F487498

General Info

Members Datasets Scaffolds Average Seq Length
985 381 978 327

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100234974|Ga0070697_1002349741
Length 392
Sequence MSTPNQWEDPSADLAKMKILIIDDEPVNVALLEEILVEAGYTRFESPIAIHLLPVDTSALRAMVLEKTGTRLVLRDVPKPKSGRGQLLVRVNACAVCRTDLHIVDGELPDPKLPLILGHQIVGRVEQIGANTGGFSMGDRVGIPWLGWTDGDCAYCRSNRENLCDRAKFTGYNIDGGYAEFTVADARYCFHLPDEYNDVDAAPLLCAGMLGYRSYRKTGDAHRLGIYGFGNAAHLIAQVARYEKKEIYAFTRPGDKAGQESARSLGAVWSGSSDEMPPKKLDAAIIFAPVGALVPIALPALAKGGIVVCGGIHMSDIPSFPYVDLWQERVICSVANLTRRDGEEFLKIAPRVPVKTKVETFSLEEANTALEKFRAGELDGNAVLQISSRQKS

Samples

Sample ID Description Type Environment
1 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
2 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
3 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
4 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
5 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
6 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
7 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
8 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
85 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
131 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
132 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
133 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
198 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
199 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
200 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
208 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
209 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
210 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
211 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
212 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
213 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
214 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
215 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
216 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
217 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
218 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
219 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
220 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
221 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
222 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
223 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
224 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
225 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
226 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
227 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
228 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
229 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
230 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
231 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
232 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
233 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
234 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
235 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
236 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
237 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
238 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
239 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
240 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
241 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
242 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
243 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
244 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
245 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
247 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
248 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
249 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
250 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
251 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
252 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
253 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
254 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
255 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
256 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
257 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
258 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
259 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
260 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
261 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
262 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
263 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
264 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
265 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
266 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
267 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
268 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
269 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
270 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
271 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
272 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
273 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
274 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
275 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
276 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
277 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
278 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
279 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
280 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
281 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
282 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
283 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
284 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
285 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
286 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
287 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
288 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
289 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
290 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
291 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
292 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
293 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
294 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
295 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
296 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
297 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
298 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
299 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
300 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
301 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
302 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
303 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
304 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
305 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
306 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
307 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
308 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
309 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
310 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
311 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
312 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
313 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
314 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
315 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
316 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
317 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
318 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
319 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
320 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
321 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
322 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
323 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
324 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
325 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
326 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
327 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
328 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
329 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
330 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
331 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
332 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
333 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
334 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
350 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
351 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
352 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
353 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
354 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
355 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
356 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
357 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
358 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
359 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
360 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
361 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
362 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
365 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
366 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
367 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
368 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
369 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
370 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
371 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
372 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
373 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
374 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
375 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
376 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
377 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
378 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
379 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
380 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
381 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0
Isolates 0.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0.71
Rhizoplane 7.21
Rhizosphere 90.36
Stem 0
Stem Tuber 0
Unclassified 1.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10018015 3300001979 Bacteria 2515
2 JGI24751J29686_10004101 3300002459 Bacteria 2952
3 JGI25406J46586_10000020 3300003203 Bacteria 86123
4 JGI25407J50210_10001965 3300003373 Bacteria 4781
5 Ga0055530_10000616 3300003791 Bacteria 30895
6 Ga0065712_10000972 3300005290 Bacteria 11589
7 Ga0065712_10079086 3300005290 Bacteria 3242
8 Ga0065715_10090112 3300005293 Bacteria 7644
9 Ga0070658_10023375 3300005327 Bacteria 4962
10 Ga0070658_10034665 3300005327 Bacteria 4061
11 Ga0070683_100004465 3300005329 Bacteria 11546
12 Ga0070683_100028824 3300005329 Bacteria 5021
13 Ga0070683_100093827 3300005329 Bacteria 2820
14 Ga0070683_100118252 3300005329 Bacteria 2503
15 Ga0070683_100134874 3300005329 Bacteria 2337
16 Ga0070690_100096328 3300005330 Unclassified 1956
17 Ga0070690_100109132 3300005330 Bacteria 1844
18 Ga0070670_100229956 3300005331 Bacteria 1614
19 Ga0070670_100331119 3300005331 Bacteria 1335
20 Ga0068869_100276208 3300005334 Bacteria 1350
21 Ga0070666_10078870 3300005335 Bacteria 2249
22 Ga0070666_10114204 3300005335 Unclassified 1869
23 Ga0070680_100005718 3300005336 Bacteria 9433
24 Ga0070680_100051864 3300005336 Bacteria 3349
25 Ga0070682_100001145 3300005337 Bacteria 15129
26 Ga0070682_100001910 3300005337 Bacteria 11625
27 Ga0070682_100088691 3300005337 Bacteria 2019
28 Ga0068868_100057920 3300005338 Bacteria 3062
29 Ga0068868_100232349 3300005338 Bacteria 1547
30 Ga0070660_100018138 3300005339 Bacteria 5136
31 Ga0070660_100041319 3300005339 Bacteria 3514
32 Ga0070660_100052224 3300005339 Bacteria 3151
33 Ga0070689_100318705 3300005340 Bacteria 1298
34 Ga0070691_10020725 3300005341 Bacteria 3038
35 Ga0070691_10029684 3300005341 Bacteria 2559
36 Ga0070691_10031278 3300005341 Bacteria 2495
37 Ga0070687_100016835 3300005343 Bacteria 3346
38 Ga0070687_100077656 3300005343 Bacteria 1802
39 Ga0070687_100081111 3300005343 Bacteria 1770
40 Ga0070661_100001970 3300005344 Bacteria 14190
41 Ga0070661_100133020 3300005344 Bacteria 1869
42 Ga0070692_10006890 3300005345 Bacteria 4966
43 Ga0070692_10041389 3300005345 Bacteria 2360
44 Ga0070692_10057793 3300005345 Bacteria 2035
45 Ga0070669_100103757 3300005353 Bacteria 2149
46 Ga0070669_100158807 3300005353 Bacteria 1755
47 Ga0070675_100040954 3300005354 Bacteria 3783
48 Ga0070675_100043593 3300005354 Bacteria 3667
49 Ga0070675_100124403 3300005354 Bacteria 2193
50 Ga0070671_100000721 3300005355 Bacteria 23675
51 Ga0070671_100013369 3300005355 Bacteria 6616
52 Ga0070671_100015419 3300005355 Bacteria 6174
53 Ga0070671_100020832 3300005355 Bacteria 5348
54 Ga0070671_100032216 3300005355 Bacteria 4335
55 Ga0070671_100046292 3300005355 Bacteria 3617
56 Ga0070674_100002976 3300005356 Bacteria 9411
57 Ga0070674_100067667 3300005356 Bacteria 2513
58 Ga0070674_100110130 3300005356 Bacteria 2020
59 Ga0070673_100110374 3300005364 Bacteria 2280
60 Ga0070673_100384807 3300005364 Bacteria 1251
61 Ga0070688_100003448 3300005365 Bacteria 8136
62 Ga0070659_100001160 3300005366 Bacteria 19249
63 Ga0070659_100041939 3300005366 Bacteria 3578
64 Ga0070659_100074009 3300005366 Bacteria 2713
65 Ga0070659_100124234 3300005366 Bacteria 2093
66 Ga0070667_100268063 3300005367 Bacteria 1530
67 Ga0070703_10004719 3300005406 Bacteria 3812
68 Ga0070703_10007507 3300005406 Bacteria 3064
69 Ga0070714_100215502 3300005435 Bacteria 1762
70 Ga0070714_100317498 3300005435 Bacteria 1456
71 Ga0070713_100221249 3300005436 Bacteria 1717
72 Ga0070701_10002582 3300005438 Bacteria 7018
73 Ga0070701_10006123 3300005438 Bacteria 5039
74 Ga0070701_10032141 3300005438 Bacteria 2611
75 Ga0070711_100006940 3300005439 Bacteria 6867
76 Ga0070711_100014729 3300005439 Bacteria 4934
77 Ga0070711_100271064 3300005439 Bacteria 1339
78 Ga0070705_100000881 3300005440 Bacteria 16765
79 Ga0070705_100040413 3300005440 Bacteria 2652
80 Ga0070705_100080907 3300005440 Bacteria 1994
81 Ga0070700_100001269 3300005441 Bacteria 12511
82 Ga0070700_100004770 3300005441 Bacteria 7113
83 Ga0070694_100002877 3300005444 Bacteria 10227
84 Ga0070708_100002831 3300005445 Bacteria 13475
85 Ga0070708_100017122 3300005445 Bacteria 6036
86 Ga0070708_100025104 3300005445 Bacteria 5092
87 Ga0070708_100035261 3300005445 Bacteria 4358
88 Ga0070708_100044283 3300005445 Bacteria 3913
89 Ga0070708_100052038 3300005445 Bacteria 3630
90 Ga0070708_100167876 3300005445 Unclassified 2048
91 Ga0070708_100183291 3300005445 Bacteria 1957
92 Ga0070708_100189274 3300005445 Unclassified 1925
93 Ga0070663_100000397 3300005455 Bacteria 22854
94 Ga0070663_100001866 3300005455 Bacteria 11755
95 Ga0070663_100003977 3300005455 Bacteria 8625
96 Ga0070663_100037531 3300005455 Bacteria 3374
97 Ga0070663_100038767 3300005455 Bacteria 3326
98 Ga0070678_100001787 3300005456 Bacteria 11583
99 Ga0070678_100074181 3300005456 Bacteria 2556
100 Ga0070678_100243943 3300005456 Bacteria 1503
101 Ga0070662_100000100 3300005457 Bacteria 47285
102 Ga0070662_100018534 3300005457 Bacteria 4710
103 Ga0070662_100045477 3300005457 Bacteria 3150
104 Ga0070681_10023008 3300005458 Bacteria 6264
105 Ga0070681_10119209 3300005458 Bacteria 2575
106 Ga0068867_100017764 3300005459 Bacteria 5050
107 Ga0068867_100233174 3300005459 Bacteria 1489
108 Ga0070685_10038191 3300005466 Bacteria 2723
109 Ga0070706_100000012 3300005467 Bacteria 195040
110 Ga0070706_100006380 3300005467 Bacteria 11140
111 Ga0070706_100009989 3300005467 Bacteria 8814
112 Ga0070706_100014995 3300005467 Bacteria 7156
113 Ga0070706_100024717 3300005467 Bacteria 5531
114 Ga0070706_100046515 3300005467 Bacteria 4005
115 Ga0070706_100079433 3300005467 Bacteria 3036
116 Ga0070706_100220454 3300005467 Unclassified 1771
117 Ga0070707_100006597 3300005468 Bacteria 10768
118 Ga0070707_100014120 3300005468 Bacteria 7484
119 Ga0070707_100033073 3300005468 Bacteria 4930
120 Ga0070707_100056212 3300005468 Bacteria 3774
121 Ga0070707_100136307 3300005468 Bacteria 2388
122 Ga0070707_100161725 3300005468 Bacteria 2182
123 Ga0070707_100403267 3300005468 Bacteria 1327
124 Ga0070698_100002676 3300005471 Bacteria 19643
125 Ga0070698_100069064 3300005471 Bacteria 3549
126 Ga0070699_100000027 3300005518 Bacteria 157339
127 Ga0070699_100004759 3300005518 Bacteria 12000
128 Ga0070699_100044292 3300005518 Bacteria 3853
129 Ga0070699_100053187 3300005518 Bacteria 3505
130 Ga0070699_100145489 3300005518 Bacteria 2094
131 Ga0070699_100188321 3300005518 Bacteria 1833
132 Ga0070679_100005694 3300005530 Bacteria 11548
133 Ga0070679_100015999 3300005530 Bacteria 7224
134 Ga0070679_100060514 3300005530 Bacteria 3774
135 Ga0070679_100144124 3300005530 Unclassified 2360
136 Ga0070679_100351872 3300005530 Bacteria 1421
137 Ga0070684_100002710 3300005535 Bacteria 13088
138 Ga0070684_100104688 3300005535 Bacteria 2531
139 Ga0070684_100122981 3300005535 Bacteria 2335
140 Ga0070697_100005109 3300005536 Bacteria 10075
141 Ga0070697_100006313 3300005536 Bacteria 9175
142 Ga0070697_100009361 3300005536 Bacteria 7654
143 Ga0070697_100106410 3300005536 Bacteria 2333
144 Ga0070697_100170445 3300005536 Bacteria 1842
145 Ga0070697_100234974 3300005536 Bacteria 1564
146 Ga0070697_100284637 3300005536 Bacteria 1419
147 Ga0068853_100003192 3300005539 Bacteria 12518
148 Ga0068853_100054701 3300005539 Bacteria 3440
149 Ga0068853_100080731 3300005539 Bacteria 2847
150 Ga0068853_100089858 3300005539 Bacteria 2698
151 Ga0070672_100041432 3300005543 Bacteria 3540
152 Ga0070672_100221061 3300005543 Bacteria 1589
153 Ga0070686_100004327 3300005544 Bacteria 7821
154 Ga0070686_100120388 3300005544 Bacteria 1801
155 Ga0070695_100000709 3300005545 Bacteria 17793
156 Ga0070695_100010513 3300005545 Bacteria 5526
157 Ga0070696_100000030 3300005546 Bacteria 65862
158 Ga0070696_100014405 3300005546 Bacteria 5304
159 Ga0070696_100016003 3300005546 Bacteria 5044
160 Ga0070696_100035703 3300005546 Bacteria 3424
161 Ga0070693_100008913 3300005547 Bacteria 4977
162 Ga0070665_100019259 3300005548 Bacteria 6847
163 Ga0070665_100020556 3300005548 Bacteria 6633
164 Ga0070704_100001841 3300005549 Bacteria 11695
165 Ga0070704_100003174 3300005549 Bacteria 9388
166 Ga0070704_100061791 3300005549 Bacteria 2683
167 Ga0068855_100005251 3300005563 Bacteria 15805
168 Ga0068855_100005342 3300005563 Bacteria 15677
169 Ga0068855_100257178 3300005563 Bacteria 1946
170 Ga0068855_100283357 3300005563 Bacteria 1839
171 Ga0068855_100305527 3300005563 Bacteria 1761
172 Ga0068855_100488794 3300005563 Bacteria 1339
173 Ga0070664_100022826 3300005564 Bacteria 5161
174 Ga0070664_100040904 3300005564 Bacteria 3910
175 Ga0070664_100196287 3300005564 Bacteria 1799
176 Ga0070664_100275820 3300005564 Bacteria 1515
177 Ga0068857_100004812 3300005577 Bacteria 11448
178 Ga0068857_100024027 3300005577 Bacteria 5365
179 Ga0068857_100027959 3300005577 Bacteria 4973
180 Ga0068857_100045962 3300005577 Bacteria 3874
181 Ga0068854_100012066 3300005578 Bacteria 5649
182 Ga0068854_100257759 3300005578 Bacteria 1395
183 Ga0068856_100003147 3300005614 Bacteria 16825
184 Ga0068856_100032450 3300005614 Bacteria 5112
185 Ga0068856_100044448 3300005614 Bacteria 4372
186 Ga0068856_100118775 3300005614 Bacteria 2645
187 Ga0068856_100179136 3300005614 Bacteria 2132
188 Ga0070702_100002363 3300005615 Bacteria 8111
189 Ga0070702_100132272 3300005615 Bacteria 1577
190 Ga0070702_100221700 3300005615 Bacteria 1265
191 Ga0068852_100074045 3300005616 Bacteria 2998
192 Ga0068852_100111522 3300005616 Bacteria 2487
193 Ga0068852_100428436 3300005616 Bacteria 1306
194 Ga0068859_100007999 3300005617 Bacteria 10718
195 Ga0068859_100030934 3300005617 Bacteria 5372
196 Ga0068859_100233940 3300005617 Bacteria 1926
197 Ga0068864_100003858 3300005618 Bacteria 12347
198 Ga0068864_100009894 3300005618 Bacteria 7865
199 Ga0068864_100211584 3300005618 Bacteria 1786
200 Ga0068866_10001230 3300005718 Bacteria 11100
201 Ga0068861_100054596 3300005719 Bacteria 3044
202 Ga0068861_100104510 3300005719 Bacteria 2260
203 Ga0068863_100015479 3300005841 Bacteria 7331
204 Ga0068863_100210726 3300005841 Bacteria 1871
205 Ga0068858_100159240 3300005842 Bacteria 2125
206 Ga0068860_100030669 3300005843 Bacteria 5171
207 Ga0068860_100154840 3300005843 Bacteria 2209
208 Ga0068862_100001754 3300005844 Bacteria 19637
209 Ga0081455_10001493 3300005937 Bacteria 28933
210 Ga0081455_10002866 3300005937 Bacteria 20313
211 Ga0081455_10003938 3300005937 Bacteria 16882
212 Ga0081455_10008953 3300005937 Bacteria 10344
213 Ga0081455_10011367 3300005937 Bacteria 8948
214 Ga0081455_10045162 3300005937 Bacteria 3836
215 Ga0081455_10083038 3300005937 Bacteria 2619
216 Ga0081538_10003492 3300005981 Bacteria 14837
217 Ga0081540_1000585 3300005983 Bacteria 35126
218 Ga0081540_1001783 3300005983 Bacteria 18056
219 Ga0081539_10000052 3300005985 Bacteria 268240
220 Ga0081539_10072198 3300005985 Bacteria 1846
221 Ga0070717_10008392 3300006028 Bacteria 7714
222 Ga0070715_10067728 3300006163 Bacteria 1586
223 Ga0070715_10181148 3300006163 Bacteria 1056
224 Ga0070716_100013085 3300006173 Bacteria 4221
225 Ga0070712_100034018 3300006175 Bacteria 3452
226 Ga0070712_100040764 3300006175 Bacteria 3185
227 Ga0070712_100047468 3300006175 Bacteria 2972
228 Ga0070712_100186355 3300006175 Bacteria 1620
229 Ga0097621_100165858 3300006237 Bacteria 1902
230 Ga0068871_100008531 3300006358 Bacteria 7365
231 Ga0068871_100087671 3300006358 Bacteria 2588
232 Ga0075428_100016349 3300006844 Bacteria 8200
233 Ga0075428_100036166 3300006844 Bacteria 5441
234 Ga0075431_100004258 3300006847 Bacteria 14009
235 Ga0075431_100010384 3300006847 Bacteria 9357
236 Ga0075431_100063842 3300006847 Bacteria 3801
237 Ga0075433_10036694 3300006852 Bacteria 4224
238 Ga0075434_100021543 3300006871 Bacteria 6265
239 Ga0075434_100030081 3300006871 Bacteria 5346
240 Ga0075434_100177238 3300006871 Bacteria 2152
241 Ga0075434_100193945 3300006871 Bacteria 2052
242 Ga0068865_100006647 3300006881 Bacteria 7075
243 Ga0075436_100012599 3300006914 Bacteria 5793
244 Ga0075436_100152805 3300006914 Bacteria 1625
245 Ga0097620_100007999 3300006931 Bacteria 10718
246 Ga0097620_100030934 3300006931 Bacteria 5372
247 Ga0097620_100233930 3300006931 Bacteria 1926
248 Ga0099824_1013620 3300006942 Bacteria 8377
249 Ga0075435_100089765 3300007076 Bacteria 2534
250 Ga0075435_100152481 3300007076 Bacteria 1944
251 Ga0099794_10000326 3300007265 Bacteria 16332
252 Ga0105240_10003453 3300009093 Bacteria 24519
253 Ga0105240_10005589 3300009093 Bacteria 18679
254 Ga0105240_10021548 3300009093 Bacteria 8570
255 Ga0105240_10179685 3300009093 Bacteria 2498
256 Ga0105240_10189937 3300009093 Bacteria 2416
257 Ga0105240_10302017 3300009093 Bacteria 1831
258 Ga0111539_10496737 3300009094 Bacteria 1421
259 Ga0105245_10030311 3300009098 Bacteria 4783
260 Ga0105245_10033847 3300009098 Bacteria 4529
261 Ga0105245_10317228 3300009098 Bacteria 1534
262 Ga0105247_10031929 3300009101 Bacteria 3198
263 Ga0114129_10004027 3300009147 Bacteria 20738
264 Ga0114129_10009722 3300009147 Bacteria 13721
265 Ga0114129_10062912 3300009147 Bacteria 5183
266 Ga0114129_10104050 3300009147 Bacteria 3923
267 Ga0114129_10228476 3300009147 Bacteria 2507
268 Ga0105243_10012348 3300009148 Bacteria 6458
269 Ga0105243_10015705 3300009148 Bacteria 5726
270 Ga0105243_10096694 3300009148 Bacteria 2443
271 Ga0105241_10001532 3300009174 Bacteria 17707
272 Ga0105241_10189001 3300009174 Bacteria 1713
273 Ga0105242_10002478 3300009176 Bacteria 14477
274 Ga0105248_10000678 3300009177 Bacteria 38605
275 Ga0105248_10009353 3300009177 Bacteria 10786
276 Ga0105248_10026767 3300009177 Bacteria 6414
277 Ga0105248_10070017 3300009177 Bacteria 3940
278 Ga0105248_10126579 3300009177 Bacteria 2882
279 Ga0105237_10031477 3300009545 Bacteria 5379
280 Ga0105237_10035959 3300009545 Bacteria 5010
281 Ga0105237_10191567 3300009545 Bacteria 2045
282 Ga0105237_10236066 3300009545 Bacteria 1830
283 Ga0105237_10258997 3300009545 Bacteria 1742
284 Ga0105238_10049920 3300009551 Bacteria 4212
285 Ga0105249_10001814 3300009553 Bacteria 18579
286 Ga0105249_10027834 3300009553 Bacteria 5101
287 Ga0105249_10050268 3300009553 Bacteria 3801
288 Ga0105239_10007473 3300010375 Bacteria 12539
289 Ga0105239_10020777 3300010375 Bacteria 7245
290 Ga0105239_10104541 3300010375 Bacteria 3135
291 Ga0105239_10451819 3300010375 Bacteria 1458
292 Ga0105239_10590234 3300010375 Bacteria 1267
293 Ga0105246_10022640 3300011119 Bacteria 4056
294 Ga0157373_10007561 3300013100 Bacteria 8074
295 Ga0157373_10011891 3300013100 Bacteria 6394
296 Ga0157373_10068938 3300013100 Bacteria 2500
297 Ga0157371_10000519 3300013102 Bacteria 46108
298 Ga0157371_10059902 3300013102 Unclassified 2699
299 Ga0157370_10007274 3300013104 Bacteria 12080
300 Ga0157370_10007847 3300013104 Bacteria 11566
301 Ga0157370_10060465 3300013104 Bacteria 3597
302 Ga0157369_10000446 3300013105 Bacteria 54687
303 Ga0157369_10036941 3300013105 Bacteria 5350
304 Ga0157369_10070248 3300013105 Bacteria 3762
305 Ga0157374_10005832 3300013296 Bacteria 10406
306 Ga0157374_10006763 3300013296 Bacteria 9749
307 Ga0157374_10064162 3300013296 Bacteria 3446
308 Ga0157374_10109303 3300013296 Bacteria 2658
309 Ga0157374_10133049 3300013296 Bacteria 2408
310 Ga0157374_10189179 3300013296 Bacteria 2013
311 Ga0157378_10001394 3300013297 Bacteria 21726
312 Ga0157378_10016784 3300013297 Bacteria 6416
313 Ga0157378_10032587 3300013297 Bacteria 4605
314 Ga0157378_10035108 3300013297 Bacteria 4434
315 Ga0157378_10262048 3300013297 Bacteria 1659
316 Ga0163162_10002009 3300013306 Bacteria 19140
317 Ga0157372_10012255 3300013307 Bacteria 9131
318 Ga0157372_10123775 3300013307 Bacteria 2972
319 Ga0157372_10262395 3300013307 Bacteria 2006
320 Ga0157375_10197358 3300013308 Bacteria 2168
321 Ga0157375_10274660 3300013308 Bacteria 1847
322 Ga0157375_10508447 3300013308 Bacteria 1369
323 Ga0157375_10571288 3300013308 Bacteria 1291
324 Ga0163163_10044532 3300014325 Bacteria 4354
325 Ga0157380_10081078 3300014326 Bacteria 2653
326 Ga0157380_10409641 3300014326 Bacteria 1289
327 Ga0182008_10097795 3300014497 Bacteria 1449
328 Ga0157376_10002533 3300014969 Bacteria 12385
329 Ga0157376_10020308 3300014969 Bacteria 5137
330 Ga0213876_10000412 3300021384 Bacteria 35878
331 Ga0213875_10000007 3300021388 Bacteria 562717
332 Ga0224572_1010860 3300024225 Bacteria 1718
333 Ga0207426_1024319 3300025302 Bacteria 2057
334 Ga0207656_10068084 3300025321 Bacteria 1577
335 Ga0207653_10004551 3300025885 Bacteria 4348
336 Ga0207692_10056960 3300025898 Unclassified 2007
337 Ga0207642_10001203 3300025899 Bacteria 7995
338 Ga0207710_10043175 3300025900 Bacteria 2005
339 Ga0207688_10030810 3300025901 Bacteria 2959
340 Ga0207680_10116532 3300025903 Bacteria 1741
341 Ga0207680_10125030 3300025903 Bacteria 1687
342 Ga0207680_10278301 3300025903 Unclassified 1162
343 Ga0207647_10003843 3300025904 Bacteria 11235
344 Ga0207647_10008571 3300025904 Bacteria 7318
345 Ga0207647_10028865 3300025904 Bacteria 3598
346 Ga0207685_10021158 3300025905 Bacteria 2175
347 Ga0207699_10272933 3300025906 Bacteria 1172
348 Ga0207645_10005412 3300025907 Bacteria 9258
349 Ga0207645_10007535 3300025907 Bacteria 7679
350 Ga0207705_10013584 3300025909 Bacteria 5877
351 Ga0207705_10023953 3300025909 Bacteria 4356
352 Ga0207684_10000028 3300025910 Bacteria 306450
353 Ga0207684_10004597 3300025910 Bacteria 12966
354 Ga0207684_10005982 3300025910 Bacteria 11129
355 Ga0207684_10007109 3300025910 Bacteria 10117
356 Ga0207684_10019108 3300025910 Bacteria 5861
357 Ga0207684_10021323 3300025910 Bacteria 5531
358 Ga0207684_10067231 3300025910 Bacteria 3045
359 Ga0207684_10099636 3300025910 Bacteria 2482
360 Ga0207707_10004133 3300025912 Bacteria 12863
361 Ga0207707_10013783 3300025912 Bacteria 7050
362 Ga0207707_10142118 3300025912 Bacteria 2098
363 Ga0207707_10187540 3300025912 Bacteria 1805
364 Ga0207695_10041027 3300025913 Bacteria 4955
365 Ga0207695_10082248 3300025913 Bacteria 3257
366 Ga0207695_10137527 3300025913 Bacteria 2395
367 Ga0207695_10145623 3300025913 Bacteria 2313
368 Ga0207695_10388196 3300025913 Bacteria 1281
369 Ga0207671_10019228 3300025914 Bacteria 5227
370 Ga0207671_10179351 3300025914 Bacteria 1648
371 Ga0207671_10356497 3300025914 Bacteria 1160
372 Ga0207693_10002251 3300025915 Bacteria 16788
373 Ga0207693_10037971 3300025915 Bacteria 3794
374 Ga0207693_10043720 3300025915 Bacteria 3522
375 Ga0207663_10019692 3300025916 Bacteria 3808
376 Ga0207663_10153594 3300025916 Unclassified 1617
377 Ga0207663_10198662 3300025916 Bacteria 1445
378 Ga0207660_10009213 3300025917 Bacteria 6387
379 Ga0207660_10013920 3300025917 Bacteria 5278
380 Ga0207660_10035529 3300025917 Bacteria 3461
381 Ga0207660_10165683 3300025917 Bacteria 1708
382 Ga0207662_10067724 3300025918 Bacteria 2154
383 Ga0207662_10101803 3300025918 Bacteria 1781
384 Ga0207657_10000420 3300025919 Bacteria 45042
385 Ga0207657_10003570 3300025919 Bacteria 16599
386 Ga0207657_10017351 3300025919 Bacteria 6905
387 Ga0207657_10022872 3300025919 Bacteria 5835
388 Ga0207657_10027113 3300025919 Bacteria 5252
389 Ga0207657_10027978 3300025919 Bacteria 5152
390 Ga0207657_10114206 3300025919 Bacteria 2227
391 Ga0207649_10002746 3300025920 Bacteria 9749
392 Ga0207649_10175789 3300025920 Bacteria 1495
393 Ga0207652_10007755 3300025921 Bacteria 8623
394 Ga0207652_10017772 3300025921 Bacteria 5825
395 Ga0207646_10020654 3300025922 Bacteria 6100
396 Ga0207646_10022826 3300025922 Bacteria 5754
397 Ga0207646_10046252 3300025922 Bacteria 3905
398 Ga0207646_10124745 3300025922 Bacteria 2315
399 Ga0207646_10343735 3300025922 Bacteria 1348
400 Ga0207681_10137741 3300025923 Bacteria 1814
401 Ga0207694_10012057 3300025924 Bacteria 6518
402 Ga0207650_10085688 3300025925 Bacteria 2397
403 Ga0207659_10116169 3300025926 Bacteria 2042
404 Ga0207687_10035887 3300025927 Bacteria 3375
405 Ga0207687_10070667 3300025927 Bacteria 2492
406 Ga0207687_10184688 3300025927 Bacteria 1618
407 Ga0207700_10022334 3300025928 Unclassified 4340
408 Ga0207700_10446364 3300025928 Bacteria 1139
409 Ga0207664_10106352 3300025929 Unclassified 2326
410 Ga0207664_10274401 3300025929 Bacteria 1478
411 Ga0207664_10424914 3300025929 Bacteria 1184
412 Ga0207644_10055646 3300025931 Bacteria 2852
413 Ga0207644_10067421 3300025931 Bacteria 2608
414 Ga0207644_10069404 3300025931 Bacteria 2573
415 Ga0207644_10083858 3300025931 Bacteria 2361
416 Ga0207690_10000043 3300025932 Bacteria 119547
417 Ga0207690_10024907 3300025932 Bacteria 3752
418 Ga0207690_10032999 3300025932 Bacteria 3326
419 Ga0207690_10057079 3300025932 Bacteria 2636
420 Ga0207690_10091256 3300025932 Bacteria 2153
421 Ga0207706_10002041 3300025933 Bacteria 19804
422 Ga0207706_10032471 3300025933 Bacteria 4649
423 Ga0207706_10140416 3300025933 Bacteria 2125
424 Ga0207686_10002827 3300025934 Bacteria 9374
425 Ga0207709_10002160 3300025935 Bacteria 12592
426 Ga0207670_10060833 3300025936 Bacteria 2574
427 Ga0207669_10002299 3300025937 Bacteria 8127
428 Ga0207669_10074887 3300025937 Bacteria 2143
429 Ga0207669_10110976 3300025937 Bacteria 1838
430 Ga0207704_10022889 3300025938 Bacteria 3357
431 Ga0207665_10040605 3300025939 Bacteria 3105
432 Ga0207665_10106440 3300025939 Bacteria 1965
433 Ga0207665_10111239 3300025939 Bacteria 1925
434 Ga0207665_10276793 3300025939 Unclassified 1248
435 Ga0207711_10000762 3300025941 Bacteria 31637
436 Ga0207711_10020386 3300025941 Bacteria 5527
437 Ga0207711_10191464 3300025941 Bacteria 1864
438 Ga0207689_10049102 3300025942 Bacteria 3482
439 Ga0207661_10049429 3300025944 Bacteria 3347
440 Ga0207661_10060499 3300025944 Bacteria 3056
441 Ga0207661_10079270 3300025944 Bacteria 2706
442 Ga0207661_10097021 3300025944 Bacteria 2467
443 Ga0207679_10012735 3300025945 Bacteria 5493
444 Ga0207679_10199796 3300025945 Bacteria 1669
445 Ga0207679_10487482 3300025945 Bacteria 1098
446 Ga0207667_10002233 3300025949 Bacteria 24327
447 Ga0207667_10010740 3300025949 Bacteria 10680
448 Ga0207667_10028104 3300025949 Bacteria 6111
449 Ga0207667_10044182 3300025949 Bacteria 4723
450 Ga0207667_10079623 3300025949 Bacteria 3396
451 Ga0207667_10097935 3300025949 Bacteria 3027
452 Ga0207667_10182149 3300025949 Bacteria 2157
453 Ga0207667_10514159 3300025949 Bacteria 1213
454 Ga0207651_10098023 3300025960 Bacteria 2166
455 Ga0207651_10192470 3300025960 Bacteria 1628
456 Ga0207712_10000667 3300025961 Bacteria 26651
457 Ga0207712_10020467 3300025961 Bacteria 4332
458 Ga0207712_10022707 3300025961 Bacteria 4135
459 Ga0207712_10276496 3300025961 Bacteria 1369
460 Ga0207668_10129137 3300025972 Bacteria 1927
461 Ga0207640_10015620 3300025981 Bacteria 4400
462 Ga0207640_10022159 3300025981 Bacteria 3797
463 Ga0207658_10038578 3300025986 Bacteria 3442
464 Ga0207658_10259098 3300025986 Bacteria 1481
465 Ga0207677_10026863 3300026023 Bacteria 3616
466 Ga0207677_10141141 3300026023 Bacteria 1844
467 Ga0207703_10077754 3300026035 Bacteria 2755
468 Ga0207703_10095494 3300026035 Bacteria 2508
469 Ga0207639_10002164 3300026041 Bacteria 13226
470 Ga0207639_10019890 3300026041 Bacteria 4797
471 Ga0207639_10085664 3300026041 Bacteria 2506
472 Ga0207639_10208441 3300026041 Bacteria 1681
473 Ga0207678_10003000 3300026067 Bacteria 15264
474 Ga0207678_10006407 3300026067 Bacteria 10454
475 Ga0207678_10012988 3300026067 Bacteria 7310
476 Ga0207678_10016828 3300026067 Bacteria 6421
477 Ga0207708_10000321 3300026075 Bacteria 37920
478 Ga0207702_10005057 3300026078 Bacteria 11580
479 Ga0207702_10019131 3300026078 Bacteria 5667
480 Ga0207702_10056522 3300026078 Bacteria 3332
481 Ga0207702_10103461 3300026078 Bacteria 2519
482 Ga0207641_10060610 3300026088 Bacteria 3225
483 Ga0207641_10113230 3300026088 Bacteria 2409
484 Ga0207648_10000214 3300026089 Bacteria 62323
485 Ga0207648_10148162 3300026089 Bacteria 2071
486 Ga0207648_10149687 3300026089 Bacteria 2059
487 Ga0207676_10003644 3300026095 Bacteria 10896
488 Ga0207676_10021565 3300026095 Bacteria 4727
489 Ga0207676_10034294 3300026095 Bacteria 3842
490 Ga0207674_10002976 3300026116 Bacteria 21037
491 Ga0207674_10014624 3300026116 Bacteria 8656
492 Ga0207674_10049444 3300026116 Bacteria 4300
493 Ga0207674_10055760 3300026116 Bacteria 4016
494 Ga0207674_10068794 3300026116 Bacteria 3563
495 Ga0207674_10224347 3300026116 Bacteria 1828
496 Ga0207675_100050099 3300026118 Bacteria 3897
497 Ga0207675_100123393 3300026118 Bacteria 2452
498 Ga0207675_100149024 3300026118 Bacteria 2226
499 Ga0207675_100172685 3300026118 Bacteria 2067
500 Ga0207683_10003051 3300026121 Bacteria 14646
501 Ga0207683_10059808 3300026121 Bacteria 3347
502 Ga0207683_10128929 3300026121 Bacteria 2274
503 Ga0207698_10002617 3300026142 Bacteria 10699
504 Ga0207698_10043170 3300026142 Bacteria 3376
505 Ga0207698_10170483 3300026142 Bacteria 1916
506 Ga0207698_10306357 3300026142 Bacteria 1481
507 Ga0209389_1000676 3300027296 Bacteria 21221
508 Ga0209589_1005614 3300027357 Bacteria 21221
509 Ga0209489_100192 3300027361 Bacteria 98028
510 Ga0209981_1001073 3300027378 Bacteria 3480
511 Ga0209999_1006589 3300027543 Bacteria 2086
512 Ga0209588_1000287 3300027671 Bacteria 13327
513 Ga0207428_10005685 3300027907 Bacteria 11588
514 Ga0207428_10050740 3300027907 Bacteria 3317
515 Ga0268266_10021111 3300028379 Bacteria 5548
516 Ga0268265_10002645 3300028380 Bacteria 13295
517 Ga0268265_10044959 3300028380 Bacteria 3292
518 Ga0268264_10007304 3300028381 Bacteria 9240
519 Ga0268264_10036627 3300028381 Bacteria 4043
520 Ga0268264_10046483 3300028381 Bacteria 3605
521 Ga0265319_1000005 3300028563 Bacteria 249025
522 Ga0307515_10128015 3300028794 Unclassified 2820
523 Ga0265338_10019630 3300028800 Bacteria 7155
524 Ga0265338_10024577 3300028800 Bacteria 6150
525 Ga0265332_10003415 3300031238 Bacteria 7676
526 Ga0265320_10003891 3300031240 Bacteria 9874
527 Ga0265325_10019011 3300031241 Bacteria 3806
528 Ga0265329_10005833 3300031242 Bacteria 4942
529 Ga0265340_10018468 3300031247 Bacteria 3596
530 Ga0265339_10016294 3300031249 Bacteria 4434
531 Ga0265331_10008726 3300031250 Bacteria 5744
532 Ga0265327_10000384 3300031251 Bacteria 83284
533 Ga0265316_10002294 3300031344 Bacteria 20005
534 Ga0265316_10007923 3300031344 Bacteria 9937
535 Ga0307408_100110709 3300031548 Bacteria 2109
536 Ga0265313_10000044 3300031595 Bacteria 117063
537 Ga0265313_10012835 3300031595 Bacteria 5083
538 Ga0265314_10003142 3300031711 Bacteria 16199
539 Ga0265314_10034195 3300031711 Bacteria 3718
540 Ga0265314_10070148 3300031711 Bacteria 2349
541 Ga0316576_10016157 3300031727 Bacteria 5032
542 Ga0316578_10027278 3300031728 Bacteria 3227
543 Ga0307405_10003454 3300031731 Bacteria 7254
544 Ga0307410_10155457 3300031852 Bacteria 1708
545 Ga0307407_10016068 3300031903 Bacteria 3719
546 Ga0307407_10033881 3300031903 Bacteria 2790
547 Ga0307409_100004647 3300031995 Bacteria 7758
548 Ga0307409_100011526 3300031995 Bacteria 5581
549 Ga0307409_100027326 3300031995 Bacteria 4041
550 Ga0307409_100042389 3300031995 Bacteria 3408
551 Ga0307416_100000623 3300032002 Bacteria 18266
552 Ga0307416_100013464 3300032002 Bacteria 5560
553 Ga0307416_100017520 3300032002 Bacteria 5015
554 Ga0307414_10013692 3300032004 Bacteria 4838
555 Ga0307414_10015850 3300032004 Bacteria 4563
556 Ga0307415_100000256 3300032126 Bacteria 23002
557 Ga0307415_100006916 3300032126 Bacteria 6159
558 Ga0307415_100077036 3300032126 Bacteria 2366
559 Ga0307415_100100564 3300032126 Bacteria 2119
560 Ga0316583_10017380 3300032133 Bacteria 2587
561 Ga0373948_0013710 3300034817 Bacteria 1468
562 Ga0373929_0004162 3300035085 Bacteria 2597
563 Ga0373923_0002168 3300035111 Bacteria 5958
564 Ga0373954_0120648 3300035118 Bacteria 1272
565 Ga0373943_0049256 3300035170 Bacteria 2067
566 Ga0373961_0004269 3300035241 Bacteria 3463
567 Ga0316574_0098796 3300035398 Bacteria 1867
568 Ga0373931_0022373 3300035691 Bacteria 3181
569 Ga0373931_0025681 3300035691 Unclassified 2992
570 Ga0373931_0064125 3300035691 Bacteria 1988
571 Ga0373931_0163912 3300035691 Bacteria 1305
572 Ga0373931_0227959 3300035691 Bacteria 1124
573 Ga0373927_0001790 3300035695 Bacteria 16043
574 Ga0373927_0072921 3300035695 Bacteria 2223
575 Ga0373947_0067658 3300035725 Bacteria 2183
576 Ga0373937_0097073 3300036401 Bacteria 2733
577 Ga0316582_0004251 3300036647 Bacteria 7195
578 Ga0316584_0009352 3300036712 Bacteria 6797
579 Ga0373925_0444600 3300037068 Bacteria 1061
580 Ga0395899_0000103 3300037312 Bacteria 147274
581 Ga0395899_0010984 3300037312 Bacteria 6935
582 Ga0395899_0011626 3300037312 Bacteria 6736
583 Ga0395899_0027843 3300037312 Bacteria 4257
584 Ga0395899_0117109 3300037312 Bacteria 1911
585 Ga0395899_0148931 3300037312 Bacteria 1660
586 Ga0395899_0157022 3300037312 Bacteria 1609
587 Ga0395899_0169415 3300037312 Bacteria 1538
588 Ga0395900_0002384 3300037418 Bacteria 20759
589 Ga0395900_0002717 3300037418 Bacteria 19339
590 Ga0395900_0003073 3300037418 Bacteria 18154
591 Ga0395900_0016026 3300037418 Bacteria 7636
592 Ga0395900_0023201 3300037418 Bacteria 6351
593 Ga0395900_0046164 3300037418 Bacteria 4486
594 Ga0395900_0047090 3300037418 Bacteria 4440
595 Ga0395900_0058657 3300037418 Bacteria 3962
596 Ga0395900_0101453 3300037418 Bacteria 2956
597 Ga0395900_0103496 3300037418 Bacteria 2924
598 Ga0395900_0114137 3300037418 Bacteria 2772
599 Ga0395900_0178595 3300037418 Bacteria 2159
600 Ga0395900_0237484 3300037418 Bacteria 1830
601 Ga0395898_0000053 3300037466 Bacteria 279600
602 Ga0395898_0002898 3300037466 Bacteria 19522
603 Ga0395898_0007983 3300037466 Bacteria 11228
604 Ga0395898_0012329 3300037466 Bacteria 8840
605 Ga0395898_0014617 3300037466 Bacteria 8062
606 Ga0395898_0024232 3300037466 Bacteria 6121
607 Ga0395898_0052265 3300037466 Bacteria 3992
608 Ga0395898_0081494 3300037466 Bacteria 3120
609 Ga0395898_0129444 3300037466 Bacteria 2418
610 Ga0395898_0249665 3300037466 Bacteria 1692
611 Ga0395898_0257387 3300037466 Bacteria 1664
612 Ga0395898_0348051 3300037466 Bacteria 1413
613 Ga0395905_0000031 3300037471 Bacteria 286757
614 Ga0395905_0002933 3300037471 Bacteria 18555
615 Ga0395905_0011028 3300037471 Bacteria 8744
616 Ga0395905_0012385 3300037471 Bacteria 8211
617 Ga0395905_0014041 3300037471 Bacteria 7658
618 Ga0395905_0017320 3300037471 Bacteria 6841
619 Ga0395905_0019078 3300037471 Bacteria 6505
620 Ga0395905_0028173 3300037471 Bacteria 5294
621 Ga0395905_0035912 3300037471 Bacteria 4654
622 Ga0395905_0051072 3300037471 Bacteria 3872
623 Ga0395905_0069555 3300037471 Bacteria 3297
624 Ga0395905_0171086 3300037471 Bacteria 2040
625 Ga0395905_0190965 3300037471 Bacteria 1921
626 Ga0395905_0398884 3300037471 Bacteria 1270
627 Ga0395905_0634130 3300037471 Bacteria 970
628 Ga0436364_0536128 3300037853 Bacteria 50208
629 Ga0436364_0682637 3300037853 Bacteria 2013
630 Ga0395901_0000163 3300038443 Bacteria 87103
631 Ga0395901_0003692 3300038443 Bacteria 15438
632 Ga0395901_0006699 3300038443 Bacteria 11641
633 Ga0395901_0011095 3300038443 Bacteria 9132
634 Ga0395901_0014941 3300038443 Bacteria 7889
635 Ga0395901_0037660 3300038443 Bacteria 5002
636 Ga0395901_0096591 3300038443 Bacteria 3096
637 Ga0395901_0104621 3300038443 Bacteria 2970
638 Ga0395901_0109031 3300038443 Bacteria 2906
639 Ga0395901_0124654 3300038443 Bacteria 2707
640 Ga0395901_0276826 3300038443 Bacteria 1744
641 Ga0395901_0384568 3300038443 Bacteria 1444
642 Ga0395901_0413734 3300038443 Bacteria 1384
643 Ga0395901_0463862 3300038443 Bacteria 1294
644 Ga0395901_0537671 3300038443 Bacteria 1185
645 Ga0395901_0542399 3300038443 Bacteria 1179
646 Ga0395901_0633289 3300038443 Bacteria 1075
647 Ga0436365_0520124 3300039437 Bacteria 63069
648 Ga0436365_1894668 3300039437 Bacteria 2496
649 Ga0436363_0625004 3300039450 Bacteria 3112
650 Ga0439461_0014960 3300041410 Bacteria 1482
651 Ga0439441_003711 3300042001 Bacteria 2271
652 Ga0439443_004504 3300042003 Bacteria 1819
653 Ga0439448_0004115 3300042005 Bacteria 4095
654 Ga0439458_0000121 3300042157 Bacteria 16048
655 Ga0439458_0001367 3300042157 Bacteria 6153
656 Ga0439434_0021801 3300042435 Bacteria 1925
657 Ga0439435_0014413 3300042436 Bacteria 1952
658 Ga0439435_0017169 3300042436 Bacteria 1825
659 Ga0439444_0026400 3300042437 Bacteria 1062
660 Ga0439460_0012660 3300042461 Bacteria 2193
661 Ga0466969_0006178 3300044656 Bacteria 6376
662 Ga0466972_0000063 3300044658 Bacteria 105889
663 Ga0466972_0047556 3300044658 Bacteria 2074
664 Ga0466965_0019715 3300044683 Bacteria 3239
665 Ga0466966_0002883 3300044684 Bacteria 11333
666 Ga0466966_0013797 3300044684 Bacteria 5346
667 Ga0466966_0018101 3300044684 Bacteria 4650
668 Ga0466966_0190441 3300044684 Bacteria 1243
669 Ga0466961_0019874 3300044693 Bacteria 4323
670 Ga0466961_0058869 3300044693 Bacteria 2443
671 Ga0466963_0002661 3300044694 Bacteria 10056
672 Ga0466963_0010554 3300044694 Bacteria 5596
673 Ga0466963_0010868 3300044694 Bacteria 5528
674 Ga0466963_0053411 3300044694 Bacteria 2682
675 Ga0466963_0126448 3300044694 Bacteria 1762
676 Ga0466964_0116042 3300044706 Bacteria 1200
677 Ga0466964_0160107 3300044706 Bacteria 1051
678 Ga0466971_0021851 3300044719 Bacteria 2848
679 Ga0466970_0021262 3300044765 Bacteria 3379
680 Ga0466957_0015688 3300044842 Bacteria 4425
681 Ga0466957_0025000 3300044842 Bacteria 3538
682 Ga0466957_0026090 3300044842 Bacteria 3465
683 Ga0466957_0041916 3300044842 Bacteria 2768
684 Ga0466960_0190397 3300044901 Bacteria 1116
685 Ga0466959_0020934 3300045049 Bacteria 4820
686 Ga0466959_0025616 3300045049 Bacteria 4373
687 Ga0466959_0039918 3300045049 Bacteria 3469
688 Ga0466959_0177015 3300045049 Bacteria 1494
689 Ga0466959_0238537 3300045049 Bacteria 1257
690 Ga0451576_0145437 3300045051 Unclassified 2472
691 Ga0466958_0001875 3300045836 Bacteria 10279
692 Ga0466958_0002438 3300045836 Bacteria 9328
693 Ga0466958_0030580 3300045836 Bacteria 3199
694 Ga0466958_0144025 3300045836 Bacteria 1501
695 Ga0466967_0013401 3300045976 Bacteria 6333
696 Ga0466967_0020072 3300045976 Bacteria 5390
697 Ga0466967_0026278 3300045976 Bacteria 4820
698 Ga0466967_0097081 3300045976 Bacteria 2689
699 Ga0466967_0122672 3300045976 Bacteria 2403
700 Ga0466967_0139563 3300045976 Bacteria 2256
701 Ga0466967_0529255 3300045976 Bacteria 1159
702 Ga0495603_0027959 3300046455 Bacteria 3401
703 Ga0495641_0096699 3300046461 Bacteria 1318
704 Ga0495651_0002911 3300046462 Bacteria 13256
705 Ga0495651_0003862 3300046462 Bacteria 11453
706 Ga0495653_0001994 3300046463 Bacteria 16052
707 Ga0495580_0018482 3300046472 Bacteria 5190
708 Ga0495582_0000431 3300046473 Bacteria 22867
709 Ga0495608_0073364 3300046511 Bacteria 2232
710 Ga0495628_0000515 3300046516 Bacteria 35499
711 Ga0495628_0003485 3300046516 Bacteria 14083
712 Ga0495630_0043576 3300046517 Bacteria 3353
713 Ga0495643_0005167 3300046522 Bacteria 8912
714 Ga0495644_0099088 3300046523 Bacteria 1102
715 Ga0495663_0029883 3300046525 Bacteria 1611
716 Ga0495652_0002256 3300046529 Bacteria 20114
717 Ga0495652_0010026 3300046529 Bacteria 8585
718 Ga0495640_0038052 3300046533 Bacteria 3387
719 Ga0495587_0001271 3300046536 Bacteria 16780
720 Ga0495645_0016848 3300046543 Bacteria 5230
721 Ga0495667_0002732 3300046559 Bacteria 11789
722 Ga0495656_0022141 3300046615 Bacteria 2485
723 Ga0495635_0006423 3300046663 Bacteria 8197
724 Ga0495588_0033165 3300046674 Bacteria 2607
725 Ga0495657_0017798 3300046675 Bacteria 5153
726 Ga0495657_0032014 3300046675 Bacteria 3673
727 Ga0495599_0029392 3300046678 Bacteria 3445
728 Ga0495658_0065393 3300046683 Bacteria 2098
729 Ga0495658_0233540 3300046683 Bacteria 1154
730 Ga0495669_0007954 3300046684 Bacteria 4449
731 Ga0495613_0184803 3300046689 Bacteria 1475
732 Ga0495624_0011960 3300046690 Bacteria 5949
733 Ga0495670_0084506 3300046691 Bacteria 1620
734 Ga0495589_0132728 3300046794 Bacteria 1195
735 Ga0495600_0238797 3300046809 Bacteria 1158
736 Ga0495581_0010437 3300047315 Bacteria 5371
737 Ga0495581_0024575 3300047315 Bacteria 3492
738 Ga0495581_0102798 3300047315 Bacteria 1660
739 Ga0495604_0007212 3300047317 Bacteria 8808
740 Ga0495604_0183788 3300047317 Bacteria 1461
741 Ga0495604_0253631 3300047317 Bacteria 1198
742 Ga0495674_0003664 3300047319 Bacteria 14949
743 Ga0495674_0204775 3300047319 Bacteria 1636
744 Ga0495672_0071417 3300047320 Bacteria 1964
745 Ga0495676_0030058 3300047321 Bacteria 4618
746 Ga0495676_0063564 3300047321 Bacteria 2876
747 Ga0495680_0000563 3300047322 Bacteria 41798
748 Ga0495675_0000371 3300047444 Bacteria 31063
749 Ga0495675_0205191 3300047444 Bacteria 1198
750 Ga0495677_0023207 3300047445 Bacteria 2252
751 Ga0495602_0012470 3300048088 Bacteria 8734
752 Ga0496100_0016696 3300048903 Bacteria 4317
753 Ga0496100_0033944 3300048903 Bacteria 3196
754 Ga0496100_0047207 3300048903 Bacteria 2773
755 Ga0496100_0166718 3300048903 Bacteria 1583
756 Ga0496101_0005176 3300048904 Bacteria 8298
757 Ga0496101_0014355 3300048904 Bacteria 5321
758 Ga0496101_0018589 3300048904 Bacteria 4728
759 Ga0496101_0035794 3300048904 Bacteria 3513
760 Ga0496102_0000455 3300048905 Bacteria 46123
761 Ga0496102_0002662 3300048905 Bacteria 15195
762 Ga0496102_0018023 3300048905 Bacteria 6196
763 Ga0496102_0025629 3300048905 Bacteria 5252
764 Ga0496102_0121851 3300048905 Bacteria 2436
765 Ga0496102_0181694 3300048905 Bacteria 1982
766 Ga0496102_0299702 3300048905 Bacteria 1515
767 Ga0496103_0002178 3300048906 Bacteria 12442
768 Ga0496103_0185753 3300048906 Bacteria 1336
769 Ga0496104_0003563 3300048907 Bacteria 13434
770 Ga0496104_0032938 3300048907 Bacteria 4825
771 Ga0496104_0084553 3300048907 Bacteria 3028
772 Ga0496104_0086658 3300048907 Bacteria 2990
773 Ga0496105_0250381 3300048908 Bacteria 1435
774 Ga0496106_0000219 3300048909 Bacteria 39803
775 Ga0496106_0005635 3300048909 Bacteria 9267
776 Ga0496106_0008543 3300048909 Bacteria 7576
777 Ga0496106_0008984 3300048909 Bacteria 7383
778 Ga0496106_0019985 3300048909 Bacteria 4966
779 Ga0496106_0077853 3300048909 Bacteria 2543
780 Ga0496106_0352466 3300048909 Bacteria 1182
781 Ga0496107_0001105 3300048910 Bacteria 16233
782 Ga0496107_0006260 3300048910 Bacteria 8180
783 Ga0496107_0009394 3300048910 Bacteria 6782
784 Ga0496107_0031185 3300048910 Bacteria 3801
785 Ga0496107_0081601 3300048910 Bacteria 2358
786 Ga0496108_0005751 3300048911 Bacteria 10042
787 Ga0496108_0034303 3300048911 Bacteria 4216
788 Ga0496108_0036768 3300048911 Bacteria 4075
789 Ga0496108_0105031 3300048911 Bacteria 2411
790 Ga0496108_0130404 3300048911 Bacteria 2161
791 Ga0496108_0332614 3300048911 Unclassified 1325
792 Ga0496109_0000470 3300048912 Bacteria 34274
793 Ga0496109_0004861 3300048912 Bacteria 11217
794 Ga0496109_0020529 3300048912 Bacteria 5835
795 Ga0496109_0256591 3300048912 Bacteria 1647
796 Ga0496110_0004040 3300048913 Bacteria 11323
797 Ga0496110_0031531 3300048913 Bacteria 4573
798 Ga0496110_0109228 3300048913 Bacteria 2484
799 Ga0496110_0213469 3300048913 Bacteria 1755
800 Ga0496111_0011044 3300048914 Bacteria 6078
801 Ga0496111_0021701 3300048914 Bacteria 4487
802 Ga0496111_0317497 3300048914 Bacteria 1154
803 Ga0496112_0015372 3300048915 Bacteria 7140
804 Ga0496112_0029020 3300048915 Bacteria 5347
805 Ga0496112_0031498 3300048915 Bacteria 5145
806 Ga0496112_0032197 3300048915 Bacteria 5090
807 Ga0496112_0096921 3300048915 Bacteria 2920
808 Ga0496112_0155995 3300048915 Bacteria 2250
809 Ga0496112_0231686 3300048915 Bacteria 1801
810 Ga0496113_0003062 3300048916 Bacteria 9913
811 Ga0496113_0053500 3300048916 Bacteria 3019
812 Ga0496113_0406620 3300048916 Unclassified 1093
813 Ga0496114_0038112 3300048917 Bacteria 3976
814 Ga0496114_0041232 3300048917 Bacteria 3824
815 Ga0496114_0091948 3300048917 Bacteria 2577
816 Ga0496114_0146056 3300048917 Bacteria 2050
817 Ga0496115_0001296 3300048918 Bacteria 17868
818 Ga0496115_0015566 3300048918 Bacteria 5772
819 Ga0496115_0018307 3300048918 Bacteria 5375
820 Ga0496115_0163241 3300048918 Bacteria 1842
821 Ga0496115_0334797 3300048918 Unclassified 1236
822 Ga0496115_0422398 3300048918 Bacteria 1080
823 Ga0496117_0000310 3300048920 Bacteria 85004
824 Ga0496121_0082601 3300048924 Bacteria 2539
825 Ga0501031_0060415 3300049568 Bacteria 2470
826 Ga0501031_0073683 3300049568 Bacteria 2223
827 Ga0501032_0024565 3300049569 Bacteria 4159
828 Ga0501032_0086245 3300049569 Bacteria 2087
829 Ga0501033_0002326 3300049570 Bacteria 16195
830 Ga0501033_0062885 3300049570 Bacteria 2733
831 Ga0501033_0150922 3300049570 Bacteria 1676
832 Ga0501033_0199625 3300049570 Bacteria 1429
833 Ga0501034_0016634 3300049571 Bacteria 7542
834 Ga0501034_0145372 3300049571 Bacteria 2349
835 Ga0501036_0000096 3300049572 Bacteria 54442
836 Ga0501036_0064391 3300049572 Bacteria 3103
837 Ga0501036_0078371 3300049572 Bacteria 2795
838 Ga0501037_0081213 3300049573 Bacteria 2351
839 Ga0501037_0154364 3300049573 Bacteria 1639
840 Ga0501037_0229619 3300049573 Bacteria 1303
841 Ga0501038_0000791 3300049574 Bacteria 28037
842 Ga0501038_0004587 3300049574 Bacteria 12856
843 Ga0501038_0082872 3300049574 Bacteria 2700
844 Ga0501038_0170545 3300049574 Bacteria 1762
845 Ga0501038_0291304 3300049574 Bacteria 1283
846 Ga0501039_0003249 3300049575 Bacteria 12149
847 Ga0501039_0029527 3300049575 Bacteria 4223
848 Ga0501039_0041354 3300049575 Bacteria 3560
849 Ga0501039_0049828 3300049575 Bacteria 3239
850 Ga0501039_0053881 3300049575 Bacteria 3113
851 Ga0501040_0000395 3300049576 Bacteria 25703
852 Ga0501040_0017103 3300049576 Bacteria 4811
853 Ga0501040_0119821 3300049576 Bacteria 1846
854 Ga0501041_0001593 3300049577 Bacteria 12649
855 Ga0501041_0002445 3300049577 Bacteria 10547
856 Ga0501041_0004801 3300049577 Bacteria 7851
857 Ga0501041_0007499 3300049577 Bacteria 6402
858 Ga0501041_0014764 3300049577 Bacteria 4638
859 Ga0501042_0002787 3300049578 Bacteria 10805
860 Ga0501042_0016971 3300049578 Bacteria 5011
861 Ga0501042_0025723 3300049578 Bacteria 4136
862 Ga0501042_0138037 3300049578 Bacteria 1757
863 Ga0501043_0014879 3300049579 Bacteria 6090
864 Ga0501043_0066212 3300049579 Bacteria 2837
865 Ga0501043_0094055 3300049579 Bacteria 2356
866 Ga0501046_0000200 3300049580 Bacteria 61991
867 Ga0501046_0012485 3300049580 Bacteria 7229
868 Ga0501047_0020350 3300049581 Bacteria 6373
869 Ga0501047_0052879 3300049581 Bacteria 3926
870 Ga0501047_0068672 3300049581 Bacteria 3413
871 Ga0501047_0345343 3300049581 Bacteria 1325
872 Ga0501048_0000761 3300049582 Bacteria 23628
873 Ga0501048_0050071 3300049582 Bacteria 2975
874 Ga0501048_0283423 3300049582 Bacteria 1178
875 Ga0501067_0083589 3300049583 Bacteria 1771
876 Ga0501068_0050188 3300049584 Bacteria 2522
877 Ga0501068_0105765 3300049584 Bacteria 1747
878 Ga0501070_0001824 3300049586 Bacteria 18764
879 Ga0501070_0042475 3300049586 Bacteria 3787
880 Ga0501070_0064551 3300049586 Bacteria 3032
881 Ga0501070_0146565 3300049586 Bacteria 1948
882 Ga0501071_0044429 3300049587 Bacteria 3186
883 Ga0501071_0071018 3300049587 Bacteria 2537
884 Ga0501072_0000765 3300049588 Bacteria 23435
885 Ga0501072_0009119 3300049588 Bacteria 7533
886 Ga0501072_0060560 3300049588 Bacteria 2984
887 Ga0501072_0065057 3300049588 Bacteria 2875
888 Ga0501072_0076622 3300049588 Bacteria 2646
889 Ga0501074_0003684 3300049590 Bacteria 10867
890 Ga0501074_0032017 3300049590 Bacteria 3811
891 Ga0501074_0039427 3300049590 Bacteria 3422
892 Ga0501075_0002417 3300049591 Bacteria 12417
893 Ga0501075_0004855 3300049591 Bacteria 9153
894 Ga0501075_0129121 3300049591 Bacteria 1925
895 Ga0501076_0003566 3300049592 Bacteria 10931
896 Ga0501076_0009014 3300049592 Bacteria 7347
897 Ga0501076_0033591 3300049592 Bacteria 4005
898 Ga0501076_0192178 3300049592 Bacteria 1666
899 Ga0501077_0001853 3300049593 Bacteria 12778
900 Ga0501077_0007642 3300049593 Bacteria 6672
901 Ga0501077_0008447 3300049593 Bacteria 6381
902 Ga0501077_0124863 3300049593 Bacteria 1631
903 Ga0501079_0003631 3300049741 Bacteria 11359
904 Ga0501079_0003781 3300049741 Bacteria 11179
905 Ga0501079_0010528 3300049741 Bacteria 7031
906 Ga0501079_0143401 3300049741 Bacteria 1861
907 Ga0501080_0001492 3300049742 Bacteria 19754
908 Ga0501080_0020624 3300049742 Bacteria 6104
909 Ga0501080_0077932 3300049742 Bacteria 3082
910 Ga0501080_0136712 3300049742 Bacteria 2268
911 Ga0501080_0310028 3300049742 Bacteria 1430
912 Ga0501080_0428309 3300049742 Bacteria 1188
913 Ga0501081_0001882 3300049743 Bacteria 13048
914 Ga0501081_0003392 3300049743 Bacteria 10145
915 Ga0501081_0004640 3300049743 Bacteria 8832
916 Ga0501081_0020935 3300049743 Bacteria 4364
917 Ga0501081_0145909 3300049743 Bacteria 1698
918 Ga0501083_0034378 3300049744 Bacteria 3466
919 Ga0501083_0050079 3300049744 Bacteria 2813
920 Ga0501035_0003095 3300049822 Bacteria 15978
921 Ga0501035_0042018 3300049822 Bacteria 4125
922 Ga0501035_0051047 3300049822 Bacteria 3704
923 Ga0501035_0202314 3300049822 Bacteria 1702
924 Ga0501044_0012756 3300049823 Bacteria 9100
925 Ga0501044_0029819 3300049823 Bacteria 5751
926 Ga0501044_0065971 3300049823 Bacteria 3691
927 Ga0501044_0113267 3300049823 Bacteria 2720
928 Ga0501045_0000087 3300049824 Bacteria 43859
929 Ga0501045_0003237 3300049824 Bacteria 11117
930 Ga0501045_0008851 3300049824 Bacteria 7028
931 Ga0501045_0045486 3300049824 Bacteria 3196
932 nmdc:mga05p37_210272_c1 3300050507 Bacteria 2352
933 nmdc:mga05p37_28657_c1 3300050507 Bacteria 6793
934 nmdc:mga05p37_33473_c1 3300050507 Bacteria 6294
935 nmdc:mga05p37_83042_c1 3300050507 Bacteria 3947
936 nmdc:mga05p37_85120_c1 3300050507 Unclassified 3896
937 nmdc:mga09592_86629_c1 3300050508 Bacteria 2673
938 nmdc:mga06r32_100685_c1 3300050510 Bacteria 2835
939 nmdc:mga06r32_897_c1 3300050510 Bacteria 26528
940 nmdc:mga08y16_489659_c1 3300050511 Bacteria 1250
941 nmdc:mga0n895_3167_c1 3300050512 Bacteria 13149
942 nmdc:mga0n895_78149_c1 3300050512 Unclassified 3293
943 nmdc:mga0n895_8149_c1 3300050512 Bacteria 9053
944 nmdc:mga0rr50_233833_c1 3300050513 Bacteria 1521
945 nmdc:mga0rr50_4008_c1 3300050513 Bacteria 8588
946 nmdc:mga0rr50_68941_c1 3300050513 Bacteria 2690
947 nmdc:mga0rr50_77661_c1 3300050513 Bacteria 2552
948 nmdc:mga08x19_38967_c1 3300050514 Bacteria 3019
949 nmdc:mga08x19_44420_c1 3300050514 Bacteria 2837
950 nmdc:mga08x19_44969_c1 3300050514 Bacteria 2821
951 nmdc:mga0a205_10416_c1 3300050515 Bacteria 8543
952 nmdc:mga0a205_330456_c1 3300050515 Bacteria 1394
953 nmdc:mga0a205_622486_c1 3300050515 Unclassified 932
954 Ga0495601_0001675 3300053077 Bacteria 12219
955 Ga0495655_0005239 3300053083 Bacteria 2279
956 Ga0495655_0005262 3300053083 Bacteria 2275
957 Ga0500627_0000020 3300053158 Bacteria 109977
958 Ga0501084_0003415 3300054114 Bacteria 12884
959 Ga0501084_0004952 3300054114 Bacteria 10888
960 Ga0501084_0014118 3300054114 Bacteria 6615
961 Ga0501084_0016140 3300054114 Bacteria 6201
962 Ga0590071_007661 3300059421 Bacteria 2552
963 Ga0590075_010614 3300059424 Bacteria 2220
964 Ga0501082_0003997 3300060353 Bacteria 12869
965 Ga0501082_0005812 3300060353 Bacteria 10710
966 Ga0501082_0022598 3300060353 Bacteria 5417
967 Ga0501082_0039366 3300060353 Bacteria 4078
968 Ga0501082_0061992 3300060353 Bacteria 3218
969 Ga0501082_0090622 3300060353 Bacteria 2640
970 Ga0501082_0253963 3300060353 Bacteria 1530
971 Ga0501082_0322712 3300060353 Bacteria 1345
972 Ga0466962_0027009 3300061719 Bacteria 2756
973 Ga0466962_0076654 3300061719 Bacteria 1598
974 Ga0530510_0000522 3300061734 Bacteria 24577
975 Ga0530510_0027514 3300061734 Bacteria 4073
976 Ga0530510_0051841 3300061734 Bacteria 2965
977 Ga0530510_0063437 3300061734 Bacteria 2675
978 Ga0530510_0087979 3300061734 Bacteria 2263

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0634130 Ga0395905_0634130_11_895 260
2 3300050515 nmdc:mga0a205_622486_c1 nmdc:mga0a205_622486_c1_21_833 270
3 3300048917 Ga0496114_0091948 Ga0496114_0091948_92_982 278
4 3300048918 Ga0496115_0334797 Ga0496115_0334797_67_957 278
5 3300006942 Ga0099824_1013620 Ga0099824_10136207 282
6 3300027296 Ga0209389_1000676 Ga0209389_10006765 282
7 3300027357 Ga0209589_1005614 Ga0209589_10056145 282
8 3300027361 Ga0209489_100192 Ga0209489_10019220 282
9 3300034817 Ga0373948_0013710 Ga0373948_0013710_21_875 283
10 3300044693 Ga0466961_0019874 Ga0466961_0019874_1701_2654 297
11 3300044765 Ga0466970_0021262 Ga0466970_0021262_989_1942 297
12 3300044842 Ga0466957_0025000 Ga0466957_0025000_2517_3470 297
13 3300045836 Ga0466958_0030580 Ga0466958_0030580_272_1225 297
14 3300005354 Ga0070675_100124403 Ga0070675_1001244032 298
15 3300025907 Ga0207645_10005412 Ga0207645_100054126 298
16 3300025961 Ga0207712_10276496 Ga0207712_102764962 298
17 3300006871 Ga0075434_100030081 Ga0075434_1000300814 301
18 3300045051 Ga0451576_0145437 Ga0451576_0145437_1276_2277 303
19 3300006847 Ga0075431_100010384 Ga0075431_1000103848 307
20 3300042001 Ga0439441_003711 Ga0439441_003711_1264_2190 307
21 3300042003 Ga0439443_004504 Ga0439443_004504_871_1797 307
22 3300042436 Ga0439435_0014413 Ga0439435_0014413_827_1753 307
23 3300042437 Ga0439444_0026400 Ga0439444_0026400_91_1017 307
24 3300042461 Ga0439460_0012660 Ga0439460_0012660_551_1477 307
25 3300049577 Ga0501041_0007499 Ga0501041_0007499_2822_3748 307
26 3300049592 Ga0501076_0192178 Ga0501076_0192178_514_1440 307
27 3300049824 Ga0501045_0045486 Ga0501045_0045486_1699_2625 307
28 3300050510 nmdc:mga06r32_897_c1 nmdc:mga06r32_897_c1_18943_19896 307
29 3300005355 Ga0070671_100015419 Ga0070671_1000154193 308
30 3300006844 Ga0075428_100036166 Ga0075428_1000361662 308
31 3300006847 Ga0075431_100004258 Ga0075431_1000042585 308
32 3300006852 Ga0075433_10036694 Ga0075433_100366945 308
33 3300006871 Ga0075434_100021543 Ga0075434_1000215434 308
34 3300006914 Ga0075436_100012599 Ga0075436_1000125992 308
35 3300007076 Ga0075435_100089765 Ga0075435_1000897653 308
36 3300009147 Ga0114129_10009722 Ga0114129_100097228 308
37 3300013296 Ga0157374_10133049 Ga0157374_101330492 308
38 3300025931 Ga0207644_10067421 Ga0207644_100674212 308
39 3300027907 Ga0207428_10005685 Ga0207428_100056852 308
40 3300039450 Ga0436363_0625004 Ga0436363_0625004_472_1476 308
41 3300047320 Ga0495672_0071417 Ga0495672_0071417_906_1919 308
42 3300047445 Ga0495677_0023207 Ga0495677_0023207_210_1235 308
43 3300050507 nmdc:mga05p37_28657_c1 nmdc:mga05p37_28657_c1_4889_5851 308
44 3300050512 nmdc:mga0n895_3167_c1 nmdc:mga0n895_3167_c1_9439_10401 308
45 3300050513 nmdc:mga0rr50_4008_c1 nmdc:mga0rr50_4008_c1_1826_2788 308
46 3300050514 nmdc:mga08x19_44969_c1 nmdc:mga08x19_44969_c1_463_1425 308
47 3300050515 nmdc:mga0a205_10416_c1 nmdc:mga0a205_10416_c1_4407_5369 308
48 3300005616 Ga0068852_100074045 Ga0068852_1000740451 309
49 3300009545 Ga0105237_10035959 Ga0105237_100359595 309
50 3300005337 Ga0070682_100001145 Ga0070682_1000011456 311
51 3300005341 Ga0070691_10020725 Ga0070691_100207253 311
52 3300005354 Ga0070675_100040954 Ga0070675_1000409541 311
53 3300005366 Ga0070659_100124234 Ga0070659_1001242343 311
54 3300005455 Ga0070663_100000397 Ga0070663_1000003971 311
55 3300005455 Ga0070663_100001866 Ga0070663_1000018665 311
56 3300005458 Ga0070681_10023008 Ga0070681_100230084 311
57 3300005459 Ga0068867_100233174 Ga0068867_1002331742 311
58 3300005530 Ga0070679_100060514 Ga0070679_1000605143 311
59 3300005539 Ga0068853_100089858 Ga0068853_1000898582 311
60 3300005546 Ga0070696_100035703 Ga0070696_1000357034 311
61 3300005577 Ga0068857_100024027 Ga0068857_1000240275 311
62 3300005578 Ga0068854_100257759 Ga0068854_1002577592 311
63 3300005617 Ga0068859_100233940 Ga0068859_1002339403 311
64 3300005841 Ga0068863_100210726 Ga0068863_1002107264 311
65 3300006358 Ga0068871_100087671 Ga0068871_1000876714 311
66 3300006931 Ga0097620_100233930 Ga0097620_1002339303 311
67 3300009094 Ga0111539_10496737 Ga0111539_104967371 311
68 3300009174 Ga0105241_10001532 Ga0105241_1000153219 311
69 3300009545 Ga0105237_10191567 Ga0105237_101915672 311
70 3300013308 Ga0157375_10571288 Ga0157375_105712881 311
71 3300025904 Ga0207647_10008571 Ga0207647_100085716 311
72 3300025914 Ga0207671_10179351 Ga0207671_101793511 311
73 3300025919 Ga0207657_10017351 Ga0207657_100173516 311
74 3300025923 Ga0207681_10137741 Ga0207681_101377412 311
75 3300025925 Ga0207650_10085688 Ga0207650_100856882 311
76 3300025927 Ga0207687_10184688 Ga0207687_101846882 311
77 3300025932 Ga0207690_10057079 Ga0207690_100570792 311
78 3300026067 Ga0207678_10006407 Ga0207678_100064072 311
79 3300026067 Ga0207678_10012988 Ga0207678_100129881 311
80 3300026089 Ga0207648_10149687 Ga0207648_101496873 311
81 3300038443 Ga0395901_0633289 Ga0395901_0633289_10_996 311
82 3300046511 Ga0495608_0073364 Ga0495608_0073364_488_1489 311
83 3300046675 Ga0495657_0032014 Ga0495657_0032014_2513_3514 311
84 3300049570 Ga0501033_0150922 Ga0501033_0150922_499_1482 311
85 3300049573 Ga0501037_0154364 Ga0501037_0154364_163_1146 311
86 3300049574 Ga0501038_0004587 Ga0501038_0004587_4129_5118 311
87 3300049579 Ga0501043_0066212 Ga0501043_0066212_1186_2169 311
88 3300049581 Ga0501047_0020350 Ga0501047_0020350_4709_5692 311
89 3300049586 Ga0501070_0001824 Ga0501070_0001824_1645_2628 311
90 3300049590 Ga0501074_0032017 Ga0501074_0032017_953_1936 311
91 3300049742 Ga0501080_0077932 Ga0501080_0077932_469_1452 311
92 3300049822 Ga0501035_0003095 Ga0501035_0003095_13405_14388 311
93 3300049823 Ga0501044_0012756 Ga0501044_0012756_261_1250 311
94 3300049823 Ga0501044_0029819 Ga0501044_0029819_2032_3015 311
95 3300050511 nmdc:mga08y16_489659_c1 nmdc:mga08y16_489659_c1_159_1130 311
96 3300005615 Ga0070702_100221700 Ga0070702_1002217001 312
97 3300013297 Ga0157378_10032587 Ga0157378_100325875 312
98 3300037471 Ga0395905_0398884 Ga0395905_0398884_149_1102 312
99 3300049593 Ga0501077_0008447 Ga0501077_0008447_53_1036 312
100 3300049822 Ga0501035_0042018 Ga0501035_0042018_2303_3292 312
101 3300050510 nmdc:mga06r32_100685_c1 nmdc:mga06r32_100685_c1_297_1304 312
102 3300005336 Ga0070680_100005718 Ga0070680_1000057189 313
103 3300005341 Ga0070691_10029684 Ga0070691_100296843 313
104 3300005345 Ga0070692_10041389 Ga0070692_100413892 313
105 3300005406 Ga0070703_10004719 Ga0070703_100047193 313
106 3300005436 Ga0070713_100221249 Ga0070713_1002212492 313
107 3300005438 Ga0070701_10006123 Ga0070701_100061233 313
108 3300005440 Ga0070705_100000881 Ga0070705_1000008816 313
109 3300005444 Ga0070694_100002877 Ga0070694_1000028773 313
110 3300005445 Ga0070708_100002831 Ga0070708_1000028313 313
111 3300005455 Ga0070663_100038767 Ga0070663_1000387671 313
112 3300005518 Ga0070699_100004759 Ga0070699_1000047593 313
113 3300005536 Ga0070697_100006313 Ga0070697_1000063139 313
114 3300005544 Ga0070686_100120388 Ga0070686_1001203881 313
115 3300005545 Ga0070695_100000709 Ga0070695_1000007097 313
116 3300005546 Ga0070696_100000030 Ga0070696_10000003028 313
117 3300005547 Ga0070693_100008913 Ga0070693_1000089132 313
118 3300005549 Ga0070704_100003174 Ga0070704_1000031746 313
119 3300005615 Ga0070702_100132272 Ga0070702_1001322722 313
120 3300005617 Ga0068859_100007999 Ga0068859_1000079994 313
121 3300005618 Ga0068864_100009894 Ga0068864_1000098947 313
122 3300005719 Ga0068861_100054596 Ga0068861_1000545964 313
123 3300005843 Ga0068860_100030669 Ga0068860_1000306693 313
124 3300005844 Ga0068862_100001754 Ga0068862_10000175420 313
125 3300006931 Ga0097620_100007999 Ga0097620_1000079994 313
126 3300009148 Ga0105243_10012348 Ga0105243_100123483 313
127 3300009553 Ga0105249_10001814 Ga0105249_1000181411 313
128 3300011119 Ga0105246_10022640 Ga0105246_100226404 313
129 3300025917 Ga0207660_10013920 Ga0207660_100139205 313
130 3300025939 Ga0207665_10111239 Ga0207665_101112392 313
131 3300025961 Ga0207712_10000667 Ga0207712_1000066721 313
132 3300026067 Ga0207678_10016828 Ga0207678_100168281 313
133 3300026095 Ga0207676_10021565 Ga0207676_100215655 313
134 3300026118 Ga0207675_100050099 Ga0207675_1000500994 313
135 3300028380 Ga0268265_10002645 Ga0268265_100026453 313
136 3300028381 Ga0268264_10007304 Ga0268264_100073044 313
137 3300035691 Ga0373931_0163912 Ga0373931_0163912_92_1078 313
138 3300037466 Ga0395898_0002898 Ga0395898_0002898_6235_7230 313
139 3300048905 Ga0496102_0000455 Ga0496102_0000455_25847_26833 313
140 3300048905 Ga0496102_0299702 Ga0496102_0299702_321_1319 313
141 3300048907 Ga0496104_0032938 Ga0496104_0032938_1274_2260 313
142 3300048909 Ga0496106_0000219 Ga0496106_0000219_1696_2682 313
143 3300048910 Ga0496107_0009394 Ga0496107_0009394_5479_6465 313
144 3300048913 Ga0496110_0213469 Ga0496110_0213469_617_1615 313
145 3300048915 Ga0496112_0155995 Ga0496112_0155995_172_1200 313
146 3300049570 Ga0501033_0199625 Ga0501033_0199625_229_1212 313
147 3300049575 Ga0501039_0041354 Ga0501039_0041354_977_1960 313
148 3300049582 Ga0501048_0283423 Ga0501048_0283423_15_980 313
149 3300049743 Ga0501081_0003392 Ga0501081_0003392_133_1116 313
150 3300060353 Ga0501082_0039366 Ga0501082_0039366_2081_3064 313
151 3300061734 Ga0530510_0063437 Ga0530510_0063437_1390_2373 313
152 3300003373 JGI25407J50210_10001965 JGI25407J50210_100019652 314
153 3300005440 Ga0070705_100040413 Ga0070705_1000404132 314
154 3300005467 Ga0070706_100046515 Ga0070706_1000465154 314
155 3300005616 Ga0068852_100428436 Ga0068852_1004284361 314
156 3300005937 Ga0081455_10008953 Ga0081455_100089532 314
157 3300005981 Ga0081538_10003492 Ga0081538_1000349213 314
158 3300006163 Ga0070715_10067728 Ga0070715_100677282 314
159 3300006175 Ga0070712_100186355 Ga0070712_1001863552 314
160 3300013308 Ga0157375_10274660 Ga0157375_102746602 314
161 3300025905 Ga0207685_10021158 Ga0207685_100211582 314
162 3300025915 Ga0207693_10002251 Ga0207693_1000225116 314
163 3300025929 Ga0207664_10274401 Ga0207664_102744012 314
164 3300025939 Ga0207665_10106440 Ga0207665_101064402 314
165 3300028380 Ga0268265_10044959 Ga0268265_100449593 314
166 3300028563 Ga0265319_1000005 Ga0265319_1000005159 314
167 3300031995 Ga0307409_100004647 Ga0307409_1000046476 314
168 3300037312 Ga0395899_0010984 Ga0395899_0010984_4180_5151 314
169 3300037418 Ga0395900_0016026 Ga0395900_0016026_2344_3315 314
170 3300037466 Ga0395898_0007983 Ga0395898_0007983_1617_2588 314
171 3300037466 Ga0395898_0014617 Ga0395898_0014617_6757_7704 314
172 3300037471 Ga0395905_0012385 Ga0395905_0012385_4564_5535 314
173 3300037471 Ga0395905_0190965 Ga0395905_0190965_595_1542 314
174 3300038443 Ga0395901_0096591 Ga0395901_0096591_757_1728 314
175 3300038443 Ga0395901_0276826 Ga0395901_0276826_238_1197 314
176 3300038443 Ga0395901_0384568 Ga0395901_0384568_107_1075 314
177 3300038443 Ga0395901_0542399 Ga0395901_0542399_174_1133 314
178 3300044694 Ga0466963_0002661 Ga0466963_0002661_7864_8823 314
179 3300044706 Ga0466964_0160107 Ga0466964_0160107_34_993 314
180 3300044842 Ga0466957_0026090 Ga0466957_0026090_1883_2842 314
181 3300045836 Ga0466958_0002438 Ga0466958_0002438_6136_7095 314
182 3300045836 Ga0466958_0144025 Ga0466958_0144025_110_1069 314
183 3300045976 Ga0466967_0020072 Ga0466967_0020072_1026_1985 314
184 3300045976 Ga0466967_0529255 Ga0466967_0529255_107_1066 314
185 3300048911 Ga0496108_0036768 Ga0496108_0036768_2950_3903 314
186 3300048914 Ga0496111_0317497 Ga0496111_0317497_71_1036 314
187 3300048915 Ga0496112_0096921 Ga0496112_0096921_719_1672 314
188 3300048918 Ga0496115_0163241 Ga0496115_0163241_679_1644 314
189 3300049568 Ga0501031_0073683 Ga0501031_0073683_374_1330 314
190 3300049569 Ga0501032_0024565 Ga0501032_0024565_1786_2742 314
191 3300049569 Ga0501032_0086245 Ga0501032_0086245_750_1706 314
192 3300049570 Ga0501033_0002326 Ga0501033_0002326_1192_2148 314
193 3300049572 Ga0501036_0000096 Ga0501036_0000096_36833_37789 314
194 3300049572 Ga0501036_0064391 Ga0501036_0064391_1387_2343 314
195 3300049573 Ga0501037_0081213 Ga0501037_0081213_765_1721 314
196 3300049574 Ga0501038_0000791 Ga0501038_0000791_16338_17294 314
197 3300049575 Ga0501039_0003249 Ga0501039_0003249_10315_11271 314
198 3300049575 Ga0501039_0029527 Ga0501039_0029527_2397_3353 314
199 3300049576 Ga0501040_0000395 Ga0501040_0000395_22808_23764 314
200 3300049576 Ga0501040_0017103 Ga0501040_0017103_3266_4222 314
201 3300049577 Ga0501041_0001593 Ga0501041_0001593_10756_11712 314
202 3300049577 Ga0501041_0002445 Ga0501041_0002445_1616_2578 314
203 3300049577 Ga0501041_0014764 Ga0501041_0014764_1757_2713 314
204 3300049578 Ga0501042_0002787 Ga0501042_0002787_8623_9579 314
205 3300049578 Ga0501042_0025723 Ga0501042_0025723_1719_2681 314
206 3300049578 Ga0501042_0138037 Ga0501042_0138037_182_1138 314
207 3300049579 Ga0501043_0014879 Ga0501043_0014879_537_1493 314
208 3300049579 Ga0501043_0094055 Ga0501043_0094055_893_1849 314
209 3300049580 Ga0501046_0000200 Ga0501046_0000200_32018_32974 314
210 3300049580 Ga0501046_0012485 Ga0501046_0012485_3769_4725 314
211 3300049582 Ga0501048_0000761 Ga0501048_0000761_1228_2184 314
212 3300049584 Ga0501068_0050188 Ga0501068_0050188_602_1558 314
213 3300049584 Ga0501068_0105765 Ga0501068_0105765_482_1438 314
214 3300049586 Ga0501070_0042475 Ga0501070_0042475_1181_2137 314
215 3300049587 Ga0501071_0044429 Ga0501071_0044429_1341_2297 314
216 3300049588 Ga0501072_0000765 Ga0501072_0000765_11803_12759 314
217 3300049588 Ga0501072_0009119 Ga0501072_0009119_4119_5075 314
218 3300049588 Ga0501072_0076622 Ga0501072_0076622_83_1045 314
219 3300049590 Ga0501074_0003684 Ga0501074_0003684_6750_7706 314
220 3300049591 Ga0501075_0002417 Ga0501075_0002417_10319_11275 314
221 3300049591 Ga0501075_0004855 Ga0501075_0004855_3384_4340 314
222 3300049592 Ga0501076_0003566 Ga0501076_0003566_2725_3681 314
223 3300049592 Ga0501076_0033591 Ga0501076_0033591_1238_2194 314
224 3300049593 Ga0501077_0001853 Ga0501077_0001853_1182_2138 314
225 3300049593 Ga0501077_0124863 Ga0501077_0124863_659_1615 314
226 3300049741 Ga0501079_0003631 Ga0501079_0003631_7455_8411 314
227 3300049741 Ga0501079_0003781 Ga0501079_0003781_8254_9210 314
228 3300049742 Ga0501080_0310028 Ga0501080_0310028_387_1343 314
229 3300049743 Ga0501081_0001882 Ga0501081_0001882_1368_2324 314
230 3300049743 Ga0501081_0004640 Ga0501081_0004640_5722_6678 314
231 3300049824 Ga0501045_0000087 Ga0501045_0000087_32116_33072 314
232 3300049824 Ga0501045_0008851 Ga0501045_0008851_2558_3514 314
233 3300054114 Ga0501084_0003415 Ga0501084_0003415_10684_11640 314
234 3300054114 Ga0501084_0016140 Ga0501084_0016140_2597_3553 314
235 3300060353 Ga0501082_0003997 Ga0501082_0003997_10774_11730 314
236 3300060353 Ga0501082_0022598 Ga0501082_0022598_2553_3509 314
237 3300061734 Ga0530510_0000522 Ga0530510_0000522_12919_13875 314
238 3300061734 Ga0530510_0027514 Ga0530510_0027514_1178_2134 314
239 3300025912 Ga0207707_10013783 Ga0207707_100137832 315
240 3300027671 Ga0209588_1000287 Ga0209588_10002872 316
241 3300048909 Ga0496106_0008984 Ga0496106_0008984_2791_3774 317
242 3300014325 Ga0163163_10044532 Ga0163163_100445324 318
243 3300014497 Ga0182008_10097795 Ga0182008_100977952 318
244 3300049576 Ga0501040_0119821 Ga0501040_0119821_634_1602 318
245 3300049741 Ga0501079_0143401 Ga0501079_0143401_816_1784 318
246 3300060353 Ga0501082_0253963 Ga0501082_0253963_257_1225 318
247 3300003203 JGI25406J46586_10000020 JGI25406J46586_1000002037 320
248 3300005530 Ga0070679_100144124 Ga0070679_1001441242 320
249 3300005985 Ga0081539_10000052 Ga0081539_1000005250 320
250 3300021384 Ga0213876_10000412 Ga0213876_100004121 320
251 3300025921 Ga0207652_10017772 Ga0207652_100177723 320
252 3300026116 Ga0207674_10068794 Ga0207674_100687943 320
253 3300027378 Ga0209981_1001073 Ga0209981_10010734 320
254 3300027543 Ga0209999_1006589 Ga0209999_10065893 320
255 3300031548 Ga0307408_100110709 Ga0307408_1001107092 320
256 3300031731 Ga0307405_10003454 Ga0307405_100034547 320
257 3300031852 Ga0307410_10155457 Ga0307410_101554572 320
258 3300031995 Ga0307409_100042389 Ga0307409_1000423894 320
259 3300032002 Ga0307416_100000623 Ga0307416_1000006237 320
260 3300032126 Ga0307415_100000256 Ga0307415_10000025610 320
261 3300035695 Ga0373927_0072921 Ga0373927_0072921_1097_2071 320
262 3300037853 Ga0436364_0682637 Ga0436364_0682637_416_1432 320
263 3300039437 Ga0436365_0520124 Ga0436365_0520124_36501_37490 320
264 3300041410 Ga0439461_0014960 Ga0439461_0014960_375_1340 320
265 3300042435 Ga0439434_0021801 Ga0439434_0021801_582_1547 320
266 3300042436 Ga0439435_0017169 Ga0439435_0017169_201_1166 320
267 3300048916 Ga0496113_0406620 Ga0496113_0406620_10_1023 320
268 3300050514 nmdc:mga08x19_44420_c1 nmdc:mga08x19_44420_c1_1186_2187 320
269 3300005445 Ga0070708_100052038 Ga0070708_1000520383 321
270 3300006871 Ga0075434_100177238 Ga0075434_1001772382 321
271 3300007265 Ga0099794_10000326 Ga0099794_1000032614 321
272 3300009147 Ga0114129_10062912 Ga0114129_100629127 321
273 3300035691 Ga0373931_0227959 Ga0373931_0227959_52_1029 321
274 3300049583 Ga0501067_0083589 Ga0501067_0083589_343_1317 321
275 3300049742 Ga0501080_0001492 Ga0501080_0001492_15339_16313 321
276 3300049744 Ga0501083_0034378 Ga0501083_0034378_2077_3051 321
277 3300050507 nmdc:mga05p37_85120_c1 nmdc:mga05p37_85120_c1_864_1841 321
278 3300050508 nmdc:mga09592_86629_c1 nmdc:mga09592_86629_c1_772_1749 321
279 3300050512 nmdc:mga0n895_78149_c1 nmdc:mga0n895_78149_c1_522_1499 321
280 3300060353 Ga0501082_0005812 Ga0501082_0005812_1180_2154 321
281 3300002459 JGI24751J29686_10004101 JGI24751J29686_100041014 322
282 3300005329 Ga0070683_100093827 Ga0070683_1000938271 322
283 3300005343 Ga0070687_100081111 Ga0070687_1000811112 322
284 3300005367 Ga0070667_100268063 Ga0070667_1002680631 322
285 3300005455 Ga0070663_100003977 Ga0070663_1000039772 322
286 3300005578 Ga0068854_100012066 Ga0068854_1000120664 322
287 3300005614 Ga0068856_100044448 Ga0068856_1000444486 322
288 3300005618 Ga0068864_100211584 Ga0068864_1002115842 322
289 3300005937 Ga0081455_10011367 Ga0081455_100113676 322
290 3300005937 Ga0081455_10083038 Ga0081455_100830382 322
291 3300006173 Ga0070716_100013085 Ga0070716_1000130853 322
292 3300009093 Ga0105240_10189937 Ga0105240_101899372 322
293 3300009098 Ga0105245_10317228 Ga0105245_103172282 322
294 3300009553 Ga0105249_10050268 Ga0105249_100502684 322
295 3300013296 Ga0157374_10064162 Ga0157374_100641622 322
296 3300013307 Ga0157372_10262395 Ga0157372_102623952 322
297 3300014969 Ga0157376_10020308 Ga0157376_100203081 322
298 3300025898 Ga0207692_10056960 Ga0207692_100569602 322
299 3300025913 Ga0207695_10145623 Ga0207695_101456232 322
300 3300025919 Ga0207657_10114206 Ga0207657_101142061 322
301 3300025928 Ga0207700_10022334 Ga0207700_100223342 322
302 3300025929 Ga0207664_10106352 Ga0207664_101063522 322
303 3300025939 Ga0207665_10040605 Ga0207665_100406052 322
304 3300025961 Ga0207712_10020467 Ga0207712_100204672 322
305 3300025981 Ga0207640_10022159 Ga0207640_100221594 322
306 3300025986 Ga0207658_10259098 Ga0207658_102590982 322
307 3300026023 Ga0207677_10141141 Ga0207677_101411413 322
308 3300026067 Ga0207678_10003000 Ga0207678_100030005 322
309 3300026095 Ga0207676_10034294 Ga0207676_100342944 322
310 3300026116 Ga0207674_10055760 Ga0207674_100557604 322
311 3300026118 Ga0207675_100172685 Ga0207675_1001726852 322
312 3300028800 Ga0265338_10024577 Ga0265338_100245772 322
313 3300031241 Ga0265325_10019011 Ga0265325_100190112 322
314 3300031595 Ga0265313_10000044 Ga0265313_1000004497 322
315 3300031711 Ga0265314_10070148 Ga0265314_100701484 322
316 3300031728 Ga0316578_10027278 Ga0316578_100272783 322
317 3300035398 Ga0316574_0098796 Ga0316574_0098796_21_1028 322
318 3300039437 Ga0436365_1894668 Ga0436365_1894668_1182_2162 322
319 3300046683 Ga0495658_0065393 Ga0495658_0065393_159_1148 322
320 3300046691 Ga0495670_0084506 Ga0495670_0084506_282_1298 322
321 3300048903 Ga0496100_0166718 Ga0496100_0166718_476_1492 322
322 3300048905 Ga0496102_0018023 Ga0496102_0018023_472_1488 322
323 3300048909 Ga0496106_0077853 Ga0496106_0077853_865_1881 322
324 3300048911 Ga0496108_0005751 Ga0496108_0005751_7696_8712 322
325 3300048912 Ga0496109_0000470 Ga0496109_0000470_526_1542 322
326 3300048913 Ga0496110_0031531 Ga0496110_0031531_2591_3607 322
327 3300048914 Ga0496111_0011044 Ga0496111_0011044_1296_2312 322
328 3300048915 Ga0496112_0032197 Ga0496112_0032197_1282_2298 322
329 3300049570 Ga0501033_0062885 Ga0501033_0062885_148_1164 322
330 3300049573 Ga0501037_0229619 Ga0501037_0229619_244_1260 322
331 3300049586 Ga0501070_0064551 Ga0501070_0064551_80_1063 322
332 3300049586 Ga0501070_0146565 Ga0501070_0146565_813_1796 322
333 3300049742 Ga0501080_0136712 Ga0501080_0136712_137_1120 322
334 3300053083 Ga0495655_0005239 Ga0495655_0005239_636_1652 322
335 iso_pu_bacteria 2513237139 2513877744 322
336 iso_pu_bacteria 2775507049 2776914552 322
337 iso_pu_bacteria 2791355123 2792750001 322
338 iso_pu_bacteria 2903748898 2903754608 322
339 iso_pu_bacteria 2970540015 2970543486 322
340 3300001979 JGI24740J21852_10018015 JGI24740J21852_100180153 323
341 3300003791 Ga0055530_10000616 Ga0055530_100006162 323
342 3300005290 Ga0065712_10000972 Ga0065712_100009725 323
343 3300005290 Ga0065712_10079086 Ga0065712_100790862 323
344 3300005293 Ga0065715_10090112 Ga0065715_100901128 323
345 3300005327 Ga0070658_10023375 Ga0070658_100233754 323
346 3300005327 Ga0070658_10034665 Ga0070658_100346654 323
347 3300005329 Ga0070683_100004465 Ga0070683_1000044658 323
348 3300005329 Ga0070683_100028824 Ga0070683_1000288242 323
349 3300005329 Ga0070683_100118252 Ga0070683_1001182523 323
350 3300005329 Ga0070683_100134874 Ga0070683_1001348743 323
351 3300005330 Ga0070690_100096328 Ga0070690_1000963282 323
352 3300005330 Ga0070690_100109132 Ga0070690_1001091322 323
353 3300005331 Ga0070670_100229956 Ga0070670_1002299561 323
354 3300005331 Ga0070670_100331119 Ga0070670_1003311192 323
355 3300005334 Ga0068869_100276208 Ga0068869_1002762082 323
356 3300005335 Ga0070666_10078870 Ga0070666_100788703 323
357 3300005335 Ga0070666_10114204 Ga0070666_101142041 323
358 3300005336 Ga0070680_100051864 Ga0070680_1000518643 323
359 3300005337 Ga0070682_100001910 Ga0070682_1000019103 323
360 3300005337 Ga0070682_100088691 Ga0070682_1000886912 323
361 3300005338 Ga0068868_100057920 Ga0068868_1000579203 323
362 3300005338 Ga0068868_100232349 Ga0068868_1002323492 323
363 3300005339 Ga0070660_100018138 Ga0070660_1000181383 323
364 3300005339 Ga0070660_100041319 Ga0070660_1000413193 323
365 3300005339 Ga0070660_100052224 Ga0070660_1000522242 323
366 3300005340 Ga0070689_100318705 Ga0070689_1003187051 323
367 3300005341 Ga0070691_10031278 Ga0070691_100312783 323
368 3300005343 Ga0070687_100016835 Ga0070687_1000168353 323
369 3300005343 Ga0070687_100077656 Ga0070687_1000776562 323
370 3300005344 Ga0070661_100001970 Ga0070661_1000019701 323
371 3300005344 Ga0070661_100133020 Ga0070661_1001330202 323
372 3300005345 Ga0070692_10006890 Ga0070692_100068904 323
373 3300005345 Ga0070692_10057793 Ga0070692_100577932 323
374 3300005353 Ga0070669_100103757 Ga0070669_1001037572 323
375 3300005353 Ga0070669_100158807 Ga0070669_1001588072 323
376 3300005354 Ga0070675_100043593 Ga0070675_1000435933 323
377 3300005355 Ga0070671_100000721 Ga0070671_1000007215 323
378 3300005355 Ga0070671_100013369 Ga0070671_1000133692 323
379 3300005355 Ga0070671_100020832 Ga0070671_1000208327 323
380 3300005355 Ga0070671_100032216 Ga0070671_1000322165 323
381 3300005355 Ga0070671_100046292 Ga0070671_1000462924 323
382 3300005356 Ga0070674_100002976 Ga0070674_1000029765 323
383 3300005356 Ga0070674_100067667 Ga0070674_1000676672 323
384 3300005356 Ga0070674_100110130 Ga0070674_1001101302 323
385 3300005364 Ga0070673_100110374 Ga0070673_1001103742 323
386 3300005364 Ga0070673_100384807 Ga0070673_1003848071 323
387 3300005365 Ga0070688_100003448 Ga0070688_1000034485 323
388 3300005366 Ga0070659_100001160 Ga0070659_10000116010 323
389 3300005366 Ga0070659_100041939 Ga0070659_1000419392 323
390 3300005366 Ga0070659_100074009 Ga0070659_1000740094 323
391 3300005406 Ga0070703_10007507 Ga0070703_100075071 323
392 3300005435 Ga0070714_100215502 Ga0070714_1002155021 323
393 3300005435 Ga0070714_100317498 Ga0070714_1003174982 323
394 3300005438 Ga0070701_10002582 Ga0070701_100025825 323
395 3300005438 Ga0070701_10032141 Ga0070701_100321413 323
396 3300005439 Ga0070711_100006940 Ga0070711_1000069404 323
397 3300005439 Ga0070711_100014729 Ga0070711_1000147293 323
398 3300005439 Ga0070711_100271064 Ga0070711_1002710641 323
399 3300005440 Ga0070705_100080907 Ga0070705_1000809071 323
400 3300005441 Ga0070700_100001269 Ga0070700_1000012691 323
401 3300005441 Ga0070700_100004770 Ga0070700_1000047704 323
402 3300005445 Ga0070708_100017122 Ga0070708_1000171225 323
403 3300005445 Ga0070708_100025104 Ga0070708_1000251042 323
404 3300005445 Ga0070708_100035261 Ga0070708_1000352612 323
405 3300005445 Ga0070708_100044283 Ga0070708_1000442832 323
406 3300005445 Ga0070708_100167876 Ga0070708_1001678762 323
407 3300005445 Ga0070708_100183291 Ga0070708_1001832912 323
408 3300005445 Ga0070708_100189274 Ga0070708_1001892742 323
409 3300005455 Ga0070663_100037531 Ga0070663_1000375311 323
410 3300005456 Ga0070678_100001787 Ga0070678_10000178711 323
411 3300005456 Ga0070678_100074181 Ga0070678_1000741813 323
412 3300005456 Ga0070678_100243943 Ga0070678_1002439432 323
413 3300005457 Ga0070662_100000100 Ga0070662_10000010047 323
414 3300005457 Ga0070662_100018534 Ga0070662_1000185344 323
415 3300005457 Ga0070662_100045477 Ga0070662_1000454773 323
416 3300005458 Ga0070681_10119209 Ga0070681_101192092 323
417 3300005459 Ga0068867_100017764 Ga0068867_1000177644 323
418 3300005466 Ga0070685_10038191 Ga0070685_100381911 323
419 3300005467 Ga0070706_100000012 Ga0070706_10000001275 323
420 3300005467 Ga0070706_100006380 Ga0070706_1000063808 323
421 3300005467 Ga0070706_100009989 Ga0070706_1000099894 323
422 3300005467 Ga0070706_100014995 Ga0070706_1000149953 323
423 3300005467 Ga0070706_100024717 Ga0070706_1000247172 323
424 3300005467 Ga0070706_100079433 Ga0070706_1000794332 323
425 3300005467 Ga0070706_100220454 Ga0070706_1002204542 323
426 3300005468 Ga0070707_100006597 Ga0070707_1000065975 323
427 3300005468 Ga0070707_100014120 Ga0070707_1000141202 323
428 3300005468 Ga0070707_100033073 Ga0070707_1000330733 323
429 3300005468 Ga0070707_100056212 Ga0070707_1000562122 323
430 3300005468 Ga0070707_100136307 Ga0070707_1001363071 323
431 3300005468 Ga0070707_100161725 Ga0070707_1001617252 323
432 3300005468 Ga0070707_100403267 Ga0070707_1004032671 323
433 3300005471 Ga0070698_100002676 Ga0070698_1000026763 323
434 3300005471 Ga0070698_100069064 Ga0070698_1000690643 323
435 3300005518 Ga0070699_100000027 Ga0070699_10000002741 323
436 3300005518 Ga0070699_100044292 Ga0070699_1000442923 323
437 3300005518 Ga0070699_100053187 Ga0070699_1000531874 323
438 3300005518 Ga0070699_100145489 Ga0070699_1001454892 323
439 3300005518 Ga0070699_100188321 Ga0070699_1001883211 323
440 3300005530 Ga0070679_100005694 Ga0070679_1000056943 323
441 3300005530 Ga0070679_100015999 Ga0070679_1000159998 323
442 3300005530 Ga0070679_100351872 Ga0070679_1003518721 323
443 3300005535 Ga0070684_100002710 Ga0070684_1000027102 323
444 3300005535 Ga0070684_100104688 Ga0070684_1001046883 323
445 3300005535 Ga0070684_100122981 Ga0070684_1001229812 323
446 3300005536 Ga0070697_100005109 Ga0070697_1000051095 323
447 3300005536 Ga0070697_100009361 Ga0070697_1000093613 323
448 3300005536 Ga0070697_100106410 Ga0070697_1001064102 323
449 3300005536 Ga0070697_100170445 Ga0070697_1001704452 323
450 3300005536 Ga0070697_100234974 Ga0070697_1002349741 323
451 3300005536 Ga0070697_100284637 Ga0070697_1002846371 323
452 3300005539 Ga0068853_100003192 Ga0068853_1000031922 323
453 3300005539 Ga0068853_100054701 Ga0068853_1000547014 323
454 3300005539 Ga0068853_100080731 Ga0068853_1000807313 323
455 3300005543 Ga0070672_100041432 Ga0070672_1000414323 323
456 3300005543 Ga0070672_100221061 Ga0070672_1002210612 323
457 3300005544 Ga0070686_100004327 Ga0070686_1000043274 323
458 3300005545 Ga0070695_100010513 Ga0070695_1000105134 323
459 3300005546 Ga0070696_100014405 Ga0070696_1000144055 323
460 3300005546 Ga0070696_100016003 Ga0070696_1000160031 323
461 3300005548 Ga0070665_100019259 Ga0070665_1000192592 323
462 3300005548 Ga0070665_100020556 Ga0070665_1000205563 323
463 3300005549 Ga0070704_100001841 Ga0070704_1000018415 323
464 3300005549 Ga0070704_100061791 Ga0070704_1000617912 323
465 3300005563 Ga0068855_100005251 Ga0068855_10000525115 323
466 3300005563 Ga0068855_100005342 Ga0068855_1000053425 323
467 3300005563 Ga0068855_100257178 Ga0068855_1002571782 323
468 3300005563 Ga0068855_100283357 Ga0068855_1002833571 323
469 3300005563 Ga0068855_100305527 Ga0068855_1003055272 323
470 3300005563 Ga0068855_100488794 Ga0068855_1004887942 323
471 3300005564 Ga0070664_100022826 Ga0070664_1000228264 323
472 3300005564 Ga0070664_100040904 Ga0070664_1000409044 323
473 3300005564 Ga0070664_100196287 Ga0070664_1001962873 323
474 3300005564 Ga0070664_100275820 Ga0070664_1002758202 323
475 3300005577 Ga0068857_100004812 Ga0068857_10000481210 323
476 3300005577 Ga0068857_100027959 Ga0068857_1000279593 323
477 3300005577 Ga0068857_100045962 Ga0068857_1000459624 323
478 3300005614 Ga0068856_100003147 Ga0068856_1000031473 323
479 3300005614 Ga0068856_100032450 Ga0068856_1000324505 323
480 3300005614 Ga0068856_100118775 Ga0068856_1001187752 323
481 3300005614 Ga0068856_100179136 Ga0068856_1001791363 323
482 3300005615 Ga0070702_100002363 Ga0070702_1000023635 323
483 3300005616 Ga0068852_100111522 Ga0068852_1001115221 323
484 3300005617 Ga0068859_100030934 Ga0068859_1000309342 323
485 3300005618 Ga0068864_100003858 Ga0068864_10000385811 323
486 3300005718 Ga0068866_10001230 Ga0068866_1000123015 323
487 3300005719 Ga0068861_100104510 Ga0068861_1001045102 323
488 3300005841 Ga0068863_100015479 Ga0068863_1000154797 323
489 3300005842 Ga0068858_100159240 Ga0068858_1001592403 323
490 3300005843 Ga0068860_100154840 Ga0068860_1001548401 323
491 3300005937 Ga0081455_10001493 Ga0081455_1000149312 323
492 3300005937 Ga0081455_10002866 Ga0081455_1000286620 323
493 3300005937 Ga0081455_10003938 Ga0081455_100039382 323
494 3300005937 Ga0081455_10045162 Ga0081455_100451622 323
495 3300005983 Ga0081540_1000585 Ga0081540_100058542 323
496 3300005983 Ga0081540_1001783 Ga0081540_10017833 323
497 3300005985 Ga0081539_10072198 Ga0081539_100721982 323
498 3300006028 Ga0070717_10008392 Ga0070717_100083925 323
499 3300006163 Ga0070715_10181148 Ga0070715_101811481 323
500 3300006175 Ga0070712_100034018 Ga0070712_1000340182 323
501 3300006175 Ga0070712_100040764 Ga0070712_1000407643 323
502 3300006175 Ga0070712_100047468 Ga0070712_1000474683 323
503 3300006237 Ga0097621_100165858 Ga0097621_1001658582 323
504 3300006358 Ga0068871_100008531 Ga0068871_1000085314 323
505 3300006844 Ga0075428_100016349 Ga0075428_1000163492 323
506 3300006847 Ga0075431_100063842 Ga0075431_1000638424 323
507 3300006871 Ga0075434_100193945 Ga0075434_1001939453 323
508 3300006881 Ga0068865_100006647 Ga0068865_1000066475 323
509 3300006914 Ga0075436_100152805 Ga0075436_1001528052 323
510 3300006931 Ga0097620_100030934 Ga0097620_1000309343 323
511 3300007076 Ga0075435_100152481 Ga0075435_1001524813 323
512 3300009093 Ga0105240_10003453 Ga0105240_1000345327 323
513 3300009093 Ga0105240_10005589 Ga0105240_1000558911 323
514 3300009093 Ga0105240_10021548 Ga0105240_100215485 323
515 3300009093 Ga0105240_10179685 Ga0105240_101796852 323
516 3300009093 Ga0105240_10302017 Ga0105240_103020172 323
517 3300009098 Ga0105245_10030311 Ga0105245_100303114 323
518 3300009098 Ga0105245_10033847 Ga0105245_100338472 323
519 3300009101 Ga0105247_10031929 Ga0105247_100319295 323
520 3300009147 Ga0114129_10004027 Ga0114129_1000402711 323
521 3300009147 Ga0114129_10104050 Ga0114129_101040506 323
522 3300009147 Ga0114129_10228476 Ga0114129_102284763 323
523 3300009148 Ga0105243_10015705 Ga0105243_100157054 323
524 3300009148 Ga0105243_10096694 Ga0105243_100966941 323
525 3300009174 Ga0105241_10189001 Ga0105241_101890012 323
526 3300009176 Ga0105242_10002478 Ga0105242_1000247810 323
527 3300009177 Ga0105248_10000678 Ga0105248_100006783 323
528 3300009177 Ga0105248_10009353 Ga0105248_1000935315 323
529 3300009177 Ga0105248_10026767 Ga0105248_100267677 323
530 3300009177 Ga0105248_10070017 Ga0105248_100700175 323
531 3300009177 Ga0105248_10126579 Ga0105248_101265792 323
532 3300009545 Ga0105237_10031477 Ga0105237_100314773 323
533 3300009545 Ga0105237_10236066 Ga0105237_102360661 323
534 3300009545 Ga0105237_10258997 Ga0105237_102589972 323
535 3300009551 Ga0105238_10049920 Ga0105238_100499205 323
536 3300009553 Ga0105249_10027834 Ga0105249_100278345 323
537 3300010375 Ga0105239_10007473 Ga0105239_100074739 323
538 3300010375 Ga0105239_10020777 Ga0105239_100207772 323
539 3300010375 Ga0105239_10104541 Ga0105239_101045413 323
540 3300010375 Ga0105239_10451819 Ga0105239_104518191 323
541 3300010375 Ga0105239_10590234 Ga0105239_105902342 323
542 3300013100 Ga0157373_10007561 Ga0157373_1000756110 323
543 3300013100 Ga0157373_10011891 Ga0157373_100118916 323
544 3300013100 Ga0157373_10068938 Ga0157373_100689382 323
545 3300013102 Ga0157371_10000519 Ga0157371_100005194 323
546 3300013102 Ga0157371_10059902 Ga0157371_100599022 323
547 3300013104 Ga0157370_10007274 Ga0157370_1000727414 323
548 3300013104 Ga0157370_10007847 Ga0157370_1000784712 323
549 3300013104 Ga0157370_10060465 Ga0157370_100604652 323
550 3300013105 Ga0157369_10000446 Ga0157369_1000044647 323
551 3300013105 Ga0157369_10036941 Ga0157369_100369415 323
552 3300013105 Ga0157369_10070248 Ga0157369_100702483 323
553 3300013296 Ga0157374_10005832 Ga0157374_100058326 323
554 3300013296 Ga0157374_10006763 Ga0157374_100067632 323
555 3300013296 Ga0157374_10109303 Ga0157374_101093032 323
556 3300013296 Ga0157374_10189179 Ga0157374_101891792 323
557 3300013297 Ga0157378_10001394 Ga0157378_100013947 323
558 3300013297 Ga0157378_10016784 Ga0157378_100167846 323
559 3300013297 Ga0157378_10035108 Ga0157378_100351083 323
560 3300013297 Ga0157378_10262048 Ga0157378_102620482 323
561 3300013306 Ga0163162_10002009 Ga0163162_1000200911 323
562 3300013307 Ga0157372_10012255 Ga0157372_1001225510 323
563 3300013307 Ga0157372_10123775 Ga0157372_101237751 323
564 3300013308 Ga0157375_10197358 Ga0157375_101973583 323
565 3300013308 Ga0157375_10508447 Ga0157375_105084471 323
566 3300014326 Ga0157380_10081078 Ga0157380_100810783 323
567 3300014326 Ga0157380_10409641 Ga0157380_104096412 323
568 3300014969 Ga0157376_10002533 Ga0157376_100025338 323
569 3300021388 Ga0213875_10000007 Ga0213875_10000007495 323
570 3300024225 Ga0224572_1010860 Ga0224572_10108602 323
571 3300025302 Ga0207426_1024319 Ga0207426_10243193 323
572 3300025321 Ga0207656_10068084 Ga0207656_100680842 323
573 3300025885 Ga0207653_10004551 Ga0207653_100045512 323
574 3300025899 Ga0207642_10001203 Ga0207642_100012036 323
575 3300025900 Ga0207710_10043175 Ga0207710_100431752 323
576 3300025901 Ga0207688_10030810 Ga0207688_100308103 323
577 3300025903 Ga0207680_10116532 Ga0207680_101165322 323
578 3300025903 Ga0207680_10125030 Ga0207680_101250302 323
579 3300025903 Ga0207680_10278301 Ga0207680_102783011 323
580 3300025904 Ga0207647_10003843 Ga0207647_100038437 323
581 3300025904 Ga0207647_10028865 Ga0207647_100288653 323
582 3300025906 Ga0207699_10272933 Ga0207699_102729331 323
583 3300025907 Ga0207645_10007535 Ga0207645_100075357 323
584 3300025909 Ga0207705_10013584 Ga0207705_100135846 323
585 3300025909 Ga0207705_10023953 Ga0207705_100239535 323
586 3300025910 Ga0207684_10000028 Ga0207684_10000028202 323
587 3300025910 Ga0207684_10004597 Ga0207684_100045979 323
588 3300025910 Ga0207684_10005982 Ga0207684_100059829 323
589 3300025910 Ga0207684_10007109 Ga0207684_100071092 323
590 3300025910 Ga0207684_10019108 Ga0207684_100191082 323
591 3300025910 Ga0207684_10021323 Ga0207684_100213232 323
592 3300025910 Ga0207684_10067231 Ga0207684_100672313 323
593 3300025910 Ga0207684_10099636 Ga0207684_100996362 323
594 3300025912 Ga0207707_10004133 Ga0207707_1000413311 323
595 3300025912 Ga0207707_10142118 Ga0207707_101421181 323
596 3300025912 Ga0207707_10187540 Ga0207707_101875403 323
597 3300025913 Ga0207695_10041027 Ga0207695_100410273 323
598 3300025913 Ga0207695_10082248 Ga0207695_100822483 323
599 3300025913 Ga0207695_10137527 Ga0207695_101375272 323
600 3300025913 Ga0207695_10388196 Ga0207695_103881961 323
601 3300025914 Ga0207671_10019228 Ga0207671_100192283 323
602 3300025914 Ga0207671_10356497 Ga0207671_103564971 323
603 3300025915 Ga0207693_10037971 Ga0207693_100379713 323
604 3300025915 Ga0207693_10043720 Ga0207693_100437203 323
605 3300025916 Ga0207663_10019692 Ga0207663_100196924 323
606 3300025916 Ga0207663_10153594 Ga0207663_101535941 323
607 3300025916 Ga0207663_10198662 Ga0207663_101986622 323
608 3300025917 Ga0207660_10009213 Ga0207660_100092133 323
609 3300025917 Ga0207660_10035529 Ga0207660_100355295 323
610 3300025917 Ga0207660_10165683 Ga0207660_101656832 323
611 3300025918 Ga0207662_10067724 Ga0207662_100677242 323
612 3300025918 Ga0207662_10101803 Ga0207662_101018032 323
613 3300025919 Ga0207657_10000420 Ga0207657_1000042015 323
614 3300025919 Ga0207657_10003570 Ga0207657_1000357013 323
615 3300025919 Ga0207657_10022872 Ga0207657_100228725 323
616 3300025919 Ga0207657_10027113 Ga0207657_100271134 323
617 3300025919 Ga0207657_10027978 Ga0207657_100279784 323
618 3300025920 Ga0207649_10002746 Ga0207649_100027463 323
619 3300025920 Ga0207649_10175789 Ga0207649_101757892 323
620 3300025921 Ga0207652_10007755 Ga0207652_1000775510 323
621 3300025922 Ga0207646_10020654 Ga0207646_100206543 323
622 3300025922 Ga0207646_10022826 Ga0207646_100228261 323
623 3300025922 Ga0207646_10046252 Ga0207646_100462522 323
624 3300025922 Ga0207646_10124745 Ga0207646_101247451 323
625 3300025922 Ga0207646_10343735 Ga0207646_103437352 323
626 3300025924 Ga0207694_10012057 Ga0207694_100120575 323
627 3300025926 Ga0207659_10116169 Ga0207659_101161691 323
628 3300025927 Ga0207687_10035887 Ga0207687_100358873 323
629 3300025927 Ga0207687_10070667 Ga0207687_100706672 323
630 3300025928 Ga0207700_10446364 Ga0207700_104463641 323
631 3300025929 Ga0207664_10424914 Ga0207664_104249141 323
632 3300025931 Ga0207644_10055646 Ga0207644_100556464 323
633 3300025931 Ga0207644_10069404 Ga0207644_100694043 323
634 3300025931 Ga0207644_10083858 Ga0207644_100838583 323
635 3300025932 Ga0207690_10000043 Ga0207690_1000004321 323
636 3300025932 Ga0207690_10024907 Ga0207690_100249074 323
637 3300025932 Ga0207690_10032999 Ga0207690_100329992 323
638 3300025932 Ga0207690_10091256 Ga0207690_100912562 323
639 3300025933 Ga0207706_10002041 Ga0207706_1000204115 323
640 3300025933 Ga0207706_10032471 Ga0207706_100324713 323
641 3300025933 Ga0207706_10140416 Ga0207706_101404162 323
642 3300025934 Ga0207686_10002827 Ga0207686_100028274 323
643 3300025935 Ga0207709_10002160 Ga0207709_100021605 323
644 3300025936 Ga0207670_10060833 Ga0207670_100608333 323
645 3300025937 Ga0207669_10002299 Ga0207669_100022995 323
646 3300025937 Ga0207669_10074887 Ga0207669_100748873 323
647 3300025937 Ga0207669_10110976 Ga0207669_101109763 323
648 3300025938 Ga0207704_10022889 Ga0207704_100228894 323
649 3300025939 Ga0207665_10276793 Ga0207665_102767932 323
650 3300025941 Ga0207711_10000762 Ga0207711_1000076215 323
651 3300025941 Ga0207711_10020386 Ga0207711_100203869 323
652 3300025941 Ga0207711_10191464 Ga0207711_101914642 323
653 3300025942 Ga0207689_10049102 Ga0207689_100491023 323
654 3300025944 Ga0207661_10049429 Ga0207661_100494293 323
655 3300025944 Ga0207661_10060499 Ga0207661_100604993 323
656 3300025944 Ga0207661_10079270 Ga0207661_100792702 323
657 3300025944 Ga0207661_10097021 Ga0207661_100970212 323
658 3300025945 Ga0207679_10012735 Ga0207679_100127354 323
659 3300025945 Ga0207679_10199796 Ga0207679_101997962 323
660 3300025945 Ga0207679_10487482 Ga0207679_104874821 323
661 3300025949 Ga0207667_10002233 Ga0207667_1000223315 323
662 3300025949 Ga0207667_10010740 Ga0207667_100107405 323
663 3300025949 Ga0207667_10028104 Ga0207667_100281044 323
664 3300025949 Ga0207667_10044182 Ga0207667_100441825 323
665 3300025949 Ga0207667_10079623 Ga0207667_100796232 323
666 3300025949 Ga0207667_10097935 Ga0207667_100979353 323
667 3300025949 Ga0207667_10182149 Ga0207667_101821492 323
668 3300025949 Ga0207667_10514159 Ga0207667_105141591 323
669 3300025960 Ga0207651_10098023 Ga0207651_100980232 323
670 3300025960 Ga0207651_10192470 Ga0207651_101924702 323
671 3300025961 Ga0207712_10022707 Ga0207712_100227075 323
672 3300025972 Ga0207668_10129137 Ga0207668_101291371 323
673 3300025981 Ga0207640_10015620 Ga0207640_100156203 323
674 3300025986 Ga0207658_10038578 Ga0207658_100385782 323
675 3300026023 Ga0207677_10026863 Ga0207677_100268631 323
676 3300026035 Ga0207703_10077754 Ga0207703_100777542 323
677 3300026035 Ga0207703_10095494 Ga0207703_100954942 323
678 3300026041 Ga0207639_10002164 Ga0207639_1000216415 323
679 3300026041 Ga0207639_10019890 Ga0207639_100198905 323
680 3300026041 Ga0207639_10085664 Ga0207639_100856642 323
681 3300026041 Ga0207639_10208441 Ga0207639_102084412 323
682 3300026075 Ga0207708_10000321 Ga0207708_1000032117 323
683 3300026078 Ga0207702_10005057 Ga0207702_100050573 323
684 3300026078 Ga0207702_10019131 Ga0207702_100191314 323
685 3300026078 Ga0207702_10056522 Ga0207702_100565223 323
686 3300026078 Ga0207702_10103461 Ga0207702_101034612 323
687 3300026088 Ga0207641_10060610 Ga0207641_100606102 323
688 3300026088 Ga0207641_10113230 Ga0207641_101132301 323
689 3300026089 Ga0207648_10000214 Ga0207648_1000021438 323
690 3300026089 Ga0207648_10148162 Ga0207648_101481623 323
691 3300026095 Ga0207676_10003644 Ga0207676_100036447 323
692 3300026116 Ga0207674_10002976 Ga0207674_100029769 323
693 3300026116 Ga0207674_10014624 Ga0207674_100146245 323
694 3300026116 Ga0207674_10049444 Ga0207674_100494443 323
695 3300026116 Ga0207674_10224347 Ga0207674_102243472 323
696 3300026118 Ga0207675_100123393 Ga0207675_1001233932 323
697 3300026118 Ga0207675_100149024 Ga0207675_1001490241 323
698 3300026121 Ga0207683_10003051 Ga0207683_100030519 323
699 3300026121 Ga0207683_10059808 Ga0207683_100598083 323
700 3300026121 Ga0207683_10128929 Ga0207683_101289292 323
701 3300026142 Ga0207698_10002617 Ga0207698_100026177 323
702 3300026142 Ga0207698_10043170 Ga0207698_100431704 323
703 3300026142 Ga0207698_10170483 Ga0207698_101704832 323
704 3300026142 Ga0207698_10306357 Ga0207698_103063572 323
705 3300027907 Ga0207428_10050740 Ga0207428_100507403 323
706 3300028379 Ga0268266_10021111 Ga0268266_100211113 323
707 3300028381 Ga0268264_10036627 Ga0268264_100366273 323
708 3300028381 Ga0268264_10046483 Ga0268264_100464833 323
709 3300028794 Ga0307515_10128015 Ga0307515_101280153 323
710 3300028800 Ga0265338_10019630 Ga0265338_100196304 323
711 3300031238 Ga0265332_10003415 Ga0265332_100034156 323
712 3300031240 Ga0265320_10003891 Ga0265320_100038919 323
713 3300031242 Ga0265329_10005833 Ga0265329_100058332 323
714 3300031247 Ga0265340_10018468 Ga0265340_100184682 323
715 3300031249 Ga0265339_10016294 Ga0265339_100162942 323
716 3300031250 Ga0265331_10008726 Ga0265331_100087264 323
717 3300031251 Ga0265327_10000384 Ga0265327_1000038413 323
718 3300031344 Ga0265316_10002294 Ga0265316_100022941 323
719 3300031344 Ga0265316_10007923 Ga0265316_100079236 323
720 3300031595 Ga0265313_10012835 Ga0265313_100128353 323
721 3300031711 Ga0265314_10003142 Ga0265314_100031429 323
722 3300031711 Ga0265314_10034195 Ga0265314_100341953 323
723 3300031727 Ga0316576_10016157 Ga0316576_100161575 323
724 3300031903 Ga0307407_10016068 Ga0307407_100160681 323
725 3300031903 Ga0307407_10033881 Ga0307407_100338812 323
726 3300031995 Ga0307409_100011526 Ga0307409_1000115263 323
727 3300031995 Ga0307409_100027326 Ga0307409_1000273262 323
728 3300032002 Ga0307416_100013464 Ga0307416_1000134642 323
729 3300032002 Ga0307416_100017520 Ga0307416_1000175203 323
730 3300032004 Ga0307414_10013692 Ga0307414_100136922 323
731 3300032004 Ga0307414_10015850 Ga0307414_100158505 323
732 3300032126 Ga0307415_100006916 Ga0307415_1000069163 323
733 3300032126 Ga0307415_100077036 Ga0307415_1000770362 323
734 3300032126 Ga0307415_100100564 Ga0307415_1001005642 323
735 3300032133 Ga0316583_10017380 Ga0316583_100173802 323
736 3300035085 Ga0373929_0004162 Ga0373929_0004162_240_1223 323
737 3300035111 Ga0373923_0002168 Ga0373923_0002168_4412_5407 323
738 3300035118 Ga0373954_0120648 Ga0373954_0120648_168_1142 323
739 3300035170 Ga0373943_0049256 Ga0373943_0049256_619_1617 323
740 3300035241 Ga0373961_0004269 Ga0373961_0004269_350_1333 323
741 3300035691 Ga0373931_0022373 Ga0373931_0022373_1901_2884 323
742 3300035691 Ga0373931_0025681 Ga0373931_0025681_345_1337 323
743 3300035691 Ga0373931_0064125 Ga0373931_0064125_961_1965 323
744 3300035695 Ga0373927_0001790 Ga0373927_0001790_2839_3834 323
745 3300035725 Ga0373947_0067658 Ga0373947_0067658_302_1276 323
746 3300036401 Ga0373937_0097073 Ga0373937_0097073_71_1057 323
747 3300036647 Ga0316582_0004251 Ga0316582_0004251_3728_4774 323
748 3300036712 Ga0316584_0009352 Ga0316584_0009352_5560_6555 323
749 3300037068 Ga0373925_0444600 Ga0373925_0444600_16_1020 323
750 3300037312 Ga0395899_0000103 Ga0395899_0000103_125822_126793 323
751 3300037312 Ga0395899_0011626 Ga0395899_0011626_1293_2330 323
752 3300037312 Ga0395899_0027843 Ga0395899_0027843_2865_3854 323
753 3300037312 Ga0395899_0117109 Ga0395899_0117109_859_1830 323
754 3300037312 Ga0395899_0148931 Ga0395899_0148931_301_1272 323
755 3300037312 Ga0395899_0157022 Ga0395899_0157022_83_1054 323
756 3300037312 Ga0395899_0169415 Ga0395899_0169415_10_1005 323
757 3300037418 Ga0395900_0002384 Ga0395900_0002384_14045_15016 323
758 3300037418 Ga0395900_0002717 Ga0395900_0002717_6121_7092 323
759 3300037418 Ga0395900_0003073 Ga0395900_0003073_4144_5115 323
760 3300037418 Ga0395900_0023201 Ga0395900_0023201_1038_2009 323
761 3300037418 Ga0395900_0046164 Ga0395900_0046164_1617_2603 323
762 3300037418 Ga0395900_0047090 Ga0395900_0047090_2639_3619 323
763 3300037418 Ga0395900_0058657 Ga0395900_0058657_1746_2717 323
764 3300037418 Ga0395900_0101453 Ga0395900_0101453_640_1641 323
765 3300037418 Ga0395900_0103496 Ga0395900_0103496_509_1480 323
766 3300037418 Ga0395900_0114137 Ga0395900_0114137_1746_2741 323
767 3300037418 Ga0395900_0178595 Ga0395900_0178595_704_1693 323
768 3300037418 Ga0395900_0237484 Ga0395900_0237484_830_1816 323
769 3300037466 Ga0395898_0000053 Ga0395898_0000053_180423_181394 323
770 3300037466 Ga0395898_0012329 Ga0395898_0012329_3312_4349 323
771 3300037466 Ga0395898_0024232 Ga0395898_0024232_2936_3907 323
772 3300037466 Ga0395898_0052265 Ga0395898_0052265_323_1294 323
773 3300037466 Ga0395898_0081494 Ga0395898_0081494_523_1494 323
774 3300037466 Ga0395898_0129444 Ga0395898_0129444_442_1413 323
775 3300037466 Ga0395898_0249665 Ga0395898_0249665_134_1129 323
776 3300037466 Ga0395898_0257387 Ga0395898_0257387_213_1184 323
777 3300037466 Ga0395898_0348051 Ga0395898_0348051_81_1067 323
778 3300037471 Ga0395905_0000031 Ga0395905_0000031_105364_106335 323
779 3300037471 Ga0395905_0002933 Ga0395905_0002933_15481_16470 323
780 3300037471 Ga0395905_0011028 Ga0395905_0011028_6526_7497 323
781 3300037471 Ga0395905_0014041 Ga0395905_0014041_4804_5835 323
782 3300037471 Ga0395905_0017320 Ga0395905_0017320_1986_2972 323
783 3300037471 Ga0395905_0019078 Ga0395905_0019078_978_1964 323
784 3300037471 Ga0395905_0028173 Ga0395905_0028173_1715_2716 323
785 3300037471 Ga0395905_0035912 Ga0395905_0035912_1911_2882 323
786 3300037471 Ga0395905_0051072 Ga0395905_0051072_1656_2627 323
787 3300037471 Ga0395905_0069555 Ga0395905_0069555_1177_2148 323
788 3300037471 Ga0395905_0171086 Ga0395905_0171086_84_1079 323
789 3300037853 Ga0436364_0536128 Ga0436364_0536128_30162_31151 323
790 3300038443 Ga0395901_0000163 Ga0395901_0000163_66180_67151 323
791 3300038443 Ga0395901_0003692 Ga0395901_0003692_4298_5269 323
792 3300038443 Ga0395901_0006699 Ga0395901_0006699_4916_5887 323
793 3300038443 Ga0395901_0011095 Ga0395901_0011095_2052_3023 323
794 3300038443 Ga0395901_0014941 Ga0395901_0014941_5719_6705 323
795 3300038443 Ga0395901_0037660 Ga0395901_0037660_2577_3548 323
796 3300038443 Ga0395901_0104621 Ga0395901_0104621_1398_2429 323
797 3300038443 Ga0395901_0109031 Ga0395901_0109031_529_1566 323
798 3300038443 Ga0395901_0124654 Ga0395901_0124654_139_1125 323
799 3300038443 Ga0395901_0413734 Ga0395901_0413734_194_1204 323
800 3300038443 Ga0395901_0463862 Ga0395901_0463862_269_1270 323
801 3300038443 Ga0395901_0537671 Ga0395901_0537671_161_1156 323
802 3300042005 Ga0439448_0004115 Ga0439448_0004115_1210_2196 323
803 3300042157 Ga0439458_0000121 Ga0439458_0000121_12715_13701 323
804 3300042157 Ga0439458_0001367 Ga0439458_0001367_2615_3601 323
805 3300044656 Ga0466969_0006178 Ga0466969_0006178_3581_4567 323
806 3300044658 Ga0466972_0000063 Ga0466972_0000063_64967_66004 323
807 3300044658 Ga0466972_0047556 Ga0466972_0047556_1037_2017 323
808 3300044683 Ga0466965_0019715 Ga0466965_0019715_2223_3194 323
809 3300044684 Ga0466966_0002883 Ga0466966_0002883_8973_9977 323
810 3300044684 Ga0466966_0013797 Ga0466966_0013797_1372_2358 323
811 3300044684 Ga0466966_0018101 Ga0466966_0018101_560_1549 323
812 3300044684 Ga0466966_0190441 Ga0466966_0190441_193_1191 323
813 3300044693 Ga0466961_0058869 Ga0466961_0058869_1156_2127 323
814 3300044694 Ga0466963_0010554 Ga0466963_0010554_137_1138 323
815 3300044694 Ga0466963_0010868 Ga0466963_0010868_1484_2455 323
816 3300044694 Ga0466963_0053411 Ga0466963_0053411_1033_2025 323
817 3300044694 Ga0466963_0126448 Ga0466963_0126448_104_1084 323
818 3300044706 Ga0466964_0116042 Ga0466964_0116042_162_1166 323
819 3300044719 Ga0466971_0021851 Ga0466971_0021851_1232_2290 323
820 3300044842 Ga0466957_0015688 Ga0466957_0015688_1553_2545 323
821 3300044842 Ga0466957_0041916 Ga0466957_0041916_1217_2197 323
822 3300044901 Ga0466960_0190397 Ga0466960_0190397_34_1035 323
823 3300045049 Ga0466959_0020934 Ga0466959_0020934_2907_3893 323
824 3300045049 Ga0466959_0025616 Ga0466959_0025616_2622_3680 323
825 3300045049 Ga0466959_0039918 Ga0466959_0039918_1507_2511 323
826 3300045049 Ga0466959_0177015 Ga0466959_0177015_302_1393 323
827 3300045049 Ga0466959_0238537 Ga0466959_0238537_259_1230 323
828 3300045836 Ga0466958_0001875 Ga0466958_0001875_1312_2304 323
829 3300045976 Ga0466967_0013401 Ga0466967_0013401_880_1860 323
830 3300045976 Ga0466967_0026278 Ga0466967_0026278_1191_2213 323
831 3300045976 Ga0466967_0097081 Ga0466967_0097081_60_1049 323
832 3300045976 Ga0466967_0122672 Ga0466967_0122672_1287_2288 323
833 3300045976 Ga0466967_0139563 Ga0466967_0139563_446_1444 323
834 3300046455 Ga0495603_0027959 Ga0495603_0027959_1534_2520 323
835 3300046461 Ga0495641_0096699 Ga0495641_0096699_204_1190 323
836 3300046462 Ga0495651_0002911 Ga0495651_0002911_100_1134 323
837 3300046462 Ga0495651_0003862 Ga0495651_0003862_4792_5796 323
838 3300046463 Ga0495653_0001994 Ga0495653_0001994_14575_15579 323
839 3300046472 Ga0495580_0018482 Ga0495580_0018482_3636_4640 323
840 3300046473 Ga0495582_0000431 Ga0495582_0000431_14305_15303 323
841 3300046516 Ga0495628_0000515 Ga0495628_0000515_14510_15514 323
842 3300046516 Ga0495628_0003485 Ga0495628_0003485_2263_3264 323
843 3300046517 Ga0495630_0043576 Ga0495630_0043576_245_1249 323
844 3300046522 Ga0495643_0005167 Ga0495643_0005167_3130_4149 323
845 3300046523 Ga0495644_0099088 Ga0495644_0099088_57_1043 323
846 3300046525 Ga0495663_0029883 Ga0495663_0029883_59_1120 323
847 3300046529 Ga0495652_0002256 Ga0495652_0002256_16771_17775 323
848 3300046529 Ga0495652_0010026 Ga0495652_0010026_2502_3497 323
849 3300046533 Ga0495640_0038052 Ga0495640_0038052_1032_2042 323
850 3300046536 Ga0495587_0001271 Ga0495587_0001271_3845_4849 323
851 3300046543 Ga0495645_0016848 Ga0495645_0016848_2163_3167 323
852 3300046559 Ga0495667_0002732 Ga0495667_0002732_4312_5316 323
853 3300046615 Ga0495656_0022141 Ga0495656_0022141_714_1697 323
854 3300046663 Ga0495635_0006423 Ga0495635_0006423_4929_5924 323
855 3300046674 Ga0495588_0033165 Ga0495588_0033165_747_1721 323
856 3300046675 Ga0495657_0017798 Ga0495657_0017798_2846_3850 323
857 3300046678 Ga0495599_0029392 Ga0495599_0029392_182_1186 323
858 3300046683 Ga0495658_0233540 Ga0495658_0233540_94_1104 323
859 3300046684 Ga0495669_0007954 Ga0495669_0007954_2543_3604 323
860 3300046689 Ga0495613_0184803 Ga0495613_0184803_231_1241 323
861 3300046690 Ga0495624_0011960 Ga0495624_0011960_4748_5743 323
862 3300046794 Ga0495589_0132728 Ga0495589_0132728_142_1128 323
863 3300046809 Ga0495600_0238797 Ga0495600_0238797_81_1085 323
864 3300047315 Ga0495581_0010437 Ga0495581_0010437_199_1197 323
865 3300047315 Ga0495581_0024575 Ga0495581_0024575_1014_2000 323
866 3300047315 Ga0495581_0102798 Ga0495581_0102798_393_1379 323
867 3300047317 Ga0495604_0007212 Ga0495604_0007212_615_1619 323
868 3300047317 Ga0495604_0183788 Ga0495604_0183788_412_1395 323
869 3300047317 Ga0495604_0253631 Ga0495604_0253631_57_1058 323
870 3300047319 Ga0495674_0003664 Ga0495674_0003664_10807_11811 323
871 3300047319 Ga0495674_0204775 Ga0495674_0204775_495_1496 323
872 3300047321 Ga0495676_0030058 Ga0495676_0030058_297_1283 323
873 3300047321 Ga0495676_0063564 Ga0495676_0063564_356_1390 323
874 3300047322 Ga0495680_0000563 Ga0495680_0000563_40749_41783 323
875 3300047444 Ga0495675_0000371 Ga0495675_0000371_20918_21922 323
876 3300047444 Ga0495675_0205191 Ga0495675_0205191_46_1080 323
877 3300048088 Ga0495602_0012470 Ga0495602_0012470_4326_5330 323
878 3300048903 Ga0496100_0016696 Ga0496100_0016696_2036_3097 323
879 3300048903 Ga0496100_0033944 Ga0496100_0033944_2148_3134 323
880 3300048903 Ga0496100_0047207 Ga0496100_0047207_1130_2131 323
881 3300048904 Ga0496101_0005176 Ga0496101_0005176_1492_2478 323
882 3300048904 Ga0496101_0014355 Ga0496101_0014355_3789_4850 323
883 3300048904 Ga0496101_0018589 Ga0496101_0018589_2783_3784 323
884 3300048904 Ga0496101_0035794 Ga0496101_0035794_958_1968 323
885 3300048905 Ga0496102_0002662 Ga0496102_0002662_6811_7797 323
886 3300048905 Ga0496102_0025629 Ga0496102_0025629_1437_2438 323
887 3300048905 Ga0496102_0121851 Ga0496102_0121851_211_1224 323
888 3300048905 Ga0496102_0181694 Ga0496102_0181694_943_1926 323
889 3300048906 Ga0496103_0002178 Ga0496103_0002178_2911_3897 323
890 3300048906 Ga0496103_0185753 Ga0496103_0185753_264_1277 323
891 3300048907 Ga0496104_0003563 Ga0496104_0003563_556_1557 323
892 3300048907 Ga0496104_0084553 Ga0496104_0084553_1005_2039 323
893 3300048907 Ga0496104_0086658 Ga0496104_0086658_172_1155 323
894 3300048908 Ga0496105_0250381 Ga0496105_0250381_287_1321 323
895 3300048909 Ga0496106_0005635 Ga0496106_0005635_300_1286 323
896 3300048909 Ga0496106_0008543 Ga0496106_0008543_3111_4172 323
897 3300048909 Ga0496106_0019985 Ga0496106_0019985_1657_2658 323
898 3300048909 Ga0496106_0352466 Ga0496106_0352466_63_1073 323
899 3300048910 Ga0496107_0001105 Ga0496107_0001105_12413_13399 323
900 3300048910 Ga0496107_0006260 Ga0496107_0006260_2347_3408 323
901 3300048910 Ga0496107_0031185 Ga0496107_0031185_932_1933 323
902 3300048910 Ga0496107_0081601 Ga0496107_0081601_144_1202 323
903 3300048911 Ga0496108_0034303 Ga0496108_0034303_1609_2622 323
904 3300048911 Ga0496108_0105031 Ga0496108_0105031_898_1899 323
905 3300048911 Ga0496108_0130404 Ga0496108_0130404_213_1196 323
906 3300048911 Ga0496108_0332614 Ga0496108_0332614_43_1023 323
907 3300048912 Ga0496109_0004861 Ga0496109_0004861_6962_8023 323
908 3300048912 Ga0496109_0020529 Ga0496109_0020529_2325_3359 323
909 3300048912 Ga0496109_0256591 Ga0496109_0256591_571_1569 323
910 3300048913 Ga0496110_0004040 Ga0496110_0004040_5156_6217 323
911 3300048913 Ga0496110_0109228 Ga0496110_0109228_1319_2320 323
912 3300048914 Ga0496111_0021701 Ga0496111_0021701_2542_3603 323
913 3300048915 Ga0496112_0015372 Ga0496112_0015372_3776_4789 323
914 3300048915 Ga0496112_0029020 Ga0496112_0029020_2285_3295 323
915 3300048915 Ga0496112_0031498 Ga0496112_0031498_1280_2305 323
916 3300048915 Ga0496112_0231686 Ga0496112_0231686_139_1110 323
917 3300048916 Ga0496113_0003062 Ga0496113_0003062_6381_7442 323
918 3300048916 Ga0496113_0053500 Ga0496113_0053500_1562_2575 323
919 3300048917 Ga0496114_0038112 Ga0496114_0038112_2846_3832 323
920 3300048917 Ga0496114_0041232 Ga0496114_0041232_1869_2870 323
921 3300048917 Ga0496114_0146056 Ga0496114_0146056_141_1151 323
922 3300048918 Ga0496115_0001296 Ga0496115_0001296_2873_3859 323
923 3300048918 Ga0496115_0015566 Ga0496115_0015566_501_1502 323
924 3300048918 Ga0496115_0018307 Ga0496115_0018307_881_1864 323
925 3300048918 Ga0496115_0422398 Ga0496115_0422398_74_1054 323
926 3300048920 Ga0496117_0000310 Ga0496117_0000310_9807_10793 323
927 3300048924 Ga0496121_0082601 Ga0496121_0082601_1153_2136 323
928 3300049568 Ga0501031_0060415 Ga0501031_0060415_129_1112 323
929 3300049571 Ga0501034_0016634 Ga0501034_0016634_5674_6657 323
930 3300049571 Ga0501034_0145372 Ga0501034_0145372_1152_2135 323
931 3300049572 Ga0501036_0078371 Ga0501036_0078371_419_1393 323
932 3300049574 Ga0501038_0082872 Ga0501038_0082872_1589_2572 323
933 3300049574 Ga0501038_0170545 Ga0501038_0170545_739_1722 323
934 3300049574 Ga0501038_0291304 Ga0501038_0291304_28_1032 323
935 3300049575 Ga0501039_0049828 Ga0501039_0049828_423_1427 323
936 3300049575 Ga0501039_0053881 Ga0501039_0053881_695_1678 323
937 3300049577 Ga0501041_0004801 Ga0501041_0004801_6683_7666 323
938 3300049578 Ga0501042_0016971 Ga0501042_0016971_3467_4450 323
939 3300049581 Ga0501047_0052879 Ga0501047_0052879_727_1779 323
940 3300049581 Ga0501047_0068672 Ga0501047_0068672_854_1828 323
941 3300049581 Ga0501047_0345343 Ga0501047_0345343_306_1289 323
942 3300049582 Ga0501048_0050071 Ga0501048_0050071_1393_2376 323
943 3300049587 Ga0501071_0071018 Ga0501071_0071018_1269_2252 323
944 3300049588 Ga0501072_0060560 Ga0501072_0060560_1429_2412 323
945 3300049588 Ga0501072_0065057 Ga0501072_0065057_95_1105 323
946 3300049590 Ga0501074_0039427 Ga0501074_0039427_124_1134 323
947 3300049591 Ga0501075_0129121 Ga0501075_0129121_599_1609 323
948 3300049592 Ga0501076_0009014 Ga0501076_0009014_2942_3925 323
949 3300049593 Ga0501077_0007642 Ga0501077_0007642_523_1533 323
950 3300049741 Ga0501079_0010528 Ga0501079_0010528_1327_2337 323
951 3300049742 Ga0501080_0020624 Ga0501080_0020624_4622_5632 323
952 3300049742 Ga0501080_0428309 Ga0501080_0428309_37_1023 323
953 3300049743 Ga0501081_0020935 Ga0501081_0020935_2888_3871 323
954 3300049743 Ga0501081_0145909 Ga0501081_0145909_36_1031 323
955 3300049744 Ga0501083_0050079 Ga0501083_0050079_1453_2436 323
956 3300049822 Ga0501035_0051047 Ga0501035_0051047_1008_1991 323
957 3300049822 Ga0501035_0202314 Ga0501035_0202314_417_1400 323
958 3300049823 Ga0501044_0065971 Ga0501044_0065971_1714_2697 323
959 3300049823 Ga0501044_0113267 Ga0501044_0113267_240_1223 323
960 3300049824 Ga0501045_0003237 Ga0501045_0003237_1064_2047 323
961 3300050507 nmdc:mga05p37_210272_c1 nmdc:mga05p37_210272_c1_227_1210 323
962 3300050507 nmdc:mga05p37_33473_c1 nmdc:mga05p37_33473_c1_4829_5818 323
963 3300050507 nmdc:mga05p37_83042_c1 nmdc:mga05p37_83042_c1_2795_3799 323
964 3300050512 nmdc:mga0n895_8149_c1 nmdc:mga0n895_8149_c1_33_1016 323
965 3300050513 nmdc:mga0rr50_233833_c1 nmdc:mga0rr50_233833_c1_338_1324 323
966 3300050513 nmdc:mga0rr50_68941_c1 nmdc:mga0rr50_68941_c1_1531_2523 323
967 3300050513 nmdc:mga0rr50_77661_c1 nmdc:mga0rr50_77661_c1_279_1262 323
968 3300050514 nmdc:mga08x19_38967_c1 nmdc:mga08x19_38967_c1_1543_2526 323
969 3300050515 nmdc:mga0a205_330456_c1 nmdc:mga0a205_330456_c1_110_1096 323
970 3300053077 Ga0495601_0001675 Ga0495601_0001675_2541_3524 323
971 3300053083 Ga0495655_0005262 Ga0495655_0005262_863_1840 323
972 3300053158 Ga0500627_0000020 Ga0500627_0000020_56319_57335 323
973 3300054114 Ga0501084_0004952 Ga0501084_0004952_81_1091 323
974 3300054114 Ga0501084_0014118 Ga0501084_0014118_2973_3956 323
975 3300059421 Ga0590071_007661 Ga0590071_007661_1132_2115 323
976 3300059424 Ga0590075_010614 Ga0590075_010614_613_1590 323
977 3300060353 Ga0501082_0061992 Ga0501082_0061992_717_1700 323
978 3300060353 Ga0501082_0090622 Ga0501082_0090622_1398_2408 323
979 3300060353 Ga0501082_0322712 Ga0501082_0322712_225_1208 323
980 3300061719 Ga0466962_0027009 Ga0466962_0027009_825_1796 323
981 3300061719 Ga0466962_0076654 Ga0466962_0076654_79_1050 323
982 3300061734 Ga0530510_0051841 Ga0530510_0051841_798_1808 323
983 3300061734 Ga0530510_0087979 Ga0530510_0087979_841_1824 323
984 iso_pu_bacteria 2643221563 2643832623 323
985 iso_pu_bacteria 2643221608 2644053582 323

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

83

194

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z6k-assembly1.cif.gz_B alcohol dehydrogenase from the antarctic psychrophile moraxella sp. tae 123 0.9484 2 323
1llu-assembly1.cif.gz_A the ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate 0.9474 2 323
6iqd-assembly1.cif.gz_A crystal structure of alcohol dehydrogenase from geobacillus stearothermophilus 0.947 2 323
3s2i-assembly2.cif.gz_H crystal structure of furx nadh+:furfuryl alcohol ii 0.9431 2 323
4z6k-assembly1.cif.gz_B alcohol dehydrogenase from the antarctic psychrophile moraxella sp. tae 123 0.9427 2 323
ID Description Score Start End Superfamily
af_P9WQC1_8_164_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9707 2 142 3.90.180.10
af_P9WQC1_165_293_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9598 143 270 3.40.50.720
2hcyB01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9466 2 142 3.90.180.10
af_P9WQC1_165_293_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9453 143 270 3.40.50.720
af_Q86AG4_1_164_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9411 4 156 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A1F3ZE52-F1-model_v4 Alcohol dehydrogenase 0.9919 1 272 GO:0004022
GO:0005737
AF-A0A559Q2V2-F1-model_v4 deleted 0.9907 1 323
AF-A0A1Q7R5G0-F1-model_v4 alcohol dehydrogenase (EC 1.1.1.1) 0.9903 1 279 GO:0004022
GO:0005737
GO:0008270
AF-A0A1H2GHW8-F1-model_v4 alcohol dehydrogenase (EC 1.1.1.1) 0.9901 1 323 GO:0004022
GO:0005737
GO:0008270
AF-A0A6P5UT19-F1-model_v4 deleted 0.9898 1 323

Feature Viewer

pLDDT pTM Quality
96.09 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map