Ga0207650_10000654 Ga0207650_1000065420 440
910 3300025926 Ga0207659_10002052 Ga0207659_100020525 440
911 3300025928 Ga0207700_10107854 Ga0207700_101078542 440
912 3300025929 Ga0207664_10016442 Ga0207664_100164422 440
913 3300025929 Ga0207664_10032639 Ga0207664_100326394 440
914 3300025931 Ga0207644_10014072 Ga0207644_100140723 440
915 3300025931 Ga0207644_10022491 Ga0207644_100224913 440
916 3300025931 Ga0207644_10035393 Ga0207644_100353933 440
917 3300025932 Ga0207690_10000479 Ga0207690_1000047916 440
918 3300025933 Ga0207706_10012558 Ga0207706_100125584 440
919 3300025935 Ga0207709_10111637 Ga0207709_101116372 440
920 3300025936 Ga0207670_10105824 Ga0207670_101058242 440
921 3300025938 Ga0207704_10014938 Ga0207704_100149382 440
922 3300025940 Ga0207691_10037913 Ga0207691_100379132 440
923 3300025940 Ga0207691_10058242 Ga0207691_100582422 440
924 3300025941 Ga0207711_10055528 Ga0207711_100555282 440
925 3300025942 Ga0207689_10002446 Ga0207689_100024463 440
926 3300025945 Ga0207679_10001523 Ga0207679_100015235 440
927 3300025945 Ga0207679_10011900 Ga0207679_100119004 440
928 3300025945 Ga0207679_10092066 Ga0207679_100920662 440
929 3300025945 Ga0207679_10092234 Ga0207679_100922342 440
930 3300025949 Ga0207667_10005313 Ga0207667_1000531312 440
931 3300025949 Ga0207667_10045267 Ga0207667_100452673 440
932 3300025949 Ga0207667_10106192 Ga0207667_101061922 440
933 3300025960 Ga0207651_10176429 Ga0207651_101764292 440
934 3300025961 Ga0207712_10054459 Ga0207712_100544592 440
935 3300025972 Ga0207668_10027421 Ga0207668_100274211 440
936 3300025972 Ga0207668_10078678 Ga0207668_100786782 440
937 3300025986 Ga0207658_10020728 Ga0207658_100207283 440
938 3300025986 Ga0207658_10042139 Ga0207658_100421393 440
939 3300026035 Ga0207703_10040845 Ga0207703_100408452 440
940 3300026041 Ga0207639_10007516 Ga0207639_100075163 440
941 3300026041 Ga0207639_10076337 Ga0207639_100763372 440
942 3300026067 Ga0207678_10004104 Ga0207678_100041043 440
943 3300026067 Ga0207678_10086238 Ga0207678_100862382 440
944 3300026075 Ga0207708_10002209 Ga0207708_1000220915 440
945 3300026078 Ga0207702_10013149 Ga0207702_100131492 440
946 3300026078 Ga0207702_10014823 Ga0207702_100148234 440
947 3300026078 Ga0207702_10036335 Ga0207702_100363353 440
948 3300026089 Ga0207648_10010271 Ga0207648_100102717 440
949 3300026095 Ga0207676_10003822 Ga0207676_100038226 440
950 3300026116 Ga0207674_10012883 Ga0207674_100128833 440
951 3300026116 Ga0207674_10026949 Ga0207674_100269494 440
952 3300026118 Ga0207675_100013782 Ga0207675_1000137824 440
953 3300026121 Ga0207683_10003032 Ga0207683_100030328 440
954 3300026121 Ga0207683_10243245 Ga0207683_102432451 440
955 3300026142 Ga0207698_10005874 Ga0207698_100058745 440
956 3300026142 Ga0207698_10014584 Ga0207698_100145844 440
957 3300026142 Ga0207698_10025173 Ga0207698_100251735 440
958 3300027471 Ga0209995_1006264 Ga0209995_10062642 440
959 3300027682 Ga0209971_1001832 Ga0209971_10018323 440
960 3300027695 Ga0209966_1007433 Ga0209966_10074331 440
961 3300027717 Ga0209998_10006525 Ga0209998_100065252 440
962 3300027876 Ga0209974_10003602 Ga0209974_100036026 440
963 3300027876 Ga0209974_10006207 Ga0209974_100062073 440
964 3300028379 Ga0268266_10239306 Ga0268266_102393062 440
965 3300031548 Ga0307408_100014530 Ga0307408_1000145303 440
966 3300031852 Ga0307410_10003577 Ga0307410_100035776 440
967 3300031901 Ga0307406_10004541 Ga0307406_100045414 440
968 3300031903 Ga0307407_10015952 Ga0307407_100159522 440
969 3300031911 Ga0307412_10002089 Ga0307412_100020894 440
970 3300031995 Ga0307409_100002393 Ga0307409_1000023933 440
971 3300032002 Ga0307416_100003419 Ga0307416_1000034194 440
972 3300032126 Ga0307415_100001060 Ga0307415_1000010603 440
973 3300035695 Ga0373927_0110842 Ga0373927_0110842_266_1588 440
974 3300037466 Ga0395898_0025436 Ga0395898_0025436_1143_2471 440
975 3300037471 Ga0395905_0222069 Ga0395905_0222069_109_1434 440
976 3300038443 Ga0395901_0151691 Ga0395901_0151691_1087_2415 440
977 3300045051 Ga0451576_0246585 Ga0451576_0246585_67_1392 440
978 3300048903 Ga0496100_0068773 Ga0496100_0068773_914_2236 440
979 3300048905 Ga0496102_0000940 Ga0496102_0000940_19668_20993 440
980 3300048905 Ga0496102_0025725 Ga0496102_0025725_289_1611 440
981 3300048907 Ga0496104_0021309 Ga0496104_0021309_699_2021 440
982 3300048908 Ga0496105_0090658 Ga0496105_0090658_1005_2327 440
983 3300048909 Ga0496106_0026338 Ga0496106_0026338_2901_4226 440
984 3300048910 Ga0496107_0011010 Ga0496107_0011010_3343_4668 440
985 3300048911 Ga0496108_0073528 Ga0496108_0073528_693_2015 440
986 3300048912 Ga0496109_0001844 Ga0496109_0001844_10180_11502 440
987 3300048913 Ga0496110_0003683 Ga0496110_0003683_1239_2561 440

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10518

TAT_signal

TAT (twin-arginine translocation) pathway signal sequence

3

23

0.93

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

55

324

0.84

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

63

354

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r2f-assembly1.cif.gz_A crystal structure of sugar transporter achl_0255 from arthrobacter chlorophenolicus a6, target efi-510633, with bound laminaribiose 0.8451 43 435
5yse-assembly1.cif.gz_A crystal structure of beta-1,2-glucooligosaccharide binding protein in complex with sophorotetraose 0.8383 45 439
7c68-assembly1.cif.gz_B crystal structure of beta-glycosides-binding protein of abc transporter in a closed state bound to cellotetraose 0.8382 45 439
7c6x-assembly7.cif.gz_G crystal structure of beta-glycosides-binding protein (w41a) of abc transporter in an open state (form i) 0.8371 46 439
4r2f-assembly1.cif.gz_A crystal structure of sugar transporter achl_0255 from arthrobacter chlorophenolicus a6, target efi-510633, with bound laminaribiose 0.8332 43 435
ID Description Score Start End Superfamily
2gh9A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8238 45 389 3.40.190.10
af_P76042_18_428_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8143 44 437 3.40.190.10
5ysdB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8136 48 389 3.40.190.10
2gh9A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8119 45 389 3.40.190.10
5f7vA00 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7973 44 436 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A536UQ54-F1-model_v4 Extracellular solute-binding protein 0.9793 197 440
AF-A0A536UQ54-F1-model_v4 Extracellular solute-binding protein 0.9715 197 440
AF-A0A528TRZ0-F1-model_v4 Extracellular solute-binding protein 0.9689 150 318 GO:0042597
AF-U5N8S9-F1-model_v4 Sugar transporter substrate-binding protein 0.9669 36 440
AF-A0A2H5ZTE3-F1-model_v4 Putative ABC transporter-binding protein 0.9647 31 440

Feature Viewer

pLDDT pTM Quality
89.58 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map