F487551
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 987 | 389 | 972 | 439 |
Family's Representative Sequence
| Representative Sequence | 3300046455|Ga0495603_0056318|Ga0495603_0056318_935_2182 |
| Length | 410 |
| Sequence | MSEFKRRRFLKTSAGVAAAAAVGPMIWVKDANAQWRNTPEKGAKLRVLRWSRFVQGDIDQYMKNVAKFTEKTGIEVRIDNEGWEDVRPKAAVAANTGAGPDIILSTNDDANLYPEKLVDVTDVCTYLGAKYGGWYPVCDQYLKPDGKKWIGVPLGCAGNALVYRASMLKAAGFDKVPRDTDGFLKLCKALKEKNTPVGFALGNNKVVIDSPETIKALEYAKDLYATFVPGTLSWLDPNNNKAFLDSQISLTSNGISIYFAAKNATDPKVKELEADIFHSNFPIGPVGRPTEFNLFFNQMIFKYSKYPKAAKEFLRFMMEDEQVNPWVTASLGYVTPALTAYEKHPVWNDPKATPYRDSMKIMLPSGYAGKMGYASAGALADFIMVNMVAEAASGSKSPKEAKRAERYYKV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 4 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 5 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 6 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 7 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 8 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 9 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 10 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 11 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 12 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 13 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 14 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 15 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 16 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 17 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 18 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 19 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 20 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 59 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 84 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 90 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 91 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 92 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 93 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 96 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 97 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 98 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 127 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 216 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 217 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 218 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 220 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 221 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 222 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 223 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 224 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 225 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 227 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 229 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 230 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 231 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 232 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 233 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 234 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 235 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 236 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 237 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 238 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 239 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 240 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 242 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 243 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 245 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 247 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 249 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 250 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 251 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 252 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 253 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 254 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 257 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 258 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 259 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 260 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 261 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 262 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 263 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 264 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 265 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 266 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 267 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 268 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 269 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 270 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 271 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 272 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 273 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 274 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 275 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 276 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 277 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 278 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 279 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 280 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 281 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 282 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 324 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 325 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 326 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 327 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 328 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 331 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 332 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 333 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 334 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 335 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 336 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 337 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 338 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 339 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 340 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 341 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 354 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 355 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 356 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 357 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 358 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 359 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 360 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 366 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 368 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 369 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 370 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 371 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 372 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 373 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 374 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 375 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 376 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 377 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 378 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 379 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 380 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 381 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 382 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 383 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 384 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 385 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 386 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 387 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 388 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 389 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.48 |
| Metatranscriptomes | 0 |
| Isolates | 1.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.31 |
| Nodule | 0 |
| Rhizoplane | 2.43 |
| Rhizosphere | 84.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1008017 | 3300001977 | Bacteria | 1603 |
| 2 | JGI24743J22301_10001202 | 3300001991 | Bacteria | 3498 |
| 3 | JGI25152J39213_1002959 | 3300002773 | Bacteria | 6045 |
| 4 | JGI25153J46596_10009620 | 3300003215 | Bacteria | 4461 |
| 5 | Ga0055526_1007227 | 3300003771 | Bacteria | 5828 |
| 6 | Ga0055534_1002873 | 3300003784 | Bacteria | 5719 |
| 7 | Ga0055530_10003423 | 3300003791 | Bacteria | 9029 |
| 8 | Ga0065165_1001929 | 3300005262 | Bacteria | 19792 |
| 9 | Ga0070658_10142806 | 3300005327 | Bacteria | 2000 |
| 10 | Ga0070658_10175498 | 3300005327 | Bacteria | 1802 |
| 11 | Ga0070676_10002428 | 3300005328 | Bacteria | 9558 |
| 12 | Ga0070676_10076270 | 3300005328 | Bacteria | 2023 |
| 13 | Ga0070683_100026839 | 3300005329 | Bacteria | 5190 |
| 14 | Ga0070690_100002891 | 3300005330 | Bacteria | 9263 |
| 15 | Ga0070690_100051374 | 3300005330 | Bacteria | 2631 |
| 16 | Ga0070690_100126919 | 3300005330 | Bacteria | 1718 |
| 17 | Ga0070670_100000403 | 3300005331 | Bacteria | 35526 |
| 18 | Ga0070670_100002168 | 3300005331 | Bacteria | 16128 |
| 19 | Ga0070670_100012532 | 3300005331 | Bacteria | 7257 |
| 20 | Ga0070670_100109983 | 3300005331 | Bacteria | 2374 |
| 21 | Ga0070670_100170861 | 3300005331 | Bacteria | 1885 |
| 22 | Ga0070677_10002422 | 3300005333 | Bacteria | 5953 |
| 23 | Ga0070677_10031267 | 3300005333 | Bacteria | 2034 |
| 24 | Ga0068869_100044762 | 3300005334 | Bacteria | 3183 |
| 25 | Ga0068869_100053189 | 3300005334 | Bacteria | 2942 |
| 26 | Ga0068869_100054919 | 3300005334 | Bacteria | 2901 |
| 27 | Ga0070666_10001963 | 3300005335 | Bacteria | 12523 |
| 28 | Ga0070666_10003434 | 3300005335 | Bacteria | 9596 |
| 29 | Ga0070666_10028929 | 3300005335 | Bacteria | 3640 |
| 30 | Ga0070666_10037161 | 3300005335 | Bacteria | 3236 |
| 31 | Ga0070680_100004529 | 3300005336 | Bacteria | 10465 |
| 32 | Ga0070680_100009735 | 3300005336 | Bacteria | 7396 |
| 33 | Ga0070680_100049187 | 3300005336 | Bacteria | 3436 |
| 34 | Ga0068868_100005341 | 3300005338 | Bacteria | 9019 |
| 35 | Ga0068868_100005830 | 3300005338 | Bacteria | 8686 |
| 36 | Ga0068868_100055798 | 3300005338 | Bacteria | 3118 |
| 37 | Ga0068868_100063437 | 3300005338 | Bacteria | 2931 |
| 38 | Ga0068868_100063898 | 3300005338 | Bacteria | 2921 |
| 39 | Ga0068868_100121061 | 3300005338 | Bacteria | 2135 |
| 40 | Ga0068868_100157985 | 3300005338 | Bacteria | 1871 |
| 41 | Ga0068868_100176585 | 3300005338 | Bacteria | 1770 |
| 42 | Ga0070660_100027463 | 3300005339 | Bacteria | 4247 |
| 43 | Ga0070660_100040343 | 3300005339 | Bacteria | 3552 |
| 44 | Ga0070660_100043813 | 3300005339 | Bacteria | 3420 |
| 45 | Ga0070660_100193411 | 3300005339 | Bacteria | 1648 |
| 46 | Ga0070689_100001549 | 3300005340 | Bacteria | 14642 |
| 47 | Ga0070689_100029731 | 3300005340 | Bacteria | 4139 |
| 48 | Ga0070689_100040119 | 3300005340 | Bacteria | 3588 |
| 49 | Ga0070687_100021134 | 3300005343 | Bacteria | 3053 |
| 50 | Ga0070687_100026415 | 3300005343 | Bacteria | 2795 |
| 51 | Ga0070661_100004818 | 3300005344 | Bacteria | 9289 |
| 52 | Ga0070661_100026491 | 3300005344 | Bacteria | 4170 |
| 53 | Ga0070661_100048573 | 3300005344 | Bacteria | 3106 |
| 54 | Ga0070661_100059702 | 3300005344 | Bacteria | 2797 |
| 55 | Ga0070661_100149226 | 3300005344 | Bacteria | 1766 |
| 56 | Ga0070692_10075970 | 3300005345 | Bacteria | 1800 |
| 57 | Ga0070668_100032908 | 3300005347 | Bacteria | 3946 |
| 58 | Ga0070669_100001676 | 3300005353 | Bacteria | 16040 |
| 59 | Ga0070669_100036531 | 3300005353 | Bacteria | 3560 |
| 60 | Ga0070675_100000815 | 3300005354 | Bacteria | 21956 |
| 61 | Ga0070675_100001022 | 3300005354 | Bacteria | 20130 |
| 62 | Ga0070675_100015525 | 3300005354 | Bacteria | 6023 |
| 63 | Ga0070675_100031242 | 3300005354 | Bacteria | 4304 |
| 64 | Ga0070675_100151237 | 3300005354 | Bacteria | 1990 |
| 65 | Ga0070671_100006677 | 3300005355 | Bacteria | 9227 |
| 66 | Ga0070671_100007060 | 3300005355 | Bacteria | 8994 |
| 67 | Ga0070671_100014895 | 3300005355 | Bacteria | 6282 |
| 68 | Ga0070671_100016498 | 3300005355 | Bacteria | 5970 |
| 69 | Ga0070671_100019739 | 3300005355 | Bacteria | 5489 |
| 70 | Ga0070671_100026363 | 3300005355 | Bacteria | 4776 |
| 71 | Ga0070674_100001557 | 3300005356 | Bacteria | 12284 |
| 72 | Ga0070674_100003570 | 3300005356 | Bacteria | 8746 |
| 73 | Ga0070674_100009857 | 3300005356 | Bacteria | 5746 |
| 74 | Ga0070674_100013348 | 3300005356 | Bacteria | 5076 |
| 75 | Ga0070673_100001934 | 3300005364 | Bacteria | 12463 |
| 76 | Ga0070673_100014070 | 3300005364 | Bacteria | 5558 |
| 77 | Ga0070673_100015567 | 3300005364 | Bacteria | 5348 |
| 78 | Ga0070673_100032868 | 3300005364 | Bacteria | 3911 |
| 79 | Ga0070673_100034495 | 3300005364 | Bacteria | 3830 |
| 80 | Ga0070688_100001074 | 3300005365 | Bacteria | 13707 |
| 81 | Ga0070688_100009209 | 3300005365 | Bacteria | 5389 |
| 82 | Ga0070659_100002847 | 3300005366 | Bacteria | 12313 |
| 83 | Ga0070659_100019546 | 3300005366 | Bacteria | 5135 |
| 84 | Ga0070659_100028640 | 3300005366 | Bacteria | 4303 |
| 85 | Ga0070667_100012710 | 3300005367 | Bacteria | 6960 |
| 86 | Ga0070667_100014862 | 3300005367 | Bacteria | 6431 |
| 87 | Ga0070667_100032704 | 3300005367 | Bacteria | 4339 |
| 88 | Ga0070667_100083367 | 3300005367 | Bacteria | 2738 |
| 89 | Ga0070709_10013191 | 3300005434 | Bacteria | 4638 |
| 90 | Ga0070709_10016788 | 3300005434 | Bacteria | 4187 |
| 91 | Ga0070709_10027608 | 3300005434 | Bacteria | 3376 |
| 92 | Ga0070714_100244019 | 3300005435 | Bacteria | 1658 |
| 93 | Ga0070713_100000662 | 3300005436 | Bacteria | 22020 |
| 94 | Ga0070713_100038438 | 3300005436 | Bacteria | 3878 |
| 95 | Ga0070713_100144532 | 3300005436 | Bacteria | 2110 |
| 96 | Ga0070713_100167906 | 3300005436 | Bacteria | 1963 |
| 97 | Ga0070701_10006091 | 3300005438 | Bacteria | 5046 |
| 98 | Ga0070701_10047622 | 3300005438 | Bacteria | 2208 |
| 99 | Ga0070701_10063306 | 3300005438 | Bacteria | 1957 |
| 100 | Ga0070711_100016266 | 3300005439 | Bacteria | 4722 |
| 101 | Ga0070705_100100322 | 3300005440 | Bacteria | 1826 |
| 102 | Ga0070663_100024405 | 3300005455 | Bacteria | 4070 |
| 103 | Ga0070678_100001980 | 3300005456 | Bacteria | 11070 |
| 104 | Ga0070678_100005836 | 3300005456 | Bacteria | 7163 |
| 105 | Ga0070678_100013439 | 3300005456 | Bacteria | 5133 |
| 106 | Ga0070678_100028162 | 3300005456 | Bacteria | 3827 |
| 107 | Ga0070678_100058303 | 3300005456 | Bacteria | 2833 |
| 108 | Ga0070678_100158819 | 3300005456 | Bacteria | 1829 |
| 109 | Ga0070662_100001732 | 3300005457 | Bacteria | 13425 |
| 110 | Ga0070662_100004864 | 3300005457 | Bacteria | 8520 |
| 111 | Ga0070662_100010906 | 3300005457 | Bacteria | 5987 |
| 112 | Ga0070681_10009151 | 3300005458 | Bacteria | 9731 |
| 113 | Ga0070681_10226107 | 3300005458 | Bacteria | 1786 |
| 114 | Ga0068867_100011138 | 3300005459 | Bacteria | 6343 |
| 115 | Ga0068867_100026482 | 3300005459 | Bacteria | 4164 |
| 116 | Ga0068867_100038864 | 3300005459 | Bacteria | 3466 |
| 117 | Ga0068867_100047964 | 3300005459 | Bacteria | 3141 |
| 118 | Ga0068867_100065748 | 3300005459 | Bacteria | 2699 |
| 119 | Ga0070685_10001710 | 3300005466 | Bacteria | 11511 |
| 120 | Ga0070685_10002286 | 3300005466 | Bacteria | 9886 |
| 121 | Ga0070685_10010239 | 3300005466 | Bacteria | 4867 |
| 122 | Ga0070706_100001321 | 3300005467 | Bacteria | 26375 |
| 123 | Ga0070706_100046470 | 3300005467 | Bacteria | 4007 |
| 124 | Ga0070698_100100992 | 3300005471 | Bacteria | 2857 |
| 125 | Ga0070699_100010858 | 3300005518 | Bacteria | 7881 |
| 126 | Ga0070699_100034555 | 3300005518 | Bacteria | 4370 |
| 127 | Ga0070679_100002199 | 3300005530 | Bacteria | 17619 |
| 128 | Ga0070679_100034907 | 3300005530 | Bacteria | 4987 |
| 129 | Ga0070684_100087136 | 3300005535 | Bacteria | 2772 |
| 130 | Ga0070684_100182835 | 3300005535 | Bacteria | 1906 |
| 131 | Ga0068853_100016438 | 3300005539 | Bacteria | 6089 |
| 132 | Ga0068853_100062500 | 3300005539 | Bacteria | 3223 |
| 133 | Ga0068853_100069432 | 3300005539 | Bacteria | 3065 |
| 134 | Ga0068853_100291457 | 3300005539 | Bacteria | 1506 |
| 135 | Ga0070672_100001412 | 3300005543 | Bacteria | 14833 |
| 136 | Ga0070672_100001817 | 3300005543 | Bacteria | 13320 |
| 137 | Ga0070672_100008785 | 3300005543 | Bacteria | 6936 |
| 138 | Ga0070672_100013430 | 3300005543 | Bacteria | 5785 |
| 139 | Ga0070672_100016427 | 3300005543 | Bacteria | 5300 |
| 140 | Ga0070672_100031008 | 3300005543 | Bacteria | 4021 |
| 141 | Ga0070672_100066695 | 3300005543 | Bacteria | 2850 |
| 142 | Ga0070672_100066775 | 3300005543 | Bacteria | 2848 |
| 143 | Ga0070672_100097636 | 3300005543 | Bacteria | 2378 |
| 144 | Ga0070672_100173256 | 3300005543 | Bacteria | 1795 |
| 145 | Ga0070686_100051659 | 3300005544 | Bacteria | 2618 |
| 146 | Ga0070696_100001069 | 3300005546 | Bacteria | 17701 |
| 147 | Ga0070693_100005196 | 3300005547 | Bacteria | 6229 |
| 148 | Ga0070693_100034738 | 3300005547 | Bacteria | 2791 |
| 149 | Ga0070693_100035112 | 3300005547 | Bacteria | 2778 |
| 150 | Ga0070693_100092527 | 3300005547 | Bacteria | 1826 |
| 151 | Ga0070665_100003498 | 3300005548 | Bacteria | 16718 |
| 152 | Ga0070665_100006314 | 3300005548 | Bacteria | 12097 |
| 153 | Ga0070665_100029079 | 3300005548 | Bacteria | 5563 |
| 154 | Ga0070665_100030832 | 3300005548 | Bacteria | 5396 |
| 155 | Ga0070665_100041342 | 3300005548 | Bacteria | 4633 |
| 156 | Ga0070704_100030185 | 3300005549 | Bacteria | 3630 |
| 157 | Ga0070704_100084272 | 3300005549 | Bacteria | 2349 |
| 158 | Ga0068855_100001539 | 3300005563 | Bacteria | 28980 |
| 159 | Ga0068855_100007145 | 3300005563 | Bacteria | 13553 |
| 160 | Ga0068855_100036094 | 3300005563 | Bacteria | 5885 |
| 161 | Ga0068855_100061675 | 3300005563 | Bacteria | 4380 |
| 162 | Ga0070664_100004354 | 3300005564 | Bacteria | 11375 |
| 163 | Ga0070664_100019498 | 3300005564 | Bacteria | 5581 |
| 164 | Ga0070664_100020289 | 3300005564 | Bacteria | 5471 |
| 165 | Ga0070664_100020987 | 3300005564 | Bacteria | 5381 |
| 166 | Ga0070664_100035837 | 3300005564 | Bacteria | 4166 |
| 167 | Ga0070664_100054372 | 3300005564 | Bacteria | 3396 |
| 168 | Ga0070664_100073314 | 3300005564 | Bacteria | 2937 |
| 169 | Ga0070664_100199930 | 3300005564 | Bacteria | 1783 |
| 170 | Ga0068857_100035640 | 3300005577 | Bacteria | 4407 |
| 171 | Ga0068857_100130386 | 3300005577 | Bacteria | 2267 |
| 172 | Ga0068854_100003803 | 3300005578 | Bacteria | 9439 |
| 173 | Ga0068854_100006013 | 3300005578 | Bacteria | 7688 |
| 174 | Ga0068854_100022163 | 3300005578 | Bacteria | 4322 |
| 175 | Ga0068854_100035336 | 3300005578 | Bacteria | 3496 |
| 176 | Ga0068854_100037496 | 3300005578 | Bacteria | 3403 |
| 177 | Ga0068856_100000246 | 3300005614 | Bacteria | 59117 |
| 178 | Ga0068856_100041781 | 3300005614 | Bacteria | 4508 |
| 179 | Ga0068856_100046294 | 3300005614 | Bacteria | 4285 |
| 180 | Ga0068856_100053277 | 3300005614 | Bacteria | 3989 |
| 181 | Ga0068856_100057174 | 3300005614 | Bacteria | 3850 |
| 182 | Ga0068856_100092988 | 3300005614 | Bacteria | 3001 |
| 183 | Ga0068856_100167638 | 3300005614 | Bacteria | 2207 |
| 184 | Ga0070702_100003579 | 3300005615 | Bacteria | 6975 |
| 185 | Ga0070702_100008689 | 3300005615 | Bacteria | 4933 |
| 186 | Ga0070702_100116143 | 3300005615 | Bacteria | 1668 |
| 187 | Ga0068852_100018994 | 3300005616 | Bacteria | 5429 |
| 188 | Ga0068852_100099242 | 3300005616 | Bacteria | 2624 |
| 189 | Ga0068852_100114988 | 3300005616 | Bacteria | 2452 |
| 190 | Ga0068852_100118610 | 3300005616 | Bacteria | 2418 |
| 191 | Ga0068852_100260912 | 3300005616 | Bacteria | 1664 |
| 192 | Ga0068852_100262944 | 3300005616 | Bacteria | 1657 |
| 193 | Ga0068859_100000631 | 3300005617 | Bacteria | 35209 |
| 194 | Ga0068859_100002547 | 3300005617 | Bacteria | 18508 |
| 195 | Ga0068859_100054348 | 3300005617 | Bacteria | 4027 |
| 196 | Ga0068859_100178980 | 3300005617 | Bacteria | 2203 |
| 197 | Ga0068864_100000761 | 3300005618 | Bacteria | 27089 |
| 198 | Ga0068864_100001006 | 3300005618 | Bacteria | 23586 |
| 199 | Ga0068864_100015902 | 3300005618 | Bacteria | 6262 |
| 200 | Ga0068864_100032182 | 3300005618 | Bacteria | 4454 |
| 201 | Ga0068864_100084703 | 3300005618 | Bacteria | 2786 |
| 202 | Ga0068864_100097316 | 3300005618 | Bacteria | 2605 |
| 203 | Ga0068864_100100358 | 3300005618 | Bacteria | 2565 |
| 204 | Ga0068864_100137963 | 3300005618 | Bacteria | 2197 |
| 205 | Ga0068864_100208279 | 3300005618 | Bacteria | 1799 |
| 206 | Ga0068866_10001391 | 3300005718 | Bacteria | 10429 |
| 207 | Ga0068866_10005562 | 3300005718 | Bacteria | 5209 |
| 208 | Ga0068861_100003340 | 3300005719 | Bacteria | 10628 |
| 209 | Ga0068861_100021335 | 3300005719 | Bacteria | 4654 |
| 210 | Ga0068861_100233909 | 3300005719 | Bacteria | 1560 |
| 211 | Ga0068851_10003782 | 3300005834 | Bacteria | 6771 |
| 212 | Ga0068851_10014649 | 3300005834 | Bacteria | 3724 |
| 213 | Ga0068851_10016960 | 3300005834 | Bacteria | 3491 |
| 214 | Ga0068851_10020500 | 3300005834 | Bacteria | 3203 |
| 215 | Ga0068851_10028117 | 3300005834 | Bacteria | 2775 |
| 216 | Ga0068851_10051482 | 3300005834 | Bacteria | 2093 |
| 217 | Ga0068870_10004781 | 3300005840 | Bacteria | 5857 |
| 218 | Ga0068863_100001520 | 3300005841 | Bacteria | 22917 |
| 219 | Ga0068863_100028533 | 3300005841 | Bacteria | 5329 |
| 220 | Ga0068863_100071725 | 3300005841 | Bacteria | 3277 |
| 221 | Ga0068863_100074661 | 3300005841 | Bacteria | 3208 |
| 222 | Ga0068863_100110582 | 3300005841 | Bacteria | 2617 |
| 223 | Ga0068863_100110598 | 3300005841 | Bacteria | 2616 |
| 224 | Ga0068858_100001003 | 3300005842 | Bacteria | 29188 |
| 225 | Ga0068858_100002479 | 3300005842 | Bacteria | 18626 |
| 226 | Ga0068858_100004428 | 3300005842 | Bacteria | 13776 |
| 227 | Ga0068858_100006624 | 3300005842 | Bacteria | 11271 |
| 228 | Ga0068858_100026455 | 3300005842 | Bacteria | 5389 |
| 229 | Ga0068860_100008652 | 3300005843 | Bacteria | 10141 |
| 230 | Ga0068860_100011471 | 3300005843 | Bacteria | 8732 |
| 231 | Ga0068860_100012688 | 3300005843 | Bacteria | 8289 |
| 232 | Ga0068860_100022329 | 3300005843 | Bacteria | 6122 |
| 233 | Ga0068860_100147030 | 3300005843 | Bacteria | 2268 |
| 234 | Ga0068860_100221933 | 3300005843 | Bacteria | 1835 |
| 235 | Ga0068862_100033069 | 3300005844 | Bacteria | 4368 |
| 236 | Ga0081539_10007328 | 3300005985 | Bacteria | 10119 |
| 237 | Ga0081539_10028541 | 3300005985 | Bacteria | 3506 |
| 238 | Ga0075365_10013462 | 3300006038 | Bacteria | 4894 |
| 239 | Ga0075365_10013860 | 3300006038 | Bacteria | 4835 |
| 240 | Ga0075368_10003480 | 3300006042 | Bacteria | 5264 |
| 241 | Ga0075363_100002634 | 3300006048 | Bacteria | 7396 |
| 242 | Ga0075432_10018964 | 3300006058 | Bacteria | 2348 |
| 243 | Ga0070712_100005788 | 3300006175 | Bacteria | 7641 |
| 244 | Ga0070712_100070848 | 3300006175 | Bacteria | 2492 |
| 245 | Ga0075362_10027810 | 3300006177 | Bacteria | 2423 |
| 246 | Ga0075367_10002281 | 3300006178 | Bacteria | 8698 |
| 247 | Ga0075367_10073532 | 3300006178 | Bacteria | 2060 |
| 248 | Ga0075366_10002262 | 3300006195 | Bacteria | 9834 |
| 249 | Ga0075366_10023241 | 3300006195 | Bacteria | 3611 |
| 250 | Ga0075366_10069410 | 3300006195 | Bacteria | 2097 |
| 251 | Ga0075366_10102696 | 3300006195 | Bacteria | 1716 |
| 252 | Ga0097621_100007405 | 3300006237 | Bacteria | 7850 |
| 253 | Ga0097621_100013201 | 3300006237 | Bacteria | 6146 |
| 254 | Ga0097621_100031564 | 3300006237 | Bacteria | 4205 |
| 255 | Ga0097621_100049274 | 3300006237 | Bacteria | 3421 |
| 256 | Ga0097621_100057987 | 3300006237 | Bacteria | 3168 |
| 257 | Ga0097621_100059916 | 3300006237 | Bacteria | 3118 |
| 258 | Ga0097621_100312814 | 3300006237 | Bacteria | 1389 |
| 259 | Ga0075370_10001313 | 3300006353 | Bacteria | 10640 |
| 260 | Ga0075370_10016975 | 3300006353 | Bacteria | 3926 |
| 261 | Ga0075370_10037289 | 3300006353 | Bacteria | 2732 |
| 262 | Ga0068871_100004805 | 3300006358 | Bacteria | 9449 |
| 263 | Ga0068871_100023358 | 3300006358 | Bacteria | 4781 |
| 264 | Ga0068871_100058376 | 3300006358 | Bacteria | 3141 |
| 265 | Ga0068871_100097150 | 3300006358 | Bacteria | 2462 |
| 266 | Ga0068871_100105397 | 3300006358 | Bacteria | 2366 |
| 267 | Ga0075428_100116605 | 3300006844 | Bacteria | 2908 |
| 268 | Ga0068865_100003331 | 3300006881 | Bacteria | 9618 |
| 269 | Ga0068865_100074351 | 3300006881 | Bacteria | 2419 |
| 270 | Ga0068865_100080660 | 3300006881 | Bacteria | 2334 |
| 271 | Ga0075436_100068140 | 3300006914 | Bacteria | 2459 |
| 272 | Ga0097620_100000631 | 3300006931 | Bacteria | 35209 |
| 273 | Ga0097620_100002547 | 3300006931 | Bacteria | 18508 |
| 274 | Ga0097620_100054342 | 3300006931 | Bacteria | 4027 |
| 275 | Ga0097620_100178976 | 3300006931 | Bacteria | 2203 |
| 276 | Ga0099794_10004769 | 3300007265 | Bacteria | 5375 |
| 277 | Ga0105240_10009479 | 3300009093 | Bacteria | 13784 |
| 278 | Ga0105240_10010648 | 3300009093 | Bacteria | 12915 |
| 279 | Ga0105240_10044820 | 3300009093 | Bacteria | 5616 |
| 280 | Ga0105240_10053996 | 3300009093 | Bacteria | 5038 |
| 281 | Ga0105240_10153052 | 3300009093 | Bacteria | 2745 |
| 282 | Ga0105245_10013089 | 3300009098 | Bacteria | 7227 |
| 283 | Ga0105245_10016169 | 3300009098 | Bacteria | 6502 |
| 284 | Ga0105245_10118727 | 3300009098 | Bacteria | 2468 |
| 285 | Ga0105245_10133467 | 3300009098 | Bacteria | 2331 |
| 286 | Ga0105245_10348823 | 3300009098 | Bacteria | 1466 |
| 287 | Ga0105241_10007643 | 3300009174 | Bacteria | 7946 |
| 288 | Ga0105241_10011568 | 3300009174 | Bacteria | 6470 |
| 289 | Ga0105242_10033379 | 3300009176 | Bacteria | 4120 |
| 290 | Ga0105242_10034458 | 3300009176 | Bacteria | 4058 |
| 291 | Ga0105248_10007014 | 3300009177 | Bacteria | 12338 |
| 292 | Ga0105248_10079735 | 3300009177 | Bacteria | 3679 |
| 293 | Ga0105248_10194288 | 3300009177 | Bacteria | 2286 |
| 294 | Ga0105248_10200385 | 3300009177 | Bacteria | 2249 |
| 295 | Ga0105248_10241428 | 3300009177 | Bacteria | 2034 |
| 296 | Ga0105237_10110770 | 3300009545 | Bacteria | 2737 |
| 297 | Ga0105237_10129281 | 3300009545 | Bacteria | 2520 |
| 298 | Ga0105238_10006338 | 3300009551 | Bacteria | 11764 |
| 299 | Ga0105238_10012746 | 3300009551 | Bacteria | 8486 |
| 300 | Ga0105238_10018081 | 3300009551 | Bacteria | 7166 |
| 301 | Ga0105249_10080759 | 3300009553 | Bacteria | 3022 |
| 302 | Ga0105249_10102216 | 3300009553 | Bacteria | 2697 |
| 303 | Ga0105239_10121432 | 3300010375 | Bacteria | 2902 |
| 304 | Ga0157373_10013160 | 3300013100 | Bacteria | 6072 |
| 305 | Ga0157373_10030428 | 3300013100 | Bacteria | 3885 |
| 306 | Ga0157373_10038402 | 3300013100 | Bacteria | 3432 |
| 307 | Ga0157371_10002555 | 3300013102 | Bacteria | 17267 |
| 308 | Ga0157370_10004306 | 3300013104 | Bacteria | 16359 |
| 309 | Ga0157370_10009815 | 3300013104 | Bacteria | 10150 |
| 310 | Ga0157370_10096408 | 3300013104 | Bacteria | 2775 |
| 311 | Ga0157370_10108106 | 3300013104 | Bacteria | 2601 |
| 312 | Ga0157369_10008064 | 3300013105 | Bacteria | 12076 |
| 313 | Ga0157369_10097638 | 3300013105 | Bacteria | 3134 |
| 314 | Ga0157369_10104750 | 3300013105 | Bacteria | 3012 |
| 315 | Ga0157369_10152905 | 3300013105 | Bacteria | 2439 |
| 316 | Ga0157374_10001315 | 3300013296 | Bacteria | 21157 |
| 317 | Ga0157374_10008118 | 3300013296 | Bacteria | 8972 |
| 318 | Ga0157374_10030270 | 3300013296 | Bacteria | 4912 |
| 319 | Ga0157378_10006295 | 3300013297 | Bacteria | 10398 |
| 320 | Ga0157378_10014395 | 3300013297 | Bacteria | 6925 |
| 321 | Ga0157378_10146599 | 3300013297 | Bacteria | 2196 |
| 322 | Ga0157378_10186571 | 3300013297 | Bacteria | 1954 |
| 323 | Ga0157378_10236891 | 3300013297 | Bacteria | 1742 |
| 324 | Ga0163162_10003915 | 3300013306 | Bacteria | 14297 |
| 325 | Ga0163162_10006607 | 3300013306 | Bacteria | 11234 |
| 326 | Ga0163162_10016098 | 3300013306 | Bacteria | 7309 |
| 327 | Ga0163162_10100693 | 3300013306 | Bacteria | 2981 |
| 328 | Ga0163162_10102649 | 3300013306 | Bacteria | 2953 |
| 329 | Ga0163162_10140260 | 3300013306 | Bacteria | 2530 |
| 330 | Ga0157372_10000342 | 3300013307 | Bacteria | 51414 |
| 331 | Ga0157372_10104769 | 3300013307 | Bacteria | 3234 |
| 332 | Ga0157372_10121816 | 3300013307 | Bacteria | 2997 |
| 333 | Ga0157372_10286269 | 3300013307 | Bacteria | 1916 |
| 334 | Ga0157375_10003025 | 3300013308 | Bacteria | 14585 |
| 335 | Ga0157375_10100843 | 3300013308 | Bacteria | 2969 |
| 336 | Ga0157375_10124421 | 3300013308 | Bacteria | 2692 |
| 337 | Ga0157375_10156839 | 3300013308 | Bacteria | 2415 |
| 338 | Ga0163163_10000467 | 3300014325 | Bacteria | 36905 |
| 339 | Ga0163163_10004530 | 3300014325 | Bacteria | 11864 |
| 340 | Ga0163163_10007271 | 3300014325 | Bacteria | 9765 |
| 341 | Ga0157380_10011483 | 3300014326 | Bacteria | 6402 |
| 342 | Ga0157380_10080513 | 3300014326 | Bacteria | 2662 |
| 343 | Ga0182008_10000654 | 3300014497 | Bacteria | 25278 |
| 344 | Ga0182008_10001019 | 3300014497 | Bacteria | 19443 |
| 345 | Ga0182008_10026911 | 3300014497 | Bacteria | 2915 |
| 346 | Ga0157377_10001599 | 3300014745 | Bacteria | 9860 |
| 347 | Ga0157379_10001988 | 3300014968 | Bacteria | 16918 |
| 348 | Ga0157379_10006045 | 3300014968 | Bacteria | 10426 |
| 349 | Ga0157379_10009277 | 3300014968 | Bacteria | 8565 |
| 350 | Ga0157379_10052111 | 3300014968 | Bacteria | 3655 |
| 351 | Ga0157379_10072578 | 3300014968 | Bacteria | 3080 |
| 352 | Ga0157379_10079548 | 3300014968 | Bacteria | 2935 |
| 353 | Ga0157379_10151461 | 3300014968 | Bacteria | 2092 |
| 354 | Ga0157376_10011104 | 3300014969 | Bacteria | 6624 |
| 355 | Ga0157376_10016382 | 3300014969 | Bacteria | 5626 |
| 356 | Ga0157376_10079159 | 3300014969 | Bacteria | 2817 |
| 357 | Ga0157376_10107010 | 3300014969 | Bacteria | 2454 |
| 358 | Ga0157376_10111753 | 3300014969 | Bacteria | 2406 |
| 359 | Ga0182007_10001610 | 3300015262 | Bacteria | 11983 |
| 360 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 361 | Ga0163161_10000606 | 3300017792 | Bacteria | 28652 |
| 362 | Ga0163161_10019038 | 3300017792 | Bacteria | 4813 |
| 363 | Ga0163161_10046116 | 3300017792 | Bacteria | 3144 |
| 364 | Ga0163161_10057062 | 3300017792 | Bacteria | 2837 |
| 365 | Ga0163161_10106728 | 3300017792 | Bacteria | 2090 |
| 366 | Ga0207425_1000448 | 3300025245 | Bacteria | 26903 |
| 367 | Ga0209129_1000124 | 3300025258 | Bacteria | 133610 |
| 368 | Ga0209673_1004568 | 3300025273 | Bacteria | 7350 |
| 369 | Ga0209673_1024574 | 3300025273 | Bacteria | 2021 |
| 370 | Ga0209130_1005106 | 3300025284 | Bacteria | 4677 |
| 371 | Ga0209675_1001148 | 3300025291 | Bacteria | 16132 |
| 372 | Ga0209676_1006751 | 3300025292 | Bacteria | 5580 |
| 373 | Ga0209564_1000057 | 3300025295 | Bacteria | 340400 |
| 374 | Ga0209758_1000214 | 3300025297 | Bacteria | 126364 |
| 375 | Ga0209758_1000232 | 3300025297 | Bacteria | 117382 |
| 376 | Ga0209050_1000268 | 3300025298 | Bacteria | 111281 |
| 377 | Ga0209051_1010377 | 3300025303 | Bacteria | 4714 |
| 378 | Ga0209051_1012907 | 3300025303 | Bacteria | 4010 |
| 379 | Ga0209257_1007196 | 3300025304 | Bacteria | 6828 |
| 380 | Ga0207697_10008831 | 3300025315 | Bacteria | 4385 |
| 381 | Ga0207656_10004085 | 3300025321 | Bacteria | 5064 |
| 382 | Ga0207656_10008628 | 3300025321 | Bacteria | 3758 |
| 383 | Ga0207656_10063340 | 3300025321 | Bacteria | 1627 |
| 384 | Ga0207682_10000068 | 3300025893 | Bacteria | 45481 |
| 385 | Ga0207682_10001129 | 3300025893 | Bacteria | 12342 |
| 386 | Ga0207682_10001755 | 3300025893 | Bacteria | 9950 |
| 387 | Ga0207682_10017681 | 3300025893 | Bacteria | 2784 |
| 388 | Ga0207688_10022024 | 3300025901 | Bacteria | 3486 |
| 389 | Ga0207688_10042276 | 3300025901 | Bacteria | 2537 |
| 390 | Ga0207688_10060234 | 3300025901 | Bacteria | 2138 |
| 391 | Ga0207680_10000777 | 3300025903 | Bacteria | 15079 |
| 392 | Ga0207680_10003229 | 3300025903 | Bacteria | 7672 |
| 393 | Ga0207680_10041827 | 3300025903 | Bacteria | 2677 |
| 394 | Ga0207680_10042713 | 3300025903 | Bacteria | 2654 |
| 395 | Ga0207645_10001270 | 3300025907 | Bacteria | 20763 |
| 396 | Ga0207645_10001926 | 3300025907 | Bacteria | 16746 |
| 397 | Ga0207645_10003904 | 3300025907 | Bacteria | 11142 |
| 398 | Ga0207645_10049844 | 3300025907 | Bacteria | 2674 |
| 399 | Ga0207645_10148028 | 3300025907 | Bacteria | 1532 |
| 400 | Ga0207643_10000298 | 3300025908 | Bacteria | 34305 |
| 401 | Ga0207643_10015505 | 3300025908 | Bacteria | 4148 |
| 402 | Ga0207643_10143358 | 3300025908 | Bacteria | 1428 |
| 403 | Ga0207705_10108792 | 3300025909 | Bacteria | 2046 |
| 404 | Ga0207705_10134555 | 3300025909 | Bacteria | 1842 |
| 405 | Ga0207684_10040849 | 3300025910 | Bacteria | 3932 |
| 406 | Ga0207654_10008668 | 3300025911 | Bacteria | 5154 |
| 407 | Ga0207654_10009118 | 3300025911 | Bacteria | 5033 |
| 408 | Ga0207707_10014602 | 3300025912 | Bacteria | 6842 |
| 409 | Ga0207707_10092742 | 3300025912 | Bacteria | 2639 |
| 410 | Ga0207707_10130569 | 3300025912 | Bacteria | 2197 |
| 411 | Ga0207707_10167325 | 3300025912 | Bacteria | 1921 |
| 412 | Ga0207695_10049214 | 3300025913 | Bacteria | 4445 |
| 413 | Ga0207695_10077536 | 3300025913 | Bacteria | 3375 |
| 414 | Ga0207695_10106163 | 3300025913 | Bacteria | 2795 |
| 415 | Ga0207695_10110776 | 3300025913 | Bacteria | 2725 |
| 416 | Ga0207671_10163484 | 3300025914 | Bacteria | 1725 |
| 417 | Ga0207693_10028327 | 3300025915 | Bacteria | 4426 |
| 418 | Ga0207693_10172725 | 3300025915 | Bacteria | 1701 |
| 419 | Ga0207663_10014144 | 3300025916 | Bacteria | 4362 |
| 420 | Ga0207660_10007424 | 3300025917 | Bacteria | 7092 |
| 421 | Ga0207660_10010630 | 3300025917 | Bacteria | 5980 |
| 422 | Ga0207660_10187497 | 3300025917 | Bacteria | 1609 |
| 423 | Ga0207662_10000764 | 3300025918 | Bacteria | 14771 |
| 424 | Ga0207662_10005747 | 3300025918 | Bacteria | 6638 |
| 425 | Ga0207662_10060376 | 3300025918 | Bacteria | 2274 |
| 426 | Ga0207662_10061703 | 3300025918 | Bacteria | 2251 |
| 427 | Ga0207657_10000738 | 3300025919 | Bacteria | 34692 |
| 428 | Ga0207657_10000884 | 3300025919 | Bacteria | 31683 |
| 429 | Ga0207657_10004460 | 3300025919 | Bacteria | 14814 |
| 430 | Ga0207657_10013043 | 3300025919 | Bacteria | 8167 |
| 431 | Ga0207657_10152786 | 3300025919 | Bacteria | 1879 |
| 432 | Ga0207649_10013416 | 3300025920 | Bacteria | 4575 |
| 433 | Ga0207649_10044347 | 3300025920 | Bacteria | 2722 |
| 434 | Ga0207649_10104174 | 3300025920 | Bacteria | 1883 |
| 435 | Ga0207652_10005535 | 3300025921 | Bacteria | 10239 |
| 436 | Ga0207652_10023610 | 3300025921 | Bacteria | 5096 |
| 437 | Ga0207652_10046991 | 3300025921 | Bacteria | 3686 |
| 438 | Ga0207646_10111752 | 3300025922 | Bacteria | 2452 |
| 439 | Ga0207646_10178582 | 3300025922 | Bacteria | 1917 |
| 440 | Ga0207681_10000771 | 3300025923 | Bacteria | 21062 |
| 441 | Ga0207681_10025743 | 3300025923 | Bacteria | 3787 |
| 442 | Ga0207681_10032191 | 3300025923 | Bacteria | 3431 |
| 443 | Ga0207681_10049263 | 3300025923 | Bacteria | 2847 |
| 444 | Ga0207681_10063287 | 3300025923 | Bacteria | 2550 |
| 445 | Ga0207681_10086338 | 3300025923 | Bacteria | 2229 |
| 446 | Ga0207694_10036099 | 3300025924 | Bacteria | 3792 |
| 447 | Ga0207694_10040036 | 3300025924 | Bacteria | 3608 |
| 448 | Ga0207650_10000408 | 3300025925 | Bacteria | 38515 |
| 449 | Ga0207650_10000560 | 3300025925 | Bacteria | 30230 |
| 450 | Ga0207650_10000654 | 3300025925 | Bacteria | 27396 |
| 451 | Ga0207650_10001998 | 3300025925 | Bacteria | 14283 |
| 452 | Ga0207650_10041784 | 3300025925 | Bacteria | 3361 |
| 453 | Ga0207650_10047393 | 3300025925 | Bacteria | 3167 |
| 454 | Ga0207650_10088947 | 3300025925 | Bacteria | 2356 |
| 455 | Ga0207659_10000256 | 3300025926 | Bacteria | 32624 |
| 456 | Ga0207659_10002052 | 3300025926 | Bacteria | 11958 |
| 457 | Ga0207659_10006382 | 3300025926 | Bacteria | 7222 |
| 458 | Ga0207659_10022714 | 3300025926 | Bacteria | 4179 |
| 459 | Ga0207687_10007275 | 3300025927 | Bacteria | 7300 |
| 460 | Ga0207687_10014865 | 3300025927 | Bacteria | 5098 |
| 461 | Ga0207687_10083957 | 3300025927 | Bacteria | 2307 |
| 462 | Ga0207700_10107854 | 3300025928 | Bacteria | 2235 |
| 463 | Ga0207664_10008503 | 3300025929 | Bacteria | 7166 |
| 464 | Ga0207664_10016442 | 3300025929 | Bacteria | 5397 |
| 465 | Ga0207664_10032639 | 3300025929 | Bacteria | 3994 |
| 466 | Ga0207644_10000392 | 3300025931 | Bacteria | 28471 |
| 467 | Ga0207644_10000817 | 3300025931 | Bacteria | 19790 |
| 468 | Ga0207644_10002297 | 3300025931 | Bacteria | 12399 |
| 469 | Ga0207644_10004537 | 3300025931 | Bacteria | 9023 |
| 470 | Ga0207644_10014072 | 3300025931 | Bacteria | 5349 |
| 471 | Ga0207644_10015516 | 3300025931 | Bacteria | 5115 |
| 472 | Ga0207644_10022491 | 3300025931 | Bacteria | 4308 |
| 473 | Ga0207644_10035393 | 3300025931 | Bacteria | 3498 |
| 474 | Ga0207644_10073669 | 3300025931 | Bacteria | 2504 |
| 475 | Ga0207644_10104303 | 3300025931 | Bacteria | 2134 |
| 476 | Ga0207644_10184693 | 3300025931 | Bacteria | 1636 |
| 477 | Ga0207690_10000479 | 3300025932 | Bacteria | 25747 |
| 478 | Ga0207690_10008231 | 3300025932 | Bacteria | 6185 |
| 479 | Ga0207706_10011643 | 3300025933 | Bacteria | 8017 |
| 480 | Ga0207706_10012558 | 3300025933 | Bacteria | 7712 |
| 481 | Ga0207706_10033969 | 3300025933 | Bacteria | 4539 |
| 482 | Ga0207706_10072621 | 3300025933 | Bacteria | 3026 |
| 483 | Ga0207686_10005871 | 3300025934 | Bacteria | 6589 |
| 484 | Ga0207686_10008914 | 3300025934 | Bacteria | 5428 |
| 485 | Ga0207686_10040244 | 3300025934 | Bacteria | 2841 |
| 486 | Ga0207686_10102922 | 3300025934 | Bacteria | 1910 |
| 487 | Ga0207709_10013260 | 3300025935 | Bacteria | 4547 |
| 488 | Ga0207709_10111637 | 3300025935 | Bacteria | 1829 |
| 489 | Ga0207670_10001589 | 3300025936 | Bacteria | 11878 |
| 490 | Ga0207670_10066152 | 3300025936 | Bacteria | 2482 |
| 491 | Ga0207670_10105824 | 3300025936 | Bacteria | 2017 |
| 492 | Ga0207669_10007148 | 3300025937 | Bacteria | 5141 |
| 493 | Ga0207669_10049261 | 3300025937 | Bacteria | 2509 |
| 494 | Ga0207669_10074826 | 3300025937 | Bacteria | 2143 |
| 495 | Ga0207669_10104194 | 3300025937 | Bacteria | 1883 |
| 496 | Ga0207704_10006681 | 3300025938 | Bacteria | 5403 |
| 497 | Ga0207704_10014938 | 3300025938 | Bacteria | 3941 |
| 498 | Ga0207665_10046917 | 3300025939 | Bacteria | 2895 |
| 499 | Ga0207691_10000360 | 3300025940 | Bacteria | 45895 |
| 500 | Ga0207691_10010241 | 3300025940 | Bacteria | 8995 |
| 501 | Ga0207691_10012083 | 3300025940 | Bacteria | 8281 |
| 502 | Ga0207691_10037913 | 3300025940 | Bacteria | 4461 |
| 503 | Ga0207691_10055015 | 3300025940 | Bacteria | 3628 |
| 504 | Ga0207691_10058242 | 3300025940 | Bacteria | 3514 |
| 505 | Ga0207691_10065131 | 3300025940 | Bacteria | 3300 |
| 506 | Ga0207691_10065404 | 3300025940 | Bacteria | 3291 |
| 507 | Ga0207711_10000260 | 3300025941 | Bacteria | 57379 |
| 508 | Ga0207711_10012387 | 3300025941 | Bacteria | 7089 |
| 509 | Ga0207711_10032815 | 3300025941 | Bacteria | 4392 |
| 510 | Ga0207711_10055528 | 3300025941 | Bacteria | 3400 |
| 511 | Ga0207711_10108107 | 3300025941 | Bacteria | 2470 |
| 512 | Ga0207711_10220736 | 3300025941 | Bacteria | 1734 |
| 513 | Ga0207689_10002446 | 3300025942 | Bacteria | 17304 |
| 514 | Ga0207689_10007734 | 3300025942 | Bacteria | 9407 |
| 515 | Ga0207689_10067369 | 3300025942 | Bacteria | 2942 |
| 516 | Ga0207689_10131192 | 3300025942 | Bacteria | 2062 |
| 517 | Ga0207661_10055317 | 3300025944 | Bacteria | 3182 |
| 518 | Ga0207661_10241976 | 3300025944 | Bacteria | 1601 |
| 519 | Ga0207679_10001523 | 3300025945 | Bacteria | 14496 |
| 520 | Ga0207679_10011900 | 3300025945 | Bacteria | 5655 |
| 521 | Ga0207679_10092066 | 3300025945 | Bacteria | 2348 |
| 522 | Ga0207679_10092234 | 3300025945 | Bacteria | 2346 |
| 523 | Ga0207679_10158499 | 3300025945 | Bacteria | 1850 |
| 524 | Ga0207679_10203714 | 3300025945 | Bacteria | 1654 |
| 525 | Ga0207667_10005313 | 3300025949 | Bacteria | 15693 |
| 526 | Ga0207667_10045267 | 3300025949 | Bacteria | 4661 |
| 527 | Ga0207667_10106192 | 3300025949 | Bacteria | 2897 |
| 528 | Ga0207667_10177740 | 3300025949 | Bacteria | 2186 |
| 529 | Ga0207667_10191303 | 3300025949 | Bacteria | 2100 |
| 530 | Ga0207651_10000554 | 3300025960 | Bacteria | 15685 |
| 531 | Ga0207651_10008778 | 3300025960 | Bacteria | 5484 |
| 532 | Ga0207651_10013533 | 3300025960 | Bacteria | 4672 |
| 533 | Ga0207651_10013580 | 3300025960 | Bacteria | 4667 |
| 534 | Ga0207651_10020777 | 3300025960 | Bacteria | 3971 |
| 535 | Ga0207651_10025601 | 3300025960 | Bacteria | 3670 |
| 536 | Ga0207651_10094781 | 3300025960 | Bacteria | 2196 |
| 537 | Ga0207651_10115487 | 3300025960 | Bacteria | 2024 |
| 538 | Ga0207651_10176429 | 3300025960 | Bacteria | 1690 |
| 539 | Ga0207712_10054459 | 3300025961 | Bacteria | 2810 |
| 540 | Ga0207668_10008779 | 3300025972 | Bacteria | 6038 |
| 541 | Ga0207668_10020784 | 3300025972 | Bacteria | 4178 |
| 542 | Ga0207668_10025745 | 3300025972 | Bacteria | 3811 |
| 543 | Ga0207668_10027421 | 3300025972 | Bacteria | 3709 |
| 544 | Ga0207668_10078678 | 3300025972 | Bacteria | 2382 |
| 545 | Ga0207668_10196923 | 3300025972 | Bacteria | 1601 |
| 546 | Ga0207640_10024716 | 3300025981 | Bacteria | 3629 |
| 547 | Ga0207640_10059192 | 3300025981 | Bacteria | 2527 |
| 548 | Ga0207640_10090010 | 3300025981 | Bacteria | 2122 |
| 549 | Ga0207640_10225607 | 3300025981 | Bacteria | 1437 |
| 550 | Ga0207658_10000818 | 3300025986 | Bacteria | 25979 |
| 551 | Ga0207658_10001915 | 3300025986 | Bacteria | 15548 |
| 552 | Ga0207658_10002797 | 3300025986 | Bacteria | 12556 |
| 553 | Ga0207658_10003185 | 3300025986 | Bacteria | 11693 |
| 554 | Ga0207658_10016161 | 3300025986 | Bacteria | 5128 |
| 555 | Ga0207658_10020728 | 3300025986 | Bacteria | 4554 |
| 556 | Ga0207658_10042139 | 3300025986 | Bacteria | 3309 |
| 557 | Ga0207658_10051485 | 3300025986 | Bacteria | 3035 |
| 558 | Ga0207658_10072467 | 3300025986 | Bacteria | 2611 |
| 559 | Ga0207658_10080115 | 3300025986 | Bacteria | 2500 |
| 560 | Ga0207677_10000160 | 3300026023 | Bacteria | 53532 |
| 561 | Ga0207677_10006603 | 3300026023 | Bacteria | 6364 |
| 562 | Ga0207677_10018163 | 3300026023 | Bacteria | 4215 |
| 563 | Ga0207677_10022471 | 3300026023 | Bacteria | 3877 |
| 564 | Ga0207677_10089631 | 3300026023 | Bacteria | 2233 |
| 565 | Ga0207677_10121386 | 3300026023 | Bacteria | 1966 |
| 566 | Ga0207703_10000668 | 3300026035 | Bacteria | 34245 |
| 567 | Ga0207703_10001037 | 3300026035 | Bacteria | 26605 |
| 568 | Ga0207703_10003675 | 3300026035 | Bacteria | 12785 |
| 569 | Ga0207703_10017240 | 3300026035 | Bacteria | 5637 |
| 570 | Ga0207703_10040845 | 3300026035 | Bacteria | 3714 |
| 571 | Ga0207703_10098713 | 3300026035 | Bacteria | 2470 |
| 572 | Ga0207639_10007516 | 3300026041 | Bacteria | 7432 |
| 573 | Ga0207639_10076337 | 3300026041 | Bacteria | 2638 |
| 574 | Ga0207639_10082999 | 3300026041 | Bacteria | 2542 |
| 575 | Ga0207678_10004104 | 3300026067 | Bacteria | 13098 |
| 576 | Ga0207678_10024482 | 3300026067 | Bacteria | 5273 |
| 577 | Ga0207678_10065216 | 3300026067 | Bacteria | 3128 |
| 578 | Ga0207678_10073364 | 3300026067 | Bacteria | 2933 |
| 579 | Ga0207678_10086238 | 3300026067 | Bacteria | 2683 |
| 580 | Ga0207708_10002209 | 3300026075 | Bacteria | 14387 |
| 581 | Ga0207708_10129850 | 3300026075 | Bacteria | 1970 |
| 582 | Ga0207708_10156639 | 3300026075 | Bacteria | 1796 |
| 583 | Ga0207702_10008513 | 3300026078 | Bacteria | 8649 |
| 584 | Ga0207702_10013149 | 3300026078 | Bacteria | 6882 |
| 585 | Ga0207702_10014823 | 3300026078 | Bacteria | 6465 |
| 586 | Ga0207702_10021062 | 3300026078 | Bacteria | 5396 |
| 587 | Ga0207702_10036335 | 3300026078 | Bacteria | 4120 |
| 588 | Ga0207702_10048102 | 3300026078 | Bacteria | 3596 |
| 589 | Ga0207641_10015742 | 3300026088 | Bacteria | 6196 |
| 590 | Ga0207641_10016641 | 3300026088 | Bacteria | 6020 |
| 591 | Ga0207641_10020425 | 3300026088 | Bacteria | 5439 |
| 592 | Ga0207641_10064469 | 3300026088 | Bacteria | 3131 |
| 593 | Ga0207648_10002249 | 3300026089 | Bacteria | 20879 |
| 594 | Ga0207648_10003985 | 3300026089 | Bacteria | 15326 |
| 595 | Ga0207648_10010108 | 3300026089 | Bacteria | 8971 |
| 596 | Ga0207648_10010271 | 3300026089 | Bacteria | 8890 |
| 597 | Ga0207648_10017630 | 3300026089 | Bacteria | 6485 |
| 598 | Ga0207648_10023261 | 3300026089 | Bacteria | 5557 |
| 599 | Ga0207648_10047650 | 3300026089 | Bacteria | 3755 |
| 600 | Ga0207676_10000460 | 3300026095 | Bacteria | 34103 |
| 601 | Ga0207676_10000684 | 3300026095 | Bacteria | 26910 |
| 602 | Ga0207676_10003822 | 3300026095 | Bacteria | 10636 |
| 603 | Ga0207676_10004373 | 3300026095 | Bacteria | 9990 |
| 604 | Ga0207676_10016045 | 3300026095 | Bacteria | 5419 |
| 605 | Ga0207676_10040865 | 3300026095 | Bacteria | 3557 |
| 606 | Ga0207676_10083224 | 3300026095 | Bacteria | 2605 |
| 607 | Ga0207676_10110582 | 3300026095 | Bacteria | 2298 |
| 608 | Ga0207676_10181939 | 3300026095 | Bacteria | 1841 |
| 609 | Ga0207676_10276977 | 3300026095 | Bacteria | 1521 |
| 610 | Ga0207674_10011720 | 3300026116 | Bacteria | 9839 |
| 611 | Ga0207674_10012883 | 3300026116 | Bacteria | 9331 |
| 612 | Ga0207674_10026949 | 3300026116 | Bacteria | 6094 |
| 613 | Ga0207675_100013782 | 3300026118 | Bacteria | 7540 |
| 614 | Ga0207675_100014357 | 3300026118 | Bacteria | 7385 |
| 615 | Ga0207675_100020315 | 3300026118 | Bacteria | 6193 |
| 616 | Ga0207675_100029124 | 3300026118 | Bacteria | 5146 |
| 617 | Ga0207675_100275251 | 3300026118 | Bacteria | 1634 |
| 618 | Ga0207683_10001906 | 3300026121 | Bacteria | 18449 |
| 619 | Ga0207683_10003032 | 3300026121 | Bacteria | 14676 |
| 620 | Ga0207683_10003821 | 3300026121 | Bacteria | 13050 |
| 621 | Ga0207683_10012871 | 3300026121 | Bacteria | 7140 |
| 622 | Ga0207683_10045899 | 3300026121 | Bacteria | 3821 |
| 623 | Ga0207683_10094445 | 3300026121 | Bacteria | 2665 |
| 624 | Ga0207683_10111836 | 3300026121 | Bacteria | 2446 |
| 625 | Ga0207683_10199709 | 3300026121 | Bacteria | 1817 |
| 626 | Ga0207683_10243245 | 3300026121 | Bacteria | 1641 |
| 627 | Ga0207698_10005874 | 3300026142 | Bacteria | 7626 |
| 628 | Ga0207698_10014584 | 3300026142 | Bacteria | 5231 |
| 629 | Ga0207698_10025173 | 3300026142 | Bacteria | 4187 |
| 630 | Ga0207698_10057249 | 3300026142 | Bacteria | 3015 |
| 631 | Ga0207698_10166728 | 3300026142 | Bacteria | 1934 |
| 632 | Ga0209995_1006264 | 3300027471 | Bacteria | 1911 |
| 633 | Ga0209983_1008037 | 3300027665 | Bacteria | 2157 |
| 634 | Ga0209588_1009283 | 3300027671 | Bacteria | 2937 |
| 635 | Ga0209971_1001832 | 3300027682 | Bacteria | 5205 |
| 636 | Ga0209966_1007433 | 3300027695 | Bacteria | 1921 |
| 637 | Ga0209998_10006525 | 3300027717 | Bacteria | 2425 |
| 638 | Ga0209974_10003602 | 3300027876 | Bacteria | 5563 |
| 639 | Ga0209974_10006207 | 3300027876 | Bacteria | 4183 |
| 640 | Ga0268266_10005919 | 3300028379 | Bacteria | 11311 |
| 641 | Ga0268266_10007969 | 3300028379 | Bacteria | 9471 |
| 642 | Ga0268266_10025799 | 3300028379 | Bacteria | 5000 |
| 643 | Ga0268266_10035623 | 3300028379 | Bacteria | 4234 |
| 644 | Ga0268266_10073026 | 3300028379 | Bacteria | 2976 |
| 645 | Ga0268266_10239306 | 3300028379 | Bacteria | 1674 |
| 646 | Ga0268265_10009900 | 3300028380 | Bacteria | 6441 |
| 647 | Ga0268265_10079904 | 3300028380 | Bacteria | 2577 |
| 648 | Ga0268264_10007353 | 3300028381 | Bacteria | 9200 |
| 649 | Ga0268264_10008990 | 3300028381 | Bacteria | 8289 |
| 650 | Ga0268264_10017628 | 3300028381 | Bacteria | 5847 |
| 651 | Ga0268264_10019355 | 3300028381 | Bacteria | 5564 |
| 652 | Ga0268264_10020240 | 3300028381 | Bacteria | 5438 |
| 653 | Ga0268264_10115365 | 3300028381 | Bacteria | 2359 |
| 654 | Ga0307517_10006989 | 3300028786 | Bacteria | 16571 |
| 655 | Ga0307517_10106480 | 3300028786 | Bacteria | 2168 |
| 656 | Ga0307515_10000034 | 3300028794 | Bacteria | 344640 |
| 657 | Ga0307515_10000221 | 3300028794 | Bacteria | 141099 |
| 658 | Ga0307515_10000525 | 3300028794 | Bacteria | 91297 |
| 659 | Ga0307515_10006043 | 3300028794 | Bacteria | 24341 |
| 660 | Ga0307515_10022638 | 3300028794 | Bacteria | 11062 |
| 661 | Ga0307515_10065230 | 3300028794 | Bacteria | 5072 |
| 662 | Ga0307515_10229727 | 3300028794 | Bacteria | 1651 |
| 663 | Ga0307511_10005456 | 3300030521 | Bacteria | 12934 |
| 664 | Ga0265332_10013905 | 3300031238 | Bacteria | 3564 |
| 665 | Ga0265331_10072293 | 3300031250 | Bacteria | 1612 |
| 666 | Ga0265327_10000851 | 3300031251 | Bacteria | 45640 |
| 667 | Ga0265327_10039548 | 3300031251 | Bacteria | 2560 |
| 668 | Ga0307509_10005306 | 3300031507 | Bacteria | 18025 |
| 669 | Ga0307509_10048038 | 3300031507 | Bacteria | 4586 |
| 670 | Ga0307509_10115106 | 3300031507 | Bacteria | 2682 |
| 671 | Ga0307509_10131190 | 3300031507 | Bacteria | 2461 |
| 672 | Ga0307408_100012538 | 3300031548 | Bacteria | 5619 |
| 673 | Ga0307408_100014530 | 3300031548 | Bacteria | 5231 |
| 674 | Ga0307408_100065328 | 3300031548 | Bacteria | 2668 |
| 675 | Ga0307408_100076205 | 3300031548 | Bacteria | 2494 |
| 676 | Ga0307508_10000141 | 3300031616 | Bacteria | 85739 |
| 677 | Ga0307508_10004610 | 3300031616 | Bacteria | 13396 |
| 678 | Ga0307508_10058845 | 3300031616 | Bacteria | 3399 |
| 679 | Ga0307508_10131020 | 3300031616 | Bacteria | 2111 |
| 680 | Ga0307514_10002352 | 3300031649 | Bacteria | 19825 |
| 681 | Ga0307514_10144343 | 3300031649 | Bacteria | 1611 |
| 682 | Ga0265314_10005818 | 3300031711 | Bacteria | 11042 |
| 683 | Ga0265314_10102411 | 3300031711 | Bacteria | 1837 |
| 684 | Ga0307516_10008188 | 3300031730 | Bacteria | 11874 |
| 685 | Ga0307516_10018003 | 3300031730 | Bacteria | 7350 |
| 686 | Ga0307516_10058949 | 3300031730 | Bacteria | 3735 |
| 687 | Ga0307405_10021076 | 3300031731 | Bacteria | 3658 |
| 688 | Ga0307405_10022909 | 3300031731 | Bacteria | 3539 |
| 689 | Ga0307405_10023337 | 3300031731 | Bacteria | 3515 |
| 690 | Ga0307405_10046588 | 3300031731 | Bacteria | 2665 |
| 691 | Ga0307413_10114075 | 3300031824 | Bacteria | 1815 |
| 692 | Ga0307410_10000433 | 3300031852 | Bacteria | 16724 |
| 693 | Ga0307410_10003577 | 3300031852 | Bacteria | 7827 |
| 694 | Ga0307410_10007774 | 3300031852 | Bacteria | 5894 |
| 695 | Ga0307410_10077848 | 3300031852 | Bacteria | 2319 |
| 696 | Ga0307410_10165241 | 3300031852 | Bacteria | 1662 |
| 697 | Ga0307406_10004541 | 3300031901 | Bacteria | 7563 |
| 698 | Ga0307406_10004966 | 3300031901 | Bacteria | 7246 |
| 699 | Ga0307406_10179622 | 3300031901 | Bacteria | 1539 |
| 700 | Ga0307407_10011742 | 3300031903 | Bacteria | 4184 |
| 701 | Ga0307407_10015952 | 3300031903 | Bacteria | 3729 |
| 702 | Ga0307407_10105787 | 3300031903 | Bacteria | 1756 |
| 703 | Ga0307412_10002089 | 3300031911 | Bacteria | 11099 |
| 704 | Ga0307412_10004567 | 3300031911 | Bacteria | 7713 |
| 705 | Ga0307412_10011920 | 3300031911 | Bacteria | 5048 |
| 706 | Ga0307412_10231271 | 3300031911 | Bacteria | 1424 |
| 707 | Ga0307409_100002278 | 3300031995 | Bacteria | 9942 |
| 708 | Ga0307409_100002393 | 3300031995 | Bacteria | 9778 |
| 709 | Ga0307409_100030184 | 3300031995 | Bacteria | 3891 |
| 710 | Ga0307409_100088458 | 3300031995 | Bacteria | 2529 |
| 711 | Ga0307416_100003419 | 3300032002 | Bacteria | 9319 |
| 712 | Ga0307416_100003982 | 3300032002 | Bacteria | 8809 |
| 713 | Ga0307416_100007289 | 3300032002 | Bacteria | 7013 |
| 714 | Ga0307416_100069457 | 3300032002 | Bacteria | 2915 |
| 715 | Ga0307414_10011253 | 3300032004 | Bacteria | 5239 |
| 716 | Ga0307414_10014216 | 3300032004 | Bacteria | 4763 |
| 717 | Ga0307414_10089861 | 3300032004 | Bacteria | 2278 |
| 718 | Ga0307414_10111480 | 3300032004 | Bacteria | 2084 |
| 719 | Ga0307411_10015181 | 3300032005 | Bacteria | 4317 |
| 720 | Ga0307411_10065824 | 3300032005 | Bacteria | 2432 |
| 721 | Ga0307411_10131735 | 3300032005 | Bacteria | 1828 |
| 722 | Ga0307415_100001060 | 3300032126 | Bacteria | 12787 |
| 723 | Ga0307415_100152720 | 3300032126 | Bacteria | 1779 |
| 724 | Ga0307507_10026219 | 3300033179 | Bacteria | 6291 |
| 725 | Ga0307507_10047478 | 3300033179 | Bacteria | 4193 |
| 726 | Ga0307507_10094496 | 3300033179 | Bacteria | 2541 |
| 727 | Ga0307510_10015777 | 3300033180 | Bacteria | 8931 |
| 728 | Ga0307510_10092443 | 3300033180 | Bacteria | 2861 |
| 729 | Ga0373934_0002811 | 3300035086 | Bacteria | 6376 |
| 730 | Ga0373923_0051629 | 3300035111 | Bacteria | 1726 |
| 731 | Ga0373923_0063009 | 3300035111 | Bacteria | 1578 |
| 732 | Ga0373936_0007078 | 3300035113 | Bacteria | 4219 |
| 733 | Ga0373936_0038128 | 3300035113 | Bacteria | 1921 |
| 734 | Ga0373936_0044861 | 3300035113 | Bacteria | 1779 |
| 735 | Ga0373956_0002885 | 3300035119 | Bacteria | 6956 |
| 736 | Ga0373956_0023220 | 3300035119 | Bacteria | 2660 |
| 737 | Ga0373956_0031478 | 3300035119 | Bacteria | 2325 |
| 738 | Ga0373957_0000970 | 3300035120 | Bacteria | 7527 |
| 739 | Ga0373946_0016344 | 3300035171 | Bacteria | 2826 |
| 740 | Ga0373946_0045327 | 3300035171 | Bacteria | 1819 |
| 741 | Ga0373955_0003124 | 3300035172 | Bacteria | 7249 |
| 742 | Ga0373955_0005751 | 3300035172 | Bacteria | 5591 |
| 743 | Ga0373955_0099524 | 3300035172 | Bacteria | 1667 |
| 744 | Ga0373942_0007240 | 3300035207 | Bacteria | 2571 |
| 745 | Ga0373924_0034965 | 3300035410 | Bacteria | 2036 |
| 746 | Ga0373931_0021096 | 3300035691 | Bacteria | 3267 |
| 747 | Ga0373931_0026920 | 3300035691 | Bacteria | 2931 |
| 748 | Ga0373935_0006980 | 3300035692 | Bacteria | 6744 |
| 749 | Ga0373935_0078989 | 3300035692 | Bacteria | 2135 |
| 750 | Ga0373935_0093869 | 3300035692 | Bacteria | 1968 |
| 751 | Ga0373935_0108013 | 3300035692 | Bacteria | 1843 |
| 752 | Ga0373927_0017083 | 3300035695 | Bacteria | 4781 |
| 753 | Ga0373927_0017512 | 3300035695 | Bacteria | 4714 |
| 754 | Ga0373927_0110842 | 3300035695 | Bacteria | 1788 |
| 755 | Ga0373927_0148757 | 3300035695 | Bacteria | 1533 |
| 756 | Ga0373927_0171831 | 3300035695 | Bacteria | 1421 |
| 757 | Ga0373933_0012042 | 3300035724 | Bacteria | 4776 |
| 758 | Ga0373933_0018091 | 3300035724 | Bacteria | 3959 |
| 759 | Ga0373947_0135755 | 3300035725 | Bacteria | 1574 |
| 760 | Ga0373937_0012460 | 3300036401 | Bacteria | 7482 |
| 761 | Ga0373937_0021385 | 3300036401 | Bacteria | 5807 |
| 762 | Ga0373937_0148550 | 3300036401 | Bacteria | 2195 |
| 763 | Ga0373937_0180351 | 3300036401 | Bacteria | 1983 |
| 764 | Ga0373937_0232254 | 3300036401 | Bacteria | 1737 |
| 765 | Ga0373925_0005088 | 3300037068 | Bacteria | 9841 |
| 766 | Ga0373925_0009135 | 3300037068 | Bacteria | 7213 |
| 767 | Ga0373925_0012993 | 3300037068 | Bacteria | 6029 |
| 768 | Ga0373925_0019343 | 3300037068 | Bacteria | 4953 |
| 769 | Ga0373925_0023450 | 3300037068 | Bacteria | 4502 |
| 770 | Ga0373925_0160324 | 3300037068 | Bacteria | 1771 |
| 771 | Ga0395899_0003984 | 3300037312 | Bacteria | 11638 |
| 772 | Ga0395899_0052574 | 3300037312 | Bacteria | 3019 |
| 773 | Ga0395900_0007847 | 3300037418 | Bacteria | 11003 |
| 774 | Ga0395900_0037654 | 3300037418 | Bacteria | 4986 |
| 775 | Ga0395900_0147704 | 3300037418 | Bacteria | 2403 |
| 776 | Ga0395898_0013040 | 3300037466 | Bacteria | 8563 |
| 777 | Ga0395898_0025436 | 3300037466 | Bacteria | 5965 |
| 778 | Ga0395905_0000042 | 3300037471 | Bacteria | 247894 |
| 779 | Ga0395905_0000377 | 3300037471 | Bacteria | 63595 |
| 780 | Ga0395905_0030359 | 3300037471 | Bacteria | 5093 |
| 781 | Ga0395905_0037027 | 3300037471 | Bacteria | 4582 |
| 782 | Ga0395905_0103955 | 3300037471 | Bacteria | 2666 |
| 783 | Ga0395905_0222069 | 3300037471 | Bacteria | 1768 |
| 784 | Ga0395905_0268013 | 3300037471 | Bacteria | 1593 |
| 785 | Ga0395901_0019515 | 3300038443 | Bacteria | 6930 |
| 786 | Ga0395901_0039104 | 3300038443 | Bacteria | 4908 |
| 787 | Ga0395901_0088482 | 3300038443 | Bacteria | 3239 |
| 788 | Ga0395901_0151691 | 3300038443 | Bacteria | 2435 |
| 789 | Ga0439436_0000623 | 3300041404 | Bacteria | 9405 |
| 790 | Ga0439447_005430 | 3300041407 | Bacteria | 4243 |
| 791 | Ga0439465_0006271 | 3300041413 | Bacteria | 3775 |
| 792 | Ga0451789_0113349 | 3300041443 | Bacteria | 3586 |
| 793 | Ga0451798_0184898 | 3300041458 | Bacteria | 3042 |
| 794 | Ga0439445_0010562 | 3300042004 | Bacteria | 2188 |
| 795 | Ga0439432_003265 | 3300042006 | Bacteria | 6029 |
| 796 | Ga0439449_0001905 | 3300042007 | Bacteria | 8206 |
| 797 | Ga0439450_003762 | 3300042008 | Bacteria | 2539 |
| 798 | Ga0439452_003048 | 3300042010 | Bacteria | 5957 |
| 799 | Ga0439457_001347 | 3300042014 | Bacteria | 7382 |
| 800 | Ga0439462_0000901 | 3300042015 | Bacteria | 6262 |
| 801 | Ga0450911_000152 | 3300042115 | Bacteria | 27922 |
| 802 | Ga0451577_0013112 | 3300042876 | Bacteria | 7769 |
| 803 | Ga0466966_0024785 | 3300044684 | Bacteria | 3924 |
| 804 | Ga0466961_0007100 | 3300044693 | Bacteria | 7124 |
| 805 | Ga0453684_0265829 | 3300044712 | Bacteria | 1963 |
| 806 | Ga0466970_0012828 | 3300044765 | Bacteria | 4290 |
| 807 | Ga0466957_0030344 | 3300044842 | Bacteria | 3227 |
| 808 | Ga0451576_0009738 | 3300045051 | Bacteria | 11112 |
| 809 | Ga0451576_0014003 | 3300045051 | Bacteria | 8942 |
| 810 | Ga0451576_0246585 | 3300045051 | Bacteria | 1867 |
| 811 | Ga0466967_0000292 | 3300045976 | Bacteria | 22396 |
| 812 | Ga0466967_0134305 | 3300045976 | Bacteria | 2300 |
| 813 | Ga0495627_004132 | 3300046453 | Bacteria | 6159 |
| 814 | Ga0495627_015990 | 3300046453 | Bacteria | 2579 |
| 815 | Ga0495592_0000142 | 3300046454 | Bacteria | 63571 |
| 816 | Ga0495592_0030716 | 3300046454 | Bacteria | 4063 |
| 817 | Ga0495603_0056318 | 3300046455 | Bacteria | 2328 |
| 818 | Ga0495590_0023016 | 3300046457 | Bacteria | 2202 |
| 819 | Ga0495629_0050996 | 3300046459 | Bacteria | 2896 |
| 820 | Ga0495629_0153359 | 3300046459 | Bacteria | 1601 |
| 821 | Ga0495638_0008762 | 3300046460 | Bacteria | 7147 |
| 822 | Ga0495653_0016870 | 3300046463 | Bacteria | 5942 |
| 823 | Ga0495653_0091666 | 3300046463 | Bacteria | 2221 |
| 824 | Ga0495639_0001883 | 3300046475 | Bacteria | 9302 |
| 825 | Ga0495639_0011546 | 3300046475 | Bacteria | 3810 |
| 826 | Ga0495664_0058074 | 3300046477 | Bacteria | 2301 |
| 827 | Ga0495594_0111545 | 3300046499 | Bacteria | 1542 |
| 828 | Ga0495628_0004819 | 3300046516 | Bacteria | 11867 |
| 829 | Ga0495628_0048048 | 3300046516 | Bacteria | 3383 |
| 830 | Ga0495628_0091453 | 3300046516 | Bacteria | 2355 |
| 831 | Ga0495630_0003398 | 3300046517 | Bacteria | 11090 |
| 832 | Ga0495632_0008357 | 3300046519 | Bacteria | 6363 |
| 833 | Ga0495632_0017325 | 3300046519 | Bacteria | 3980 |
| 834 | Ga0495637_0014207 | 3300046520 | Bacteria | 3759 |
| 835 | Ga0495642_0013638 | 3300046528 | Bacteria | 3147 |
| 836 | Ga0495652_0007395 | 3300046529 | Bacteria | 10126 |
| 837 | Ga0495665_0016464 | 3300046531 | Bacteria | 3984 |
| 838 | Ga0495587_0039982 | 3300046536 | Bacteria | 2804 |
| 839 | Ga0495621_0033415 | 3300046539 | Bacteria | 1773 |
| 840 | Ga0495645_0000419 | 3300046543 | Bacteria | 29318 |
| 841 | Ga0495645_0069507 | 3300046543 | Bacteria | 2542 |
| 842 | Ga0495656_0004699 | 3300046615 | Bacteria | 4691 |
| 843 | Ga0495656_0011267 | 3300046615 | Bacteria | 3279 |
| 844 | Ga0495625_0014315 | 3300046660 | Bacteria | 6337 |
| 845 | Ga0495625_0035602 | 3300046660 | Bacteria | 3668 |
| 846 | Ga0495635_0008428 | 3300046663 | Bacteria | 7198 |
| 847 | Ga0495599_0000476 | 3300046678 | Bacteria | 22901 |
| 848 | Ga0495646_0027738 | 3300046680 | Bacteria | 3550 |
| 849 | Ga0495646_0086397 | 3300046680 | Bacteria | 1819 |
| 850 | Ga0495647_0007029 | 3300046681 | Bacteria | 3751 |
| 851 | Ga0495647_0017865 | 3300046681 | Bacteria | 2516 |
| 852 | Ga0495647_0057571 | 3300046681 | Bacteria | 1526 |
| 853 | Ga0495658_0010519 | 3300046683 | Bacteria | 4629 |
| 854 | Ga0495613_0005723 | 3300046689 | Bacteria | 9314 |
| 855 | Ga0495613_0123637 | 3300046689 | Bacteria | 1856 |
| 856 | Ga0495624_0013649 | 3300046690 | Bacteria | 5534 |
| 857 | Ga0495671_0007807 | 3300046692 | Bacteria | 6057 |
| 858 | Ga0495649_0006612 | 3300046694 | Bacteria | 7204 |
| 859 | Ga0495600_0100556 | 3300046809 | Bacteria | 1885 |
| 860 | Ga0495660_0026540 | 3300046810 | Bacteria | 3283 |
| 861 | Ga0495581_0017958 | 3300047315 | Bacteria | 4110 |
| 862 | Ga0495581_0104486 | 3300047315 | Bacteria | 1646 |
| 863 | Ga0495675_0013490 | 3300047444 | Bacteria | 5158 |
| 864 | Ga0495684_0003384 | 3300047471 | Bacteria | 12521 |
| 865 | Ga0495684_0212860 | 3300047471 | Bacteria | 1420 |
| 866 | Ga0495686_0003768 | 3300047472 | Bacteria | 12886 |
| 867 | Ga0495614_0035198 | 3300048089 | Bacteria | 2152 |
| 868 | Ga0495626_0075851 | 3300048091 | Bacteria | 1502 |
| 869 | Ga0496100_0068773 | 3300048903 | Bacteria | 2356 |
| 870 | Ga0496100_0119886 | 3300048903 | Bacteria | 1839 |
| 871 | Ga0496101_0219051 | 3300048904 | Bacteria | 1476 |
| 872 | Ga0496102_0000940 | 3300048905 | Bacteria | 27514 |
| 873 | Ga0496102_0014300 | 3300048905 | Bacteria | 6896 |
| 874 | Ga0496102_0025725 | 3300048905 | Bacteria | 5241 |
| 875 | Ga0496102_0138011 | 3300048905 | Bacteria | 2285 |
| 876 | Ga0496104_0021309 | 3300048907 | Bacteria | 5948 |
| 877 | Ga0496104_0038484 | 3300048907 | Bacteria | 4475 |
| 878 | Ga0496105_0090658 | 3300048908 | Bacteria | 2525 |
| 879 | Ga0496106_0011519 | 3300048909 | Bacteria | 6540 |
| 880 | Ga0496106_0026338 | 3300048909 | Bacteria | 4329 |
| 881 | Ga0496107_0011010 | 3300048910 | Bacteria | 6292 |
| 882 | Ga0496107_0052863 | 3300048910 | Bacteria | 2930 |
| 883 | Ga0496108_0073528 | 3300048911 | Bacteria | 2885 |
| 884 | Ga0496109_0001844 | 3300048912 | Bacteria | 17571 |
| 885 | Ga0496109_0317604 | 3300048912 | Bacteria | 1470 |
| 886 | Ga0496110_0003683 | 3300048913 | Bacteria | 11796 |
| 887 | Ga0496112_0103179 | 3300048915 | Bacteria | 2821 |
| 888 | Ga0496114_0022149 | 3300048917 | Bacteria | 5176 |
| 889 | Ga0496114_0062393 | 3300048917 | Bacteria | 3119 |
| 890 | Ga0496115_0011956 | 3300048918 | Bacteria | 6520 |
| 891 | Ga0496117_0108491 | 3300048920 | Bacteria | 1736 |
| 892 | Ga0496121_0009076 | 3300048924 | Bacteria | 11515 |
| 893 | Ga0496122_0002676 | 3300048925 | Bacteria | 24814 |
| 894 | Ga0496123_0004397 | 3300048926 | Bacteria | 14858 |
| 895 | Ga0496124_0105373 | 3300048927 | Bacteria | 2278 |
| 896 | Ga0496125_0025776 | 3300048928 | Bacteria | 5376 |
| 897 | Ga0496125_0044090 | 3300048928 | Bacteria | 3777 |
| 898 | Ga0496125_0099388 | 3300048928 | Bacteria | 2149 |
| 899 | Ga0496126_0103421 | 3300048929 | Bacteria | 2489 |
| 900 | Ga0501034_0092920 | 3300049571 | Bacteria | 3013 |
| 901 | Ga0501036_0092234 | 3300049572 | Bacteria | 2559 |
| 902 | Ga0501036_0124164 | 3300049572 | Bacteria | 2180 |
| 903 | Ga0501043_0000072 | 3300049579 | Bacteria | 89021 |
| 904 | Ga0501046_0000112 | 3300049580 | Bacteria | 86313 |
| 905 | Ga0501046_0080956 | 3300049580 | Bacteria | 2508 |
| 906 | Ga0501047_0000138 | 3300049581 | Bacteria | 89028 |
| 907 | Ga0501047_0071256 | 3300049581 | Bacteria | 3345 |
| 908 | Ga0501048_0016360 | 3300049582 | Bacteria | 5465 |
| 909 | Ga0501073_0043590 | 3300049589 | Bacteria | 3164 |
| 910 | Ga0501075_0013598 | 3300049591 | Bacteria | 5813 |
| 911 | Ga0501076_0250471 | 3300049592 | Bacteria | 1449 |
| 912 | Ga0501035_0075918 | 3300049822 | Bacteria | 2972 |
| 913 | Ga0501044_0044351 | 3300049823 | Bacteria | 4614 |
| 914 | Ga0501045_0034681 | 3300049824 | Bacteria | 3664 |
| 915 | Ga0501045_0036945 | 3300049824 | Bacteria | 3549 |
| 916 | nmdc:mga03683_47083_c1 | 3300050489 | Bacteria | 1789 |
| 917 | nmdc:mga03683_56211_c1 | 3300050489 | Bacteria | 1654 |
| 918 | nmdc:mga03n38_1080_c1 | 3300050490 | Bacteria | 7528 |
| 919 | nmdc:mga00v17_31683_c1 | 3300050491 | Bacteria | 3120 |
| 920 | nmdc:mga0yw44_102264_c1 | 3300050492 | Bacteria | 1827 |
| 921 | nmdc:mga0yw44_30902_c1 | 3300050492 | Bacteria | 3110 |
| 922 | nmdc:mga0k408_137005_c1 | 3300050493 | Bacteria | 1455 |
| 923 | nmdc:mga0k408_2556_c1 | 3300050493 | Bacteria | 9253 |
| 924 | nmdc:mga0k408_30899_c1 | 3300050493 | Bacteria | 3056 |
| 925 | nmdc:mga0k408_32800_c1 | 3300050493 | Bacteria | 2967 |
| 926 | nmdc:mga0k408_3535_c1 | 3300050493 | Bacteria | 8252 |
| 927 | nmdc:mga0k408_48073_c1 | 3300050493 | Bacteria | 2467 |
| 928 | nmdc:mga0k408_54223_c1 | 3300050493 | Bacteria | 2324 |
| 929 | nmdc:mga06z11_18083_c1 | 3300050494 | Bacteria | 3213 |
| 930 | nmdc:mga07m45_2012_c1 | 3300050496 | Bacteria | 9421 |
| 931 | nmdc:mga07m45_2789_c1 | 3300050496 | Bacteria | 8259 |
| 932 | nmdc:mga07m45_334_c1 | 3300050496 | Bacteria | 19102 |
| 933 | nmdc:mga07m45_919_c1 | 3300050496 | Bacteria | 12885 |
| 934 | nmdc:mga09592_244702_c1 | 3300050508 | Bacteria | 1554 |
| 935 | nmdc:mga09592_34460_c1 | 3300050508 | Bacteria | 4232 |
| 936 | nmdc:mga0qj67_93086_c1 | 3300050509 | Bacteria | 2423 |
| 937 | nmdc:mga06r32_260272_c1 | 3300050510 | Bacteria | 1722 |
| 938 | Ga0495601_0131874 | 3300053077 | Bacteria | 1628 |
| 939 | Ga0495612_0055714 | 3300053078 | Bacteria | 1631 |
| 940 | Ga0500610_0000785 | 3300053079 | Bacteria | 10017 |
| 941 | Ga0500610_0007879 | 3300053079 | Bacteria | 4600 |
| 942 | Ga0495595_0022721 | 3300053084 | Bacteria | 2755 |
| 943 | Ga0495595_0140471 | 3300053084 | Bacteria | 1185 |
| 944 | Ga0500578_0000442 | 3300053086 | Bacteria | 50642 |
| 945 | Ga0500578_0115508 | 3300053086 | Bacteria | 1689 |
| 946 | Ga0500644_0010323 | 3300053088 | Bacteria | 2526 |
| 947 | Ga0500644_0015006 | 3300053088 | Bacteria | 2198 |
| 948 | Ga0500646_0008511 | 3300053090 | Bacteria | 2624 |
| 949 | Ga0500583_0001132 | 3300053092 | Bacteria | 7615 |
| 950 | Ga0500651_0133576 | 3300053093 | Bacteria | 1499 |
| 951 | Ga0500650_0060740 | 3300053098 | Bacteria | 1765 |
| 952 | Ga0500593_004410 | 3300053117 | Bacteria | 5445 |
| 953 | Ga0500594_0012252 | 3300053118 | Bacteria | 2017 |
| 954 | Ga0500607_002882 | 3300053121 | Bacteria | 13231 |
| 955 | Ga0500642_0019885 | 3300053130 | Bacteria | 2628 |
| 956 | Ga0500652_008087 | 3300053131 | Bacteria | 3484 |
| 957 | Ga0500658_0007229 | 3300053134 | Bacteria | 4101 |
| 958 | Ga0500559_0000014 | 3300053136 | Bacteria | 160139 |
| 959 | Ga0500559_0001094 | 3300053136 | Bacteria | 16435 |
| 960 | Ga0500568_0016368 | 3300053139 | Bacteria | 3299 |
| 961 | Ga0500568_0037026 | 3300053139 | Bacteria | 1981 |
| 962 | Ga0500577_0027114 | 3300053142 | Bacteria | 1958 |
| 963 | Ga0500579_099088 | 3300053143 | Bacteria | 1529 |
| 964 | Ga0500590_021314 | 3300053148 | Bacteria | 3364 |
| 965 | Ga0500604_0027661 | 3300053151 | Bacteria | 1642 |
| 966 | Ga0500616_0029527 | 3300053153 | Bacteria | 3016 |
| 967 | Ga0500622_0000866 | 3300053156 | Bacteria | 25758 |
| 968 | Ga0500622_0006682 | 3300053156 | Bacteria | 6647 |
| 969 | Ga0500622_0036982 | 3300053156 | Bacteria | 2551 |
| 970 | Ga0500627_0000632 | 3300053158 | Bacteria | 9372 |
| 971 | Ga0500645_007944 | 3300053730 | Bacteria | 3658 |
| 972 | Ga0530510_0114470 | 3300061734 | Bacteria | 1977 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013102 | Ga0157371_10002555 | Ga0157371_1000255515 | 371 |
| 2 | 3300053084 | Ga0495595_0140471 | Ga0495595_0140471_12_1151 | 378 |
| 3 | 3300053086 | Ga0500578_0115508 | Ga0500578_0115508_24_1241 | 404 |
| 4 | 3300027665 | Ga0209983_1008037 | Ga0209983_10080372 | 410 |
| 5 | 3300046455 | Ga0495603_0056318 | Ga0495603_0056318_935_2182 | 410 |
| 6 | 3300033179 | Ga0307507_10047478 | Ga0307507_100474782 | 412 |
| 7 | 3300025934 | Ga0207686_10102922 | Ga0207686_101029222 | 413 |
| 8 | 3300025940 | Ga0207691_10065404 | Ga0207691_100654042 | 413 |
| 9 | 3300050489 | nmdc:mga03683_56211_c1 | nmdc:mga03683_56211_c1_91_1341 | 414 |
| 10 | 3300053143 | Ga0500579_099088 | Ga0500579_099088_11_1270 | 414 |
| 11 | 3300005841 | Ga0068863_100110598 | Ga0068863_1001105983 | 415 |
| 12 | 3300009093 | Ga0105240_10053996 | Ga0105240_100539963 | 415 |
| 13 | 3300013104 | Ga0157370_10009815 | Ga0157370_100098157 | 415 |
| 14 | 3300013307 | Ga0157372_10121816 | Ga0157372_101218162 | 415 |
| 15 | 3300025960 | Ga0207651_10094781 | Ga0207651_100947812 | 416 |
| 16 | 3300048904 | Ga0496101_0219051 | Ga0496101_0219051_215_1465 | 416 |
| 17 | 3300031731 | Ga0307405_10023337 | Ga0307405_100233372 | 418 |
| 18 | 3300031995 | Ga0307409_100002278 | Ga0307409_1000022784 | 418 |
| 19 | 3300032002 | Ga0307416_100003982 | Ga0307416_1000039824 | 418 |
| 20 | 3300032005 | Ga0307411_10065824 | Ga0307411_100658241 | 418 |
| 21 | 3300005564 | Ga0070664_100020289 | Ga0070664_1000202893 | 419 |
| 22 | 3300046516 | Ga0495628_0091453 | Ga0495628_0091453_996_2330 | 419 |
| 23 | 3300046681 | Ga0495647_0057571 | Ga0495647_0057571_106_1440 | 419 |
| 24 | 3300047315 | Ga0495581_0017958 | Ga0495581_0017958_1520_2794 | 419 |
| 25 | 3300005355 | Ga0070671_100019739 | Ga0070671_1000197394 | 420 |
| 26 | 3300005618 | Ga0068864_100208279 | Ga0068864_1002082791 | 420 |
| 27 | 3300006237 | Ga0097621_100049274 | Ga0097621_1000492742 | 420 |
| 28 | 3300006358 | Ga0068871_100058376 | Ga0068871_1000583763 | 420 |
| 29 | 3300009177 | Ga0105248_10241428 | Ga0105248_102414282 | 420 |
| 30 | 3300025931 | Ga0207644_10000392 | Ga0207644_100003926 | 420 |
| 31 | 3300025941 | Ga0207711_10220736 | Ga0207711_102207362 | 420 |
| 32 | 3300026095 | Ga0207676_10016045 | Ga0207676_100160454 | 420 |
| 33 | 3300026121 | Ga0207683_10094445 | Ga0207683_100944452 | 420 |
| 34 | 3300007265 | Ga0099794_10004769 | Ga0099794_100047694 | 421 |
| 35 | 3300027671 | Ga0209588_1009283 | Ga0209588_10092832 | 421 |
| 36 | 3300028794 | Ga0307515_10000525 | Ga0307515_1000052565 | 421 |
| 37 | 3300033180 | Ga0307510_10015777 | Ga0307510_100157773 | 421 |
| 38 | 3300045976 | Ga0466967_0134305 | Ga0466967_0134305_505_1833 | 422 |
| 39 | 3300046528 | Ga0495642_0013638 | Ga0495642_0013638_1027_2343 | 422 |
| 40 | 3300046615 | Ga0495656_0011267 | Ga0495656_0011267_1066_2382 | 422 |
| 41 | 3300035113 | Ga0373936_0044861 | Ga0373936_0044861_374_1690 | 424 |
| 42 | 3300035692 | Ga0373935_0006980 | Ga0373935_0006980_2289_3605 | 424 |
| 43 | 3300037068 | Ga0373925_0005088 | Ga0373925_0005088_3567_4883 | 424 |
| 44 | 3300033179 | Ga0307507_10026219 | Ga0307507_100262192 | 425 |
| 45 | 3300053078 | Ga0495612_0055714 | Ga0495612_0055714_98_1378 | 425 |
| 46 | 3300037418 | Ga0395900_0147704 | Ga0395900_0147704_257_1573 | 426 |
| 47 | 3300037471 | Ga0395905_0268013 | Ga0395905_0268013_112_1428 | 426 |
| 48 | 3300005331 | Ga0070670_100002168 | Ga0070670_10000216813 | 427 |
| 49 | 3300005354 | Ga0070675_100031242 | Ga0070675_1000312422 | 427 |
| 50 | 3300005543 | Ga0070672_100066695 | Ga0070672_1000666952 | 427 |
| 51 | 3300009177 | Ga0105248_10200385 | Ga0105248_102003852 | 427 |
| 52 | 3300025925 | Ga0207650_10000560 | Ga0207650_1000056015 | 427 |
| 53 | 3300025926 | Ga0207659_10006382 | Ga0207659_100063822 | 427 |
| 54 | 3300025941 | Ga0207711_10108107 | Ga0207711_101081072 | 427 |
| 55 | 3300053139 | Ga0500568_0016368 | Ga0500568_0016368_602_1915 | 427 |
| 56 | iso_pu_bacteria | 2585428057 | 2587727857 | 429 |
| 57 | iso_pu_bacteria | 2585428058 | 2587733829 | 429 |
| 58 | iso_pu_bacteria | 2588253510 | 2588291634 | 429 |
| 59 | iso_pu_bacteria | 2643221592 | 2643972533 | 429 |
| 60 | iso_pu_bacteria | 2643221625 | 2644138459 | 429 |
| 61 | iso_pu_bacteria | 2643221648 | 2644273041 | 429 |
| 62 | 3300005355 | Ga0070671_100026363 | Ga0070671_1000263633 | 430 |
| 63 | 3300015683 | Ga0183362_10001 | Ga0183362_10001262 | 430 |
| 64 | 3300025931 | Ga0207644_10004537 | Ga0207644_100045373 | 430 |
| 65 | 3300031711 | Ga0265314_10102411 | Ga0265314_101024111 | 431 |
| 66 | 3300035695 | Ga0373927_0017083 | Ga0373927_0017083_2903_4228 | 431 |
| 67 | 3300037068 | Ga0373925_0012993 | Ga0373925_0012993_1788_3113 | 431 |
| 68 | 3300028794 | Ga0307515_10065230 | Ga0307515_100652302 | 432 |
| 69 | 3300031507 | Ga0307509_10131190 | Ga0307509_101311902 | 432 |
| 70 | 3300031616 | Ga0307508_10058845 | Ga0307508_100588453 | 432 |
| 71 | 3300031616 | Ga0307508_10131020 | Ga0307508_101310202 | 432 |
| 72 | 3300035691 | Ga0373931_0021096 | Ga0373931_0021096_956_2263 | 432 |
| 73 | 3300045051 | Ga0451576_0009738 | Ga0451576_0009738_9141_10451 | 432 |
| 74 | 3300046457 | Ga0495590_0023016 | Ga0495590_0023016_435_1748 | 432 |
| 75 | 3300046690 | Ga0495624_0013649 | Ga0495624_0013649_1115_2422 | 432 |
| 76 | 3300046694 | Ga0495649_0006612 | Ga0495649_0006612_4329_5642 | 432 |
| 77 | 3300046810 | Ga0495660_0026540 | Ga0495660_0026540_1202_2515 | 432 |
| 78 | 3300050508 | nmdc:mga09592_244702_c1 | nmdc:mga09592_244702_c1_11_1321 | 432 |
| 79 | 3300002773 | JGI25152J39213_1002959 | JGI25152J39213_10029595 | 433 |
| 80 | 3300003215 | JGI25153J46596_10009620 | JGI25153J46596_100096203 | 433 |
| 81 | 3300003771 | Ga0055526_1007227 | Ga0055526_10072274 | 433 |
| 82 | 3300003791 | Ga0055530_10003423 | Ga0055530_100034238 | 433 |
| 83 | 3300005262 | Ga0065165_1001929 | Ga0065165_10019293 | 433 |
| 84 | 3300005330 | Ga0070690_100002891 | Ga0070690_1000028915 | 433 |
| 85 | 3300005334 | Ga0068869_100044762 | Ga0068869_1000447623 | 433 |
| 86 | 3300005334 | Ga0068869_100053189 | Ga0068869_1000531892 | 433 |
| 87 | 3300005335 | Ga0070666_10003434 | Ga0070666_100034348 | 433 |
| 88 | 3300005336 | Ga0070680_100004529 | Ga0070680_1000045297 | 433 |
| 89 | 3300005338 | Ga0068868_100005341 | Ga0068868_1000053415 | 433 |
| 90 | 3300005338 | Ga0068868_100063437 | Ga0068868_1000634371 | 433 |
| 91 | 3300005340 | Ga0070689_100001549 | Ga0070689_10000154912 | 433 |
| 92 | 3300005355 | Ga0070671_100007060 | Ga0070671_1000070605 | 433 |
| 93 | 3300005356 | Ga0070674_100013348 | Ga0070674_1000133482 | 433 |
| 94 | 3300005364 | Ga0070673_100001934 | Ga0070673_1000019349 | 433 |
| 95 | 3300005365 | Ga0070688_100001074 | Ga0070688_1000010748 | 433 |
| 96 | 3300005434 | Ga0070709_10016788 | Ga0070709_100167882 | 433 |
| 97 | 3300005434 | Ga0070709_10027608 | Ga0070709_100276082 | 433 |
| 98 | 3300005436 | Ga0070713_100000662 | Ga0070713_10000066219 | 433 |
| 99 | 3300005436 | Ga0070713_100038438 | Ga0070713_1000384382 | 433 |
| 100 | 3300005438 | Ga0070701_10047622 | Ga0070701_100476222 | 433 |
| 101 | 3300005439 | Ga0070711_100016266 | Ga0070711_1000162663 | 433 |
| 102 | 3300005440 | Ga0070705_100100322 | Ga0070705_1001003221 | 433 |
| 103 | 3300005456 | Ga0070678_100001980 | Ga0070678_10000198011 | 433 |
| 104 | 3300005459 | Ga0068867_100065748 | Ga0068867_1000657482 | 433 |
| 105 | 3300005466 | Ga0070685_10001710 | Ga0070685_100017102 | 433 |
| 106 | 3300005467 | Ga0070706_100046470 | Ga0070706_1000464702 | 433 |
| 107 | 3300005518 | Ga0070699_100034555 | Ga0070699_1000345554 | 433 |
| 108 | 3300005544 | Ga0070686_100051659 | Ga0070686_1000516592 | 433 |
| 109 | 3300005547 | Ga0070693_100005196 | Ga0070693_1000051962 | 433 |
| 110 | 3300005547 | Ga0070693_100034738 | Ga0070693_1000347382 | 433 |
| 111 | 3300005548 | Ga0070665_100003498 | Ga0070665_1000034985 | 433 |
| 112 | 3300005549 | Ga0070704_100084272 | Ga0070704_1000842721 | 433 |
| 113 | 3300005578 | Ga0068854_100022163 | Ga0068854_1000221635 | 433 |
| 114 | 3300005578 | Ga0068854_100037496 | Ga0068854_1000374963 | 433 |
| 115 | 3300005614 | Ga0068856_100046294 | Ga0068856_1000462944 | 433 |
| 116 | 3300005614 | Ga0068856_100167638 | Ga0068856_1001676382 | 433 |
| 117 | 3300005615 | Ga0070702_100008689 | Ga0070702_1000086895 | 433 |
| 118 | 3300005617 | Ga0068859_100002547 | Ga0068859_10000254711 | 433 |
| 119 | 3300005618 | Ga0068864_100000761 | Ga0068864_10000076114 | 433 |
| 120 | 3300005718 | Ga0068866_10005562 | Ga0068866_100055622 | 433 |
| 121 | 3300005834 | Ga0068851_10051482 | Ga0068851_100514822 | 433 |
| 122 | 3300005841 | Ga0068863_100001520 | Ga0068863_1000015206 | 433 |
| 123 | 3300005842 | Ga0068858_100002479 | Ga0068858_1000024796 | 433 |
| 124 | 3300005843 | Ga0068860_100022329 | Ga0068860_1000223293 | 433 |
| 125 | 3300006175 | Ga0070712_100005788 | Ga0070712_1000057885 | 433 |
| 126 | 3300006175 | Ga0070712_100070848 | Ga0070712_1000708482 | 433 |
| 127 | 3300006237 | Ga0097621_100013201 | Ga0097621_1000132012 | 433 |
| 128 | 3300006358 | Ga0068871_100023358 | Ga0068871_1000233582 | 433 |
| 129 | 3300006914 | Ga0075436_100068140 | Ga0075436_1000681402 | 433 |
| 130 | 3300006931 | Ga0097620_100002547 | Ga0097620_10000254711 | 433 |
| 131 | 3300009093 | Ga0105240_10153052 | Ga0105240_101530522 | 433 |
| 132 | 3300009098 | Ga0105245_10013089 | Ga0105245_100130895 | 433 |
| 133 | 3300009098 | Ga0105245_10016169 | Ga0105245_100161695 | 433 |
| 134 | 3300009098 | Ga0105245_10133467 | Ga0105245_101334672 | 433 |
| 135 | 3300009174 | Ga0105241_10011568 | Ga0105241_100115686 | 433 |
| 136 | 3300009176 | Ga0105242_10034458 | Ga0105242_100344583 | 433 |
| 137 | 3300009177 | Ga0105248_10007014 | Ga0105248_100070142 | 433 |
| 138 | 3300009545 | Ga0105237_10110770 | Ga0105237_101107702 | 433 |
| 139 | 3300013104 | Ga0157370_10108106 | Ga0157370_101081062 | 433 |
| 140 | 3300013296 | Ga0157374_10001315 | Ga0157374_100013159 | 433 |
| 141 | 3300013297 | Ga0157378_10014395 | Ga0157378_100143955 | 433 |
| 142 | 3300013297 | Ga0157378_10146599 | Ga0157378_101465992 | 433 |
| 143 | 3300013306 | Ga0163162_10016098 | Ga0163162_100160983 | 433 |
| 144 | 3300013306 | Ga0163162_10100693 | Ga0163162_101006932 | 433 |
| 145 | 3300013308 | Ga0157375_10003025 | Ga0157375_100030252 | 433 |
| 146 | 3300014325 | Ga0163163_10000467 | Ga0163163_1000046720 | 433 |
| 147 | 3300014968 | Ga0157379_10001988 | Ga0157379_1000198810 | 433 |
| 148 | 3300014969 | Ga0157376_10011104 | Ga0157376_100111043 | 433 |
| 149 | 3300014969 | Ga0157376_10016382 | Ga0157376_100163822 | 433 |
| 150 | 3300025245 | Ga0207425_1000448 | Ga0207425_100044814 | 433 |
| 151 | 3300025258 | Ga0209129_1000124 | Ga0209129_100012451 | 433 |
| 152 | 3300025273 | Ga0209673_1004568 | Ga0209673_10045682 | 433 |
| 153 | 3300025295 | Ga0209564_1000057 | Ga0209564_100005770 | 433 |
| 154 | 3300025297 | Ga0209758_1000214 | Ga0209758_100021440 | 433 |
| 155 | 3300025297 | Ga0209758_1000232 | Ga0209758_100023237 | 433 |
| 156 | 3300025298 | Ga0209050_1000268 | Ga0209050_100026810 | 433 |
| 157 | 3300025303 | Ga0209051_1012907 | Ga0209051_10129073 | 433 |
| 158 | 3300025909 | Ga0207705_10134555 | Ga0207705_101345552 | 433 |
| 159 | 3300025942 | Ga0207689_10067369 | Ga0207689_100673692 | 433 |
| 160 | 3300025986 | Ga0207658_10003185 | Ga0207658_100031857 | 433 |
| 161 | 3300026023 | Ga0207677_10022471 | Ga0207677_100224711 | 433 |
| 162 | 3300026067 | Ga0207678_10065216 | Ga0207678_100652163 | 433 |
| 163 | 3300028794 | Ga0307515_10006043 | Ga0307515_1000604318 | 433 |
| 164 | 3300031911 | Ga0307412_10231271 | Ga0307412_102312711 | 433 |
| 165 | 3300037068 | Ga0373925_0019343 | Ga0373925_0019343_1051_2367 | 433 |
| 166 | 3300041443 | Ga0451789_0113349 | Ga0451789_0113349_442_1758 | 433 |
| 167 | 3300041458 | Ga0451798_0184898 | Ga0451798_0184898_1534_2850 | 433 |
| 168 | 3300046460 | Ga0495638_0008762 | Ga0495638_0008762_1494_2810 | 433 |
| 169 | 3300046519 | Ga0495632_0017325 | Ga0495632_0017325_901_2217 | 433 |
| 170 | 3300053086 | Ga0500578_0000442 | Ga0500578_0000442_15100_16416 | 433 |
| 171 | 3300053093 | Ga0500651_0133576 | Ga0500651_0133576_21_1337 | 433 |
| 172 | 3300053098 | Ga0500650_0060740 | Ga0500650_0060740_408_1724 | 433 |
| 173 | 3300053130 | Ga0500642_0019885 | Ga0500642_0019885_112_1428 | 433 |
| 174 | 3300053131 | Ga0500652_008087 | Ga0500652_008087_149_1465 | 433 |
| 175 | 3300053139 | Ga0500568_0037026 | Ga0500568_0037026_44_1360 | 433 |
| 176 | 3300053142 | Ga0500577_0027114 | Ga0500577_0027114_453_1769 | 433 |
| 177 | 3300053156 | Ga0500622_0000866 | Ga0500622_0000866_21811_23127 | 433 |
| 178 | 3300053156 | Ga0500622_0036982 | Ga0500622_0036982_532_1848 | 433 |
| 179 | iso_pu_bacteria | 2585428062 | 2587754399 | 433 |
| 180 | iso_pu_bacteria | 2643221654 | 2644302449 | 433 |
| 181 | iso_pu_bacteria | 2738543013 | 2739248454 | 433 |
| 182 | iso_pu_bacteria | 2842733646 | 2842733772 | 433 |
| 183 | iso_pu_bacteria | 2842747753 | 2842752278 | 433 |
| 184 | iso_pu_bacteria | 2885192300 | 2885194576 | 433 |
| 185 | iso_pu_bacteria | 2945909444 | 2945909489 | 433 |
| 186 | iso_pu_bacteria | 2945984333 | 2945988530 | 433 |
| 187 | 3300005328 | Ga0070676_10002428 | Ga0070676_100024285 | 434 |
| 188 | 3300005331 | Ga0070670_100000403 | Ga0070670_10000040321 | 434 |
| 189 | 3300005333 | Ga0070677_10002422 | Ga0070677_100024222 | 434 |
| 190 | 3300005333 | Ga0070677_10031267 | Ga0070677_100312672 | 434 |
| 191 | 3300005338 | Ga0068868_100005830 | Ga0068868_1000058305 | 434 |
| 192 | 3300005354 | Ga0070675_100001022 | Ga0070675_10000102215 | 434 |
| 193 | 3300005354 | Ga0070675_100015525 | Ga0070675_1000155254 | 434 |
| 194 | 3300005355 | Ga0070671_100014895 | Ga0070671_1000148955 | 434 |
| 195 | 3300005355 | Ga0070671_100016498 | Ga0070671_1000164984 | 434 |
| 196 | 3300005356 | Ga0070674_100001557 | Ga0070674_1000015575 | 434 |
| 197 | 3300005364 | Ga0070673_100014070 | Ga0070673_1000140705 | 434 |
| 198 | 3300005364 | Ga0070673_100015567 | Ga0070673_1000155674 | 434 |
| 199 | 3300005367 | Ga0070667_100083367 | Ga0070667_1000833672 | 434 |
| 200 | 3300005456 | Ga0070678_100005836 | Ga0070678_1000058364 | 434 |
| 201 | 3300005456 | Ga0070678_100013439 | Ga0070678_1000134394 | 434 |
| 202 | 3300005459 | Ga0068867_100011138 | Ga0068867_1000111385 | 434 |
| 203 | 3300005459 | Ga0068867_100047964 | Ga0068867_1000479642 | 434 |
| 204 | 3300005543 | Ga0070672_100001817 | Ga0070672_10000181714 | 434 |
| 205 | 3300005543 | Ga0070672_100013430 | Ga0070672_1000134302 | 434 |
| 206 | 3300005548 | Ga0070665_100006314 | Ga0070665_10000631410 | 434 |
| 207 | 3300005615 | Ga0070702_100116143 | Ga0070702_1001161431 | 434 |
| 208 | 3300005616 | Ga0068852_100118610 | Ga0068852_1001186102 | 434 |
| 209 | 3300005618 | Ga0068864_100015902 | Ga0068864_1000159025 | 434 |
| 210 | 3300005834 | Ga0068851_10028117 | Ga0068851_100281172 | 434 |
| 211 | 3300005841 | Ga0068863_100071725 | Ga0068863_1000717253 | 434 |
| 212 | 3300005842 | Ga0068858_100004428 | Ga0068858_1000044284 | 434 |
| 213 | 3300005843 | Ga0068860_100011471 | Ga0068860_1000114714 | 434 |
| 214 | 3300006237 | Ga0097621_100031564 | Ga0097621_1000315642 | 434 |
| 215 | 3300006237 | Ga0097621_100059916 | Ga0097621_1000599162 | 434 |
| 216 | 3300006358 | Ga0068871_100097150 | Ga0068871_1000971502 | 434 |
| 217 | 3300006881 | Ga0068865_100074351 | Ga0068865_1000743512 | 434 |
| 218 | 3300013297 | Ga0157378_10186571 | Ga0157378_101865712 | 434 |
| 219 | 3300013306 | Ga0163162_10140260 | Ga0163162_101402602 | 434 |
| 220 | 3300013308 | Ga0157375_10124421 | Ga0157375_101244212 | 434 |
| 221 | 3300014326 | Ga0157380_10011483 | Ga0157380_100114834 | 434 |
| 222 | 3300014968 | Ga0157379_10009277 | Ga0157379_100092774 | 434 |
| 223 | 3300014969 | Ga0157376_10079159 | Ga0157376_100791592 | 434 |
| 224 | 3300014969 | Ga0157376_10111753 | Ga0157376_101117532 | 434 |
| 225 | 3300017792 | Ga0163161_10046116 | Ga0163161_100461162 | 434 |
| 226 | 3300017792 | Ga0163161_10057062 | Ga0163161_100570622 | 434 |
| 227 | 3300025321 | Ga0207656_10008628 | Ga0207656_100086283 | 434 |
| 228 | 3300025893 | Ga0207682_10001129 | Ga0207682_1000112911 | 434 |
| 229 | 3300025893 | Ga0207682_10001755 | Ga0207682_100017554 | 434 |
| 230 | 3300025901 | Ga0207688_10042276 | Ga0207688_100422762 | 434 |
| 231 | 3300025903 | Ga0207680_10003229 | Ga0207680_100032293 | 434 |
| 232 | 3300025907 | Ga0207645_10001270 | Ga0207645_1000127017 | 434 |
| 233 | 3300025907 | Ga0207645_10003904 | Ga0207645_100039042 | 434 |
| 234 | 3300025907 | Ga0207645_10049844 | Ga0207645_100498442 | 434 |
| 235 | 3300025907 | Ga0207645_10148028 | Ga0207645_101480282 | 434 |
| 236 | 3300025908 | Ga0207643_10015505 | Ga0207643_100155052 | 434 |
| 237 | 3300025908 | Ga0207643_10143358 | Ga0207643_101433581 | 434 |
| 238 | 3300025911 | Ga0207654_10009118 | Ga0207654_100091185 | 434 |
| 239 | 3300025913 | Ga0207695_10106163 | Ga0207695_101061632 | 434 |
| 240 | 3300025915 | Ga0207693_10028327 | Ga0207693_100283273 | 434 |
| 241 | 3300025916 | Ga0207663_10014144 | Ga0207663_100141443 | 434 |
| 242 | 3300025918 | Ga0207662_10060376 | Ga0207662_100603762 | 434 |
| 243 | 3300025918 | Ga0207662_10061703 | Ga0207662_100617032 | 434 |
| 244 | 3300025919 | Ga0207657_10004460 | Ga0207657_1000446014 | 434 |
| 245 | 3300025922 | Ga0207646_10111752 | Ga0207646_101117522 | 434 |
| 246 | 3300025923 | Ga0207681_10049263 | Ga0207681_100492632 | 434 |
| 247 | 3300025925 | Ga0207650_10000408 | Ga0207650_1000040813 | 434 |
| 248 | 3300025925 | Ga0207650_10041784 | Ga0207650_100417842 | 434 |
| 249 | 3300025926 | Ga0207659_10000256 | Ga0207659_1000025610 | 434 |
| 250 | 3300025927 | Ga0207687_10007275 | Ga0207687_100072753 | 434 |
| 251 | 3300025927 | Ga0207687_10014865 | Ga0207687_100148652 | 434 |
| 252 | 3300025929 | Ga0207664_10008503 | Ga0207664_100085038 | 434 |
| 253 | 3300025931 | Ga0207644_10000817 | Ga0207644_1000081710 | 434 |
| 254 | 3300025931 | Ga0207644_10002297 | Ga0207644_100022977 | 434 |
| 255 | 3300025931 | Ga0207644_10015516 | Ga0207644_100155165 | 434 |
| 256 | 3300025931 | Ga0207644_10104303 | Ga0207644_101043032 | 434 |
| 257 | 3300025933 | Ga0207706_10033969 | Ga0207706_100339695 | 434 |
| 258 | 3300025934 | Ga0207686_10005871 | Ga0207686_100058715 | 434 |
| 259 | 3300025934 | Ga0207686_10008914 | Ga0207686_100089142 | 434 |
| 260 | 3300025936 | Ga0207670_10001589 | Ga0207670_100015894 | 434 |
| 261 | 3300025937 | Ga0207669_10007148 | Ga0207669_100071485 | 434 |
| 262 | 3300025937 | Ga0207669_10104194 | Ga0207669_101041942 | 434 |
| 263 | 3300025939 | Ga0207665_10046917 | Ga0207665_100469171 | 434 |
| 264 | 3300025940 | Ga0207691_10000360 | Ga0207691_1000036023 | 434 |
| 265 | 3300025940 | Ga0207691_10010241 | Ga0207691_100102414 | 434 |
| 266 | 3300025941 | Ga0207711_10000260 | Ga0207711_1000026035 | 434 |
| 267 | 3300025942 | Ga0207689_10007734 | Ga0207689_100077343 | 434 |
| 268 | 3300025945 | Ga0207679_10158499 | Ga0207679_101584992 | 434 |
| 269 | 3300025949 | Ga0207667_10177740 | Ga0207667_101777401 | 434 |
| 270 | 3300025960 | Ga0207651_10000554 | Ga0207651_100005543 | 434 |
| 271 | 3300025960 | Ga0207651_10013533 | Ga0207651_100135334 | 434 |
| 272 | 3300025960 | Ga0207651_10020777 | Ga0207651_100207772 | 434 |
| 273 | 3300025972 | Ga0207668_10020784 | Ga0207668_100207842 | 434 |
| 274 | 3300025981 | Ga0207640_10090010 | Ga0207640_100900102 | 434 |
| 275 | 3300025986 | Ga0207658_10001915 | Ga0207658_100019153 | 434 |
| 276 | 3300025986 | Ga0207658_10002797 | Ga0207658_100027976 | 434 |
| 277 | 3300025986 | Ga0207658_10072467 | Ga0207658_100724672 | 434 |
| 278 | 3300026023 | Ga0207677_10000160 | Ga0207677_1000016035 | 434 |
| 279 | 3300026023 | Ga0207677_10018163 | Ga0207677_100181632 | 434 |
| 280 | 3300026035 | Ga0207703_10001037 | Ga0207703_1000103714 | 434 |
| 281 | 3300026035 | Ga0207703_10017240 | Ga0207703_100172402 | 434 |
| 282 | 3300026041 | Ga0207639_10082999 | Ga0207639_100829991 | 434 |
| 283 | 3300026067 | Ga0207678_10024482 | Ga0207678_100244822 | 434 |
| 284 | 3300026078 | Ga0207702_10021062 | Ga0207702_100210624 | 434 |
| 285 | 3300026088 | Ga0207641_10016641 | Ga0207641_100166413 | 434 |
| 286 | 3300026088 | Ga0207641_10020425 | Ga0207641_100204253 | 434 |
| 287 | 3300026089 | Ga0207648_10003985 | Ga0207648_1000398516 | 434 |
| 288 | 3300026089 | Ga0207648_10010108 | Ga0207648_100101084 | 434 |
| 289 | 3300026089 | Ga0207648_10017630 | Ga0207648_100176303 | 434 |
| 290 | 3300026089 | Ga0207648_10023261 | Ga0207648_100232614 | 434 |
| 291 | 3300026095 | Ga0207676_10000684 | Ga0207676_1000068418 | 434 |
| 292 | 3300026095 | Ga0207676_10004373 | Ga0207676_100043734 | 434 |
| 293 | 3300026121 | Ga0207683_10001906 | Ga0207683_100019065 | 434 |
| 294 | 3300026121 | Ga0207683_10003821 | Ga0207683_100038212 | 434 |
| 295 | 3300026121 | Ga0207683_10012871 | Ga0207683_100128714 | 434 |
| 296 | 3300028379 | Ga0268266_10005919 | Ga0268266_100059198 | 434 |
| 297 | 3300028379 | Ga0268266_10007969 | Ga0268266_100079695 | 434 |
| 298 | 3300028381 | Ga0268264_10007353 | Ga0268264_100073537 | 434 |
| 299 | 3300028381 | Ga0268264_10008990 | Ga0268264_100089905 | 434 |
| 300 | 3300028381 | Ga0268264_10019355 | Ga0268264_100193552 | 434 |
| 301 | 3300031548 | Ga0307408_100065328 | Ga0307408_1000653283 | 434 |
| 302 | 3300031731 | Ga0307405_10046588 | Ga0307405_100465882 | 434 |
| 303 | 3300031824 | Ga0307413_10114075 | Ga0307413_101140751 | 434 |
| 304 | 3300031852 | Ga0307410_10077848 | Ga0307410_100778482 | 434 |
| 305 | 3300031901 | Ga0307406_10004966 | Ga0307406_100049662 | 434 |
| 306 | 3300031903 | Ga0307407_10105787 | Ga0307407_101057871 | 434 |
| 307 | 3300031911 | Ga0307412_10011920 | Ga0307412_100119203 | 434 |
| 308 | 3300032002 | Ga0307416_100069457 | Ga0307416_1000694572 | 434 |
| 309 | 3300032004 | Ga0307414_10014216 | Ga0307414_100142162 | 434 |
| 310 | 3300032004 | Ga0307414_10111480 | Ga0307414_101114802 | 434 |
| 311 | 3300032005 | Ga0307411_10015181 | Ga0307411_100151813 | 434 |
| 312 | 3300032126 | Ga0307415_100152720 | Ga0307415_1001527202 | 434 |
| 313 | 3300035086 | Ga0373934_0002811 | Ga0373934_0002811_1909_3228 | 434 |
| 314 | 3300035111 | Ga0373923_0063009 | Ga0373923_0063009_54_1373 | 434 |
| 315 | 3300035113 | Ga0373936_0038128 | Ga0373936_0038128_178_1497 | 434 |
| 316 | 3300035119 | Ga0373956_0002885 | Ga0373956_0002885_3264_4583 | 434 |
| 317 | 3300035119 | Ga0373956_0031478 | Ga0373956_0031478_893_2212 | 434 |
| 318 | 3300035120 | Ga0373957_0000970 | Ga0373957_0000970_4148_5467 | 434 |
| 319 | 3300035171 | Ga0373946_0016344 | Ga0373946_0016344_761_2080 | 434 |
| 320 | 3300035172 | Ga0373955_0005751 | Ga0373955_0005751_157_1476 | 434 |
| 321 | 3300035692 | Ga0373935_0078989 | Ga0373935_0078989_744_2063 | 434 |
| 322 | 3300035695 | Ga0373927_0148757 | Ga0373927_0148757_91_1410 | 434 |
| 323 | 3300035724 | Ga0373933_0018091 | Ga0373933_0018091_2109_3428 | 434 |
| 324 | 3300036401 | Ga0373937_0232254 | Ga0373937_0232254_65_1384 | 434 |
| 325 | 3300037068 | Ga0373925_0009135 | Ga0373925_0009135_651_1970 | 434 |
| 326 | 3300037068 | Ga0373925_0160324 | Ga0373925_0160324_313_1632 | 434 |
| 327 | 3300037471 | Ga0395905_0030359 | Ga0395905_0030359_2345_3664 | 434 |
| 328 | 3300046459 | Ga0495629_0050996 | Ga0495629_0050996_1270_2589 | 434 |
| 329 | 3300046475 | Ga0495639_0011546 | Ga0495639_0011546_463_1782 | 434 |
| 330 | 3300046499 | Ga0495594_0111545 | Ga0495594_0111545_189_1508 | 434 |
| 331 | 3300046531 | Ga0495665_0016464 | Ga0495665_0016464_1233_2552 | 434 |
| 332 | 3300046543 | Ga0495645_0069507 | Ga0495645_0069507_293_1612 | 434 |
| 333 | 3300046663 | Ga0495635_0008428 | Ga0495635_0008428_2208_3527 | 434 |
| 334 | 3300046681 | Ga0495647_0007029 | Ga0495647_0007029_291_1610 | 434 |
| 335 | 3300046683 | Ga0495658_0010519 | Ga0495658_0010519_1072_2391 | 434 |
| 336 | 3300046689 | Ga0495613_0005723 | Ga0495613_0005723_2032_3351 | 434 |
| 337 | 3300047471 | Ga0495684_0003384 | Ga0495684_0003384_7837_9156 | 434 |
| 338 | 3300048091 | Ga0495626_0075851 | Ga0495626_0075851_28_1350 | 434 |
| 339 | 3300048905 | Ga0496102_0138011 | Ga0496102_0138011_197_1516 | 434 |
| 340 | 3300048907 | Ga0496104_0038484 | Ga0496104_0038484_220_1539 | 434 |
| 341 | 3300048910 | Ga0496107_0052863 | Ga0496107_0052863_102_1421 | 434 |
| 342 | 3300048912 | Ga0496109_0317604 | Ga0496109_0317604_130_1449 | 434 |
| 343 | 3300048915 | Ga0496112_0103179 | Ga0496112_0103179_45_1364 | 434 |
| 344 | 3300048917 | Ga0496114_0062393 | Ga0496114_0062393_1670_2989 | 434 |
| 345 | 3300048918 | Ga0496115_0011956 | Ga0496115_0011956_181_1500 | 434 |
| 346 | 3300053134 | Ga0500658_0007229 | Ga0500658_0007229_1612_2934 | 434 |
| 347 | iso_pu_bacteria | 2945945610 | 2945945643 | 434 |
| 348 | 3300005457 | Ga0070662_100004864 | Ga0070662_1000048648 | 435 |
| 349 | 3300005467 | Ga0070706_100001321 | Ga0070706_1000013212 | 435 |
| 350 | 3300005616 | Ga0068852_100260912 | Ga0068852_1002609122 | 435 |
| 351 | 3300006177 | Ga0075362_10027810 | Ga0075362_100278102 | 435 |
| 352 | 3300006178 | Ga0075367_10073532 | Ga0075367_100735322 | 435 |
| 353 | 3300006353 | Ga0075370_10016975 | Ga0075370_100169752 | 435 |
| 354 | 3300013297 | Ga0157378_10236891 | Ga0157378_102368912 | 435 |
| 355 | 3300014326 | Ga0157380_10080513 | Ga0157380_100805132 | 435 |
| 356 | 3300025910 | Ga0207684_10040849 | Ga0207684_100408491 | 435 |
| 357 | 3300025922 | Ga0207646_10178582 | Ga0207646_101785822 | 435 |
| 358 | 3300025933 | Ga0207706_10011643 | Ga0207706_100116432 | 435 |
| 359 | 3300026116 | Ga0207674_10011720 | Ga0207674_100117209 | 435 |
| 360 | 3300028786 | Ga0307517_10106480 | Ga0307517_101064802 | 435 |
| 361 | 3300031730 | Ga0307516_10058949 | Ga0307516_100589492 | 435 |
| 362 | 3300046660 | Ga0495625_0014315 | Ga0495625_0014315_2587_3909 | 435 |
| 363 | 3300048903 | Ga0496100_0119886 | Ga0496100_0119886_205_1527 | 435 |
| 364 | 3300050489 | nmdc:mga03683_47083_c1 | nmdc:mga03683_47083_c1_52_1374 | 435 |
| 365 | 3300050493 | nmdc:mga0k408_30899_c1 | nmdc:mga0k408_30899_c1_1508_2830 | 435 |
| 366 | 3300050496 | nmdc:mga07m45_2012_c1 | nmdc:mga07m45_2012_c1_7760_9151 | 435 |
| 367 | 3300050496 | nmdc:mga07m45_334_c1 | nmdc:mga07m45_334_c1_1680_3002 | 435 |
| 368 | 3300005335 | Ga0070666_10028929 | Ga0070666_100289292 | 436 |
| 369 | 3300005338 | Ga0068868_100157985 | Ga0068868_1001579852 | 436 |
| 370 | 3300005356 | Ga0070674_100009857 | Ga0070674_1000098574 | 436 |
| 371 | 3300005367 | Ga0070667_100014862 | Ga0070667_1000148625 | 436 |
| 372 | 3300005456 | Ga0070678_100028162 | Ga0070678_1000281623 | 436 |
| 373 | 3300005548 | Ga0070665_100029079 | Ga0070665_1000290792 | 436 |
| 374 | 3300005548 | Ga0070665_100041342 | Ga0070665_1000413423 | 436 |
| 375 | 3300005618 | Ga0068864_100032182 | Ga0068864_1000321824 | 436 |
| 376 | 3300005719 | Ga0068861_100003340 | Ga0068861_1000033409 | 436 |
| 377 | 3300005841 | Ga0068863_100074661 | Ga0068863_1000746613 | 436 |
| 378 | 3300005843 | Ga0068860_100008652 | Ga0068860_1000086522 | 436 |
| 379 | 3300006038 | Ga0075365_10013462 | Ga0075365_100134624 | 436 |
| 380 | 3300006195 | Ga0075366_10069410 | Ga0075366_100694101 | 436 |
| 381 | 3300006358 | Ga0068871_100105397 | Ga0068871_1001053972 | 436 |
| 382 | 3300006881 | Ga0068865_100003331 | Ga0068865_1000033318 | 436 |
| 383 | 3300009098 | Ga0105245_10348823 | Ga0105245_103488231 | 436 |
| 384 | 3300009177 | Ga0105248_10079735 | Ga0105248_100797354 | 436 |
| 385 | 3300013297 | Ga0157378_10006295 | Ga0157378_100062952 | 436 |
| 386 | 3300013306 | Ga0163162_10006607 | Ga0163162_100066075 | 436 |
| 387 | 3300013308 | Ga0157375_10100843 | Ga0157375_101008433 | 436 |
| 388 | 3300014968 | Ga0157379_10072578 | Ga0157379_100725782 | 436 |
| 389 | 3300014968 | Ga0157379_10151461 | Ga0157379_101514612 | 436 |
| 390 | 3300025937 | Ga0207669_10049261 | Ga0207669_100492612 | 436 |
| 391 | 3300025938 | Ga0207704_10006681 | Ga0207704_100066813 | 436 |
| 392 | 3300025940 | Ga0207691_10065131 | Ga0207691_100651313 | 436 |
| 393 | 3300025960 | Ga0207651_10115487 | Ga0207651_101154872 | 436 |
| 394 | 3300025972 | Ga0207668_10008779 | Ga0207668_100087792 | 436 |
| 395 | 3300025981 | Ga0207640_10059192 | Ga0207640_100591922 | 436 |
| 396 | 3300025986 | Ga0207658_10051485 | Ga0207658_100514853 | 436 |
| 397 | 3300026023 | Ga0207677_10089631 | Ga0207677_100896312 | 436 |
| 398 | 3300026088 | Ga0207641_10064469 | Ga0207641_100644691 | 436 |
| 399 | 3300026089 | Ga0207648_10002249 | Ga0207648_1000224914 | 436 |
| 400 | 3300026118 | Ga0207675_100020315 | Ga0207675_1000203156 | 436 |
| 401 | 3300026121 | Ga0207683_10045899 | Ga0207683_100458992 | 436 |
| 402 | 3300028379 | Ga0268266_10025799 | Ga0268266_100257994 | 436 |
| 403 | 3300028379 | Ga0268266_10073026 | Ga0268266_100730262 | 436 |
| 404 | 3300028380 | Ga0268265_10009900 | Ga0268265_100099003 | 436 |
| 405 | 3300028381 | Ga0268264_10115365 | Ga0268264_101153652 | 436 |
| 406 | 3300032004 | Ga0307414_10089861 | Ga0307414_100898612 | 436 |
| 407 | 3300036401 | Ga0373937_0180351 | Ga0373937_0180351_597_1922 | 436 |
| 408 | 3300042008 | Ga0439450_003762 | Ga0439450_003762_300_1634 | 436 |
| 409 | 3300045051 | Ga0451576_0014003 | Ga0451576_0014003_6857_8185 | 436 |
| 410 | 3300050492 | nmdc:mga0yw44_30902_c1 | nmdc:mga0yw44_30902_c1_1113_2438 | 436 |
| 411 | 3300050493 | nmdc:mga0k408_32800_c1 | nmdc:mga0k408_32800_c1_932_2260 | 436 |
| 412 | 3300053148 | Ga0500590_021314 | Ga0500590_021314_1491_2816 | 436 |
| 413 | 3300003784 | Ga0055534_1002873 | Ga0055534_10028734 | 437 |
| 414 | 3300005330 | Ga0070690_100051374 | Ga0070690_1000513742 | 437 |
| 415 | 3300005331 | Ga0070670_100012532 | Ga0070670_1000125322 | 437 |
| 416 | 3300005331 | Ga0070670_100109983 | Ga0070670_1001099832 | 437 |
| 417 | 3300005331 | Ga0070670_100170861 | Ga0070670_1001708612 | 437 |
| 418 | 3300005335 | Ga0070666_10001963 | Ga0070666_100019634 | 437 |
| 419 | 3300005335 | Ga0070666_10037161 | Ga0070666_100371612 | 437 |
| 420 | 3300005336 | Ga0070680_100009735 | Ga0070680_1000097354 | 437 |
| 421 | 3300005338 | Ga0068868_100055798 | Ga0068868_1000557981 | 437 |
| 422 | 3300005338 | Ga0068868_100063898 | Ga0068868_1000638982 | 437 |
| 423 | 3300005339 | Ga0070660_100043813 | Ga0070660_1000438133 | 437 |
| 424 | 3300005340 | Ga0070689_100040119 | Ga0070689_1000401193 | 437 |
| 425 | 3300005343 | Ga0070687_100026415 | Ga0070687_1000264152 | 437 |
| 426 | 3300005344 | Ga0070661_100004818 | Ga0070661_1000048186 | 437 |
| 427 | 3300005344 | Ga0070661_100149226 | Ga0070661_1001492261 | 437 |
| 428 | 3300005347 | Ga0070668_100032908 | Ga0070668_1000329082 | 437 |
| 429 | 3300005353 | Ga0070669_100001676 | Ga0070669_10000167611 | 437 |
| 430 | 3300005353 | Ga0070669_100036531 | Ga0070669_1000365312 | 437 |
| 431 | 3300005354 | Ga0070675_100000815 | Ga0070675_1000008153 | 437 |
| 432 | 3300005354 | Ga0070675_100151237 | Ga0070675_1001512372 | 437 |
| 433 | 3300005356 | Ga0070674_100003570 | Ga0070674_1000035709 | 437 |
| 434 | 3300005364 | Ga0070673_100032868 | Ga0070673_1000328682 | 437 |
| 435 | 3300005365 | Ga0070688_100009209 | Ga0070688_1000092092 | 437 |
| 436 | 3300005367 | Ga0070667_100012710 | Ga0070667_1000127105 | 437 |
| 437 | 3300005438 | Ga0070701_10063306 | Ga0070701_100633062 | 437 |
| 438 | 3300005456 | Ga0070678_100058303 | Ga0070678_1000583032 | 437 |
| 439 | 3300005457 | Ga0070662_100010906 | Ga0070662_1000109066 | 437 |
| 440 | 3300005458 | Ga0070681_10226107 | Ga0070681_102261071 | 437 |
| 441 | 3300005459 | Ga0068867_100026482 | Ga0068867_1000264823 | 437 |
| 442 | 3300005459 | Ga0068867_100038864 | Ga0068867_1000388642 | 437 |
| 443 | 3300005466 | Ga0070685_10010239 | Ga0070685_100102394 | 437 |
| 444 | 3300005530 | Ga0070679_100002199 | Ga0070679_1000021994 | 437 |
| 445 | 3300005535 | Ga0070684_100087136 | Ga0070684_1000871362 | 437 |
| 446 | 3300005539 | Ga0068853_100062500 | Ga0068853_1000625002 | 437 |
| 447 | 3300005539 | Ga0068853_100291457 | Ga0068853_1002914571 | 437 |
| 448 | 3300005543 | Ga0070672_100001412 | Ga0070672_10000141213 | 437 |
| 449 | 3300005543 | Ga0070672_100008785 | Ga0070672_1000087852 | 437 |
| 450 | 3300005543 | Ga0070672_100031008 | Ga0070672_1000310082 | 437 |
| 451 | 3300005543 | Ga0070672_100097636 | Ga0070672_1000976362 | 437 |
| 452 | 3300005543 | Ga0070672_100173256 | Ga0070672_1001732562 | 437 |
| 453 | 3300005547 | Ga0070693_100035112 | Ga0070693_1000351123 | 437 |
| 454 | 3300005548 | Ga0070665_100030832 | Ga0070665_1000308326 | 437 |
| 455 | 3300005563 | Ga0068855_100007145 | Ga0068855_1000071455 | 437 |
| 456 | 3300005564 | Ga0070664_100004354 | Ga0070664_1000043549 | 437 |
| 457 | 3300005577 | Ga0068857_100035640 | Ga0068857_1000356403 | 437 |
| 458 | 3300005577 | Ga0068857_100130386 | Ga0068857_1001303862 | 437 |
| 459 | 3300005578 | Ga0068854_100006013 | Ga0068854_1000060132 | 437 |
| 460 | 3300005578 | Ga0068854_100035336 | Ga0068854_1000353364 | 437 |
| 461 | 3300005614 | Ga0068856_100041781 | Ga0068856_1000417813 | 437 |
| 462 | 3300005614 | Ga0068856_100057174 | Ga0068856_1000571741 | 437 |
| 463 | 3300005616 | Ga0068852_100018994 | Ga0068852_1000189943 | 437 |
| 464 | 3300005616 | Ga0068852_100099242 | Ga0068852_1000992422 | 437 |
| 465 | 3300005616 | Ga0068852_100262944 | Ga0068852_1002629441 | 437 |
| 466 | 3300005617 | Ga0068859_100000631 | Ga0068859_10000063120 | 437 |
| 467 | 3300005618 | Ga0068864_100001006 | Ga0068864_10000100616 | 437 |
| 468 | 3300005618 | Ga0068864_100100358 | Ga0068864_1001003582 | 437 |
| 469 | 3300005618 | Ga0068864_100137963 | Ga0068864_1001379632 | 437 |
| 470 | 3300005719 | Ga0068861_100021335 | Ga0068861_1000213352 | 437 |
| 471 | 3300005834 | Ga0068851_10014649 | Ga0068851_100146493 | 437 |
| 472 | 3300005834 | Ga0068851_10016960 | Ga0068851_100169601 | 437 |
| 473 | 3300005841 | Ga0068863_100028533 | Ga0068863_1000285334 | 437 |
| 474 | 3300005841 | Ga0068863_100110582 | Ga0068863_1001105822 | 437 |
| 475 | 3300005842 | Ga0068858_100001003 | Ga0068858_10000100311 | 437 |
| 476 | 3300005842 | Ga0068858_100006624 | Ga0068858_1000066242 | 437 |
| 477 | 3300005842 | Ga0068858_100026455 | Ga0068858_1000264555 | 437 |
| 478 | 3300005843 | Ga0068860_100012688 | Ga0068860_1000126884 | 437 |
| 479 | 3300005843 | Ga0068860_100147030 | Ga0068860_1001470302 | 437 |
| 480 | 3300005844 | Ga0068862_100033069 | Ga0068862_1000330693 | 437 |
| 481 | 3300006038 | Ga0075365_10013860 | Ga0075365_100138602 | 437 |
| 482 | 3300006058 | Ga0075432_10018964 | Ga0075432_100189642 | 437 |
| 483 | 3300006195 | Ga0075366_10002262 | Ga0075366_100022622 | 437 |
| 484 | 3300006195 | Ga0075366_10023241 | Ga0075366_100232412 | 437 |
| 485 | 3300006195 | Ga0075366_10102696 | Ga0075366_101026962 | 437 |
| 486 | 3300006237 | Ga0097621_100007405 | Ga0097621_1000074052 | 437 |
| 487 | 3300006237 | Ga0097621_100057987 | Ga0097621_1000579872 | 437 |
| 488 | 3300006237 | Ga0097621_100312814 | Ga0097621_1003128141 | 437 |
| 489 | 3300006353 | Ga0075370_10001313 | Ga0075370_1000131312 | 437 |
| 490 | 3300006358 | Ga0068871_100004805 | Ga0068871_10000480510 | 437 |
| 491 | 3300006844 | Ga0075428_100116605 | Ga0075428_1001166052 | 437 |
| 492 | 3300006931 | Ga0097620_100000631 | Ga0097620_10000063120 | 437 |
| 493 | 3300009093 | Ga0105240_10009479 | Ga0105240_100094798 | 437 |
| 494 | 3300009093 | Ga0105240_10010648 | Ga0105240_100106487 | 437 |
| 495 | 3300009176 | Ga0105242_10033379 | Ga0105242_100333793 | 437 |
| 496 | 3300009551 | Ga0105238_10006338 | Ga0105238_100063384 | 437 |
| 497 | 3300009551 | Ga0105238_10012746 | Ga0105238_100127467 | 437 |
| 498 | 3300009553 | Ga0105249_10080759 | Ga0105249_100807592 | 437 |
| 499 | 3300013100 | Ga0157373_10030428 | Ga0157373_100304283 | 437 |
| 500 | 3300013104 | Ga0157370_10004306 | Ga0157370_1000430612 | 437 |
| 501 | 3300013105 | Ga0157369_10008064 | Ga0157369_100080644 | 437 |
| 502 | 3300013306 | Ga0163162_10003915 | Ga0163162_100039152 | 437 |
| 503 | 3300013307 | Ga0157372_10104769 | Ga0157372_101047692 | 437 |
| 504 | 3300013307 | Ga0157372_10286269 | Ga0157372_102862692 | 437 |
| 505 | 3300014325 | Ga0163163_10007271 | Ga0163163_100072719 | 437 |
| 506 | 3300014497 | Ga0182008_10000654 | Ga0182008_1000065425 | 437 |
| 507 | 3300014497 | Ga0182008_10001019 | Ga0182008_100010199 | 437 |
| 508 | 3300014497 | Ga0182008_10026911 | Ga0182008_100269112 | 437 |
| 509 | 3300014968 | Ga0157379_10052111 | Ga0157379_100521113 | 437 |
| 510 | 3300014968 | Ga0157379_10079548 | Ga0157379_100795482 | 437 |
| 511 | 3300014969 | Ga0157376_10107010 | Ga0157376_101070102 | 437 |
| 512 | 3300015262 | Ga0182007_10001610 | Ga0182007_1000161011 | 437 |
| 513 | 3300017792 | Ga0163161_10000606 | Ga0163161_100006065 | 437 |
| 514 | 3300017792 | Ga0163161_10106728 | Ga0163161_101067282 | 437 |
| 515 | 3300025273 | Ga0209673_1024574 | Ga0209673_10245742 | 437 |
| 516 | 3300025284 | Ga0209130_1005106 | Ga0209130_10051062 | 437 |
| 517 | 3300025291 | Ga0209675_1001148 | Ga0209675_100114814 | 437 |
| 518 | 3300025292 | Ga0209676_1006751 | Ga0209676_10067513 | 437 |
| 519 | 3300025303 | Ga0209051_1010377 | Ga0209051_10103772 | 437 |
| 520 | 3300025304 | Ga0209257_1007196 | Ga0209257_10071965 | 437 |
| 521 | 3300025321 | Ga0207656_10063340 | Ga0207656_100633401 | 437 |
| 522 | 3300025893 | Ga0207682_10017681 | Ga0207682_100176812 | 437 |
| 523 | 3300025901 | Ga0207688_10060234 | Ga0207688_100602342 | 437 |
| 524 | 3300025903 | Ga0207680_10000777 | Ga0207680_1000077714 | 437 |
| 525 | 3300025903 | Ga0207680_10041827 | Ga0207680_100418272 | 437 |
| 526 | 3300025912 | Ga0207707_10167325 | Ga0207707_101673251 | 437 |
| 527 | 3300025913 | Ga0207695_10049214 | Ga0207695_100492144 | 437 |
| 528 | 3300025917 | Ga0207660_10010630 | Ga0207660_100106304 | 437 |
| 529 | 3300025917 | Ga0207660_10187497 | Ga0207660_101874971 | 437 |
| 530 | 3300025918 | Ga0207662_10000764 | Ga0207662_1000076413 | 437 |
| 531 | 3300025920 | Ga0207649_10013416 | Ga0207649_100134161 | 437 |
| 532 | 3300025920 | Ga0207649_10104174 | Ga0207649_101041742 | 437 |
| 533 | 3300025921 | Ga0207652_10005535 | Ga0207652_100055352 | 437 |
| 534 | 3300025923 | Ga0207681_10000771 | Ga0207681_1000077111 | 437 |
| 535 | 3300025923 | Ga0207681_10025743 | Ga0207681_100257432 | 437 |
| 536 | 3300025923 | Ga0207681_10063287 | Ga0207681_100632872 | 437 |
| 537 | 3300025923 | Ga0207681_10086338 | Ga0207681_100863382 | 437 |
| 538 | 3300025924 | Ga0207694_10040036 | Ga0207694_100400362 | 437 |
| 539 | 3300025925 | Ga0207650_10001998 | Ga0207650_1000199811 | 437 |
| 540 | 3300025925 | Ga0207650_10047393 | Ga0207650_100473932 | 437 |
| 541 | 3300025925 | Ga0207650_10088947 | Ga0207650_100889472 | 437 |
| 542 | 3300025926 | Ga0207659_10022714 | Ga0207659_100227144 | 437 |
| 543 | 3300025927 | Ga0207687_10083957 | Ga0207687_100839572 | 437 |
| 544 | 3300025931 | Ga0207644_10073669 | Ga0207644_100736692 | 437 |
| 545 | 3300025931 | Ga0207644_10184693 | Ga0207644_101846932 | 437 |
| 546 | 3300025932 | Ga0207690_10008231 | Ga0207690_100082313 | 437 |
| 547 | 3300025933 | Ga0207706_10072621 | Ga0207706_100726212 | 437 |
| 548 | 3300025934 | Ga0207686_10040244 | Ga0207686_100402443 | 437 |
| 549 | 3300025935 | Ga0207709_10013260 | Ga0207709_100132602 | 437 |
| 550 | 3300025936 | Ga0207670_10066152 | Ga0207670_100661522 | 437 |
| 551 | 3300025937 | Ga0207669_10074826 | Ga0207669_100748262 | 437 |
| 552 | 3300025940 | Ga0207691_10012083 | Ga0207691_100120839 | 437 |
| 553 | 3300025940 | Ga0207691_10055015 | Ga0207691_100550152 | 437 |
| 554 | 3300025941 | Ga0207711_10012387 | Ga0207711_100123872 | 437 |
| 555 | 3300025941 | Ga0207711_10032815 | Ga0207711_100328152 | 437 |
| 556 | 3300025942 | Ga0207689_10131192 | Ga0207689_101311921 | 437 |
| 557 | 3300025944 | Ga0207661_10055317 | Ga0207661_100553172 | 437 |
| 558 | 3300025944 | Ga0207661_10241976 | Ga0207661_102419761 | 437 |
| 559 | 3300025945 | Ga0207679_10203714 | Ga0207679_102037142 | 437 |
| 560 | 3300025960 | Ga0207651_10008778 | Ga0207651_100087784 | 437 |
| 561 | 3300025960 | Ga0207651_10013580 | Ga0207651_100135804 | 437 |
| 562 | 3300025960 | Ga0207651_10025601 | Ga0207651_100256012 | 437 |
| 563 | 3300025972 | Ga0207668_10025745 | Ga0207668_100257452 | 437 |
| 564 | 3300025972 | Ga0207668_10196923 | Ga0207668_101969232 | 437 |
| 565 | 3300025981 | Ga0207640_10024716 | Ga0207640_100247164 | 437 |
| 566 | 3300025981 | Ga0207640_10225607 | Ga0207640_102256071 | 437 |
| 567 | 3300025986 | Ga0207658_10000818 | Ga0207658_1000081811 | 437 |
| 568 | 3300025986 | Ga0207658_10016161 | Ga0207658_100161613 | 437 |
| 569 | 3300025986 | Ga0207658_10080115 | Ga0207658_100801152 | 437 |
| 570 | 3300026023 | Ga0207677_10006603 | Ga0207677_100066033 | 437 |
| 571 | 3300026023 | Ga0207677_10121386 | Ga0207677_101213861 | 437 |
| 572 | 3300026035 | Ga0207703_10000668 | Ga0207703_1000066816 | 437 |
| 573 | 3300026035 | Ga0207703_10003675 | Ga0207703_100036752 | 437 |
| 574 | 3300026035 | Ga0207703_10098713 | Ga0207703_100987132 | 437 |
| 575 | 3300026067 | Ga0207678_10073364 | Ga0207678_100733642 | 437 |
| 576 | 3300026075 | Ga0207708_10129850 | Ga0207708_101298502 | 437 |
| 577 | 3300026075 | Ga0207708_10156639 | Ga0207708_101566392 | 437 |
| 578 | 3300026078 | Ga0207702_10008513 | Ga0207702_100085139 | 437 |
| 579 | 3300026088 | Ga0207641_10015742 | Ga0207641_100157424 | 437 |
| 580 | 3300026089 | Ga0207648_10047650 | Ga0207648_100476502 | 437 |
| 581 | 3300026095 | Ga0207676_10000460 | Ga0207676_1000046015 | 437 |
| 582 | 3300026095 | Ga0207676_10083224 | Ga0207676_100832242 | 437 |
| 583 | 3300026095 | Ga0207676_10110582 | Ga0207676_101105822 | 437 |
| 584 | 3300026095 | Ga0207676_10181939 | Ga0207676_101819392 | 437 |
| 585 | 3300026095 | Ga0207676_10276977 | Ga0207676_102769772 | 437 |
| 586 | 3300026118 | Ga0207675_100014357 | Ga0207675_1000143577 | 437 |
| 587 | 3300026118 | Ga0207675_100029124 | Ga0207675_1000291244 | 437 |
| 588 | 3300026118 | Ga0207675_100275251 | Ga0207675_1002752512 | 437 |
| 589 | 3300026121 | Ga0207683_10111836 | Ga0207683_101118362 | 437 |
| 590 | 3300026121 | Ga0207683_10199709 | Ga0207683_101997092 | 437 |
| 591 | 3300026142 | Ga0207698_10057249 | Ga0207698_100572492 | 437 |
| 592 | 3300026142 | Ga0207698_10166728 | Ga0207698_101667282 | 437 |
| 593 | 3300028379 | Ga0268266_10035623 | Ga0268266_100356234 | 437 |
| 594 | 3300028380 | Ga0268265_10079904 | Ga0268265_100799042 | 437 |
| 595 | 3300028381 | Ga0268264_10017628 | Ga0268264_100176284 | 437 |
| 596 | 3300028381 | Ga0268264_10020240 | Ga0268264_100202402 | 437 |
| 597 | 3300028786 | Ga0307517_10006989 | Ga0307517_1000698910 | 437 |
| 598 | 3300028794 | Ga0307515_10000034 | Ga0307515_1000003460 | 437 |
| 599 | 3300028794 | Ga0307515_10000221 | Ga0307515_1000022110 | 437 |
| 600 | 3300028794 | Ga0307515_10022638 | Ga0307515_100226387 | 437 |
| 601 | 3300028794 | Ga0307515_10229727 | Ga0307515_102297272 | 437 |
| 602 | 3300031238 | Ga0265332_10013905 | Ga0265332_100139052 | 437 |
| 603 | 3300031250 | Ga0265331_10072293 | Ga0265331_100722932 | 437 |
| 604 | 3300031251 | Ga0265327_10000851 | Ga0265327_1000085118 | 437 |
| 605 | 3300031251 | Ga0265327_10039548 | Ga0265327_100395482 | 437 |
| 606 | 3300031507 | Ga0307509_10005306 | Ga0307509_1000530614 | 437 |
| 607 | 3300031507 | Ga0307509_10048038 | Ga0307509_100480384 | 437 |
| 608 | 3300031507 | Ga0307509_10115106 | Ga0307509_101151062 | 437 |
| 609 | 3300031548 | Ga0307408_100076205 | Ga0307408_1000762052 | 437 |
| 610 | 3300031616 | Ga0307508_10000141 | Ga0307508_1000014170 | 437 |
| 611 | 3300031616 | Ga0307508_10004610 | Ga0307508_100046108 | 437 |
| 612 | 3300031649 | Ga0307514_10002352 | Ga0307514_1000235213 | 437 |
| 613 | 3300031649 | Ga0307514_10144343 | Ga0307514_101443432 | 437 |
| 614 | 3300031711 | Ga0265314_10005818 | Ga0265314_1000581810 | 437 |
| 615 | 3300031730 | Ga0307516_10008188 | Ga0307516_1000818811 | 437 |
| 616 | 3300031730 | Ga0307516_10018003 | Ga0307516_100180031 | 437 |
| 617 | 3300031911 | Ga0307412_10004567 | Ga0307412_100045676 | 437 |
| 618 | 3300033180 | Ga0307510_10092443 | Ga0307510_100924431 | 437 |
| 619 | 3300035111 | Ga0373923_0051629 | Ga0373923_0051629_231_1565 | 437 |
| 620 | 3300035119 | Ga0373956_0023220 | Ga0373956_0023220_316_1632 | 437 |
| 621 | 3300035172 | Ga0373955_0003124 | Ga0373955_0003124_713_2029 | 437 |
| 622 | 3300035691 | Ga0373931_0026920 | Ga0373931_0026920_1268_2584 | 437 |
| 623 | 3300035695 | Ga0373927_0171831 | Ga0373927_0171831_65_1399 | 437 |
| 624 | 3300035724 | Ga0373933_0012042 | Ga0373933_0012042_1142_2458 | 437 |
| 625 | 3300036401 | Ga0373937_0021385 | Ga0373937_0021385_3673_4989 | 437 |
| 626 | 3300037068 | Ga0373925_0023450 | Ga0373925_0023450_781_2115 | 437 |
| 627 | 3300037312 | Ga0395899_0003984 | Ga0395899_0003984_4756_6084 | 437 |
| 628 | 3300037312 | Ga0395899_0052574 | Ga0395899_0052574_1232_2560 | 437 |
| 629 | 3300037418 | Ga0395900_0007847 | Ga0395900_0007847_1102_2430 | 437 |
| 630 | 3300037418 | Ga0395900_0037654 | Ga0395900_0037654_2316_3644 | 437 |
| 631 | 3300037466 | Ga0395898_0013040 | Ga0395898_0013040_4503_5831 | 437 |
| 632 | 3300037471 | Ga0395905_0000042 | Ga0395905_0000042_28852_30180 | 437 |
| 633 | 3300037471 | Ga0395905_0000377 | Ga0395905_0000377_39378_40706 | 437 |
| 634 | 3300037471 | Ga0395905_0037027 | Ga0395905_0037027_1977_3305 | 437 |
| 635 | 3300037471 | Ga0395905_0103955 | Ga0395905_0103955_877_2205 | 437 |
| 636 | 3300038443 | Ga0395901_0019515 | Ga0395901_0019515_4392_5720 | 437 |
| 637 | 3300038443 | Ga0395901_0039104 | Ga0395901_0039104_812_2140 | 437 |
| 638 | 3300038443 | Ga0395901_0088482 | Ga0395901_0088482_718_2046 | 437 |
| 639 | 3300041404 | Ga0439436_0000623 | Ga0439436_0000623_3824_5152 | 437 |
| 640 | 3300041407 | Ga0439447_005430 | Ga0439447_005430_2453_3781 | 437 |
| 641 | 3300041413 | Ga0439465_0006271 | Ga0439465_0006271_943_2271 | 437 |
| 642 | 3300042004 | Ga0439445_0010562 | Ga0439445_0010562_211_1545 | 437 |
| 643 | 3300042006 | Ga0439432_003265 | Ga0439432_003265_2392_3720 | 437 |
| 644 | 3300042007 | Ga0439449_0001905 | Ga0439449_0001905_4094_5422 | 437 |
| 645 | 3300042010 | Ga0439452_003048 | Ga0439452_003048_3102_4430 | 437 |
| 646 | 3300042014 | Ga0439457_001347 | Ga0439457_001347_4798_6126 | 437 |
| 647 | 3300042015 | Ga0439462_0000901 | Ga0439462_0000901_3077_4405 | 437 |
| 648 | 3300042115 | Ga0450911_000152 | Ga0450911_000152_14380_15714 | 437 |
| 649 | 3300042876 | Ga0451577_0013112 | Ga0451577_0013112_3955_5283 | 437 |
| 650 | 3300044684 | Ga0466966_0024785 | Ga0466966_0024785_1556_2884 | 437 |
| 651 | 3300044693 | Ga0466961_0007100 | Ga0466961_0007100_434_1762 | 437 |
| 652 | 3300044712 | Ga0453684_0265829 | Ga0453684_0265829_556_1884 | 437 |
| 653 | 3300044765 | Ga0466970_0012828 | Ga0466970_0012828_2879_4207 | 437 |
| 654 | 3300044842 | Ga0466957_0030344 | Ga0466957_0030344_1528_2856 | 437 |
| 655 | 3300045976 | Ga0466967_0000292 | Ga0466967_0000292_14626_15942 | 437 |
| 656 | 3300046453 | Ga0495627_004132 | Ga0495627_004132_3179_4507 | 437 |
| 657 | 3300046453 | Ga0495627_015990 | Ga0495627_015990_861_2189 | 437 |
| 658 | 3300046454 | Ga0495592_0000142 | Ga0495592_0000142_25946_27274 | 437 |
| 659 | 3300046459 | Ga0495629_0153359 | Ga0495629_0153359_90_1424 | 437 |
| 660 | 3300046463 | Ga0495653_0091666 | Ga0495653_0091666_164_1492 | 437 |
| 661 | 3300046516 | Ga0495628_0004819 | Ga0495628_0004819_9442_10758 | 437 |
| 662 | 3300046519 | Ga0495632_0008357 | Ga0495632_0008357_2342_3670 | 437 |
| 663 | 3300046520 | Ga0495637_0014207 | Ga0495637_0014207_2004_3332 | 437 |
| 664 | 3300046529 | Ga0495652_0007395 | Ga0495652_0007395_177_1493 | 437 |
| 665 | 3300046539 | Ga0495621_0033415 | Ga0495621_0033415_421_1749 | 437 |
| 666 | 3300046543 | Ga0495645_0000419 | Ga0495645_0000419_19039_20355 | 437 |
| 667 | 3300046615 | Ga0495656_0004699 | Ga0495656_0004699_1738_3066 | 437 |
| 668 | 3300046660 | Ga0495625_0035602 | Ga0495625_0035602_1192_2520 | 437 |
| 669 | 3300046678 | Ga0495599_0000476 | Ga0495599_0000476_5094_6410 | 437 |
| 670 | 3300046680 | Ga0495646_0027738 | Ga0495646_0027738_1724_3052 | 437 |
| 671 | 3300046692 | Ga0495671_0007807 | Ga0495671_0007807_3312_4640 | 437 |
| 672 | 3300046809 | Ga0495600_0100556 | Ga0495600_0100556_224_1552 | 437 |
| 673 | 3300047471 | Ga0495684_0212860 | Ga0495684_0212860_50_1384 | 437 |
| 674 | 3300048905 | Ga0496102_0014300 | Ga0496102_0014300_500_1828 | 437 |
| 675 | 3300048909 | Ga0496106_0011519 | Ga0496106_0011519_4620_5948 | 437 |
| 676 | 3300048917 | Ga0496114_0022149 | Ga0496114_0022149_3178_4506 | 437 |
| 677 | 3300048920 | Ga0496117_0108491 | Ga0496117_0108491_20_1348 | 437 |
| 678 | 3300048924 | Ga0496121_0009076 | Ga0496121_0009076_7664_8998 | 437 |
| 679 | 3300048925 | Ga0496122_0002676 | Ga0496122_0002676_7449_8777 | 437 |
| 680 | 3300048926 | Ga0496123_0004397 | Ga0496123_0004397_8030_9358 | 437 |
| 681 | 3300048927 | Ga0496124_0105373 | Ga0496124_0105373_464_1798 | 437 |
| 682 | 3300048928 | Ga0496125_0025776 | Ga0496125_0025776_3407_4741 | 437 |
| 683 | 3300048928 | Ga0496125_0044090 | Ga0496125_0044090_1227_2561 | 437 |
| 684 | 3300048928 | Ga0496125_0099388 | Ga0496125_0099388_593_1927 | 437 |
| 685 | 3300048929 | Ga0496126_0103421 | Ga0496126_0103421_472_1806 | 437 |
| 686 | 3300049571 | Ga0501034_0092920 | Ga0501034_0092920_244_1635 | 437 |
| 687 | 3300049572 | Ga0501036_0092234 | Ga0501036_0092234_601_1992 | 437 |
| 688 | 3300049579 | Ga0501043_0000072 | Ga0501043_0000072_83634_84962 | 437 |
| 689 | 3300049580 | Ga0501046_0000112 | Ga0501046_0000112_80985_82313 | 437 |
| 690 | 3300049580 | Ga0501046_0080956 | Ga0501046_0080956_938_2329 | 437 |
| 691 | 3300049581 | Ga0501047_0000138 | Ga0501047_0000138_4060_5388 | 437 |
| 692 | 3300049581 | Ga0501047_0071256 | Ga0501047_0071256_1403_2794 | 437 |
| 693 | 3300049582 | Ga0501048_0016360 | Ga0501048_0016360_2618_3946 | 437 |
| 694 | 3300049589 | Ga0501073_0043590 | Ga0501073_0043590_1538_2929 | 437 |
| 695 | 3300049822 | Ga0501035_0075918 | Ga0501035_0075918_1164_2555 | 437 |
| 696 | 3300049823 | Ga0501044_0044351 | Ga0501044_0044351_1550_2941 | 437 |
| 697 | 3300050493 | nmdc:mga0k408_137005_c1 | nmdc:mga0k408_137005_c1_80_1408 | 437 |
| 698 | 3300050493 | nmdc:mga0k408_2556_c1 | nmdc:mga0k408_2556_c1_691_2019 | 437 |
| 699 | 3300050493 | nmdc:mga0k408_3535_c1 | nmdc:mga0k408_3535_c1_6590_7921 | 437 |
| 700 | 3300050493 | nmdc:mga0k408_48073_c1 | nmdc:mga0k408_48073_c1_770_2098 | 437 |
| 701 | 3300050496 | nmdc:mga07m45_2789_c1 | nmdc:mga07m45_2789_c1_722_2053 | 437 |
| 702 | 3300050496 | nmdc:mga07m45_919_c1 | nmdc:mga07m45_919_c1_10788_12116 | 437 |
| 703 | 3300050508 | nmdc:mga09592_34460_c1 | nmdc:mga09592_34460_c1_1548_2876 | 437 |
| 704 | 3300050509 | nmdc:mga0qj67_93086_c1 | nmdc:mga0qj67_93086_c1_603_1931 | 437 |
| 705 | 3300050510 | nmdc:mga06r32_260272_c1 | nmdc:mga06r32_260272_c1_138_1472 | 437 |
| 706 | 3300053077 | Ga0495601_0131874 | Ga0495601_0131874_283_1611 | 437 |
| 707 | 3300053079 | Ga0500610_0000785 | Ga0500610_0000785_2799_4127 | 437 |
| 708 | 3300053079 | Ga0500610_0007879 | Ga0500610_0007879_2799_4127 | 437 |
| 709 | 3300053088 | Ga0500644_0010323 | Ga0500644_0010323_1096_2424 | 437 |
| 710 | 3300053088 | Ga0500644_0015006 | Ga0500644_0015006_625_1953 | 437 |
| 711 | 3300053117 | Ga0500593_004410 | Ga0500593_004410_1480_2808 | 437 |
| 712 | 3300053118 | Ga0500594_0012252 | Ga0500594_0012252_566_1894 | 437 |
| 713 | 3300053121 | Ga0500607_002882 | Ga0500607_002882_676_2004 | 437 |
| 714 | 3300053136 | Ga0500559_0000014 | Ga0500559_0000014_146358_147686 | 437 |
| 715 | 3300053136 | Ga0500559_0001094 | Ga0500559_0001094_3771_5099 | 437 |
| 716 | 3300053153 | Ga0500616_0029527 | Ga0500616_0029527_1067_2395 | 437 |
| 717 | 3300053156 | Ga0500622_0006682 | Ga0500622_0006682_3194_4522 | 437 |
| 718 | 3300053158 | Ga0500627_0000632 | Ga0500627_0000632_2946_4274 | 437 |
| 719 | 3300053730 | Ga0500645_007944 | Ga0500645_007944_655_2088 | 437 |
| 720 | 3300005547 | Ga0070693_100092527 | Ga0070693_1000925271 | 438 |
| 721 | 3300006042 | Ga0075368_10003480 | Ga0075368_100034805 | 438 |
| 722 | 3300006048 | Ga0075363_100002634 | Ga0075363_1000026343 | 438 |
| 723 | 3300006178 | Ga0075367_10002281 | Ga0075367_100022814 | 438 |
| 724 | 3300006353 | Ga0075370_10037289 | Ga0075370_100372892 | 438 |
| 725 | 3300030521 | Ga0307511_10005456 | Ga0307511_100054563 | 438 |
| 726 | 3300033179 | Ga0307507_10094496 | Ga0307507_100944962 | 438 |
| 727 | 3300035113 | Ga0373936_0007078 | Ga0373936_0007078_505_1827 | 438 |
| 728 | 3300035171 | Ga0373946_0045327 | Ga0373946_0045327_269_1591 | 438 |
| 729 | 3300035207 | Ga0373942_0007240 | Ga0373942_0007240_1039_2358 | 438 |
| 730 | 3300035410 | Ga0373924_0034965 | Ga0373924_0034965_550_1872 | 438 |
| 731 | 3300035695 | Ga0373927_0017512 | Ga0373927_0017512_3195_4517 | 438 |
| 732 | 3300035725 | Ga0373947_0135755 | Ga0373947_0135755_22_1344 | 438 |
| 733 | 3300046454 | Ga0495592_0030716 | Ga0495592_0030716_1196_2518 | 438 |
| 734 | 3300046463 | Ga0495653_0016870 | Ga0495653_0016870_3896_5215 | 438 |
| 735 | 3300046475 | Ga0495639_0001883 | Ga0495639_0001883_7002_8324 | 438 |
| 736 | 3300046477 | Ga0495664_0058074 | Ga0495664_0058074_717_2036 | 438 |
| 737 | 3300046516 | Ga0495628_0048048 | Ga0495628_0048048_579_1901 | 438 |
| 738 | 3300046517 | Ga0495630_0003398 | Ga0495630_0003398_6232_7554 | 438 |
| 739 | 3300046536 | Ga0495587_0039982 | Ga0495587_0039982_208_1527 | 438 |
| 740 | 3300046680 | Ga0495646_0086397 | Ga0495646_0086397_306_1628 | 438 |
| 741 | 3300046681 | Ga0495647_0017865 | Ga0495647_0017865_142_1464 | 438 |
| 742 | 3300046689 | Ga0495613_0123637 | Ga0495613_0123637_112_1434 | 438 |
| 743 | 3300047315 | Ga0495581_0104486 | Ga0495581_0104486_202_1524 | 438 |
| 744 | 3300047444 | Ga0495675_0013490 | Ga0495675_0013490_3541_4863 | 438 |
| 745 | 3300047472 | Ga0495686_0003768 | Ga0495686_0003768_9099_10427 | 438 |
| 746 | 3300048089 | Ga0495614_0035198 | Ga0495614_0035198_612_1934 | 438 |
| 747 | 3300049592 | Ga0501076_0250471 | Ga0501076_0250471_12_1331 | 438 |
| 748 | 3300049824 | Ga0501045_0034681 | Ga0501045_0034681_2018_3337 | 438 |
| 749 | 3300050490 | nmdc:mga03n38_1080_c1 | nmdc:mga03n38_1080_c1_4290_5612 | 438 |
| 750 | 3300050491 | nmdc:mga00v17_31683_c1 | nmdc:mga00v17_31683_c1_1619_2941 | 438 |
| 751 | 3300050492 | nmdc:mga0yw44_102264_c1 | nmdc:mga0yw44_102264_c1_180_1502 | 438 |
| 752 | 3300050493 | nmdc:mga0k408_54223_c1 | nmdc:mga0k408_54223_c1_454_1776 | 438 |
| 753 | 3300050494 | nmdc:mga06z11_18083_c1 | nmdc:mga06z11_18083_c1_203_1525 | 438 |
| 754 | 3300053084 | Ga0495595_0022721 | Ga0495595_0022721_953_2275 | 438 |
| 755 | 3300053090 | Ga0500646_0008511 | Ga0500646_0008511_217_1539 | 438 |
| 756 | 3300053092 | Ga0500583_0001132 | Ga0500583_0001132_1720_3042 | 438 |
| 757 | 3300053151 | Ga0500604_0027661 | Ga0500604_0027661_71_1393 | 438 |
| 758 | 3300005434 | Ga0070709_10013191 | Ga0070709_100131913 | 439 |
| 759 | 3300005436 | Ga0070713_100167906 | Ga0070713_1001679062 | 439 |
| 760 | 3300005471 | Ga0070698_100100992 | Ga0070698_1001009923 | 439 |
| 761 | 3300005518 | Ga0070699_100010858 | Ga0070699_1000108583 | 439 |
| 762 | 3300005546 | Ga0070696_100001069 | Ga0070696_1000010694 | 439 |
| 763 | 3300005549 | Ga0070704_100030185 | Ga0070704_1000301853 | 439 |
| 764 | 3300005563 | Ga0068855_100061675 | Ga0068855_1000616753 | 439 |
| 765 | 3300005564 | Ga0070664_100019498 | Ga0070664_1000194984 | 439 |
| 766 | 3300005614 | Ga0068856_100053277 | Ga0068856_1000532772 | 439 |
| 767 | 3300005617 | Ga0068859_100178980 | Ga0068859_1001789802 | 439 |
| 768 | 3300005618 | Ga0068864_100084703 | Ga0068864_1000847032 | 439 |
| 769 | 3300005985 | Ga0081539_10028541 | Ga0081539_100285412 | 439 |
| 770 | 3300006931 | Ga0097620_100178976 | Ga0097620_1001789762 | 439 |
| 771 | 3300009098 | Ga0105245_10118727 | Ga0105245_101187272 | 439 |
| 772 | 3300025913 | Ga0207695_10110776 | Ga0207695_101107762 | 439 |
| 773 | 3300025949 | Ga0207667_10191303 | Ga0207667_101913031 | 439 |
| 774 | 3300026078 | Ga0207702_10048102 | Ga0207702_100481022 | 439 |
| 775 | 3300026095 | Ga0207676_10040865 | Ga0207676_100408653 | 439 |
| 776 | 3300031548 | Ga0307408_100012538 | Ga0307408_1000125381 | 439 |
| 777 | 3300031731 | Ga0307405_10021076 | Ga0307405_100210762 | 439 |
| 778 | 3300031731 | Ga0307405_10022909 | Ga0307405_100229091 | 439 |
| 779 | 3300031852 | Ga0307410_10000433 | Ga0307410_100004334 | 439 |
| 780 | 3300031852 | Ga0307410_10007774 | Ga0307410_100077743 | 439 |
| 781 | 3300031852 | Ga0307410_10165241 | Ga0307410_101652412 | 439 |
| 782 | 3300031901 | Ga0307406_10179622 | Ga0307406_101796221 | 439 |
| 783 | 3300031903 | Ga0307407_10011742 | Ga0307407_100117421 | 439 |
| 784 | 3300031995 | Ga0307409_100030184 | Ga0307409_1000301844 | 439 |
| 785 | 3300031995 | Ga0307409_100088458 | Ga0307409_1000884582 | 439 |
| 786 | 3300032002 | Ga0307416_100007289 | Ga0307416_1000072892 | 439 |
| 787 | 3300032004 | Ga0307414_10011253 | Ga0307414_100112531 | 439 |
| 788 | 3300032005 | Ga0307411_10131735 | Ga0307411_101317352 | 439 |
| 789 | 3300035172 | Ga0373955_0099524 | Ga0373955_0099524_313_1635 | 439 |
| 790 | 3300035692 | Ga0373935_0093869 | Ga0373935_0093869_194_1516 | 439 |
| 791 | 3300035692 | Ga0373935_0108013 | Ga0373935_0108013_249_1571 | 439 |
| 792 | 3300036401 | Ga0373937_0012460 | Ga0373937_0012460_3482_4804 | 439 |
| 793 | 3300036401 | Ga0373937_0148550 | Ga0373937_0148550_789_2111 | 439 |
| 794 | 3300049572 | Ga0501036_0124164 | Ga0501036_0124164_116_1444 | 439 |
| 795 | 3300049591 | Ga0501075_0013598 | Ga0501075_0013598_686_2014 | 439 |
| 796 | 3300049824 | Ga0501045_0036945 | Ga0501045_0036945_1939_3267 | 439 |
| 797 | 3300061734 | Ga0530510_0114470 | Ga0530510_0114470_446_1774 | 439 |
| 798 | 3300001977 | JGI24746J21847_1008017 | JGI24746J21847_10080172 | 440 |
| 799 | 3300001991 | JGI24743J22301_10001202 | JGI24743J22301_100012023 | 440 |
| 800 | 3300005327 | Ga0070658_10142806 | Ga0070658_101428062 | 440 |
| 801 | 3300005327 | Ga0070658_10175498 | Ga0070658_101754982 | 440 |
| 802 | 3300005328 | Ga0070676_10076270 | Ga0070676_100762702 | 440 |
| 803 | 3300005329 | Ga0070683_100026839 | Ga0070683_1000268394 | 440 |
| 804 | 3300005330 | Ga0070690_100126919 | Ga0070690_1001269192 | 440 |
| 805 | 3300005334 | Ga0068869_100054919 | Ga0068869_1000549192 | 440 |
| 806 | 3300005336 | Ga0070680_100049187 | Ga0070680_1000491873 | 440 |
| 807 | 3300005338 | Ga0068868_100121061 | Ga0068868_1001210612 | 440 |
| 808 | 3300005338 | Ga0068868_100176585 | Ga0068868_1001765851 | 440 |
| 809 | 3300005339 | Ga0070660_100027463 | Ga0070660_1000274632 | 440 |
| 810 | 3300005339 | Ga0070660_100040343 | Ga0070660_1000403433 | 440 |
| 811 | 3300005339 | Ga0070660_100193411 | Ga0070660_1001934112 | 440 |
| 812 | 3300005340 | Ga0070689_100029731 | Ga0070689_1000297312 | 440 |
| 813 | 3300005343 | Ga0070687_100021134 | Ga0070687_1000211342 | 440 |
| 814 | 3300005344 | Ga0070661_100026491 | Ga0070661_1000264914 | 440 |
| 815 | 3300005344 | Ga0070661_100048573 | Ga0070661_1000485732 | 440 |
| 816 | 3300005344 | Ga0070661_100059702 | Ga0070661_1000597022 | 440 |
| 817 | 3300005345 | Ga0070692_10075970 | Ga0070692_100759702 | 440 |
| 818 | 3300005355 | Ga0070671_100006677 | Ga0070671_1000066779 | 440 |
| 819 | 3300005364 | Ga0070673_100034495 | Ga0070673_1000344954 | 440 |
| 820 | 3300005366 | Ga0070659_100002847 | Ga0070659_1000028473 | 440 |
| 821 | 3300005366 | Ga0070659_100019546 | Ga0070659_1000195462 | 440 |
| 822 | 3300005366 | Ga0070659_100028640 | Ga0070659_1000286403 | 440 |
| 823 | 3300005367 | Ga0070667_100032704 | Ga0070667_1000327043 | 440 |
| 824 | 3300005435 | Ga0070714_100244019 | Ga0070714_1002440192 | 440 |
| 825 | 3300005436 | Ga0070713_100144532 | Ga0070713_1001445322 | 440 |
| 826 | 3300005438 | Ga0070701_10006091 | Ga0070701_100060912 | 440 |
| 827 | 3300005455 | Ga0070663_100024405 | Ga0070663_1000244052 | 440 |
| 828 | 3300005456 | Ga0070678_100158819 | Ga0070678_1001588192 | 440 |
| 829 | 3300005457 | Ga0070662_100001732 | Ga0070662_1000017329 | 440 |
| 830 | 3300005458 | Ga0070681_10009151 | Ga0070681_100091514 | 440 |
| 831 | 3300005466 | Ga0070685_10002286 | Ga0070685_100022867 | 440 |
| 832 | 3300005530 | Ga0070679_100034907 | Ga0070679_1000349071 | 440 |
| 833 | 3300005535 | Ga0070684_100182835 | Ga0070684_1001828352 | 440 |
| 834 | 3300005539 | Ga0068853_100016438 | Ga0068853_1000164384 | 440 |
| 835 | 3300005539 | Ga0068853_100069432 | Ga0068853_1000694323 | 440 |
| 836 | 3300005543 | Ga0070672_100016427 | Ga0070672_1000164272 | 440 |
| 837 | 3300005543 | Ga0070672_100066775 | Ga0070672_1000667752 | 440 |
| 838 | 3300005563 | Ga0068855_100001539 | Ga0068855_10000153915 | 440 |
| 839 | 3300005563 | Ga0068855_100036094 | Ga0068855_1000360942 | 440 |
| 840 | 3300005564 | Ga0070664_100020987 | Ga0070664_1000209875 | 440 |
| 841 | 3300005564 | Ga0070664_100035837 | Ga0070664_1000358373 | 440 |
| 842 | 3300005564 | Ga0070664_100054372 | Ga0070664_1000543722 | 440 |
| 843 | 3300005564 | Ga0070664_100073314 | Ga0070664_1000733142 | 440 |
| 844 | 3300005564 | Ga0070664_100199930 | Ga0070664_1001999302 | 440 |
| 845 | 3300005578 | Ga0068854_100003803 | Ga0068854_10000380310 | 440 |
| 846 | 3300005614 | Ga0068856_100000246 | Ga0068856_10000024654 | 440 |
| 847 | 3300005614 | Ga0068856_100092988 | Ga0068856_1000929882 | 440 |
| 848 | 3300005615 | Ga0070702_100003579 | Ga0070702_1000035797 | 440 |
| 849 | 3300005616 | Ga0068852_100114988 | Ga0068852_1001149882 | 440 |
| 850 | 3300005617 | Ga0068859_100054348 | Ga0068859_1000543483 | 440 |
| 851 | 3300005618 | Ga0068864_100097316 | Ga0068864_1000973162 | 440 |
| 852 | 3300005718 | Ga0068866_10001391 | Ga0068866_1000139110 | 440 |
| 853 | 3300005719 | Ga0068861_100233909 | Ga0068861_1002339091 | 440 |
| 854 | 3300005834 | Ga0068851_10003782 | Ga0068851_100037823 | 440 |
| 855 | 3300005834 | Ga0068851_10020500 | Ga0068851_100205002 | 440 |
| 856 | 3300005840 | Ga0068870_10004781 | Ga0068870_100047812 | 440 |
| 857 | 3300005843 | Ga0068860_100221933 | Ga0068860_1002219332 | 440 |
| 858 | 3300005985 | Ga0081539_10007328 | Ga0081539_100073281 | 440 |
| 859 | 3300006881 | Ga0068865_100080660 | Ga0068865_1000806602 | 440 |
| 860 | 3300006931 | Ga0097620_100054342 | Ga0097620_1000543423 | 440 |
| 861 | 3300009093 | Ga0105240_10044820 | Ga0105240_100448202 | 440 |
| 862 | 3300009174 | Ga0105241_10007643 | Ga0105241_100076432 | 440 |
| 863 | 3300009177 | Ga0105248_10194288 | Ga0105248_101942882 | 440 |
| 864 | 3300009545 | Ga0105237_10129281 | Ga0105237_101292812 | 440 |
| 865 | 3300009551 | Ga0105238_10018081 | Ga0105238_100180816 | 440 |
| 866 | 3300009553 | Ga0105249_10102216 | Ga0105249_101022162 | 440 |
| 867 | 3300010375 | Ga0105239_10121432 | Ga0105239_101214322 | 440 |
| 868 | 3300013100 | Ga0157373_10013160 | Ga0157373_100131602 | 440 |
| 869 | 3300013100 | Ga0157373_10038402 | Ga0157373_100384022 | 440 |
| 870 | 3300013104 | Ga0157370_10096408 | Ga0157370_100964082 | 440 |
| 871 | 3300013105 | Ga0157369_10097638 | Ga0157369_100976382 | 440 |
| 872 | 3300013105 | Ga0157369_10104750 | Ga0157369_101047502 | 440 |
| 873 | 3300013105 | Ga0157369_10152905 | Ga0157369_101529052 | 440 |
| 874 | 3300013296 | Ga0157374_10008118 | Ga0157374_100081189 | 440 |
| 875 | 3300013296 | Ga0157374_10030270 | Ga0157374_100302704 | 440 |
| 876 | 3300013306 | Ga0163162_10102649 | Ga0163162_101026492 | 440 |
| 877 | 3300013307 | Ga0157372_10000342 | Ga0157372_1000034243 | 440 |
| 878 | 3300013308 | Ga0157375_10156839 | Ga0157375_101568392 | 440 |
| 879 | 3300014325 | Ga0163163_10004530 | Ga0163163_1000453010 | 440 |
| 880 | 3300014745 | Ga0157377_10001599 | Ga0157377_100015996 | 440 |
| 881 | 3300014968 | Ga0157379_10006045 | Ga0157379_100060459 | 440 |
| 882 | 3300017792 | Ga0163161_10019038 | Ga0163161_100190383 | 440 |
| 883 | 3300025315 | Ga0207697_10008831 | Ga0207697_100088312 | 440 |
| 884 | 3300025321 | Ga0207656_10004085 | Ga0207656_100040854 | 440 |
| 885 | 3300025893 | Ga0207682_10000068 | Ga0207682_1000006831 | 440 |
| 886 | 3300025901 | Ga0207688_10022024 | Ga0207688_100220242 | 440 |
| 887 | 3300025903 | Ga0207680_10042713 | Ga0207680_100427132 | 440 |
| 888 | 3300025907 | Ga0207645_10001926 | Ga0207645_100019263 | 440 |
| 889 | 3300025908 | Ga0207643_10000298 | Ga0207643_100002985 | 440 |
| 890 | 3300025909 | Ga0207705_10108792 | Ga0207705_101087922 | 440 |
| 891 | 3300025911 | Ga0207654_10008668 | Ga0207654_100086685 | 440 |
| 892 | 3300025912 | Ga0207707_10014602 | Ga0207707_100146024 | 440 |
| 893 | 3300025912 | Ga0207707_10092742 | Ga0207707_100927422 | 440 |
| 894 | 3300025912 | Ga0207707_10130569 | Ga0207707_101305692 | 440 |
| 895 | 3300025913 | Ga0207695_10077536 | Ga0207695_100775362 | 440 |
| 896 | 3300025914 | Ga0207671_10163484 | Ga0207671_101634841 | 440 |
| 897 | 3300025915 | Ga0207693_10172725 | Ga0207693_101727252 | 440 |
| 898 | 3300025917 | Ga0207660_10007424 | Ga0207660_100074243 | 440 |
| 899 | 3300025918 | Ga0207662_10005747 | Ga0207662_100057477 | 440 |
| 900 | 3300025919 | Ga0207657_10000738 | Ga0207657_100007384 | 440 |
| 901 | 3300025919 | Ga0207657_10000884 | Ga0207657_1000088424 | 440 |
| 902 | 3300025919 | Ga0207657_10013043 | Ga0207657_100130435 | 440 |
| 903 | 3300025919 | Ga0207657_10152786 | Ga0207657_101527861 | 440 |
| 904 | 3300025920 | Ga0207649_10044347 | Ga0207649_100443472 | 440 |
| 905 | 3300025921 | Ga0207652_10023610 | Ga0207652_100236101 | 440 |
| 906 | 3300025921 | Ga0207652_10046991 | Ga0207652_100469913 | 440 |
| 907 | 3300025923 | Ga0207681_10032191 | Ga0207681_100321912 | 440 |
| 908 | 3300025924 | Ga0207694_10036099 | Ga0207694_100360993 | 440 |
| 909 | 3300025925 | Ga0207650_10000654 | Ga0207650_1000065420 | 440 |
| 910 | 3300025926 | Ga0207659_10002052 | Ga0207659_100020525 | 440 |
| 911 | 3300025928 | Ga0207700_10107854 | Ga0207700_101078542 | 440 |
| 912 | 3300025929 | Ga0207664_10016442 | Ga0207664_100164422 | 440 |
| 913 | 3300025929 | Ga0207664_10032639 | Ga0207664_100326394 | 440 |
| 914 | 3300025931 | Ga0207644_10014072 | Ga0207644_100140723 | 440 |
| 915 | 3300025931 | Ga0207644_10022491 | Ga0207644_100224913 | 440 |
| 916 | 3300025931 | Ga0207644_10035393 | Ga0207644_100353933 | 440 |
| 917 | 3300025932 | Ga0207690_10000479 | Ga0207690_1000047916 | 440 |
| 918 | 3300025933 | Ga0207706_10012558 | Ga0207706_100125584 | 440 |
| 919 | 3300025935 | Ga0207709_10111637 | Ga0207709_101116372 | 440 |
| 920 | 3300025936 | Ga0207670_10105824 | Ga0207670_101058242 | 440 |
| 921 | 3300025938 | Ga0207704_10014938 | Ga0207704_100149382 | 440 |
| 922 | 3300025940 | Ga0207691_10037913 | Ga0207691_100379132 | 440 |
| 923 | 3300025940 | Ga0207691_10058242 | Ga0207691_100582422 | 440 |
| 924 | 3300025941 | Ga0207711_10055528 | Ga0207711_100555282 | 440 |
| 925 | 3300025942 | Ga0207689_10002446 | Ga0207689_100024463 | 440 |
| 926 | 3300025945 | Ga0207679_10001523 | Ga0207679_100015235 | 440 |
| 927 | 3300025945 | Ga0207679_10011900 | Ga0207679_100119004 | 440 |
| 928 | 3300025945 | Ga0207679_10092066 | Ga0207679_100920662 | 440 |
| 929 | 3300025945 | Ga0207679_10092234 | Ga0207679_100922342 | 440 |
| 930 | 3300025949 | Ga0207667_10005313 | Ga0207667_1000531312 | 440 |
| 931 | 3300025949 | Ga0207667_10045267 | Ga0207667_100452673 | 440 |
| 932 | 3300025949 | Ga0207667_10106192 | Ga0207667_101061922 | 440 |
| 933 | 3300025960 | Ga0207651_10176429 | Ga0207651_101764292 | 440 |
| 934 | 3300025961 | Ga0207712_10054459 | Ga0207712_100544592 | 440 |
| 935 | 3300025972 | Ga0207668_10027421 | Ga0207668_100274211 | 440 |
| 936 | 3300025972 | Ga0207668_10078678 | Ga0207668_100786782 | 440 |
| 937 | 3300025986 | Ga0207658_10020728 | Ga0207658_100207283 | 440 |
| 938 | 3300025986 | Ga0207658_10042139 | Ga0207658_100421393 | 440 |
| 939 | 3300026035 | Ga0207703_10040845 | Ga0207703_100408452 | 440 |
| 940 | 3300026041 | Ga0207639_10007516 | Ga0207639_100075163 | 440 |
| 941 | 3300026041 | Ga0207639_10076337 | Ga0207639_100763372 | 440 |
| 942 | 3300026067 | Ga0207678_10004104 | Ga0207678_100041043 | 440 |
| 943 | 3300026067 | Ga0207678_10086238 | Ga0207678_100862382 | 440 |
| 944 | 3300026075 | Ga0207708_10002209 | Ga0207708_1000220915 | 440 |
| 945 | 3300026078 | Ga0207702_10013149 | Ga0207702_100131492 | 440 |
| 946 | 3300026078 | Ga0207702_10014823 | Ga0207702_100148234 | 440 |
| 947 | 3300026078 | Ga0207702_10036335 | Ga0207702_100363353 | 440 |
| 948 | 3300026089 | Ga0207648_10010271 | Ga0207648_100102717 | 440 |
| 949 | 3300026095 | Ga0207676_10003822 | Ga0207676_100038226 | 440 |
| 950 | 3300026116 | Ga0207674_10012883 | Ga0207674_100128833 | 440 |
| 951 | 3300026116 | Ga0207674_10026949 | Ga0207674_100269494 | 440 |
| 952 | 3300026118 | Ga0207675_100013782 | Ga0207675_1000137824 | 440 |
| 953 | 3300026121 | Ga0207683_10003032 | Ga0207683_100030328 | 440 |
| 954 | 3300026121 | Ga0207683_10243245 | Ga0207683_102432451 | 440 |
| 955 | 3300026142 | Ga0207698_10005874 | Ga0207698_100058745 | 440 |
| 956 | 3300026142 | Ga0207698_10014584 | Ga0207698_100145844 | 440 |
| 957 | 3300026142 | Ga0207698_10025173 | Ga0207698_100251735 | 440 |
| 958 | 3300027471 | Ga0209995_1006264 | Ga0209995_10062642 | 440 |
| 959 | 3300027682 | Ga0209971_1001832 | Ga0209971_10018323 | 440 |
| 960 | 3300027695 | Ga0209966_1007433 | Ga0209966_10074331 | 440 |
| 961 | 3300027717 | Ga0209998_10006525 | Ga0209998_100065252 | 440 |
| 962 | 3300027876 | Ga0209974_10003602 | Ga0209974_100036026 | 440 |
| 963 | 3300027876 | Ga0209974_10006207 | Ga0209974_100062073 | 440 |
| 964 | 3300028379 | Ga0268266_10239306 | Ga0268266_102393062 | 440 |
| 965 | 3300031548 | Ga0307408_100014530 | Ga0307408_1000145303 | 440 |
| 966 | 3300031852 | Ga0307410_10003577 | Ga0307410_100035776 | 440 |
| 967 | 3300031901 | Ga0307406_10004541 | Ga0307406_100045414 | 440 |
| 968 | 3300031903 | Ga0307407_10015952 | Ga0307407_100159522 | 440 |
| 969 | 3300031911 | Ga0307412_10002089 | Ga0307412_100020894 | 440 |
| 970 | 3300031995 | Ga0307409_100002393 | Ga0307409_1000023933 | 440 |
| 971 | 3300032002 | Ga0307416_100003419 | Ga0307416_1000034194 | 440 |
| 972 | 3300032126 | Ga0307415_100001060 | Ga0307415_1000010603 | 440 |
| 973 | 3300035695 | Ga0373927_0110842 | Ga0373927_0110842_266_1588 | 440 |
| 974 | 3300037466 | Ga0395898_0025436 | Ga0395898_0025436_1143_2471 | 440 |
| 975 | 3300037471 | Ga0395905_0222069 | Ga0395905_0222069_109_1434 | 440 |
| 976 | 3300038443 | Ga0395901_0151691 | Ga0395901_0151691_1087_2415 | 440 |
| 977 | 3300045051 | Ga0451576_0246585 | Ga0451576_0246585_67_1392 | 440 |
| 978 | 3300048903 | Ga0496100_0068773 | Ga0496100_0068773_914_2236 | 440 |
| 979 | 3300048905 | Ga0496102_0000940 | Ga0496102_0000940_19668_20993 | 440 |
| 980 | 3300048905 | Ga0496102_0025725 | Ga0496102_0025725_289_1611 | 440 |
| 981 | 3300048907 | Ga0496104_0021309 | Ga0496104_0021309_699_2021 | 440 |
| 982 | 3300048908 | Ga0496105_0090658 | Ga0496105_0090658_1005_2327 | 440 |
| 983 | 3300048909 | Ga0496106_0026338 | Ga0496106_0026338_2901_4226 | 440 |
| 984 | 3300048910 | Ga0496107_0011010 | Ga0496107_0011010_3343_4668 | 440 |
| 985 | 3300048911 | Ga0496108_0073528 | Ga0496108_0073528_693_2015 | 440 |
| 986 | 3300048912 | Ga0496109_0001844 | Ga0496109_0001844_10180_11502 | 440 |
| 987 | 3300048913 | Ga0496110_0003683 | Ga0496110_0003683_1239_2561 | 440 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4r2f-assembly1.cif.gz_A | crystal structure of sugar transporter achl_0255 from arthrobacter chlorophenolicus a6, target efi-510633, with bound laminaribiose | 0.8451 | 43 | 435 |
| 5yse-assembly1.cif.gz_A | crystal structure of beta-1,2-glucooligosaccharide binding protein in complex with sophorotetraose | 0.8383 | 45 | 439 |
| 7c68-assembly1.cif.gz_B | crystal structure of beta-glycosides-binding protein of abc transporter in a closed state bound to cellotetraose | 0.8382 | 45 | 439 |
| 7c6x-assembly7.cif.gz_G | crystal structure of beta-glycosides-binding protein (w41a) of abc transporter in an open state (form i) | 0.8371 | 46 | 439 |
| 4r2f-assembly1.cif.gz_A | crystal structure of sugar transporter achl_0255 from arthrobacter chlorophenolicus a6, target efi-510633, with bound laminaribiose | 0.8332 | 43 | 435 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2gh9A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8238 | 45 | 389 | 3.40.190.10 |
| af_P76042_18_428_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8143 | 44 | 437 | 3.40.190.10 |
| 5ysdB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8136 | 48 | 389 | 3.40.190.10 |
| 2gh9A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8119 | 45 | 389 | 3.40.190.10 |
| 5f7vA00 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.7973 | 44 | 436 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536UQ54-F1-model_v4 | Extracellular solute-binding protein | 0.9793 | 197 | 440 |
|
| AF-A0A536UQ54-F1-model_v4 | Extracellular solute-binding protein | 0.9715 | 197 | 440 |
|
| AF-A0A528TRZ0-F1-model_v4 | Extracellular solute-binding protein | 0.9689 | 150 | 318 |
GO:0042597
|
| AF-U5N8S9-F1-model_v4 | Sugar transporter substrate-binding protein | 0.9669 | 36 | 440 |
|
| AF-A0A2H5ZTE3-F1-model_v4 | Putative ABC transporter-binding protein | 0.9647 | 31 | 440 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar