F487498
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 985 | 381 | 978 | 327 |
Family's Representative Sequence
| Representative Sequence | 3300005536|Ga0070697_100234974|Ga0070697_1002349741 |
| Length | 392 |
| Sequence | MSTPNQWEDPSADLAKMKILIIDDEPVNVALLEEILVEAGYTRFESPIAIHLLPVDTSALRAMVLEKTGTRLVLRDVPKPKSGRGQLLVRVNACAVCRTDLHIVDGELPDPKLPLILGHQIVGRVEQIGANTGGFSMGDRVGIPWLGWTDGDCAYCRSNRENLCDRAKFTGYNIDGGYAEFTVADARYCFHLPDEYNDVDAAPLLCAGMLGYRSYRKTGDAHRLGIYGFGNAAHLIAQVARYEKKEIYAFTRPGDKAGQESARSLGAVWSGSSDEMPPKKLDAAIIFAPVGALVPIALPALAKGGIVVCGGIHMSDIPSFPYVDLWQERVICSVANLTRRDGEEFLKIAPRVPVKTKVETFSLEEANTALEKFRAGELDGNAVLQISSRQKS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 2 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 3 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 4 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 5 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 6 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 7 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 8 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 9 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 10 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 11 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 12 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 86 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 87 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 95 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 96 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 129 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 131 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 132 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 133 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 198 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 199 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 200 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 204 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 208 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 209 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 211 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 212 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 213 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 214 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 215 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 216 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 217 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 218 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 219 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 220 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 223 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 224 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 225 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 226 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 227 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 228 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 229 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 230 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 231 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 232 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 233 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 234 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 235 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 237 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 239 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 240 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 241 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 242 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 244 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 245 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 247 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 248 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 249 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 250 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 251 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 252 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 253 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 254 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 255 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 256 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 257 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 258 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 259 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 260 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 261 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 262 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 263 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 264 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 265 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 266 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 267 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 268 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 269 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 270 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 271 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 272 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 273 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 274 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 275 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 276 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 277 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 278 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 319 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 320 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 321 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 322 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 323 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 324 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 327 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 328 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 329 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 330 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 331 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 332 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 333 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 334 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 376 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 378 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 379 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 381 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.29 |
| Metatranscriptomes | 0 |
| Isolates | 0.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.3 |
| Nodule | 0.71 |
| Rhizoplane | 7.21 |
| Rhizosphere | 90.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10018015 | 3300001979 | Bacteria | 2515 |
| 2 | JGI24751J29686_10004101 | 3300002459 | Bacteria | 2952 |
| 3 | JGI25406J46586_10000020 | 3300003203 | Bacteria | 86123 |
| 4 | JGI25407J50210_10001965 | 3300003373 | Bacteria | 4781 |
| 5 | Ga0055530_10000616 | 3300003791 | Bacteria | 30895 |
| 6 | Ga0065712_10000972 | 3300005290 | Bacteria | 11589 |
| 7 | Ga0065712_10079086 | 3300005290 | Bacteria | 3242 |
| 8 | Ga0065715_10090112 | 3300005293 | Bacteria | 7644 |
| 9 | Ga0070658_10023375 | 3300005327 | Bacteria | 4962 |
| 10 | Ga0070658_10034665 | 3300005327 | Bacteria | 4061 |
| 11 | Ga0070683_100004465 | 3300005329 | Bacteria | 11546 |
| 12 | Ga0070683_100028824 | 3300005329 | Bacteria | 5021 |
| 13 | Ga0070683_100093827 | 3300005329 | Bacteria | 2820 |
| 14 | Ga0070683_100118252 | 3300005329 | Bacteria | 2503 |
| 15 | Ga0070683_100134874 | 3300005329 | Bacteria | 2337 |
| 16 | Ga0070690_100096328 | 3300005330 | Unclassified | 1956 |
| 17 | Ga0070690_100109132 | 3300005330 | Bacteria | 1844 |
| 18 | Ga0070670_100229956 | 3300005331 | Bacteria | 1614 |
| 19 | Ga0070670_100331119 | 3300005331 | Bacteria | 1335 |
| 20 | Ga0068869_100276208 | 3300005334 | Bacteria | 1350 |
| 21 | Ga0070666_10078870 | 3300005335 | Bacteria | 2249 |
| 22 | Ga0070666_10114204 | 3300005335 | Unclassified | 1869 |
| 23 | Ga0070680_100005718 | 3300005336 | Bacteria | 9433 |
| 24 | Ga0070680_100051864 | 3300005336 | Bacteria | 3349 |
| 25 | Ga0070682_100001145 | 3300005337 | Bacteria | 15129 |
| 26 | Ga0070682_100001910 | 3300005337 | Bacteria | 11625 |
| 27 | Ga0070682_100088691 | 3300005337 | Bacteria | 2019 |
| 28 | Ga0068868_100057920 | 3300005338 | Bacteria | 3062 |
| 29 | Ga0068868_100232349 | 3300005338 | Bacteria | 1547 |
| 30 | Ga0070660_100018138 | 3300005339 | Bacteria | 5136 |
| 31 | Ga0070660_100041319 | 3300005339 | Bacteria | 3514 |
| 32 | Ga0070660_100052224 | 3300005339 | Bacteria | 3151 |
| 33 | Ga0070689_100318705 | 3300005340 | Bacteria | 1298 |
| 34 | Ga0070691_10020725 | 3300005341 | Bacteria | 3038 |
| 35 | Ga0070691_10029684 | 3300005341 | Bacteria | 2559 |
| 36 | Ga0070691_10031278 | 3300005341 | Bacteria | 2495 |
| 37 | Ga0070687_100016835 | 3300005343 | Bacteria | 3346 |
| 38 | Ga0070687_100077656 | 3300005343 | Bacteria | 1802 |
| 39 | Ga0070687_100081111 | 3300005343 | Bacteria | 1770 |
| 40 | Ga0070661_100001970 | 3300005344 | Bacteria | 14190 |
| 41 | Ga0070661_100133020 | 3300005344 | Bacteria | 1869 |
| 42 | Ga0070692_10006890 | 3300005345 | Bacteria | 4966 |
| 43 | Ga0070692_10041389 | 3300005345 | Bacteria | 2360 |
| 44 | Ga0070692_10057793 | 3300005345 | Bacteria | 2035 |
| 45 | Ga0070669_100103757 | 3300005353 | Bacteria | 2149 |
| 46 | Ga0070669_100158807 | 3300005353 | Bacteria | 1755 |
| 47 | Ga0070675_100040954 | 3300005354 | Bacteria | 3783 |
| 48 | Ga0070675_100043593 | 3300005354 | Bacteria | 3667 |
| 49 | Ga0070675_100124403 | 3300005354 | Bacteria | 2193 |
| 50 | Ga0070671_100000721 | 3300005355 | Bacteria | 23675 |
| 51 | Ga0070671_100013369 | 3300005355 | Bacteria | 6616 |
| 52 | Ga0070671_100015419 | 3300005355 | Bacteria | 6174 |
| 53 | Ga0070671_100020832 | 3300005355 | Bacteria | 5348 |
| 54 | Ga0070671_100032216 | 3300005355 | Bacteria | 4335 |
| 55 | Ga0070671_100046292 | 3300005355 | Bacteria | 3617 |
| 56 | Ga0070674_100002976 | 3300005356 | Bacteria | 9411 |
| 57 | Ga0070674_100067667 | 3300005356 | Bacteria | 2513 |
| 58 | Ga0070674_100110130 | 3300005356 | Bacteria | 2020 |
| 59 | Ga0070673_100110374 | 3300005364 | Bacteria | 2280 |
| 60 | Ga0070673_100384807 | 3300005364 | Bacteria | 1251 |
| 61 | Ga0070688_100003448 | 3300005365 | Bacteria | 8136 |
| 62 | Ga0070659_100001160 | 3300005366 | Bacteria | 19249 |
| 63 | Ga0070659_100041939 | 3300005366 | Bacteria | 3578 |
| 64 | Ga0070659_100074009 | 3300005366 | Bacteria | 2713 |
| 65 | Ga0070659_100124234 | 3300005366 | Bacteria | 2093 |
| 66 | Ga0070667_100268063 | 3300005367 | Bacteria | 1530 |
| 67 | Ga0070703_10004719 | 3300005406 | Bacteria | 3812 |
| 68 | Ga0070703_10007507 | 3300005406 | Bacteria | 3064 |
| 69 | Ga0070714_100215502 | 3300005435 | Bacteria | 1762 |
| 70 | Ga0070714_100317498 | 3300005435 | Bacteria | 1456 |
| 71 | Ga0070713_100221249 | 3300005436 | Bacteria | 1717 |
| 72 | Ga0070701_10002582 | 3300005438 | Bacteria | 7018 |
| 73 | Ga0070701_10006123 | 3300005438 | Bacteria | 5039 |
| 74 | Ga0070701_10032141 | 3300005438 | Bacteria | 2611 |
| 75 | Ga0070711_100006940 | 3300005439 | Bacteria | 6867 |
| 76 | Ga0070711_100014729 | 3300005439 | Bacteria | 4934 |
| 77 | Ga0070711_100271064 | 3300005439 | Bacteria | 1339 |
| 78 | Ga0070705_100000881 | 3300005440 | Bacteria | 16765 |
| 79 | Ga0070705_100040413 | 3300005440 | Bacteria | 2652 |
| 80 | Ga0070705_100080907 | 3300005440 | Bacteria | 1994 |
| 81 | Ga0070700_100001269 | 3300005441 | Bacteria | 12511 |
| 82 | Ga0070700_100004770 | 3300005441 | Bacteria | 7113 |
| 83 | Ga0070694_100002877 | 3300005444 | Bacteria | 10227 |
| 84 | Ga0070708_100002831 | 3300005445 | Bacteria | 13475 |
| 85 | Ga0070708_100017122 | 3300005445 | Bacteria | 6036 |
| 86 | Ga0070708_100025104 | 3300005445 | Bacteria | 5092 |
| 87 | Ga0070708_100035261 | 3300005445 | Bacteria | 4358 |
| 88 | Ga0070708_100044283 | 3300005445 | Bacteria | 3913 |
| 89 | Ga0070708_100052038 | 3300005445 | Bacteria | 3630 |
| 90 | Ga0070708_100167876 | 3300005445 | Unclassified | 2048 |
| 91 | Ga0070708_100183291 | 3300005445 | Bacteria | 1957 |
| 92 | Ga0070708_100189274 | 3300005445 | Unclassified | 1925 |
| 93 | Ga0070663_100000397 | 3300005455 | Bacteria | 22854 |
| 94 | Ga0070663_100001866 | 3300005455 | Bacteria | 11755 |
| 95 | Ga0070663_100003977 | 3300005455 | Bacteria | 8625 |
| 96 | Ga0070663_100037531 | 3300005455 | Bacteria | 3374 |
| 97 | Ga0070663_100038767 | 3300005455 | Bacteria | 3326 |
| 98 | Ga0070678_100001787 | 3300005456 | Bacteria | 11583 |
| 99 | Ga0070678_100074181 | 3300005456 | Bacteria | 2556 |
| 100 | Ga0070678_100243943 | 3300005456 | Bacteria | 1503 |
| 101 | Ga0070662_100000100 | 3300005457 | Bacteria | 47285 |
| 102 | Ga0070662_100018534 | 3300005457 | Bacteria | 4710 |
| 103 | Ga0070662_100045477 | 3300005457 | Bacteria | 3150 |
| 104 | Ga0070681_10023008 | 3300005458 | Bacteria | 6264 |
| 105 | Ga0070681_10119209 | 3300005458 | Bacteria | 2575 |
| 106 | Ga0068867_100017764 | 3300005459 | Bacteria | 5050 |
| 107 | Ga0068867_100233174 | 3300005459 | Bacteria | 1489 |
| 108 | Ga0070685_10038191 | 3300005466 | Bacteria | 2723 |
| 109 | Ga0070706_100000012 | 3300005467 | Bacteria | 195040 |
| 110 | Ga0070706_100006380 | 3300005467 | Bacteria | 11140 |
| 111 | Ga0070706_100009989 | 3300005467 | Bacteria | 8814 |
| 112 | Ga0070706_100014995 | 3300005467 | Bacteria | 7156 |
| 113 | Ga0070706_100024717 | 3300005467 | Bacteria | 5531 |
| 114 | Ga0070706_100046515 | 3300005467 | Bacteria | 4005 |
| 115 | Ga0070706_100079433 | 3300005467 | Bacteria | 3036 |
| 116 | Ga0070706_100220454 | 3300005467 | Unclassified | 1771 |
| 117 | Ga0070707_100006597 | 3300005468 | Bacteria | 10768 |
| 118 | Ga0070707_100014120 | 3300005468 | Bacteria | 7484 |
| 119 | Ga0070707_100033073 | 3300005468 | Bacteria | 4930 |
| 120 | Ga0070707_100056212 | 3300005468 | Bacteria | 3774 |
| 121 | Ga0070707_100136307 | 3300005468 | Bacteria | 2388 |
| 122 | Ga0070707_100161725 | 3300005468 | Bacteria | 2182 |
| 123 | Ga0070707_100403267 | 3300005468 | Bacteria | 1327 |
| 124 | Ga0070698_100002676 | 3300005471 | Bacteria | 19643 |
| 125 | Ga0070698_100069064 | 3300005471 | Bacteria | 3549 |
| 126 | Ga0070699_100000027 | 3300005518 | Bacteria | 157339 |
| 127 | Ga0070699_100004759 | 3300005518 | Bacteria | 12000 |
| 128 | Ga0070699_100044292 | 3300005518 | Bacteria | 3853 |
| 129 | Ga0070699_100053187 | 3300005518 | Bacteria | 3505 |
| 130 | Ga0070699_100145489 | 3300005518 | Bacteria | 2094 |
| 131 | Ga0070699_100188321 | 3300005518 | Bacteria | 1833 |
| 132 | Ga0070679_100005694 | 3300005530 | Bacteria | 11548 |
| 133 | Ga0070679_100015999 | 3300005530 | Bacteria | 7224 |
| 134 | Ga0070679_100060514 | 3300005530 | Bacteria | 3774 |
| 135 | Ga0070679_100144124 | 3300005530 | Unclassified | 2360 |
| 136 | Ga0070679_100351872 | 3300005530 | Bacteria | 1421 |
| 137 | Ga0070684_100002710 | 3300005535 | Bacteria | 13088 |
| 138 | Ga0070684_100104688 | 3300005535 | Bacteria | 2531 |
| 139 | Ga0070684_100122981 | 3300005535 | Bacteria | 2335 |
| 140 | Ga0070697_100005109 | 3300005536 | Bacteria | 10075 |
| 141 | Ga0070697_100006313 | 3300005536 | Bacteria | 9175 |
| 142 | Ga0070697_100009361 | 3300005536 | Bacteria | 7654 |
| 143 | Ga0070697_100106410 | 3300005536 | Bacteria | 2333 |
| 144 | Ga0070697_100170445 | 3300005536 | Bacteria | 1842 |
| 145 | Ga0070697_100234974 | 3300005536 | Bacteria | 1564 |
| 146 | Ga0070697_100284637 | 3300005536 | Bacteria | 1419 |
| 147 | Ga0068853_100003192 | 3300005539 | Bacteria | 12518 |
| 148 | Ga0068853_100054701 | 3300005539 | Bacteria | 3440 |
| 149 | Ga0068853_100080731 | 3300005539 | Bacteria | 2847 |
| 150 | Ga0068853_100089858 | 3300005539 | Bacteria | 2698 |
| 151 | Ga0070672_100041432 | 3300005543 | Bacteria | 3540 |
| 152 | Ga0070672_100221061 | 3300005543 | Bacteria | 1589 |
| 153 | Ga0070686_100004327 | 3300005544 | Bacteria | 7821 |
| 154 | Ga0070686_100120388 | 3300005544 | Bacteria | 1801 |
| 155 | Ga0070695_100000709 | 3300005545 | Bacteria | 17793 |
| 156 | Ga0070695_100010513 | 3300005545 | Bacteria | 5526 |
| 157 | Ga0070696_100000030 | 3300005546 | Bacteria | 65862 |
| 158 | Ga0070696_100014405 | 3300005546 | Bacteria | 5304 |
| 159 | Ga0070696_100016003 | 3300005546 | Bacteria | 5044 |
| 160 | Ga0070696_100035703 | 3300005546 | Bacteria | 3424 |
| 161 | Ga0070693_100008913 | 3300005547 | Bacteria | 4977 |
| 162 | Ga0070665_100019259 | 3300005548 | Bacteria | 6847 |
| 163 | Ga0070665_100020556 | 3300005548 | Bacteria | 6633 |
| 164 | Ga0070704_100001841 | 3300005549 | Bacteria | 11695 |
| 165 | Ga0070704_100003174 | 3300005549 | Bacteria | 9388 |
| 166 | Ga0070704_100061791 | 3300005549 | Bacteria | 2683 |
| 167 | Ga0068855_100005251 | 3300005563 | Bacteria | 15805 |
| 168 | Ga0068855_100005342 | 3300005563 | Bacteria | 15677 |
| 169 | Ga0068855_100257178 | 3300005563 | Bacteria | 1946 |
| 170 | Ga0068855_100283357 | 3300005563 | Bacteria | 1839 |
| 171 | Ga0068855_100305527 | 3300005563 | Bacteria | 1761 |
| 172 | Ga0068855_100488794 | 3300005563 | Bacteria | 1339 |
| 173 | Ga0070664_100022826 | 3300005564 | Bacteria | 5161 |
| 174 | Ga0070664_100040904 | 3300005564 | Bacteria | 3910 |
| 175 | Ga0070664_100196287 | 3300005564 | Bacteria | 1799 |
| 176 | Ga0070664_100275820 | 3300005564 | Bacteria | 1515 |
| 177 | Ga0068857_100004812 | 3300005577 | Bacteria | 11448 |
| 178 | Ga0068857_100024027 | 3300005577 | Bacteria | 5365 |
| 179 | Ga0068857_100027959 | 3300005577 | Bacteria | 4973 |
| 180 | Ga0068857_100045962 | 3300005577 | Bacteria | 3874 |
| 181 | Ga0068854_100012066 | 3300005578 | Bacteria | 5649 |
| 182 | Ga0068854_100257759 | 3300005578 | Bacteria | 1395 |
| 183 | Ga0068856_100003147 | 3300005614 | Bacteria | 16825 |
| 184 | Ga0068856_100032450 | 3300005614 | Bacteria | 5112 |
| 185 | Ga0068856_100044448 | 3300005614 | Bacteria | 4372 |
| 186 | Ga0068856_100118775 | 3300005614 | Bacteria | 2645 |
| 187 | Ga0068856_100179136 | 3300005614 | Bacteria | 2132 |
| 188 | Ga0070702_100002363 | 3300005615 | Bacteria | 8111 |
| 189 | Ga0070702_100132272 | 3300005615 | Bacteria | 1577 |
| 190 | Ga0070702_100221700 | 3300005615 | Bacteria | 1265 |
| 191 | Ga0068852_100074045 | 3300005616 | Bacteria | 2998 |
| 192 | Ga0068852_100111522 | 3300005616 | Bacteria | 2487 |
| 193 | Ga0068852_100428436 | 3300005616 | Bacteria | 1306 |
| 194 | Ga0068859_100007999 | 3300005617 | Bacteria | 10718 |
| 195 | Ga0068859_100030934 | 3300005617 | Bacteria | 5372 |
| 196 | Ga0068859_100233940 | 3300005617 | Bacteria | 1926 |
| 197 | Ga0068864_100003858 | 3300005618 | Bacteria | 12347 |
| 198 | Ga0068864_100009894 | 3300005618 | Bacteria | 7865 |
| 199 | Ga0068864_100211584 | 3300005618 | Bacteria | 1786 |
| 200 | Ga0068866_10001230 | 3300005718 | Bacteria | 11100 |
| 201 | Ga0068861_100054596 | 3300005719 | Bacteria | 3044 |
| 202 | Ga0068861_100104510 | 3300005719 | Bacteria | 2260 |
| 203 | Ga0068863_100015479 | 3300005841 | Bacteria | 7331 |
| 204 | Ga0068863_100210726 | 3300005841 | Bacteria | 1871 |
| 205 | Ga0068858_100159240 | 3300005842 | Bacteria | 2125 |
| 206 | Ga0068860_100030669 | 3300005843 | Bacteria | 5171 |
| 207 | Ga0068860_100154840 | 3300005843 | Bacteria | 2209 |
| 208 | Ga0068862_100001754 | 3300005844 | Bacteria | 19637 |
| 209 | Ga0081455_10001493 | 3300005937 | Bacteria | 28933 |
| 210 | Ga0081455_10002866 | 3300005937 | Bacteria | 20313 |
| 211 | Ga0081455_10003938 | 3300005937 | Bacteria | 16882 |
| 212 | Ga0081455_10008953 | 3300005937 | Bacteria | 10344 |
| 213 | Ga0081455_10011367 | 3300005937 | Bacteria | 8948 |
| 214 | Ga0081455_10045162 | 3300005937 | Bacteria | 3836 |
| 215 | Ga0081455_10083038 | 3300005937 | Bacteria | 2619 |
| 216 | Ga0081538_10003492 | 3300005981 | Bacteria | 14837 |
| 217 | Ga0081540_1000585 | 3300005983 | Bacteria | 35126 |
| 218 | Ga0081540_1001783 | 3300005983 | Bacteria | 18056 |
| 219 | Ga0081539_10000052 | 3300005985 | Bacteria | 268240 |
| 220 | Ga0081539_10072198 | 3300005985 | Bacteria | 1846 |
| 221 | Ga0070717_10008392 | 3300006028 | Bacteria | 7714 |
| 222 | Ga0070715_10067728 | 3300006163 | Bacteria | 1586 |
| 223 | Ga0070715_10181148 | 3300006163 | Bacteria | 1056 |
| 224 | Ga0070716_100013085 | 3300006173 | Bacteria | 4221 |
| 225 | Ga0070712_100034018 | 3300006175 | Bacteria | 3452 |
| 226 | Ga0070712_100040764 | 3300006175 | Bacteria | 3185 |
| 227 | Ga0070712_100047468 | 3300006175 | Bacteria | 2972 |
| 228 | Ga0070712_100186355 | 3300006175 | Bacteria | 1620 |
| 229 | Ga0097621_100165858 | 3300006237 | Bacteria | 1902 |
| 230 | Ga0068871_100008531 | 3300006358 | Bacteria | 7365 |
| 231 | Ga0068871_100087671 | 3300006358 | Bacteria | 2588 |
| 232 | Ga0075428_100016349 | 3300006844 | Bacteria | 8200 |
| 233 | Ga0075428_100036166 | 3300006844 | Bacteria | 5441 |
| 234 | Ga0075431_100004258 | 3300006847 | Bacteria | 14009 |
| 235 | Ga0075431_100010384 | 3300006847 | Bacteria | 9357 |
| 236 | Ga0075431_100063842 | 3300006847 | Bacteria | 3801 |
| 237 | Ga0075433_10036694 | 3300006852 | Bacteria | 4224 |
| 238 | Ga0075434_100021543 | 3300006871 | Bacteria | 6265 |
| 239 | Ga0075434_100030081 | 3300006871 | Bacteria | 5346 |
| 240 | Ga0075434_100177238 | 3300006871 | Bacteria | 2152 |
| 241 | Ga0075434_100193945 | 3300006871 | Bacteria | 2052 |
| 242 | Ga0068865_100006647 | 3300006881 | Bacteria | 7075 |
| 243 | Ga0075436_100012599 | 3300006914 | Bacteria | 5793 |
| 244 | Ga0075436_100152805 | 3300006914 | Bacteria | 1625 |
| 245 | Ga0097620_100007999 | 3300006931 | Bacteria | 10718 |
| 246 | Ga0097620_100030934 | 3300006931 | Bacteria | 5372 |
| 247 | Ga0097620_100233930 | 3300006931 | Bacteria | 1926 |
| 248 | Ga0099824_1013620 | 3300006942 | Bacteria | 8377 |
| 249 | Ga0075435_100089765 | 3300007076 | Bacteria | 2534 |
| 250 | Ga0075435_100152481 | 3300007076 | Bacteria | 1944 |
| 251 | Ga0099794_10000326 | 3300007265 | Bacteria | 16332 |
| 252 | Ga0105240_10003453 | 3300009093 | Bacteria | 24519 |
| 253 | Ga0105240_10005589 | 3300009093 | Bacteria | 18679 |
| 254 | Ga0105240_10021548 | 3300009093 | Bacteria | 8570 |
| 255 | Ga0105240_10179685 | 3300009093 | Bacteria | 2498 |
| 256 | Ga0105240_10189937 | 3300009093 | Bacteria | 2416 |
| 257 | Ga0105240_10302017 | 3300009093 | Bacteria | 1831 |
| 258 | Ga0111539_10496737 | 3300009094 | Bacteria | 1421 |
| 259 | Ga0105245_10030311 | 3300009098 | Bacteria | 4783 |
| 260 | Ga0105245_10033847 | 3300009098 | Bacteria | 4529 |
| 261 | Ga0105245_10317228 | 3300009098 | Bacteria | 1534 |
| 262 | Ga0105247_10031929 | 3300009101 | Bacteria | 3198 |
| 263 | Ga0114129_10004027 | 3300009147 | Bacteria | 20738 |
| 264 | Ga0114129_10009722 | 3300009147 | Bacteria | 13721 |
| 265 | Ga0114129_10062912 | 3300009147 | Bacteria | 5183 |
| 266 | Ga0114129_10104050 | 3300009147 | Bacteria | 3923 |
| 267 | Ga0114129_10228476 | 3300009147 | Bacteria | 2507 |
| 268 | Ga0105243_10012348 | 3300009148 | Bacteria | 6458 |
| 269 | Ga0105243_10015705 | 3300009148 | Bacteria | 5726 |
| 270 | Ga0105243_10096694 | 3300009148 | Bacteria | 2443 |
| 271 | Ga0105241_10001532 | 3300009174 | Bacteria | 17707 |
| 272 | Ga0105241_10189001 | 3300009174 | Bacteria | 1713 |
| 273 | Ga0105242_10002478 | 3300009176 | Bacteria | 14477 |
| 274 | Ga0105248_10000678 | 3300009177 | Bacteria | 38605 |
| 275 | Ga0105248_10009353 | 3300009177 | Bacteria | 10786 |
| 276 | Ga0105248_10026767 | 3300009177 | Bacteria | 6414 |
| 277 | Ga0105248_10070017 | 3300009177 | Bacteria | 3940 |
| 278 | Ga0105248_10126579 | 3300009177 | Bacteria | 2882 |
| 279 | Ga0105237_10031477 | 3300009545 | Bacteria | 5379 |
| 280 | Ga0105237_10035959 | 3300009545 | Bacteria | 5010 |
| 281 | Ga0105237_10191567 | 3300009545 | Bacteria | 2045 |
| 282 | Ga0105237_10236066 | 3300009545 | Bacteria | 1830 |
| 283 | Ga0105237_10258997 | 3300009545 | Bacteria | 1742 |
| 284 | Ga0105238_10049920 | 3300009551 | Bacteria | 4212 |
| 285 | Ga0105249_10001814 | 3300009553 | Bacteria | 18579 |
| 286 | Ga0105249_10027834 | 3300009553 | Bacteria | 5101 |
| 287 | Ga0105249_10050268 | 3300009553 | Bacteria | 3801 |
| 288 | Ga0105239_10007473 | 3300010375 | Bacteria | 12539 |
| 289 | Ga0105239_10020777 | 3300010375 | Bacteria | 7245 |
| 290 | Ga0105239_10104541 | 3300010375 | Bacteria | 3135 |
| 291 | Ga0105239_10451819 | 3300010375 | Bacteria | 1458 |
| 292 | Ga0105239_10590234 | 3300010375 | Bacteria | 1267 |
| 293 | Ga0105246_10022640 | 3300011119 | Bacteria | 4056 |
| 294 | Ga0157373_10007561 | 3300013100 | Bacteria | 8074 |
| 295 | Ga0157373_10011891 | 3300013100 | Bacteria | 6394 |
| 296 | Ga0157373_10068938 | 3300013100 | Bacteria | 2500 |
| 297 | Ga0157371_10000519 | 3300013102 | Bacteria | 46108 |
| 298 | Ga0157371_10059902 | 3300013102 | Unclassified | 2699 |
| 299 | Ga0157370_10007274 | 3300013104 | Bacteria | 12080 |
| 300 | Ga0157370_10007847 | 3300013104 | Bacteria | 11566 |
| 301 | Ga0157370_10060465 | 3300013104 | Bacteria | 3597 |
| 302 | Ga0157369_10000446 | 3300013105 | Bacteria | 54687 |
| 303 | Ga0157369_10036941 | 3300013105 | Bacteria | 5350 |
| 304 | Ga0157369_10070248 | 3300013105 | Bacteria | 3762 |
| 305 | Ga0157374_10005832 | 3300013296 | Bacteria | 10406 |
| 306 | Ga0157374_10006763 | 3300013296 | Bacteria | 9749 |
| 307 | Ga0157374_10064162 | 3300013296 | Bacteria | 3446 |
| 308 | Ga0157374_10109303 | 3300013296 | Bacteria | 2658 |
| 309 | Ga0157374_10133049 | 3300013296 | Bacteria | 2408 |
| 310 | Ga0157374_10189179 | 3300013296 | Bacteria | 2013 |
| 311 | Ga0157378_10001394 | 3300013297 | Bacteria | 21726 |
| 312 | Ga0157378_10016784 | 3300013297 | Bacteria | 6416 |
| 313 | Ga0157378_10032587 | 3300013297 | Bacteria | 4605 |
| 314 | Ga0157378_10035108 | 3300013297 | Bacteria | 4434 |
| 315 | Ga0157378_10262048 | 3300013297 | Bacteria | 1659 |
| 316 | Ga0163162_10002009 | 3300013306 | Bacteria | 19140 |
| 317 | Ga0157372_10012255 | 3300013307 | Bacteria | 9131 |
| 318 | Ga0157372_10123775 | 3300013307 | Bacteria | 2972 |
| 319 | Ga0157372_10262395 | 3300013307 | Bacteria | 2006 |
| 320 | Ga0157375_10197358 | 3300013308 | Bacteria | 2168 |
| 321 | Ga0157375_10274660 | 3300013308 | Bacteria | 1847 |
| 322 | Ga0157375_10508447 | 3300013308 | Bacteria | 1369 |
| 323 | Ga0157375_10571288 | 3300013308 | Bacteria | 1291 |
| 324 | Ga0163163_10044532 | 3300014325 | Bacteria | 4354 |
| 325 | Ga0157380_10081078 | 3300014326 | Bacteria | 2653 |
| 326 | Ga0157380_10409641 | 3300014326 | Bacteria | 1289 |
| 327 | Ga0182008_10097795 | 3300014497 | Bacteria | 1449 |
| 328 | Ga0157376_10002533 | 3300014969 | Bacteria | 12385 |
| 329 | Ga0157376_10020308 | 3300014969 | Bacteria | 5137 |
| 330 | Ga0213876_10000412 | 3300021384 | Bacteria | 35878 |
| 331 | Ga0213875_10000007 | 3300021388 | Bacteria | 562717 |
| 332 | Ga0224572_1010860 | 3300024225 | Bacteria | 1718 |
| 333 | Ga0207426_1024319 | 3300025302 | Bacteria | 2057 |
| 334 | Ga0207656_10068084 | 3300025321 | Bacteria | 1577 |
| 335 | Ga0207653_10004551 | 3300025885 | Bacteria | 4348 |
| 336 | Ga0207692_10056960 | 3300025898 | Unclassified | 2007 |
| 337 | Ga0207642_10001203 | 3300025899 | Bacteria | 7995 |
| 338 | Ga0207710_10043175 | 3300025900 | Bacteria | 2005 |
| 339 | Ga0207688_10030810 | 3300025901 | Bacteria | 2959 |
| 340 | Ga0207680_10116532 | 3300025903 | Bacteria | 1741 |
| 341 | Ga0207680_10125030 | 3300025903 | Bacteria | 1687 |
| 342 | Ga0207680_10278301 | 3300025903 | Unclassified | 1162 |
| 343 | Ga0207647_10003843 | 3300025904 | Bacteria | 11235 |
| 344 | Ga0207647_10008571 | 3300025904 | Bacteria | 7318 |
| 345 | Ga0207647_10028865 | 3300025904 | Bacteria | 3598 |
| 346 | Ga0207685_10021158 | 3300025905 | Bacteria | 2175 |
| 347 | Ga0207699_10272933 | 3300025906 | Bacteria | 1172 |
| 348 | Ga0207645_10005412 | 3300025907 | Bacteria | 9258 |
| 349 | Ga0207645_10007535 | 3300025907 | Bacteria | 7679 |
| 350 | Ga0207705_10013584 | 3300025909 | Bacteria | 5877 |
| 351 | Ga0207705_10023953 | 3300025909 | Bacteria | 4356 |
| 352 | Ga0207684_10000028 | 3300025910 | Bacteria | 306450 |
| 353 | Ga0207684_10004597 | 3300025910 | Bacteria | 12966 |
| 354 | Ga0207684_10005982 | 3300025910 | Bacteria | 11129 |
| 355 | Ga0207684_10007109 | 3300025910 | Bacteria | 10117 |
| 356 | Ga0207684_10019108 | 3300025910 | Bacteria | 5861 |
| 357 | Ga0207684_10021323 | 3300025910 | Bacteria | 5531 |
| 358 | Ga0207684_10067231 | 3300025910 | Bacteria | 3045 |
| 359 | Ga0207684_10099636 | 3300025910 | Bacteria | 2482 |
| 360 | Ga0207707_10004133 | 3300025912 | Bacteria | 12863 |
| 361 | Ga0207707_10013783 | 3300025912 | Bacteria | 7050 |
| 362 | Ga0207707_10142118 | 3300025912 | Bacteria | 2098 |
| 363 | Ga0207707_10187540 | 3300025912 | Bacteria | 1805 |
| 364 | Ga0207695_10041027 | 3300025913 | Bacteria | 4955 |
| 365 | Ga0207695_10082248 | 3300025913 | Bacteria | 3257 |
| 366 | Ga0207695_10137527 | 3300025913 | Bacteria | 2395 |
| 367 | Ga0207695_10145623 | 3300025913 | Bacteria | 2313 |
| 368 | Ga0207695_10388196 | 3300025913 | Bacteria | 1281 |
| 369 | Ga0207671_10019228 | 3300025914 | Bacteria | 5227 |
| 370 | Ga0207671_10179351 | 3300025914 | Bacteria | 1648 |
| 371 | Ga0207671_10356497 | 3300025914 | Bacteria | 1160 |
| 372 | Ga0207693_10002251 | 3300025915 | Bacteria | 16788 |
| 373 | Ga0207693_10037971 | 3300025915 | Bacteria | 3794 |
| 374 | Ga0207693_10043720 | 3300025915 | Bacteria | 3522 |
| 375 | Ga0207663_10019692 | 3300025916 | Bacteria | 3808 |
| 376 | Ga0207663_10153594 | 3300025916 | Unclassified | 1617 |
| 377 | Ga0207663_10198662 | 3300025916 | Bacteria | 1445 |
| 378 | Ga0207660_10009213 | 3300025917 | Bacteria | 6387 |
| 379 | Ga0207660_10013920 | 3300025917 | Bacteria | 5278 |
| 380 | Ga0207660_10035529 | 3300025917 | Bacteria | 3461 |
| 381 | Ga0207660_10165683 | 3300025917 | Bacteria | 1708 |
| 382 | Ga0207662_10067724 | 3300025918 | Bacteria | 2154 |
| 383 | Ga0207662_10101803 | 3300025918 | Bacteria | 1781 |
| 384 | Ga0207657_10000420 | 3300025919 | Bacteria | 45042 |
| 385 | Ga0207657_10003570 | 3300025919 | Bacteria | 16599 |
| 386 | Ga0207657_10017351 | 3300025919 | Bacteria | 6905 |
| 387 | Ga0207657_10022872 | 3300025919 | Bacteria | 5835 |
| 388 | Ga0207657_10027113 | 3300025919 | Bacteria | 5252 |
| 389 | Ga0207657_10027978 | 3300025919 | Bacteria | 5152 |
| 390 | Ga0207657_10114206 | 3300025919 | Bacteria | 2227 |
| 391 | Ga0207649_10002746 | 3300025920 | Bacteria | 9749 |
| 392 | Ga0207649_10175789 | 3300025920 | Bacteria | 1495 |
| 393 | Ga0207652_10007755 | 3300025921 | Bacteria | 8623 |
| 394 | Ga0207652_10017772 | 3300025921 | Bacteria | 5825 |
| 395 | Ga0207646_10020654 | 3300025922 | Bacteria | 6100 |
| 396 | Ga0207646_10022826 | 3300025922 | Bacteria | 5754 |
| 397 | Ga0207646_10046252 | 3300025922 | Bacteria | 3905 |
| 398 | Ga0207646_10124745 | 3300025922 | Bacteria | 2315 |
| 399 | Ga0207646_10343735 | 3300025922 | Bacteria | 1348 |
| 400 | Ga0207681_10137741 | 3300025923 | Bacteria | 1814 |
| 401 | Ga0207694_10012057 | 3300025924 | Bacteria | 6518 |
| 402 | Ga0207650_10085688 | 3300025925 | Bacteria | 2397 |
| 403 | Ga0207659_10116169 | 3300025926 | Bacteria | 2042 |
| 404 | Ga0207687_10035887 | 3300025927 | Bacteria | 3375 |
| 405 | Ga0207687_10070667 | 3300025927 | Bacteria | 2492 |
| 406 | Ga0207687_10184688 | 3300025927 | Bacteria | 1618 |
| 407 | Ga0207700_10022334 | 3300025928 | Unclassified | 4340 |
| 408 | Ga0207700_10446364 | 3300025928 | Bacteria | 1139 |
| 409 | Ga0207664_10106352 | 3300025929 | Unclassified | 2326 |
| 410 | Ga0207664_10274401 | 3300025929 | Bacteria | 1478 |
| 411 | Ga0207664_10424914 | 3300025929 | Bacteria | 1184 |
| 412 | Ga0207644_10055646 | 3300025931 | Bacteria | 2852 |
| 413 | Ga0207644_10067421 | 3300025931 | Bacteria | 2608 |
| 414 | Ga0207644_10069404 | 3300025931 | Bacteria | 2573 |
| 415 | Ga0207644_10083858 | 3300025931 | Bacteria | 2361 |
| 416 | Ga0207690_10000043 | 3300025932 | Bacteria | 119547 |
| 417 | Ga0207690_10024907 | 3300025932 | Bacteria | 3752 |
| 418 | Ga0207690_10032999 | 3300025932 | Bacteria | 3326 |
| 419 | Ga0207690_10057079 | 3300025932 | Bacteria | 2636 |
| 420 | Ga0207690_10091256 | 3300025932 | Bacteria | 2153 |
| 421 | Ga0207706_10002041 | 3300025933 | Bacteria | 19804 |
| 422 | Ga0207706_10032471 | 3300025933 | Bacteria | 4649 |
| 423 | Ga0207706_10140416 | 3300025933 | Bacteria | 2125 |
| 424 | Ga0207686_10002827 | 3300025934 | Bacteria | 9374 |
| 425 | Ga0207709_10002160 | 3300025935 | Bacteria | 12592 |
| 426 | Ga0207670_10060833 | 3300025936 | Bacteria | 2574 |
| 427 | Ga0207669_10002299 | 3300025937 | Bacteria | 8127 |
| 428 | Ga0207669_10074887 | 3300025937 | Bacteria | 2143 |
| 429 | Ga0207669_10110976 | 3300025937 | Bacteria | 1838 |
| 430 | Ga0207704_10022889 | 3300025938 | Bacteria | 3357 |
| 431 | Ga0207665_10040605 | 3300025939 | Bacteria | 3105 |
| 432 | Ga0207665_10106440 | 3300025939 | Bacteria | 1965 |
| 433 | Ga0207665_10111239 | 3300025939 | Bacteria | 1925 |
| 434 | Ga0207665_10276793 | 3300025939 | Unclassified | 1248 |
| 435 | Ga0207711_10000762 | 3300025941 | Bacteria | 31637 |
| 436 | Ga0207711_10020386 | 3300025941 | Bacteria | 5527 |
| 437 | Ga0207711_10191464 | 3300025941 | Bacteria | 1864 |
| 438 | Ga0207689_10049102 | 3300025942 | Bacteria | 3482 |
| 439 | Ga0207661_10049429 | 3300025944 | Bacteria | 3347 |
| 440 | Ga0207661_10060499 | 3300025944 | Bacteria | 3056 |
| 441 | Ga0207661_10079270 | 3300025944 | Bacteria | 2706 |
| 442 | Ga0207661_10097021 | 3300025944 | Bacteria | 2467 |
| 443 | Ga0207679_10012735 | 3300025945 | Bacteria | 5493 |
| 444 | Ga0207679_10199796 | 3300025945 | Bacteria | 1669 |
| 445 | Ga0207679_10487482 | 3300025945 | Bacteria | 1098 |
| 446 | Ga0207667_10002233 | 3300025949 | Bacteria | 24327 |
| 447 | Ga0207667_10010740 | 3300025949 | Bacteria | 10680 |
| 448 | Ga0207667_10028104 | 3300025949 | Bacteria | 6111 |
| 449 | Ga0207667_10044182 | 3300025949 | Bacteria | 4723 |
| 450 | Ga0207667_10079623 | 3300025949 | Bacteria | 3396 |
| 451 | Ga0207667_10097935 | 3300025949 | Bacteria | 3027 |
| 452 | Ga0207667_10182149 | 3300025949 | Bacteria | 2157 |
| 453 | Ga0207667_10514159 | 3300025949 | Bacteria | 1213 |
| 454 | Ga0207651_10098023 | 3300025960 | Bacteria | 2166 |
| 455 | Ga0207651_10192470 | 3300025960 | Bacteria | 1628 |
| 456 | Ga0207712_10000667 | 3300025961 | Bacteria | 26651 |
| 457 | Ga0207712_10020467 | 3300025961 | Bacteria | 4332 |
| 458 | Ga0207712_10022707 | 3300025961 | Bacteria | 4135 |
| 459 | Ga0207712_10276496 | 3300025961 | Bacteria | 1369 |
| 460 | Ga0207668_10129137 | 3300025972 | Bacteria | 1927 |
| 461 | Ga0207640_10015620 | 3300025981 | Bacteria | 4400 |
| 462 | Ga0207640_10022159 | 3300025981 | Bacteria | 3797 |
| 463 | Ga0207658_10038578 | 3300025986 | Bacteria | 3442 |
| 464 | Ga0207658_10259098 | 3300025986 | Bacteria | 1481 |
| 465 | Ga0207677_10026863 | 3300026023 | Bacteria | 3616 |
| 466 | Ga0207677_10141141 | 3300026023 | Bacteria | 1844 |
| 467 | Ga0207703_10077754 | 3300026035 | Bacteria | 2755 |
| 468 | Ga0207703_10095494 | 3300026035 | Bacteria | 2508 |
| 469 | Ga0207639_10002164 | 3300026041 | Bacteria | 13226 |
| 470 | Ga0207639_10019890 | 3300026041 | Bacteria | 4797 |
| 471 | Ga0207639_10085664 | 3300026041 | Bacteria | 2506 |
| 472 | Ga0207639_10208441 | 3300026041 | Bacteria | 1681 |
| 473 | Ga0207678_10003000 | 3300026067 | Bacteria | 15264 |
| 474 | Ga0207678_10006407 | 3300026067 | Bacteria | 10454 |
| 475 | Ga0207678_10012988 | 3300026067 | Bacteria | 7310 |
| 476 | Ga0207678_10016828 | 3300026067 | Bacteria | 6421 |
| 477 | Ga0207708_10000321 | 3300026075 | Bacteria | 37920 |
| 478 | Ga0207702_10005057 | 3300026078 | Bacteria | 11580 |
| 479 | Ga0207702_10019131 | 3300026078 | Bacteria | 5667 |
| 480 | Ga0207702_10056522 | 3300026078 | Bacteria | 3332 |
| 481 | Ga0207702_10103461 | 3300026078 | Bacteria | 2519 |
| 482 | Ga0207641_10060610 | 3300026088 | Bacteria | 3225 |
| 483 | Ga0207641_10113230 | 3300026088 | Bacteria | 2409 |
| 484 | Ga0207648_10000214 | 3300026089 | Bacteria | 62323 |
| 485 | Ga0207648_10148162 | 3300026089 | Bacteria | 2071 |
| 486 | Ga0207648_10149687 | 3300026089 | Bacteria | 2059 |
| 487 | Ga0207676_10003644 | 3300026095 | Bacteria | 10896 |
| 488 | Ga0207676_10021565 | 3300026095 | Bacteria | 4727 |
| 489 | Ga0207676_10034294 | 3300026095 | Bacteria | 3842 |
| 490 | Ga0207674_10002976 | 3300026116 | Bacteria | 21037 |
| 491 | Ga0207674_10014624 | 3300026116 | Bacteria | 8656 |
| 492 | Ga0207674_10049444 | 3300026116 | Bacteria | 4300 |
| 493 | Ga0207674_10055760 | 3300026116 | Bacteria | 4016 |
| 494 | Ga0207674_10068794 | 3300026116 | Bacteria | 3563 |
| 495 | Ga0207674_10224347 | 3300026116 | Bacteria | 1828 |
| 496 | Ga0207675_100050099 | 3300026118 | Bacteria | 3897 |
| 497 | Ga0207675_100123393 | 3300026118 | Bacteria | 2452 |
| 498 | Ga0207675_100149024 | 3300026118 | Bacteria | 2226 |
| 499 | Ga0207675_100172685 | 3300026118 | Bacteria | 2067 |
| 500 | Ga0207683_10003051 | 3300026121 | Bacteria | 14646 |
| 501 | Ga0207683_10059808 | 3300026121 | Bacteria | 3347 |
| 502 | Ga0207683_10128929 | 3300026121 | Bacteria | 2274 |
| 503 | Ga0207698_10002617 | 3300026142 | Bacteria | 10699 |
| 504 | Ga0207698_10043170 | 3300026142 | Bacteria | 3376 |
| 505 | Ga0207698_10170483 | 3300026142 | Bacteria | 1916 |
| 506 | Ga0207698_10306357 | 3300026142 | Bacteria | 1481 |
| 507 | Ga0209389_1000676 | 3300027296 | Bacteria | 21221 |
| 508 | Ga0209589_1005614 | 3300027357 | Bacteria | 21221 |
| 509 | Ga0209489_100192 | 3300027361 | Bacteria | 98028 |
| 510 | Ga0209981_1001073 | 3300027378 | Bacteria | 3480 |
| 511 | Ga0209999_1006589 | 3300027543 | Bacteria | 2086 |
| 512 | Ga0209588_1000287 | 3300027671 | Bacteria | 13327 |
| 513 | Ga0207428_10005685 | 3300027907 | Bacteria | 11588 |
| 514 | Ga0207428_10050740 | 3300027907 | Bacteria | 3317 |
| 515 | Ga0268266_10021111 | 3300028379 | Bacteria | 5548 |
| 516 | Ga0268265_10002645 | 3300028380 | Bacteria | 13295 |
| 517 | Ga0268265_10044959 | 3300028380 | Bacteria | 3292 |
| 518 | Ga0268264_10007304 | 3300028381 | Bacteria | 9240 |
| 519 | Ga0268264_10036627 | 3300028381 | Bacteria | 4043 |
| 520 | Ga0268264_10046483 | 3300028381 | Bacteria | 3605 |
| 521 | Ga0265319_1000005 | 3300028563 | Bacteria | 249025 |
| 522 | Ga0307515_10128015 | 3300028794 | Unclassified | 2820 |
| 523 | Ga0265338_10019630 | 3300028800 | Bacteria | 7155 |
| 524 | Ga0265338_10024577 | 3300028800 | Bacteria | 6150 |
| 525 | Ga0265332_10003415 | 3300031238 | Bacteria | 7676 |
| 526 | Ga0265320_10003891 | 3300031240 | Bacteria | 9874 |
| 527 | Ga0265325_10019011 | 3300031241 | Bacteria | 3806 |
| 528 | Ga0265329_10005833 | 3300031242 | Bacteria | 4942 |
| 529 | Ga0265340_10018468 | 3300031247 | Bacteria | 3596 |
| 530 | Ga0265339_10016294 | 3300031249 | Bacteria | 4434 |
| 531 | Ga0265331_10008726 | 3300031250 | Bacteria | 5744 |
| 532 | Ga0265327_10000384 | 3300031251 | Bacteria | 83284 |
| 533 | Ga0265316_10002294 | 3300031344 | Bacteria | 20005 |
| 534 | Ga0265316_10007923 | 3300031344 | Bacteria | 9937 |
| 535 | Ga0307408_100110709 | 3300031548 | Bacteria | 2109 |
| 536 | Ga0265313_10000044 | 3300031595 | Bacteria | 117063 |
| 537 | Ga0265313_10012835 | 3300031595 | Bacteria | 5083 |
| 538 | Ga0265314_10003142 | 3300031711 | Bacteria | 16199 |
| 539 | Ga0265314_10034195 | 3300031711 | Bacteria | 3718 |
| 540 | Ga0265314_10070148 | 3300031711 | Bacteria | 2349 |
| 541 | Ga0316576_10016157 | 3300031727 | Bacteria | 5032 |
| 542 | Ga0316578_10027278 | 3300031728 | Bacteria | 3227 |
| 543 | Ga0307405_10003454 | 3300031731 | Bacteria | 7254 |
| 544 | Ga0307410_10155457 | 3300031852 | Bacteria | 1708 |
| 545 | Ga0307407_10016068 | 3300031903 | Bacteria | 3719 |
| 546 | Ga0307407_10033881 | 3300031903 | Bacteria | 2790 |
| 547 | Ga0307409_100004647 | 3300031995 | Bacteria | 7758 |
| 548 | Ga0307409_100011526 | 3300031995 | Bacteria | 5581 |
| 549 | Ga0307409_100027326 | 3300031995 | Bacteria | 4041 |
| 550 | Ga0307409_100042389 | 3300031995 | Bacteria | 3408 |
| 551 | Ga0307416_100000623 | 3300032002 | Bacteria | 18266 |
| 552 | Ga0307416_100013464 | 3300032002 | Bacteria | 5560 |
| 553 | Ga0307416_100017520 | 3300032002 | Bacteria | 5015 |
| 554 | Ga0307414_10013692 | 3300032004 | Bacteria | 4838 |
| 555 | Ga0307414_10015850 | 3300032004 | Bacteria | 4563 |
| 556 | Ga0307415_100000256 | 3300032126 | Bacteria | 23002 |
| 557 | Ga0307415_100006916 | 3300032126 | Bacteria | 6159 |
| 558 | Ga0307415_100077036 | 3300032126 | Bacteria | 2366 |
| 559 | Ga0307415_100100564 | 3300032126 | Bacteria | 2119 |
| 560 | Ga0316583_10017380 | 3300032133 | Bacteria | 2587 |
| 561 | Ga0373948_0013710 | 3300034817 | Bacteria | 1468 |
| 562 | Ga0373929_0004162 | 3300035085 | Bacteria | 2597 |
| 563 | Ga0373923_0002168 | 3300035111 | Bacteria | 5958 |
| 564 | Ga0373954_0120648 | 3300035118 | Bacteria | 1272 |
| 565 | Ga0373943_0049256 | 3300035170 | Bacteria | 2067 |
| 566 | Ga0373961_0004269 | 3300035241 | Bacteria | 3463 |
| 567 | Ga0316574_0098796 | 3300035398 | Bacteria | 1867 |
| 568 | Ga0373931_0022373 | 3300035691 | Bacteria | 3181 |
| 569 | Ga0373931_0025681 | 3300035691 | Unclassified | 2992 |
| 570 | Ga0373931_0064125 | 3300035691 | Bacteria | 1988 |
| 571 | Ga0373931_0163912 | 3300035691 | Bacteria | 1305 |
| 572 | Ga0373931_0227959 | 3300035691 | Bacteria | 1124 |
| 573 | Ga0373927_0001790 | 3300035695 | Bacteria | 16043 |
| 574 | Ga0373927_0072921 | 3300035695 | Bacteria | 2223 |
| 575 | Ga0373947_0067658 | 3300035725 | Bacteria | 2183 |
| 576 | Ga0373937_0097073 | 3300036401 | Bacteria | 2733 |
| 577 | Ga0316582_0004251 | 3300036647 | Bacteria | 7195 |
| 578 | Ga0316584_0009352 | 3300036712 | Bacteria | 6797 |
| 579 | Ga0373925_0444600 | 3300037068 | Bacteria | 1061 |
| 580 | Ga0395899_0000103 | 3300037312 | Bacteria | 147274 |
| 581 | Ga0395899_0010984 | 3300037312 | Bacteria | 6935 |
| 582 | Ga0395899_0011626 | 3300037312 | Bacteria | 6736 |
| 583 | Ga0395899_0027843 | 3300037312 | Bacteria | 4257 |
| 584 | Ga0395899_0117109 | 3300037312 | Bacteria | 1911 |
| 585 | Ga0395899_0148931 | 3300037312 | Bacteria | 1660 |
| 586 | Ga0395899_0157022 | 3300037312 | Bacteria | 1609 |
| 587 | Ga0395899_0169415 | 3300037312 | Bacteria | 1538 |
| 588 | Ga0395900_0002384 | 3300037418 | Bacteria | 20759 |
| 589 | Ga0395900_0002717 | 3300037418 | Bacteria | 19339 |
| 590 | Ga0395900_0003073 | 3300037418 | Bacteria | 18154 |
| 591 | Ga0395900_0016026 | 3300037418 | Bacteria | 7636 |
| 592 | Ga0395900_0023201 | 3300037418 | Bacteria | 6351 |
| 593 | Ga0395900_0046164 | 3300037418 | Bacteria | 4486 |
| 594 | Ga0395900_0047090 | 3300037418 | Bacteria | 4440 |
| 595 | Ga0395900_0058657 | 3300037418 | Bacteria | 3962 |
| 596 | Ga0395900_0101453 | 3300037418 | Bacteria | 2956 |
| 597 | Ga0395900_0103496 | 3300037418 | Bacteria | 2924 |
| 598 | Ga0395900_0114137 | 3300037418 | Bacteria | 2772 |
| 599 | Ga0395900_0178595 | 3300037418 | Bacteria | 2159 |
| 600 | Ga0395900_0237484 | 3300037418 | Bacteria | 1830 |
| 601 | Ga0395898_0000053 | 3300037466 | Bacteria | 279600 |
| 602 | Ga0395898_0002898 | 3300037466 | Bacteria | 19522 |
| 603 | Ga0395898_0007983 | 3300037466 | Bacteria | 11228 |
| 604 | Ga0395898_0012329 | 3300037466 | Bacteria | 8840 |
| 605 | Ga0395898_0014617 | 3300037466 | Bacteria | 8062 |
| 606 | Ga0395898_0024232 | 3300037466 | Bacteria | 6121 |
| 607 | Ga0395898_0052265 | 3300037466 | Bacteria | 3992 |
| 608 | Ga0395898_0081494 | 3300037466 | Bacteria | 3120 |
| 609 | Ga0395898_0129444 | 3300037466 | Bacteria | 2418 |
| 610 | Ga0395898_0249665 | 3300037466 | Bacteria | 1692 |
| 611 | Ga0395898_0257387 | 3300037466 | Bacteria | 1664 |
| 612 | Ga0395898_0348051 | 3300037466 | Bacteria | 1413 |
| 613 | Ga0395905_0000031 | 3300037471 | Bacteria | 286757 |
| 614 | Ga0395905_0002933 | 3300037471 | Bacteria | 18555 |
| 615 | Ga0395905_0011028 | 3300037471 | Bacteria | 8744 |
| 616 | Ga0395905_0012385 | 3300037471 | Bacteria | 8211 |
| 617 | Ga0395905_0014041 | 3300037471 | Bacteria | 7658 |
| 618 | Ga0395905_0017320 | 3300037471 | Bacteria | 6841 |
| 619 | Ga0395905_0019078 | 3300037471 | Bacteria | 6505 |
| 620 | Ga0395905_0028173 | 3300037471 | Bacteria | 5294 |
| 621 | Ga0395905_0035912 | 3300037471 | Bacteria | 4654 |
| 622 | Ga0395905_0051072 | 3300037471 | Bacteria | 3872 |
| 623 | Ga0395905_0069555 | 3300037471 | Bacteria | 3297 |
| 624 | Ga0395905_0171086 | 3300037471 | Bacteria | 2040 |
| 625 | Ga0395905_0190965 | 3300037471 | Bacteria | 1921 |
| 626 | Ga0395905_0398884 | 3300037471 | Bacteria | 1270 |
| 627 | Ga0395905_0634130 | 3300037471 | Bacteria | 970 |
| 628 | Ga0436364_0536128 | 3300037853 | Bacteria | 50208 |
| 629 | Ga0436364_0682637 | 3300037853 | Bacteria | 2013 |
| 630 | Ga0395901_0000163 | 3300038443 | Bacteria | 87103 |
| 631 | Ga0395901_0003692 | 3300038443 | Bacteria | 15438 |
| 632 | Ga0395901_0006699 | 3300038443 | Bacteria | 11641 |
| 633 | Ga0395901_0011095 | 3300038443 | Bacteria | 9132 |
| 634 | Ga0395901_0014941 | 3300038443 | Bacteria | 7889 |
| 635 | Ga0395901_0037660 | 3300038443 | Bacteria | 5002 |
| 636 | Ga0395901_0096591 | 3300038443 | Bacteria | 3096 |
| 637 | Ga0395901_0104621 | 3300038443 | Bacteria | 2970 |
| 638 | Ga0395901_0109031 | 3300038443 | Bacteria | 2906 |
| 639 | Ga0395901_0124654 | 3300038443 | Bacteria | 2707 |
| 640 | Ga0395901_0276826 | 3300038443 | Bacteria | 1744 |
| 641 | Ga0395901_0384568 | 3300038443 | Bacteria | 1444 |
| 642 | Ga0395901_0413734 | 3300038443 | Bacteria | 1384 |
| 643 | Ga0395901_0463862 | 3300038443 | Bacteria | 1294 |
| 644 | Ga0395901_0537671 | 3300038443 | Bacteria | 1185 |
| 645 | Ga0395901_0542399 | 3300038443 | Bacteria | 1179 |
| 646 | Ga0395901_0633289 | 3300038443 | Bacteria | 1075 |
| 647 | Ga0436365_0520124 | 3300039437 | Bacteria | 63069 |
| 648 | Ga0436365_1894668 | 3300039437 | Bacteria | 2496 |
| 649 | Ga0436363_0625004 | 3300039450 | Bacteria | 3112 |
| 650 | Ga0439461_0014960 | 3300041410 | Bacteria | 1482 |
| 651 | Ga0439441_003711 | 3300042001 | Bacteria | 2271 |
| 652 | Ga0439443_004504 | 3300042003 | Bacteria | 1819 |
| 653 | Ga0439448_0004115 | 3300042005 | Bacteria | 4095 |
| 654 | Ga0439458_0000121 | 3300042157 | Bacteria | 16048 |
| 655 | Ga0439458_0001367 | 3300042157 | Bacteria | 6153 |
| 656 | Ga0439434_0021801 | 3300042435 | Bacteria | 1925 |
| 657 | Ga0439435_0014413 | 3300042436 | Bacteria | 1952 |
| 658 | Ga0439435_0017169 | 3300042436 | Bacteria | 1825 |
| 659 | Ga0439444_0026400 | 3300042437 | Bacteria | 1062 |
| 660 | Ga0439460_0012660 | 3300042461 | Bacteria | 2193 |
| 661 | Ga0466969_0006178 | 3300044656 | Bacteria | 6376 |
| 662 | Ga0466972_0000063 | 3300044658 | Bacteria | 105889 |
| 663 | Ga0466972_0047556 | 3300044658 | Bacteria | 2074 |
| 664 | Ga0466965_0019715 | 3300044683 | Bacteria | 3239 |
| 665 | Ga0466966_0002883 | 3300044684 | Bacteria | 11333 |
| 666 | Ga0466966_0013797 | 3300044684 | Bacteria | 5346 |
| 667 | Ga0466966_0018101 | 3300044684 | Bacteria | 4650 |
| 668 | Ga0466966_0190441 | 3300044684 | Bacteria | 1243 |
| 669 | Ga0466961_0019874 | 3300044693 | Bacteria | 4323 |
| 670 | Ga0466961_0058869 | 3300044693 | Bacteria | 2443 |
| 671 | Ga0466963_0002661 | 3300044694 | Bacteria | 10056 |
| 672 | Ga0466963_0010554 | 3300044694 | Bacteria | 5596 |
| 673 | Ga0466963_0010868 | 3300044694 | Bacteria | 5528 |
| 674 | Ga0466963_0053411 | 3300044694 | Bacteria | 2682 |
| 675 | Ga0466963_0126448 | 3300044694 | Bacteria | 1762 |
| 676 | Ga0466964_0116042 | 3300044706 | Bacteria | 1200 |
| 677 | Ga0466964_0160107 | 3300044706 | Bacteria | 1051 |
| 678 | Ga0466971_0021851 | 3300044719 | Bacteria | 2848 |
| 679 | Ga0466970_0021262 | 3300044765 | Bacteria | 3379 |
| 680 | Ga0466957_0015688 | 3300044842 | Bacteria | 4425 |
| 681 | Ga0466957_0025000 | 3300044842 | Bacteria | 3538 |
| 682 | Ga0466957_0026090 | 3300044842 | Bacteria | 3465 |
| 683 | Ga0466957_0041916 | 3300044842 | Bacteria | 2768 |
| 684 | Ga0466960_0190397 | 3300044901 | Bacteria | 1116 |
| 685 | Ga0466959_0020934 | 3300045049 | Bacteria | 4820 |
| 686 | Ga0466959_0025616 | 3300045049 | Bacteria | 4373 |
| 687 | Ga0466959_0039918 | 3300045049 | Bacteria | 3469 |
| 688 | Ga0466959_0177015 | 3300045049 | Bacteria | 1494 |
| 689 | Ga0466959_0238537 | 3300045049 | Bacteria | 1257 |
| 690 | Ga0451576_0145437 | 3300045051 | Unclassified | 2472 |
| 691 | Ga0466958_0001875 | 3300045836 | Bacteria | 10279 |
| 692 | Ga0466958_0002438 | 3300045836 | Bacteria | 9328 |
| 693 | Ga0466958_0030580 | 3300045836 | Bacteria | 3199 |
| 694 | Ga0466958_0144025 | 3300045836 | Bacteria | 1501 |
| 695 | Ga0466967_0013401 | 3300045976 | Bacteria | 6333 |
| 696 | Ga0466967_0020072 | 3300045976 | Bacteria | 5390 |
| 697 | Ga0466967_0026278 | 3300045976 | Bacteria | 4820 |
| 698 | Ga0466967_0097081 | 3300045976 | Bacteria | 2689 |
| 699 | Ga0466967_0122672 | 3300045976 | Bacteria | 2403 |
| 700 | Ga0466967_0139563 | 3300045976 | Bacteria | 2256 |
| 701 | Ga0466967_0529255 | 3300045976 | Bacteria | 1159 |
| 702 | Ga0495603_0027959 | 3300046455 | Bacteria | 3401 |
| 703 | Ga0495641_0096699 | 3300046461 | Bacteria | 1318 |
| 704 | Ga0495651_0002911 | 3300046462 | Bacteria | 13256 |
| 705 | Ga0495651_0003862 | 3300046462 | Bacteria | 11453 |
| 706 | Ga0495653_0001994 | 3300046463 | Bacteria | 16052 |
| 707 | Ga0495580_0018482 | 3300046472 | Bacteria | 5190 |
| 708 | Ga0495582_0000431 | 3300046473 | Bacteria | 22867 |
| 709 | Ga0495608_0073364 | 3300046511 | Bacteria | 2232 |
| 710 | Ga0495628_0000515 | 3300046516 | Bacteria | 35499 |
| 711 | Ga0495628_0003485 | 3300046516 | Bacteria | 14083 |
| 712 | Ga0495630_0043576 | 3300046517 | Bacteria | 3353 |
| 713 | Ga0495643_0005167 | 3300046522 | Bacteria | 8912 |
| 714 | Ga0495644_0099088 | 3300046523 | Bacteria | 1102 |
| 715 | Ga0495663_0029883 | 3300046525 | Bacteria | 1611 |
| 716 | Ga0495652_0002256 | 3300046529 | Bacteria | 20114 |
| 717 | Ga0495652_0010026 | 3300046529 | Bacteria | 8585 |
| 718 | Ga0495640_0038052 | 3300046533 | Bacteria | 3387 |
| 719 | Ga0495587_0001271 | 3300046536 | Bacteria | 16780 |
| 720 | Ga0495645_0016848 | 3300046543 | Bacteria | 5230 |
| 721 | Ga0495667_0002732 | 3300046559 | Bacteria | 11789 |
| 722 | Ga0495656_0022141 | 3300046615 | Bacteria | 2485 |
| 723 | Ga0495635_0006423 | 3300046663 | Bacteria | 8197 |
| 724 | Ga0495588_0033165 | 3300046674 | Bacteria | 2607 |
| 725 | Ga0495657_0017798 | 3300046675 | Bacteria | 5153 |
| 726 | Ga0495657_0032014 | 3300046675 | Bacteria | 3673 |
| 727 | Ga0495599_0029392 | 3300046678 | Bacteria | 3445 |
| 728 | Ga0495658_0065393 | 3300046683 | Bacteria | 2098 |
| 729 | Ga0495658_0233540 | 3300046683 | Bacteria | 1154 |
| 730 | Ga0495669_0007954 | 3300046684 | Bacteria | 4449 |
| 731 | Ga0495613_0184803 | 3300046689 | Bacteria | 1475 |
| 732 | Ga0495624_0011960 | 3300046690 | Bacteria | 5949 |
| 733 | Ga0495670_0084506 | 3300046691 | Bacteria | 1620 |
| 734 | Ga0495589_0132728 | 3300046794 | Bacteria | 1195 |
| 735 | Ga0495600_0238797 | 3300046809 | Bacteria | 1158 |
| 736 | Ga0495581_0010437 | 3300047315 | Bacteria | 5371 |
| 737 | Ga0495581_0024575 | 3300047315 | Bacteria | 3492 |
| 738 | Ga0495581_0102798 | 3300047315 | Bacteria | 1660 |
| 739 | Ga0495604_0007212 | 3300047317 | Bacteria | 8808 |
| 740 | Ga0495604_0183788 | 3300047317 | Bacteria | 1461 |
| 741 | Ga0495604_0253631 | 3300047317 | Bacteria | 1198 |
| 742 | Ga0495674_0003664 | 3300047319 | Bacteria | 14949 |
| 743 | Ga0495674_0204775 | 3300047319 | Bacteria | 1636 |
| 744 | Ga0495672_0071417 | 3300047320 | Bacteria | 1964 |
| 745 | Ga0495676_0030058 | 3300047321 | Bacteria | 4618 |
| 746 | Ga0495676_0063564 | 3300047321 | Bacteria | 2876 |
| 747 | Ga0495680_0000563 | 3300047322 | Bacteria | 41798 |
| 748 | Ga0495675_0000371 | 3300047444 | Bacteria | 31063 |
| 749 | Ga0495675_0205191 | 3300047444 | Bacteria | 1198 |
| 750 | Ga0495677_0023207 | 3300047445 | Bacteria | 2252 |
| 751 | Ga0495602_0012470 | 3300048088 | Bacteria | 8734 |
| 752 | Ga0496100_0016696 | 3300048903 | Bacteria | 4317 |
| 753 | Ga0496100_0033944 | 3300048903 | Bacteria | 3196 |
| 754 | Ga0496100_0047207 | 3300048903 | Bacteria | 2773 |
| 755 | Ga0496100_0166718 | 3300048903 | Bacteria | 1583 |
| 756 | Ga0496101_0005176 | 3300048904 | Bacteria | 8298 |
| 757 | Ga0496101_0014355 | 3300048904 | Bacteria | 5321 |
| 758 | Ga0496101_0018589 | 3300048904 | Bacteria | 4728 |
| 759 | Ga0496101_0035794 | 3300048904 | Bacteria | 3513 |
| 760 | Ga0496102_0000455 | 3300048905 | Bacteria | 46123 |
| 761 | Ga0496102_0002662 | 3300048905 | Bacteria | 15195 |
| 762 | Ga0496102_0018023 | 3300048905 | Bacteria | 6196 |
| 763 | Ga0496102_0025629 | 3300048905 | Bacteria | 5252 |
| 764 | Ga0496102_0121851 | 3300048905 | Bacteria | 2436 |
| 765 | Ga0496102_0181694 | 3300048905 | Bacteria | 1982 |
| 766 | Ga0496102_0299702 | 3300048905 | Bacteria | 1515 |
| 767 | Ga0496103_0002178 | 3300048906 | Bacteria | 12442 |
| 768 | Ga0496103_0185753 | 3300048906 | Bacteria | 1336 |
| 769 | Ga0496104_0003563 | 3300048907 | Bacteria | 13434 |
| 770 | Ga0496104_0032938 | 3300048907 | Bacteria | 4825 |
| 771 | Ga0496104_0084553 | 3300048907 | Bacteria | 3028 |
| 772 | Ga0496104_0086658 | 3300048907 | Bacteria | 2990 |
| 773 | Ga0496105_0250381 | 3300048908 | Bacteria | 1435 |
| 774 | Ga0496106_0000219 | 3300048909 | Bacteria | 39803 |
| 775 | Ga0496106_0005635 | 3300048909 | Bacteria | 9267 |
| 776 | Ga0496106_0008543 | 3300048909 | Bacteria | 7576 |
| 777 | Ga0496106_0008984 | 3300048909 | Bacteria | 7383 |
| 778 | Ga0496106_0019985 | 3300048909 | Bacteria | 4966 |
| 779 | Ga0496106_0077853 | 3300048909 | Bacteria | 2543 |
| 780 | Ga0496106_0352466 | 3300048909 | Bacteria | 1182 |
| 781 | Ga0496107_0001105 | 3300048910 | Bacteria | 16233 |
| 782 | Ga0496107_0006260 | 3300048910 | Bacteria | 8180 |
| 783 | Ga0496107_0009394 | 3300048910 | Bacteria | 6782 |
| 784 | Ga0496107_0031185 | 3300048910 | Bacteria | 3801 |
| 785 | Ga0496107_0081601 | 3300048910 | Bacteria | 2358 |
| 786 | Ga0496108_0005751 | 3300048911 | Bacteria | 10042 |
| 787 | Ga0496108_0034303 | 3300048911 | Bacteria | 4216 |
| 788 | Ga0496108_0036768 | 3300048911 | Bacteria | 4075 |
| 789 | Ga0496108_0105031 | 3300048911 | Bacteria | 2411 |
| 790 | Ga0496108_0130404 | 3300048911 | Bacteria | 2161 |
| 791 | Ga0496108_0332614 | 3300048911 | Unclassified | 1325 |
| 792 | Ga0496109_0000470 | 3300048912 | Bacteria | 34274 |
| 793 | Ga0496109_0004861 | 3300048912 | Bacteria | 11217 |
| 794 | Ga0496109_0020529 | 3300048912 | Bacteria | 5835 |
| 795 | Ga0496109_0256591 | 3300048912 | Bacteria | 1647 |
| 796 | Ga0496110_0004040 | 3300048913 | Bacteria | 11323 |
| 797 | Ga0496110_0031531 | 3300048913 | Bacteria | 4573 |
| 798 | Ga0496110_0109228 | 3300048913 | Bacteria | 2484 |
| 799 | Ga0496110_0213469 | 3300048913 | Bacteria | 1755 |
| 800 | Ga0496111_0011044 | 3300048914 | Bacteria | 6078 |
| 801 | Ga0496111_0021701 | 3300048914 | Bacteria | 4487 |
| 802 | Ga0496111_0317497 | 3300048914 | Bacteria | 1154 |
| 803 | Ga0496112_0015372 | 3300048915 | Bacteria | 7140 |
| 804 | Ga0496112_0029020 | 3300048915 | Bacteria | 5347 |
| 805 | Ga0496112_0031498 | 3300048915 | Bacteria | 5145 |
| 806 | Ga0496112_0032197 | 3300048915 | Bacteria | 5090 |
| 807 | Ga0496112_0096921 | 3300048915 | Bacteria | 2920 |
| 808 | Ga0496112_0155995 | 3300048915 | Bacteria | 2250 |
| 809 | Ga0496112_0231686 | 3300048915 | Bacteria | 1801 |
| 810 | Ga0496113_0003062 | 3300048916 | Bacteria | 9913 |
| 811 | Ga0496113_0053500 | 3300048916 | Bacteria | 3019 |
| 812 | Ga0496113_0406620 | 3300048916 | Unclassified | 1093 |
| 813 | Ga0496114_0038112 | 3300048917 | Bacteria | 3976 |
| 814 | Ga0496114_0041232 | 3300048917 | Bacteria | 3824 |
| 815 | Ga0496114_0091948 | 3300048917 | Bacteria | 2577 |
| 816 | Ga0496114_0146056 | 3300048917 | Bacteria | 2050 |
| 817 | Ga0496115_0001296 | 3300048918 | Bacteria | 17868 |
| 818 | Ga0496115_0015566 | 3300048918 | Bacteria | 5772 |
| 819 | Ga0496115_0018307 | 3300048918 | Bacteria | 5375 |
| 820 | Ga0496115_0163241 | 3300048918 | Bacteria | 1842 |
| 821 | Ga0496115_0334797 | 3300048918 | Unclassified | 1236 |
| 822 | Ga0496115_0422398 | 3300048918 | Bacteria | 1080 |
| 823 | Ga0496117_0000310 | 3300048920 | Bacteria | 85004 |
| 824 | Ga0496121_0082601 | 3300048924 | Bacteria | 2539 |
| 825 | Ga0501031_0060415 | 3300049568 | Bacteria | 2470 |
| 826 | Ga0501031_0073683 | 3300049568 | Bacteria | 2223 |
| 827 | Ga0501032_0024565 | 3300049569 | Bacteria | 4159 |
| 828 | Ga0501032_0086245 | 3300049569 | Bacteria | 2087 |
| 829 | Ga0501033_0002326 | 3300049570 | Bacteria | 16195 |
| 830 | Ga0501033_0062885 | 3300049570 | Bacteria | 2733 |
| 831 | Ga0501033_0150922 | 3300049570 | Bacteria | 1676 |
| 832 | Ga0501033_0199625 | 3300049570 | Bacteria | 1429 |
| 833 | Ga0501034_0016634 | 3300049571 | Bacteria | 7542 |
| 834 | Ga0501034_0145372 | 3300049571 | Bacteria | 2349 |
| 835 | Ga0501036_0000096 | 3300049572 | Bacteria | 54442 |
| 836 | Ga0501036_0064391 | 3300049572 | Bacteria | 3103 |
| 837 | Ga0501036_0078371 | 3300049572 | Bacteria | 2795 |
| 838 | Ga0501037_0081213 | 3300049573 | Bacteria | 2351 |
| 839 | Ga0501037_0154364 | 3300049573 | Bacteria | 1639 |
| 840 | Ga0501037_0229619 | 3300049573 | Bacteria | 1303 |
| 841 | Ga0501038_0000791 | 3300049574 | Bacteria | 28037 |
| 842 | Ga0501038_0004587 | 3300049574 | Bacteria | 12856 |
| 843 | Ga0501038_0082872 | 3300049574 | Bacteria | 2700 |
| 844 | Ga0501038_0170545 | 3300049574 | Bacteria | 1762 |
| 845 | Ga0501038_0291304 | 3300049574 | Bacteria | 1283 |
| 846 | Ga0501039_0003249 | 3300049575 | Bacteria | 12149 |
| 847 | Ga0501039_0029527 | 3300049575 | Bacteria | 4223 |
| 848 | Ga0501039_0041354 | 3300049575 | Bacteria | 3560 |
| 849 | Ga0501039_0049828 | 3300049575 | Bacteria | 3239 |
| 850 | Ga0501039_0053881 | 3300049575 | Bacteria | 3113 |
| 851 | Ga0501040_0000395 | 3300049576 | Bacteria | 25703 |
| 852 | Ga0501040_0017103 | 3300049576 | Bacteria | 4811 |
| 853 | Ga0501040_0119821 | 3300049576 | Bacteria | 1846 |
| 854 | Ga0501041_0001593 | 3300049577 | Bacteria | 12649 |
| 855 | Ga0501041_0002445 | 3300049577 | Bacteria | 10547 |
| 856 | Ga0501041_0004801 | 3300049577 | Bacteria | 7851 |
| 857 | Ga0501041_0007499 | 3300049577 | Bacteria | 6402 |
| 858 | Ga0501041_0014764 | 3300049577 | Bacteria | 4638 |
| 859 | Ga0501042_0002787 | 3300049578 | Bacteria | 10805 |
| 860 | Ga0501042_0016971 | 3300049578 | Bacteria | 5011 |
| 861 | Ga0501042_0025723 | 3300049578 | Bacteria | 4136 |
| 862 | Ga0501042_0138037 | 3300049578 | Bacteria | 1757 |
| 863 | Ga0501043_0014879 | 3300049579 | Bacteria | 6090 |
| 864 | Ga0501043_0066212 | 3300049579 | Bacteria | 2837 |
| 865 | Ga0501043_0094055 | 3300049579 | Bacteria | 2356 |
| 866 | Ga0501046_0000200 | 3300049580 | Bacteria | 61991 |
| 867 | Ga0501046_0012485 | 3300049580 | Bacteria | 7229 |
| 868 | Ga0501047_0020350 | 3300049581 | Bacteria | 6373 |
| 869 | Ga0501047_0052879 | 3300049581 | Bacteria | 3926 |
| 870 | Ga0501047_0068672 | 3300049581 | Bacteria | 3413 |
| 871 | Ga0501047_0345343 | 3300049581 | Bacteria | 1325 |
| 872 | Ga0501048_0000761 | 3300049582 | Bacteria | 23628 |
| 873 | Ga0501048_0050071 | 3300049582 | Bacteria | 2975 |
| 874 | Ga0501048_0283423 | 3300049582 | Bacteria | 1178 |
| 875 | Ga0501067_0083589 | 3300049583 | Bacteria | 1771 |
| 876 | Ga0501068_0050188 | 3300049584 | Bacteria | 2522 |
| 877 | Ga0501068_0105765 | 3300049584 | Bacteria | 1747 |
| 878 | Ga0501070_0001824 | 3300049586 | Bacteria | 18764 |
| 879 | Ga0501070_0042475 | 3300049586 | Bacteria | 3787 |
| 880 | Ga0501070_0064551 | 3300049586 | Bacteria | 3032 |
| 881 | Ga0501070_0146565 | 3300049586 | Bacteria | 1948 |
| 882 | Ga0501071_0044429 | 3300049587 | Bacteria | 3186 |
| 883 | Ga0501071_0071018 | 3300049587 | Bacteria | 2537 |
| 884 | Ga0501072_0000765 | 3300049588 | Bacteria | 23435 |
| 885 | Ga0501072_0009119 | 3300049588 | Bacteria | 7533 |
| 886 | Ga0501072_0060560 | 3300049588 | Bacteria | 2984 |
| 887 | Ga0501072_0065057 | 3300049588 | Bacteria | 2875 |
| 888 | Ga0501072_0076622 | 3300049588 | Bacteria | 2646 |
| 889 | Ga0501074_0003684 | 3300049590 | Bacteria | 10867 |
| 890 | Ga0501074_0032017 | 3300049590 | Bacteria | 3811 |
| 891 | Ga0501074_0039427 | 3300049590 | Bacteria | 3422 |
| 892 | Ga0501075_0002417 | 3300049591 | Bacteria | 12417 |
| 893 | Ga0501075_0004855 | 3300049591 | Bacteria | 9153 |
| 894 | Ga0501075_0129121 | 3300049591 | Bacteria | 1925 |
| 895 | Ga0501076_0003566 | 3300049592 | Bacteria | 10931 |
| 896 | Ga0501076_0009014 | 3300049592 | Bacteria | 7347 |
| 897 | Ga0501076_0033591 | 3300049592 | Bacteria | 4005 |
| 898 | Ga0501076_0192178 | 3300049592 | Bacteria | 1666 |
| 899 | Ga0501077_0001853 | 3300049593 | Bacteria | 12778 |
| 900 | Ga0501077_0007642 | 3300049593 | Bacteria | 6672 |
| 901 | Ga0501077_0008447 | 3300049593 | Bacteria | 6381 |
| 902 | Ga0501077_0124863 | 3300049593 | Bacteria | 1631 |
| 903 | Ga0501079_0003631 | 3300049741 | Bacteria | 11359 |
| 904 | Ga0501079_0003781 | 3300049741 | Bacteria | 11179 |
| 905 | Ga0501079_0010528 | 3300049741 | Bacteria | 7031 |
| 906 | Ga0501079_0143401 | 3300049741 | Bacteria | 1861 |
| 907 | Ga0501080_0001492 | 3300049742 | Bacteria | 19754 |
| 908 | Ga0501080_0020624 | 3300049742 | Bacteria | 6104 |
| 909 | Ga0501080_0077932 | 3300049742 | Bacteria | 3082 |
| 910 | Ga0501080_0136712 | 3300049742 | Bacteria | 2268 |
| 911 | Ga0501080_0310028 | 3300049742 | Bacteria | 1430 |
| 912 | Ga0501080_0428309 | 3300049742 | Bacteria | 1188 |
| 913 | Ga0501081_0001882 | 3300049743 | Bacteria | 13048 |
| 914 | Ga0501081_0003392 | 3300049743 | Bacteria | 10145 |
| 915 | Ga0501081_0004640 | 3300049743 | Bacteria | 8832 |
| 916 | Ga0501081_0020935 | 3300049743 | Bacteria | 4364 |
| 917 | Ga0501081_0145909 | 3300049743 | Bacteria | 1698 |
| 918 | Ga0501083_0034378 | 3300049744 | Bacteria | 3466 |
| 919 | Ga0501083_0050079 | 3300049744 | Bacteria | 2813 |
| 920 | Ga0501035_0003095 | 3300049822 | Bacteria | 15978 |
| 921 | Ga0501035_0042018 | 3300049822 | Bacteria | 4125 |
| 922 | Ga0501035_0051047 | 3300049822 | Bacteria | 3704 |
| 923 | Ga0501035_0202314 | 3300049822 | Bacteria | 1702 |
| 924 | Ga0501044_0012756 | 3300049823 | Bacteria | 9100 |
| 925 | Ga0501044_0029819 | 3300049823 | Bacteria | 5751 |
| 926 | Ga0501044_0065971 | 3300049823 | Bacteria | 3691 |
| 927 | Ga0501044_0113267 | 3300049823 | Bacteria | 2720 |
| 928 | Ga0501045_0000087 | 3300049824 | Bacteria | 43859 |
| 929 | Ga0501045_0003237 | 3300049824 | Bacteria | 11117 |
| 930 | Ga0501045_0008851 | 3300049824 | Bacteria | 7028 |
| 931 | Ga0501045_0045486 | 3300049824 | Bacteria | 3196 |
| 932 | nmdc:mga05p37_210272_c1 | 3300050507 | Bacteria | 2352 |
| 933 | nmdc:mga05p37_28657_c1 | 3300050507 | Bacteria | 6793 |
| 934 | nmdc:mga05p37_33473_c1 | 3300050507 | Bacteria | 6294 |
| 935 | nmdc:mga05p37_83042_c1 | 3300050507 | Bacteria | 3947 |
| 936 | nmdc:mga05p37_85120_c1 | 3300050507 | Unclassified | 3896 |
| 937 | nmdc:mga09592_86629_c1 | 3300050508 | Bacteria | 2673 |
| 938 | nmdc:mga06r32_100685_c1 | 3300050510 | Bacteria | 2835 |
| 939 | nmdc:mga06r32_897_c1 | 3300050510 | Bacteria | 26528 |
| 940 | nmdc:mga08y16_489659_c1 | 3300050511 | Bacteria | 1250 |
| 941 | nmdc:mga0n895_3167_c1 | 3300050512 | Bacteria | 13149 |
| 942 | nmdc:mga0n895_78149_c1 | 3300050512 | Unclassified | 3293 |
| 943 | nmdc:mga0n895_8149_c1 | 3300050512 | Bacteria | 9053 |
| 944 | nmdc:mga0rr50_233833_c1 | 3300050513 | Bacteria | 1521 |
| 945 | nmdc:mga0rr50_4008_c1 | 3300050513 | Bacteria | 8588 |
| 946 | nmdc:mga0rr50_68941_c1 | 3300050513 | Bacteria | 2690 |
| 947 | nmdc:mga0rr50_77661_c1 | 3300050513 | Bacteria | 2552 |
| 948 | nmdc:mga08x19_38967_c1 | 3300050514 | Bacteria | 3019 |
| 949 | nmdc:mga08x19_44420_c1 | 3300050514 | Bacteria | 2837 |
| 950 | nmdc:mga08x19_44969_c1 | 3300050514 | Bacteria | 2821 |
| 951 | nmdc:mga0a205_10416_c1 | 3300050515 | Bacteria | 8543 |
| 952 | nmdc:mga0a205_330456_c1 | 3300050515 | Bacteria | 1394 |
| 953 | nmdc:mga0a205_622486_c1 | 3300050515 | Unclassified | 932 |
| 954 | Ga0495601_0001675 | 3300053077 | Bacteria | 12219 |
| 955 | Ga0495655_0005239 | 3300053083 | Bacteria | 2279 |
| 956 | Ga0495655_0005262 | 3300053083 | Bacteria | 2275 |
| 957 | Ga0500627_0000020 | 3300053158 | Bacteria | 109977 |
| 958 | Ga0501084_0003415 | 3300054114 | Bacteria | 12884 |
| 959 | Ga0501084_0004952 | 3300054114 | Bacteria | 10888 |
| 960 | Ga0501084_0014118 | 3300054114 | Bacteria | 6615 |
| 961 | Ga0501084_0016140 | 3300054114 | Bacteria | 6201 |
| 962 | Ga0590071_007661 | 3300059421 | Bacteria | 2552 |
| 963 | Ga0590075_010614 | 3300059424 | Bacteria | 2220 |
| 964 | Ga0501082_0003997 | 3300060353 | Bacteria | 12869 |
| 965 | Ga0501082_0005812 | 3300060353 | Bacteria | 10710 |
| 966 | Ga0501082_0022598 | 3300060353 | Bacteria | 5417 |
| 967 | Ga0501082_0039366 | 3300060353 | Bacteria | 4078 |
| 968 | Ga0501082_0061992 | 3300060353 | Bacteria | 3218 |
| 969 | Ga0501082_0090622 | 3300060353 | Bacteria | 2640 |
| 970 | Ga0501082_0253963 | 3300060353 | Bacteria | 1530 |
| 971 | Ga0501082_0322712 | 3300060353 | Bacteria | 1345 |
| 972 | Ga0466962_0027009 | 3300061719 | Bacteria | 2756 |
| 973 | Ga0466962_0076654 | 3300061719 | Bacteria | 1598 |
| 974 | Ga0530510_0000522 | 3300061734 | Bacteria | 24577 |
| 975 | Ga0530510_0027514 | 3300061734 | Bacteria | 4073 |
| 976 | Ga0530510_0051841 | 3300061734 | Bacteria | 2965 |
| 977 | Ga0530510_0063437 | 3300061734 | Bacteria | 2675 |
| 978 | Ga0530510_0087979 | 3300061734 | Bacteria | 2263 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037471 | Ga0395905_0634130 | Ga0395905_0634130_11_895 | 260 |
| 2 | 3300050515 | nmdc:mga0a205_622486_c1 | nmdc:mga0a205_622486_c1_21_833 | 270 |
| 3 | 3300048917 | Ga0496114_0091948 | Ga0496114_0091948_92_982 | 278 |
| 4 | 3300048918 | Ga0496115_0334797 | Ga0496115_0334797_67_957 | 278 |
| 5 | 3300006942 | Ga0099824_1013620 | Ga0099824_10136207 | 282 |
| 6 | 3300027296 | Ga0209389_1000676 | Ga0209389_10006765 | 282 |
| 7 | 3300027357 | Ga0209589_1005614 | Ga0209589_10056145 | 282 |
| 8 | 3300027361 | Ga0209489_100192 | Ga0209489_10019220 | 282 |
| 9 | 3300034817 | Ga0373948_0013710 | Ga0373948_0013710_21_875 | 283 |
| 10 | 3300044693 | Ga0466961_0019874 | Ga0466961_0019874_1701_2654 | 297 |
| 11 | 3300044765 | Ga0466970_0021262 | Ga0466970_0021262_989_1942 | 297 |
| 12 | 3300044842 | Ga0466957_0025000 | Ga0466957_0025000_2517_3470 | 297 |
| 13 | 3300045836 | Ga0466958_0030580 | Ga0466958_0030580_272_1225 | 297 |
| 14 | 3300005354 | Ga0070675_100124403 | Ga0070675_1001244032 | 298 |
| 15 | 3300025907 | Ga0207645_10005412 | Ga0207645_100054126 | 298 |
| 16 | 3300025961 | Ga0207712_10276496 | Ga0207712_102764962 | 298 |
| 17 | 3300006871 | Ga0075434_100030081 | Ga0075434_1000300814 | 301 |
| 18 | 3300045051 | Ga0451576_0145437 | Ga0451576_0145437_1276_2277 | 303 |
| 19 | 3300006847 | Ga0075431_100010384 | Ga0075431_1000103848 | 307 |
| 20 | 3300042001 | Ga0439441_003711 | Ga0439441_003711_1264_2190 | 307 |
| 21 | 3300042003 | Ga0439443_004504 | Ga0439443_004504_871_1797 | 307 |
| 22 | 3300042436 | Ga0439435_0014413 | Ga0439435_0014413_827_1753 | 307 |
| 23 | 3300042437 | Ga0439444_0026400 | Ga0439444_0026400_91_1017 | 307 |
| 24 | 3300042461 | Ga0439460_0012660 | Ga0439460_0012660_551_1477 | 307 |
| 25 | 3300049577 | Ga0501041_0007499 | Ga0501041_0007499_2822_3748 | 307 |
| 26 | 3300049592 | Ga0501076_0192178 | Ga0501076_0192178_514_1440 | 307 |
| 27 | 3300049824 | Ga0501045_0045486 | Ga0501045_0045486_1699_2625 | 307 |
| 28 | 3300050510 | nmdc:mga06r32_897_c1 | nmdc:mga06r32_897_c1_18943_19896 | 307 |
| 29 | 3300005355 | Ga0070671_100015419 | Ga0070671_1000154193 | 308 |
| 30 | 3300006844 | Ga0075428_100036166 | Ga0075428_1000361662 | 308 |
| 31 | 3300006847 | Ga0075431_100004258 | Ga0075431_1000042585 | 308 |
| 32 | 3300006852 | Ga0075433_10036694 | Ga0075433_100366945 | 308 |
| 33 | 3300006871 | Ga0075434_100021543 | Ga0075434_1000215434 | 308 |
| 34 | 3300006914 | Ga0075436_100012599 | Ga0075436_1000125992 | 308 |
| 35 | 3300007076 | Ga0075435_100089765 | Ga0075435_1000897653 | 308 |
| 36 | 3300009147 | Ga0114129_10009722 | Ga0114129_100097228 | 308 |
| 37 | 3300013296 | Ga0157374_10133049 | Ga0157374_101330492 | 308 |
| 38 | 3300025931 | Ga0207644_10067421 | Ga0207644_100674212 | 308 |
| 39 | 3300027907 | Ga0207428_10005685 | Ga0207428_100056852 | 308 |
| 40 | 3300039450 | Ga0436363_0625004 | Ga0436363_0625004_472_1476 | 308 |
| 41 | 3300047320 | Ga0495672_0071417 | Ga0495672_0071417_906_1919 | 308 |
| 42 | 3300047445 | Ga0495677_0023207 | Ga0495677_0023207_210_1235 | 308 |
| 43 | 3300050507 | nmdc:mga05p37_28657_c1 | nmdc:mga05p37_28657_c1_4889_5851 | 308 |
| 44 | 3300050512 | nmdc:mga0n895_3167_c1 | nmdc:mga0n895_3167_c1_9439_10401 | 308 |
| 45 | 3300050513 | nmdc:mga0rr50_4008_c1 | nmdc:mga0rr50_4008_c1_1826_2788 | 308 |
| 46 | 3300050514 | nmdc:mga08x19_44969_c1 | nmdc:mga08x19_44969_c1_463_1425 | 308 |
| 47 | 3300050515 | nmdc:mga0a205_10416_c1 | nmdc:mga0a205_10416_c1_4407_5369 | 308 |
| 48 | 3300005616 | Ga0068852_100074045 | Ga0068852_1000740451 | 309 |
| 49 | 3300009545 | Ga0105237_10035959 | Ga0105237_100359595 | 309 |
| 50 | 3300005337 | Ga0070682_100001145 | Ga0070682_1000011456 | 311 |
| 51 | 3300005341 | Ga0070691_10020725 | Ga0070691_100207253 | 311 |
| 52 | 3300005354 | Ga0070675_100040954 | Ga0070675_1000409541 | 311 |
| 53 | 3300005366 | Ga0070659_100124234 | Ga0070659_1001242343 | 311 |
| 54 | 3300005455 | Ga0070663_100000397 | Ga0070663_1000003971 | 311 |
| 55 | 3300005455 | Ga0070663_100001866 | Ga0070663_1000018665 | 311 |
| 56 | 3300005458 | Ga0070681_10023008 | Ga0070681_100230084 | 311 |
| 57 | 3300005459 | Ga0068867_100233174 | Ga0068867_1002331742 | 311 |
| 58 | 3300005530 | Ga0070679_100060514 | Ga0070679_1000605143 | 311 |
| 59 | 3300005539 | Ga0068853_100089858 | Ga0068853_1000898582 | 311 |
| 60 | 3300005546 | Ga0070696_100035703 | Ga0070696_1000357034 | 311 |
| 61 | 3300005577 | Ga0068857_100024027 | Ga0068857_1000240275 | 311 |
| 62 | 3300005578 | Ga0068854_100257759 | Ga0068854_1002577592 | 311 |
| 63 | 3300005617 | Ga0068859_100233940 | Ga0068859_1002339403 | 311 |
| 64 | 3300005841 | Ga0068863_100210726 | Ga0068863_1002107264 | 311 |
| 65 | 3300006358 | Ga0068871_100087671 | Ga0068871_1000876714 | 311 |
| 66 | 3300006931 | Ga0097620_100233930 | Ga0097620_1002339303 | 311 |
| 67 | 3300009094 | Ga0111539_10496737 | Ga0111539_104967371 | 311 |
| 68 | 3300009174 | Ga0105241_10001532 | Ga0105241_1000153219 | 311 |
| 69 | 3300009545 | Ga0105237_10191567 | Ga0105237_101915672 | 311 |
| 70 | 3300013308 | Ga0157375_10571288 | Ga0157375_105712881 | 311 |
| 71 | 3300025904 | Ga0207647_10008571 | Ga0207647_100085716 | 311 |
| 72 | 3300025914 | Ga0207671_10179351 | Ga0207671_101793511 | 311 |
| 73 | 3300025919 | Ga0207657_10017351 | Ga0207657_100173516 | 311 |
| 74 | 3300025923 | Ga0207681_10137741 | Ga0207681_101377412 | 311 |
| 75 | 3300025925 | Ga0207650_10085688 | Ga0207650_100856882 | 311 |
| 76 | 3300025927 | Ga0207687_10184688 | Ga0207687_101846882 | 311 |
| 77 | 3300025932 | Ga0207690_10057079 | Ga0207690_100570792 | 311 |
| 78 | 3300026067 | Ga0207678_10006407 | Ga0207678_100064072 | 311 |
| 79 | 3300026067 | Ga0207678_10012988 | Ga0207678_100129881 | 311 |
| 80 | 3300026089 | Ga0207648_10149687 | Ga0207648_101496873 | 311 |
| 81 | 3300038443 | Ga0395901_0633289 | Ga0395901_0633289_10_996 | 311 |
| 82 | 3300046511 | Ga0495608_0073364 | Ga0495608_0073364_488_1489 | 311 |
| 83 | 3300046675 | Ga0495657_0032014 | Ga0495657_0032014_2513_3514 | 311 |
| 84 | 3300049570 | Ga0501033_0150922 | Ga0501033_0150922_499_1482 | 311 |
| 85 | 3300049573 | Ga0501037_0154364 | Ga0501037_0154364_163_1146 | 311 |
| 86 | 3300049574 | Ga0501038_0004587 | Ga0501038_0004587_4129_5118 | 311 |
| 87 | 3300049579 | Ga0501043_0066212 | Ga0501043_0066212_1186_2169 | 311 |
| 88 | 3300049581 | Ga0501047_0020350 | Ga0501047_0020350_4709_5692 | 311 |
| 89 | 3300049586 | Ga0501070_0001824 | Ga0501070_0001824_1645_2628 | 311 |
| 90 | 3300049590 | Ga0501074_0032017 | Ga0501074_0032017_953_1936 | 311 |
| 91 | 3300049742 | Ga0501080_0077932 | Ga0501080_0077932_469_1452 | 311 |
| 92 | 3300049822 | Ga0501035_0003095 | Ga0501035_0003095_13405_14388 | 311 |
| 93 | 3300049823 | Ga0501044_0012756 | Ga0501044_0012756_261_1250 | 311 |
| 94 | 3300049823 | Ga0501044_0029819 | Ga0501044_0029819_2032_3015 | 311 |
| 95 | 3300050511 | nmdc:mga08y16_489659_c1 | nmdc:mga08y16_489659_c1_159_1130 | 311 |
| 96 | 3300005615 | Ga0070702_100221700 | Ga0070702_1002217001 | 312 |
| 97 | 3300013297 | Ga0157378_10032587 | Ga0157378_100325875 | 312 |
| 98 | 3300037471 | Ga0395905_0398884 | Ga0395905_0398884_149_1102 | 312 |
| 99 | 3300049593 | Ga0501077_0008447 | Ga0501077_0008447_53_1036 | 312 |
| 100 | 3300049822 | Ga0501035_0042018 | Ga0501035_0042018_2303_3292 | 312 |
| 101 | 3300050510 | nmdc:mga06r32_100685_c1 | nmdc:mga06r32_100685_c1_297_1304 | 312 |
| 102 | 3300005336 | Ga0070680_100005718 | Ga0070680_1000057189 | 313 |
| 103 | 3300005341 | Ga0070691_10029684 | Ga0070691_100296843 | 313 |
| 104 | 3300005345 | Ga0070692_10041389 | Ga0070692_100413892 | 313 |
| 105 | 3300005406 | Ga0070703_10004719 | Ga0070703_100047193 | 313 |
| 106 | 3300005436 | Ga0070713_100221249 | Ga0070713_1002212492 | 313 |
| 107 | 3300005438 | Ga0070701_10006123 | Ga0070701_100061233 | 313 |
| 108 | 3300005440 | Ga0070705_100000881 | Ga0070705_1000008816 | 313 |
| 109 | 3300005444 | Ga0070694_100002877 | Ga0070694_1000028773 | 313 |
| 110 | 3300005445 | Ga0070708_100002831 | Ga0070708_1000028313 | 313 |
| 111 | 3300005455 | Ga0070663_100038767 | Ga0070663_1000387671 | 313 |
| 112 | 3300005518 | Ga0070699_100004759 | Ga0070699_1000047593 | 313 |
| 113 | 3300005536 | Ga0070697_100006313 | Ga0070697_1000063139 | 313 |
| 114 | 3300005544 | Ga0070686_100120388 | Ga0070686_1001203881 | 313 |
| 115 | 3300005545 | Ga0070695_100000709 | Ga0070695_1000007097 | 313 |
| 116 | 3300005546 | Ga0070696_100000030 | Ga0070696_10000003028 | 313 |
| 117 | 3300005547 | Ga0070693_100008913 | Ga0070693_1000089132 | 313 |
| 118 | 3300005549 | Ga0070704_100003174 | Ga0070704_1000031746 | 313 |
| 119 | 3300005615 | Ga0070702_100132272 | Ga0070702_1001322722 | 313 |
| 120 | 3300005617 | Ga0068859_100007999 | Ga0068859_1000079994 | 313 |
| 121 | 3300005618 | Ga0068864_100009894 | Ga0068864_1000098947 | 313 |
| 122 | 3300005719 | Ga0068861_100054596 | Ga0068861_1000545964 | 313 |
| 123 | 3300005843 | Ga0068860_100030669 | Ga0068860_1000306693 | 313 |
| 124 | 3300005844 | Ga0068862_100001754 | Ga0068862_10000175420 | 313 |
| 125 | 3300006931 | Ga0097620_100007999 | Ga0097620_1000079994 | 313 |
| 126 | 3300009148 | Ga0105243_10012348 | Ga0105243_100123483 | 313 |
| 127 | 3300009553 | Ga0105249_10001814 | Ga0105249_1000181411 | 313 |
| 128 | 3300011119 | Ga0105246_10022640 | Ga0105246_100226404 | 313 |
| 129 | 3300025917 | Ga0207660_10013920 | Ga0207660_100139205 | 313 |
| 130 | 3300025939 | Ga0207665_10111239 | Ga0207665_101112392 | 313 |
| 131 | 3300025961 | Ga0207712_10000667 | Ga0207712_1000066721 | 313 |
| 132 | 3300026067 | Ga0207678_10016828 | Ga0207678_100168281 | 313 |
| 133 | 3300026095 | Ga0207676_10021565 | Ga0207676_100215655 | 313 |
| 134 | 3300026118 | Ga0207675_100050099 | Ga0207675_1000500994 | 313 |
| 135 | 3300028380 | Ga0268265_10002645 | Ga0268265_100026453 | 313 |
| 136 | 3300028381 | Ga0268264_10007304 | Ga0268264_100073044 | 313 |
| 137 | 3300035691 | Ga0373931_0163912 | Ga0373931_0163912_92_1078 | 313 |
| 138 | 3300037466 | Ga0395898_0002898 | Ga0395898_0002898_6235_7230 | 313 |
| 139 | 3300048905 | Ga0496102_0000455 | Ga0496102_0000455_25847_26833 | 313 |
| 140 | 3300048905 | Ga0496102_0299702 | Ga0496102_0299702_321_1319 | 313 |
| 141 | 3300048907 | Ga0496104_0032938 | Ga0496104_0032938_1274_2260 | 313 |
| 142 | 3300048909 | Ga0496106_0000219 | Ga0496106_0000219_1696_2682 | 313 |
| 143 | 3300048910 | Ga0496107_0009394 | Ga0496107_0009394_5479_6465 | 313 |
| 144 | 3300048913 | Ga0496110_0213469 | Ga0496110_0213469_617_1615 | 313 |
| 145 | 3300048915 | Ga0496112_0155995 | Ga0496112_0155995_172_1200 | 313 |
| 146 | 3300049570 | Ga0501033_0199625 | Ga0501033_0199625_229_1212 | 313 |
| 147 | 3300049575 | Ga0501039_0041354 | Ga0501039_0041354_977_1960 | 313 |
| 148 | 3300049582 | Ga0501048_0283423 | Ga0501048_0283423_15_980 | 313 |
| 149 | 3300049743 | Ga0501081_0003392 | Ga0501081_0003392_133_1116 | 313 |
| 150 | 3300060353 | Ga0501082_0039366 | Ga0501082_0039366_2081_3064 | 313 |
| 151 | 3300061734 | Ga0530510_0063437 | Ga0530510_0063437_1390_2373 | 313 |
| 152 | 3300003373 | JGI25407J50210_10001965 | JGI25407J50210_100019652 | 314 |
| 153 | 3300005440 | Ga0070705_100040413 | Ga0070705_1000404132 | 314 |
| 154 | 3300005467 | Ga0070706_100046515 | Ga0070706_1000465154 | 314 |
| 155 | 3300005616 | Ga0068852_100428436 | Ga0068852_1004284361 | 314 |
| 156 | 3300005937 | Ga0081455_10008953 | Ga0081455_100089532 | 314 |
| 157 | 3300005981 | Ga0081538_10003492 | Ga0081538_1000349213 | 314 |
| 158 | 3300006163 | Ga0070715_10067728 | Ga0070715_100677282 | 314 |
| 159 | 3300006175 | Ga0070712_100186355 | Ga0070712_1001863552 | 314 |
| 160 | 3300013308 | Ga0157375_10274660 | Ga0157375_102746602 | 314 |
| 161 | 3300025905 | Ga0207685_10021158 | Ga0207685_100211582 | 314 |
| 162 | 3300025915 | Ga0207693_10002251 | Ga0207693_1000225116 | 314 |
| 163 | 3300025929 | Ga0207664_10274401 | Ga0207664_102744012 | 314 |
| 164 | 3300025939 | Ga0207665_10106440 | Ga0207665_101064402 | 314 |
| 165 | 3300028380 | Ga0268265_10044959 | Ga0268265_100449593 | 314 |
| 166 | 3300028563 | Ga0265319_1000005 | Ga0265319_1000005159 | 314 |
| 167 | 3300031995 | Ga0307409_100004647 | Ga0307409_1000046476 | 314 |
| 168 | 3300037312 | Ga0395899_0010984 | Ga0395899_0010984_4180_5151 | 314 |
| 169 | 3300037418 | Ga0395900_0016026 | Ga0395900_0016026_2344_3315 | 314 |
| 170 | 3300037466 | Ga0395898_0007983 | Ga0395898_0007983_1617_2588 | 314 |
| 171 | 3300037466 | Ga0395898_0014617 | Ga0395898_0014617_6757_7704 | 314 |
| 172 | 3300037471 | Ga0395905_0012385 | Ga0395905_0012385_4564_5535 | 314 |
| 173 | 3300037471 | Ga0395905_0190965 | Ga0395905_0190965_595_1542 | 314 |
| 174 | 3300038443 | Ga0395901_0096591 | Ga0395901_0096591_757_1728 | 314 |
| 175 | 3300038443 | Ga0395901_0276826 | Ga0395901_0276826_238_1197 | 314 |
| 176 | 3300038443 | Ga0395901_0384568 | Ga0395901_0384568_107_1075 | 314 |
| 177 | 3300038443 | Ga0395901_0542399 | Ga0395901_0542399_174_1133 | 314 |
| 178 | 3300044694 | Ga0466963_0002661 | Ga0466963_0002661_7864_8823 | 314 |
| 179 | 3300044706 | Ga0466964_0160107 | Ga0466964_0160107_34_993 | 314 |
| 180 | 3300044842 | Ga0466957_0026090 | Ga0466957_0026090_1883_2842 | 314 |
| 181 | 3300045836 | Ga0466958_0002438 | Ga0466958_0002438_6136_7095 | 314 |
| 182 | 3300045836 | Ga0466958_0144025 | Ga0466958_0144025_110_1069 | 314 |
| 183 | 3300045976 | Ga0466967_0020072 | Ga0466967_0020072_1026_1985 | 314 |
| 184 | 3300045976 | Ga0466967_0529255 | Ga0466967_0529255_107_1066 | 314 |
| 185 | 3300048911 | Ga0496108_0036768 | Ga0496108_0036768_2950_3903 | 314 |
| 186 | 3300048914 | Ga0496111_0317497 | Ga0496111_0317497_71_1036 | 314 |
| 187 | 3300048915 | Ga0496112_0096921 | Ga0496112_0096921_719_1672 | 314 |
| 188 | 3300048918 | Ga0496115_0163241 | Ga0496115_0163241_679_1644 | 314 |
| 189 | 3300049568 | Ga0501031_0073683 | Ga0501031_0073683_374_1330 | 314 |
| 190 | 3300049569 | Ga0501032_0024565 | Ga0501032_0024565_1786_2742 | 314 |
| 191 | 3300049569 | Ga0501032_0086245 | Ga0501032_0086245_750_1706 | 314 |
| 192 | 3300049570 | Ga0501033_0002326 | Ga0501033_0002326_1192_2148 | 314 |
| 193 | 3300049572 | Ga0501036_0000096 | Ga0501036_0000096_36833_37789 | 314 |
| 194 | 3300049572 | Ga0501036_0064391 | Ga0501036_0064391_1387_2343 | 314 |
| 195 | 3300049573 | Ga0501037_0081213 | Ga0501037_0081213_765_1721 | 314 |
| 196 | 3300049574 | Ga0501038_0000791 | Ga0501038_0000791_16338_17294 | 314 |
| 197 | 3300049575 | Ga0501039_0003249 | Ga0501039_0003249_10315_11271 | 314 |
| 198 | 3300049575 | Ga0501039_0029527 | Ga0501039_0029527_2397_3353 | 314 |
| 199 | 3300049576 | Ga0501040_0000395 | Ga0501040_0000395_22808_23764 | 314 |
| 200 | 3300049576 | Ga0501040_0017103 | Ga0501040_0017103_3266_4222 | 314 |
| 201 | 3300049577 | Ga0501041_0001593 | Ga0501041_0001593_10756_11712 | 314 |
| 202 | 3300049577 | Ga0501041_0002445 | Ga0501041_0002445_1616_2578 | 314 |
| 203 | 3300049577 | Ga0501041_0014764 | Ga0501041_0014764_1757_2713 | 314 |
| 204 | 3300049578 | Ga0501042_0002787 | Ga0501042_0002787_8623_9579 | 314 |
| 205 | 3300049578 | Ga0501042_0025723 | Ga0501042_0025723_1719_2681 | 314 |
| 206 | 3300049578 | Ga0501042_0138037 | Ga0501042_0138037_182_1138 | 314 |
| 207 | 3300049579 | Ga0501043_0014879 | Ga0501043_0014879_537_1493 | 314 |
| 208 | 3300049579 | Ga0501043_0094055 | Ga0501043_0094055_893_1849 | 314 |
| 209 | 3300049580 | Ga0501046_0000200 | Ga0501046_0000200_32018_32974 | 314 |
| 210 | 3300049580 | Ga0501046_0012485 | Ga0501046_0012485_3769_4725 | 314 |
| 211 | 3300049582 | Ga0501048_0000761 | Ga0501048_0000761_1228_2184 | 314 |
| 212 | 3300049584 | Ga0501068_0050188 | Ga0501068_0050188_602_1558 | 314 |
| 213 | 3300049584 | Ga0501068_0105765 | Ga0501068_0105765_482_1438 | 314 |
| 214 | 3300049586 | Ga0501070_0042475 | Ga0501070_0042475_1181_2137 | 314 |
| 215 | 3300049587 | Ga0501071_0044429 | Ga0501071_0044429_1341_2297 | 314 |
| 216 | 3300049588 | Ga0501072_0000765 | Ga0501072_0000765_11803_12759 | 314 |
| 217 | 3300049588 | Ga0501072_0009119 | Ga0501072_0009119_4119_5075 | 314 |
| 218 | 3300049588 | Ga0501072_0076622 | Ga0501072_0076622_83_1045 | 314 |
| 219 | 3300049590 | Ga0501074_0003684 | Ga0501074_0003684_6750_7706 | 314 |
| 220 | 3300049591 | Ga0501075_0002417 | Ga0501075_0002417_10319_11275 | 314 |
| 221 | 3300049591 | Ga0501075_0004855 | Ga0501075_0004855_3384_4340 | 314 |
| 222 | 3300049592 | Ga0501076_0003566 | Ga0501076_0003566_2725_3681 | 314 |
| 223 | 3300049592 | Ga0501076_0033591 | Ga0501076_0033591_1238_2194 | 314 |
| 224 | 3300049593 | Ga0501077_0001853 | Ga0501077_0001853_1182_2138 | 314 |
| 225 | 3300049593 | Ga0501077_0124863 | Ga0501077_0124863_659_1615 | 314 |
| 226 | 3300049741 | Ga0501079_0003631 | Ga0501079_0003631_7455_8411 | 314 |
| 227 | 3300049741 | Ga0501079_0003781 | Ga0501079_0003781_8254_9210 | 314 |
| 228 | 3300049742 | Ga0501080_0310028 | Ga0501080_0310028_387_1343 | 314 |
| 229 | 3300049743 | Ga0501081_0001882 | Ga0501081_0001882_1368_2324 | 314 |
| 230 | 3300049743 | Ga0501081_0004640 | Ga0501081_0004640_5722_6678 | 314 |
| 231 | 3300049824 | Ga0501045_0000087 | Ga0501045_0000087_32116_33072 | 314 |
| 232 | 3300049824 | Ga0501045_0008851 | Ga0501045_0008851_2558_3514 | 314 |
| 233 | 3300054114 | Ga0501084_0003415 | Ga0501084_0003415_10684_11640 | 314 |
| 234 | 3300054114 | Ga0501084_0016140 | Ga0501084_0016140_2597_3553 | 314 |
| 235 | 3300060353 | Ga0501082_0003997 | Ga0501082_0003997_10774_11730 | 314 |
| 236 | 3300060353 | Ga0501082_0022598 | Ga0501082_0022598_2553_3509 | 314 |
| 237 | 3300061734 | Ga0530510_0000522 | Ga0530510_0000522_12919_13875 | 314 |
| 238 | 3300061734 | Ga0530510_0027514 | Ga0530510_0027514_1178_2134 | 314 |
| 239 | 3300025912 | Ga0207707_10013783 | Ga0207707_100137832 | 315 |
| 240 | 3300027671 | Ga0209588_1000287 | Ga0209588_10002872 | 316 |
| 241 | 3300048909 | Ga0496106_0008984 | Ga0496106_0008984_2791_3774 | 317 |
| 242 | 3300014325 | Ga0163163_10044532 | Ga0163163_100445324 | 318 |
| 243 | 3300014497 | Ga0182008_10097795 | Ga0182008_100977952 | 318 |
| 244 | 3300049576 | Ga0501040_0119821 | Ga0501040_0119821_634_1602 | 318 |
| 245 | 3300049741 | Ga0501079_0143401 | Ga0501079_0143401_816_1784 | 318 |
| 246 | 3300060353 | Ga0501082_0253963 | Ga0501082_0253963_257_1225 | 318 |
| 247 | 3300003203 | JGI25406J46586_10000020 | JGI25406J46586_1000002037 | 320 |
| 248 | 3300005530 | Ga0070679_100144124 | Ga0070679_1001441242 | 320 |
| 249 | 3300005985 | Ga0081539_10000052 | Ga0081539_1000005250 | 320 |
| 250 | 3300021384 | Ga0213876_10000412 | Ga0213876_100004121 | 320 |
| 251 | 3300025921 | Ga0207652_10017772 | Ga0207652_100177723 | 320 |
| 252 | 3300026116 | Ga0207674_10068794 | Ga0207674_100687943 | 320 |
| 253 | 3300027378 | Ga0209981_1001073 | Ga0209981_10010734 | 320 |
| 254 | 3300027543 | Ga0209999_1006589 | Ga0209999_10065893 | 320 |
| 255 | 3300031548 | Ga0307408_100110709 | Ga0307408_1001107092 | 320 |
| 256 | 3300031731 | Ga0307405_10003454 | Ga0307405_100034547 | 320 |
| 257 | 3300031852 | Ga0307410_10155457 | Ga0307410_101554572 | 320 |
| 258 | 3300031995 | Ga0307409_100042389 | Ga0307409_1000423894 | 320 |
| 259 | 3300032002 | Ga0307416_100000623 | Ga0307416_1000006237 | 320 |
| 260 | 3300032126 | Ga0307415_100000256 | Ga0307415_10000025610 | 320 |
| 261 | 3300035695 | Ga0373927_0072921 | Ga0373927_0072921_1097_2071 | 320 |
| 262 | 3300037853 | Ga0436364_0682637 | Ga0436364_0682637_416_1432 | 320 |
| 263 | 3300039437 | Ga0436365_0520124 | Ga0436365_0520124_36501_37490 | 320 |
| 264 | 3300041410 | Ga0439461_0014960 | Ga0439461_0014960_375_1340 | 320 |
| 265 | 3300042435 | Ga0439434_0021801 | Ga0439434_0021801_582_1547 | 320 |
| 266 | 3300042436 | Ga0439435_0017169 | Ga0439435_0017169_201_1166 | 320 |
| 267 | 3300048916 | Ga0496113_0406620 | Ga0496113_0406620_10_1023 | 320 |
| 268 | 3300050514 | nmdc:mga08x19_44420_c1 | nmdc:mga08x19_44420_c1_1186_2187 | 320 |
| 269 | 3300005445 | Ga0070708_100052038 | Ga0070708_1000520383 | 321 |
| 270 | 3300006871 | Ga0075434_100177238 | Ga0075434_1001772382 | 321 |
| 271 | 3300007265 | Ga0099794_10000326 | Ga0099794_1000032614 | 321 |
| 272 | 3300009147 | Ga0114129_10062912 | Ga0114129_100629127 | 321 |
| 273 | 3300035691 | Ga0373931_0227959 | Ga0373931_0227959_52_1029 | 321 |
| 274 | 3300049583 | Ga0501067_0083589 | Ga0501067_0083589_343_1317 | 321 |
| 275 | 3300049742 | Ga0501080_0001492 | Ga0501080_0001492_15339_16313 | 321 |
| 276 | 3300049744 | Ga0501083_0034378 | Ga0501083_0034378_2077_3051 | 321 |
| 277 | 3300050507 | nmdc:mga05p37_85120_c1 | nmdc:mga05p37_85120_c1_864_1841 | 321 |
| 278 | 3300050508 | nmdc:mga09592_86629_c1 | nmdc:mga09592_86629_c1_772_1749 | 321 |
| 279 | 3300050512 | nmdc:mga0n895_78149_c1 | nmdc:mga0n895_78149_c1_522_1499 | 321 |
| 280 | 3300060353 | Ga0501082_0005812 | Ga0501082_0005812_1180_2154 | 321 |
| 281 | 3300002459 | JGI24751J29686_10004101 | JGI24751J29686_100041014 | 322 |
| 282 | 3300005329 | Ga0070683_100093827 | Ga0070683_1000938271 | 322 |
| 283 | 3300005343 | Ga0070687_100081111 | Ga0070687_1000811112 | 322 |
| 284 | 3300005367 | Ga0070667_100268063 | Ga0070667_1002680631 | 322 |
| 285 | 3300005455 | Ga0070663_100003977 | Ga0070663_1000039772 | 322 |
| 286 | 3300005578 | Ga0068854_100012066 | Ga0068854_1000120664 | 322 |
| 287 | 3300005614 | Ga0068856_100044448 | Ga0068856_1000444486 | 322 |
| 288 | 3300005618 | Ga0068864_100211584 | Ga0068864_1002115842 | 322 |
| 289 | 3300005937 | Ga0081455_10011367 | Ga0081455_100113676 | 322 |
| 290 | 3300005937 | Ga0081455_10083038 | Ga0081455_100830382 | 322 |
| 291 | 3300006173 | Ga0070716_100013085 | Ga0070716_1000130853 | 322 |
| 292 | 3300009093 | Ga0105240_10189937 | Ga0105240_101899372 | 322 |
| 293 | 3300009098 | Ga0105245_10317228 | Ga0105245_103172282 | 322 |
| 294 | 3300009553 | Ga0105249_10050268 | Ga0105249_100502684 | 322 |
| 295 | 3300013296 | Ga0157374_10064162 | Ga0157374_100641622 | 322 |
| 296 | 3300013307 | Ga0157372_10262395 | Ga0157372_102623952 | 322 |
| 297 | 3300014969 | Ga0157376_10020308 | Ga0157376_100203081 | 322 |
| 298 | 3300025898 | Ga0207692_10056960 | Ga0207692_100569602 | 322 |
| 299 | 3300025913 | Ga0207695_10145623 | Ga0207695_101456232 | 322 |
| 300 | 3300025919 | Ga0207657_10114206 | Ga0207657_101142061 | 322 |
| 301 | 3300025928 | Ga0207700_10022334 | Ga0207700_100223342 | 322 |
| 302 | 3300025929 | Ga0207664_10106352 | Ga0207664_101063522 | 322 |
| 303 | 3300025939 | Ga0207665_10040605 | Ga0207665_100406052 | 322 |
| 304 | 3300025961 | Ga0207712_10020467 | Ga0207712_100204672 | 322 |
| 305 | 3300025981 | Ga0207640_10022159 | Ga0207640_100221594 | 322 |
| 306 | 3300025986 | Ga0207658_10259098 | Ga0207658_102590982 | 322 |
| 307 | 3300026023 | Ga0207677_10141141 | Ga0207677_101411413 | 322 |
| 308 | 3300026067 | Ga0207678_10003000 | Ga0207678_100030005 | 322 |
| 309 | 3300026095 | Ga0207676_10034294 | Ga0207676_100342944 | 322 |
| 310 | 3300026116 | Ga0207674_10055760 | Ga0207674_100557604 | 322 |
| 311 | 3300026118 | Ga0207675_100172685 | Ga0207675_1001726852 | 322 |
| 312 | 3300028800 | Ga0265338_10024577 | Ga0265338_100245772 | 322 |
| 313 | 3300031241 | Ga0265325_10019011 | Ga0265325_100190112 | 322 |
| 314 | 3300031595 | Ga0265313_10000044 | Ga0265313_1000004497 | 322 |
| 315 | 3300031711 | Ga0265314_10070148 | Ga0265314_100701484 | 322 |
| 316 | 3300031728 | Ga0316578_10027278 | Ga0316578_100272783 | 322 |
| 317 | 3300035398 | Ga0316574_0098796 | Ga0316574_0098796_21_1028 | 322 |
| 318 | 3300039437 | Ga0436365_1894668 | Ga0436365_1894668_1182_2162 | 322 |
| 319 | 3300046683 | Ga0495658_0065393 | Ga0495658_0065393_159_1148 | 322 |
| 320 | 3300046691 | Ga0495670_0084506 | Ga0495670_0084506_282_1298 | 322 |
| 321 | 3300048903 | Ga0496100_0166718 | Ga0496100_0166718_476_1492 | 322 |
| 322 | 3300048905 | Ga0496102_0018023 | Ga0496102_0018023_472_1488 | 322 |
| 323 | 3300048909 | Ga0496106_0077853 | Ga0496106_0077853_865_1881 | 322 |
| 324 | 3300048911 | Ga0496108_0005751 | Ga0496108_0005751_7696_8712 | 322 |
| 325 | 3300048912 | Ga0496109_0000470 | Ga0496109_0000470_526_1542 | 322 |
| 326 | 3300048913 | Ga0496110_0031531 | Ga0496110_0031531_2591_3607 | 322 |
| 327 | 3300048914 | Ga0496111_0011044 | Ga0496111_0011044_1296_2312 | 322 |
| 328 | 3300048915 | Ga0496112_0032197 | Ga0496112_0032197_1282_2298 | 322 |
| 329 | 3300049570 | Ga0501033_0062885 | Ga0501033_0062885_148_1164 | 322 |
| 330 | 3300049573 | Ga0501037_0229619 | Ga0501037_0229619_244_1260 | 322 |
| 331 | 3300049586 | Ga0501070_0064551 | Ga0501070_0064551_80_1063 | 322 |
| 332 | 3300049586 | Ga0501070_0146565 | Ga0501070_0146565_813_1796 | 322 |
| 333 | 3300049742 | Ga0501080_0136712 | Ga0501080_0136712_137_1120 | 322 |
| 334 | 3300053083 | Ga0495655_0005239 | Ga0495655_0005239_636_1652 | 322 |
| 335 | iso_pu_bacteria | 2513237139 | 2513877744 | 322 |
| 336 | iso_pu_bacteria | 2775507049 | 2776914552 | 322 |
| 337 | iso_pu_bacteria | 2791355123 | 2792750001 | 322 |
| 338 | iso_pu_bacteria | 2903748898 | 2903754608 | 322 |
| 339 | iso_pu_bacteria | 2970540015 | 2970543486 | 322 |
| 340 | 3300001979 | JGI24740J21852_10018015 | JGI24740J21852_100180153 | 323 |
| 341 | 3300003791 | Ga0055530_10000616 | Ga0055530_100006162 | 323 |
| 342 | 3300005290 | Ga0065712_10000972 | Ga0065712_100009725 | 323 |
| 343 | 3300005290 | Ga0065712_10079086 | Ga0065712_100790862 | 323 |
| 344 | 3300005293 | Ga0065715_10090112 | Ga0065715_100901128 | 323 |
| 345 | 3300005327 | Ga0070658_10023375 | Ga0070658_100233754 | 323 |
| 346 | 3300005327 | Ga0070658_10034665 | Ga0070658_100346654 | 323 |
| 347 | 3300005329 | Ga0070683_100004465 | Ga0070683_1000044658 | 323 |
| 348 | 3300005329 | Ga0070683_100028824 | Ga0070683_1000288242 | 323 |
| 349 | 3300005329 | Ga0070683_100118252 | Ga0070683_1001182523 | 323 |
| 350 | 3300005329 | Ga0070683_100134874 | Ga0070683_1001348743 | 323 |
| 351 | 3300005330 | Ga0070690_100096328 | Ga0070690_1000963282 | 323 |
| 352 | 3300005330 | Ga0070690_100109132 | Ga0070690_1001091322 | 323 |
| 353 | 3300005331 | Ga0070670_100229956 | Ga0070670_1002299561 | 323 |
| 354 | 3300005331 | Ga0070670_100331119 | Ga0070670_1003311192 | 323 |
| 355 | 3300005334 | Ga0068869_100276208 | Ga0068869_1002762082 | 323 |
| 356 | 3300005335 | Ga0070666_10078870 | Ga0070666_100788703 | 323 |
| 357 | 3300005335 | Ga0070666_10114204 | Ga0070666_101142041 | 323 |
| 358 | 3300005336 | Ga0070680_100051864 | Ga0070680_1000518643 | 323 |
| 359 | 3300005337 | Ga0070682_100001910 | Ga0070682_1000019103 | 323 |
| 360 | 3300005337 | Ga0070682_100088691 | Ga0070682_1000886912 | 323 |
| 361 | 3300005338 | Ga0068868_100057920 | Ga0068868_1000579203 | 323 |
| 362 | 3300005338 | Ga0068868_100232349 | Ga0068868_1002323492 | 323 |
| 363 | 3300005339 | Ga0070660_100018138 | Ga0070660_1000181383 | 323 |
| 364 | 3300005339 | Ga0070660_100041319 | Ga0070660_1000413193 | 323 |
| 365 | 3300005339 | Ga0070660_100052224 | Ga0070660_1000522242 | 323 |
| 366 | 3300005340 | Ga0070689_100318705 | Ga0070689_1003187051 | 323 |
| 367 | 3300005341 | Ga0070691_10031278 | Ga0070691_100312783 | 323 |
| 368 | 3300005343 | Ga0070687_100016835 | Ga0070687_1000168353 | 323 |
| 369 | 3300005343 | Ga0070687_100077656 | Ga0070687_1000776562 | 323 |
| 370 | 3300005344 | Ga0070661_100001970 | Ga0070661_1000019701 | 323 |
| 371 | 3300005344 | Ga0070661_100133020 | Ga0070661_1001330202 | 323 |
| 372 | 3300005345 | Ga0070692_10006890 | Ga0070692_100068904 | 323 |
| 373 | 3300005345 | Ga0070692_10057793 | Ga0070692_100577932 | 323 |
| 374 | 3300005353 | Ga0070669_100103757 | Ga0070669_1001037572 | 323 |
| 375 | 3300005353 | Ga0070669_100158807 | Ga0070669_1001588072 | 323 |
| 376 | 3300005354 | Ga0070675_100043593 | Ga0070675_1000435933 | 323 |
| 377 | 3300005355 | Ga0070671_100000721 | Ga0070671_1000007215 | 323 |
| 378 | 3300005355 | Ga0070671_100013369 | Ga0070671_1000133692 | 323 |
| 379 | 3300005355 | Ga0070671_100020832 | Ga0070671_1000208327 | 323 |
| 380 | 3300005355 | Ga0070671_100032216 | Ga0070671_1000322165 | 323 |
| 381 | 3300005355 | Ga0070671_100046292 | Ga0070671_1000462924 | 323 |
| 382 | 3300005356 | Ga0070674_100002976 | Ga0070674_1000029765 | 323 |
| 383 | 3300005356 | Ga0070674_100067667 | Ga0070674_1000676672 | 323 |
| 384 | 3300005356 | Ga0070674_100110130 | Ga0070674_1001101302 | 323 |
| 385 | 3300005364 | Ga0070673_100110374 | Ga0070673_1001103742 | 323 |
| 386 | 3300005364 | Ga0070673_100384807 | Ga0070673_1003848071 | 323 |
| 387 | 3300005365 | Ga0070688_100003448 | Ga0070688_1000034485 | 323 |
| 388 | 3300005366 | Ga0070659_100001160 | Ga0070659_10000116010 | 323 |
| 389 | 3300005366 | Ga0070659_100041939 | Ga0070659_1000419392 | 323 |
| 390 | 3300005366 | Ga0070659_100074009 | Ga0070659_1000740094 | 323 |
| 391 | 3300005406 | Ga0070703_10007507 | Ga0070703_100075071 | 323 |
| 392 | 3300005435 | Ga0070714_100215502 | Ga0070714_1002155021 | 323 |
| 393 | 3300005435 | Ga0070714_100317498 | Ga0070714_1003174982 | 323 |
| 394 | 3300005438 | Ga0070701_10002582 | Ga0070701_100025825 | 323 |
| 395 | 3300005438 | Ga0070701_10032141 | Ga0070701_100321413 | 323 |
| 396 | 3300005439 | Ga0070711_100006940 | Ga0070711_1000069404 | 323 |
| 397 | 3300005439 | Ga0070711_100014729 | Ga0070711_1000147293 | 323 |
| 398 | 3300005439 | Ga0070711_100271064 | Ga0070711_1002710641 | 323 |
| 399 | 3300005440 | Ga0070705_100080907 | Ga0070705_1000809071 | 323 |
| 400 | 3300005441 | Ga0070700_100001269 | Ga0070700_1000012691 | 323 |
| 401 | 3300005441 | Ga0070700_100004770 | Ga0070700_1000047704 | 323 |
| 402 | 3300005445 | Ga0070708_100017122 | Ga0070708_1000171225 | 323 |
| 403 | 3300005445 | Ga0070708_100025104 | Ga0070708_1000251042 | 323 |
| 404 | 3300005445 | Ga0070708_100035261 | Ga0070708_1000352612 | 323 |
| 405 | 3300005445 | Ga0070708_100044283 | Ga0070708_1000442832 | 323 |
| 406 | 3300005445 | Ga0070708_100167876 | Ga0070708_1001678762 | 323 |
| 407 | 3300005445 | Ga0070708_100183291 | Ga0070708_1001832912 | 323 |
| 408 | 3300005445 | Ga0070708_100189274 | Ga0070708_1001892742 | 323 |
| 409 | 3300005455 | Ga0070663_100037531 | Ga0070663_1000375311 | 323 |
| 410 | 3300005456 | Ga0070678_100001787 | Ga0070678_10000178711 | 323 |
| 411 | 3300005456 | Ga0070678_100074181 | Ga0070678_1000741813 | 323 |
| 412 | 3300005456 | Ga0070678_100243943 | Ga0070678_1002439432 | 323 |
| 413 | 3300005457 | Ga0070662_100000100 | Ga0070662_10000010047 | 323 |
| 414 | 3300005457 | Ga0070662_100018534 | Ga0070662_1000185344 | 323 |
| 415 | 3300005457 | Ga0070662_100045477 | Ga0070662_1000454773 | 323 |
| 416 | 3300005458 | Ga0070681_10119209 | Ga0070681_101192092 | 323 |
| 417 | 3300005459 | Ga0068867_100017764 | Ga0068867_1000177644 | 323 |
| 418 | 3300005466 | Ga0070685_10038191 | Ga0070685_100381911 | 323 |
| 419 | 3300005467 | Ga0070706_100000012 | Ga0070706_10000001275 | 323 |
| 420 | 3300005467 | Ga0070706_100006380 | Ga0070706_1000063808 | 323 |
| 421 | 3300005467 | Ga0070706_100009989 | Ga0070706_1000099894 | 323 |
| 422 | 3300005467 | Ga0070706_100014995 | Ga0070706_1000149953 | 323 |
| 423 | 3300005467 | Ga0070706_100024717 | Ga0070706_1000247172 | 323 |
| 424 | 3300005467 | Ga0070706_100079433 | Ga0070706_1000794332 | 323 |
| 425 | 3300005467 | Ga0070706_100220454 | Ga0070706_1002204542 | 323 |
| 426 | 3300005468 | Ga0070707_100006597 | Ga0070707_1000065975 | 323 |
| 427 | 3300005468 | Ga0070707_100014120 | Ga0070707_1000141202 | 323 |
| 428 | 3300005468 | Ga0070707_100033073 | Ga0070707_1000330733 | 323 |
| 429 | 3300005468 | Ga0070707_100056212 | Ga0070707_1000562122 | 323 |
| 430 | 3300005468 | Ga0070707_100136307 | Ga0070707_1001363071 | 323 |
| 431 | 3300005468 | Ga0070707_100161725 | Ga0070707_1001617252 | 323 |
| 432 | 3300005468 | Ga0070707_100403267 | Ga0070707_1004032671 | 323 |
| 433 | 3300005471 | Ga0070698_100002676 | Ga0070698_1000026763 | 323 |
| 434 | 3300005471 | Ga0070698_100069064 | Ga0070698_1000690643 | 323 |
| 435 | 3300005518 | Ga0070699_100000027 | Ga0070699_10000002741 | 323 |
| 436 | 3300005518 | Ga0070699_100044292 | Ga0070699_1000442923 | 323 |
| 437 | 3300005518 | Ga0070699_100053187 | Ga0070699_1000531874 | 323 |
| 438 | 3300005518 | Ga0070699_100145489 | Ga0070699_1001454892 | 323 |
| 439 | 3300005518 | Ga0070699_100188321 | Ga0070699_1001883211 | 323 |
| 440 | 3300005530 | Ga0070679_100005694 | Ga0070679_1000056943 | 323 |
| 441 | 3300005530 | Ga0070679_100015999 | Ga0070679_1000159998 | 323 |
| 442 | 3300005530 | Ga0070679_100351872 | Ga0070679_1003518721 | 323 |
| 443 | 3300005535 | Ga0070684_100002710 | Ga0070684_1000027102 | 323 |
| 444 | 3300005535 | Ga0070684_100104688 | Ga0070684_1001046883 | 323 |
| 445 | 3300005535 | Ga0070684_100122981 | Ga0070684_1001229812 | 323 |
| 446 | 3300005536 | Ga0070697_100005109 | Ga0070697_1000051095 | 323 |
| 447 | 3300005536 | Ga0070697_100009361 | Ga0070697_1000093613 | 323 |
| 448 | 3300005536 | Ga0070697_100106410 | Ga0070697_1001064102 | 323 |
| 449 | 3300005536 | Ga0070697_100170445 | Ga0070697_1001704452 | 323 |
| 450 | 3300005536 | Ga0070697_100234974 | Ga0070697_1002349741 | 323 |
| 451 | 3300005536 | Ga0070697_100284637 | Ga0070697_1002846371 | 323 |
| 452 | 3300005539 | Ga0068853_100003192 | Ga0068853_1000031922 | 323 |
| 453 | 3300005539 | Ga0068853_100054701 | Ga0068853_1000547014 | 323 |
| 454 | 3300005539 | Ga0068853_100080731 | Ga0068853_1000807313 | 323 |
| 455 | 3300005543 | Ga0070672_100041432 | Ga0070672_1000414323 | 323 |
| 456 | 3300005543 | Ga0070672_100221061 | Ga0070672_1002210612 | 323 |
| 457 | 3300005544 | Ga0070686_100004327 | Ga0070686_1000043274 | 323 |
| 458 | 3300005545 | Ga0070695_100010513 | Ga0070695_1000105134 | 323 |
| 459 | 3300005546 | Ga0070696_100014405 | Ga0070696_1000144055 | 323 |
| 460 | 3300005546 | Ga0070696_100016003 | Ga0070696_1000160031 | 323 |
| 461 | 3300005548 | Ga0070665_100019259 | Ga0070665_1000192592 | 323 |
| 462 | 3300005548 | Ga0070665_100020556 | Ga0070665_1000205563 | 323 |
| 463 | 3300005549 | Ga0070704_100001841 | Ga0070704_1000018415 | 323 |
| 464 | 3300005549 | Ga0070704_100061791 | Ga0070704_1000617912 | 323 |
| 465 | 3300005563 | Ga0068855_100005251 | Ga0068855_10000525115 | 323 |
| 466 | 3300005563 | Ga0068855_100005342 | Ga0068855_1000053425 | 323 |
| 467 | 3300005563 | Ga0068855_100257178 | Ga0068855_1002571782 | 323 |
| 468 | 3300005563 | Ga0068855_100283357 | Ga0068855_1002833571 | 323 |
| 469 | 3300005563 | Ga0068855_100305527 | Ga0068855_1003055272 | 323 |
| 470 | 3300005563 | Ga0068855_100488794 | Ga0068855_1004887942 | 323 |
| 471 | 3300005564 | Ga0070664_100022826 | Ga0070664_1000228264 | 323 |
| 472 | 3300005564 | Ga0070664_100040904 | Ga0070664_1000409044 | 323 |
| 473 | 3300005564 | Ga0070664_100196287 | Ga0070664_1001962873 | 323 |
| 474 | 3300005564 | Ga0070664_100275820 | Ga0070664_1002758202 | 323 |
| 475 | 3300005577 | Ga0068857_100004812 | Ga0068857_10000481210 | 323 |
| 476 | 3300005577 | Ga0068857_100027959 | Ga0068857_1000279593 | 323 |
| 477 | 3300005577 | Ga0068857_100045962 | Ga0068857_1000459624 | 323 |
| 478 | 3300005614 | Ga0068856_100003147 | Ga0068856_1000031473 | 323 |
| 479 | 3300005614 | Ga0068856_100032450 | Ga0068856_1000324505 | 323 |
| 480 | 3300005614 | Ga0068856_100118775 | Ga0068856_1001187752 | 323 |
| 481 | 3300005614 | Ga0068856_100179136 | Ga0068856_1001791363 | 323 |
| 482 | 3300005615 | Ga0070702_100002363 | Ga0070702_1000023635 | 323 |
| 483 | 3300005616 | Ga0068852_100111522 | Ga0068852_1001115221 | 323 |
| 484 | 3300005617 | Ga0068859_100030934 | Ga0068859_1000309342 | 323 |
| 485 | 3300005618 | Ga0068864_100003858 | Ga0068864_10000385811 | 323 |
| 486 | 3300005718 | Ga0068866_10001230 | Ga0068866_1000123015 | 323 |
| 487 | 3300005719 | Ga0068861_100104510 | Ga0068861_1001045102 | 323 |
| 488 | 3300005841 | Ga0068863_100015479 | Ga0068863_1000154797 | 323 |
| 489 | 3300005842 | Ga0068858_100159240 | Ga0068858_1001592403 | 323 |
| 490 | 3300005843 | Ga0068860_100154840 | Ga0068860_1001548401 | 323 |
| 491 | 3300005937 | Ga0081455_10001493 | Ga0081455_1000149312 | 323 |
| 492 | 3300005937 | Ga0081455_10002866 | Ga0081455_1000286620 | 323 |
| 493 | 3300005937 | Ga0081455_10003938 | Ga0081455_100039382 | 323 |
| 494 | 3300005937 | Ga0081455_10045162 | Ga0081455_100451622 | 323 |
| 495 | 3300005983 | Ga0081540_1000585 | Ga0081540_100058542 | 323 |
| 496 | 3300005983 | Ga0081540_1001783 | Ga0081540_10017833 | 323 |
| 497 | 3300005985 | Ga0081539_10072198 | Ga0081539_100721982 | 323 |
| 498 | 3300006028 | Ga0070717_10008392 | Ga0070717_100083925 | 323 |
| 499 | 3300006163 | Ga0070715_10181148 | Ga0070715_101811481 | 323 |
| 500 | 3300006175 | Ga0070712_100034018 | Ga0070712_1000340182 | 323 |
| 501 | 3300006175 | Ga0070712_100040764 | Ga0070712_1000407643 | 323 |
| 502 | 3300006175 | Ga0070712_100047468 | Ga0070712_1000474683 | 323 |
| 503 | 3300006237 | Ga0097621_100165858 | Ga0097621_1001658582 | 323 |
| 504 | 3300006358 | Ga0068871_100008531 | Ga0068871_1000085314 | 323 |
| 505 | 3300006844 | Ga0075428_100016349 | Ga0075428_1000163492 | 323 |
| 506 | 3300006847 | Ga0075431_100063842 | Ga0075431_1000638424 | 323 |
| 507 | 3300006871 | Ga0075434_100193945 | Ga0075434_1001939453 | 323 |
| 508 | 3300006881 | Ga0068865_100006647 | Ga0068865_1000066475 | 323 |
| 509 | 3300006914 | Ga0075436_100152805 | Ga0075436_1001528052 | 323 |
| 510 | 3300006931 | Ga0097620_100030934 | Ga0097620_1000309343 | 323 |
| 511 | 3300007076 | Ga0075435_100152481 | Ga0075435_1001524813 | 323 |
| 512 | 3300009093 | Ga0105240_10003453 | Ga0105240_1000345327 | 323 |
| 513 | 3300009093 | Ga0105240_10005589 | Ga0105240_1000558911 | 323 |
| 514 | 3300009093 | Ga0105240_10021548 | Ga0105240_100215485 | 323 |
| 515 | 3300009093 | Ga0105240_10179685 | Ga0105240_101796852 | 323 |
| 516 | 3300009093 | Ga0105240_10302017 | Ga0105240_103020172 | 323 |
| 517 | 3300009098 | Ga0105245_10030311 | Ga0105245_100303114 | 323 |
| 518 | 3300009098 | Ga0105245_10033847 | Ga0105245_100338472 | 323 |
| 519 | 3300009101 | Ga0105247_10031929 | Ga0105247_100319295 | 323 |
| 520 | 3300009147 | Ga0114129_10004027 | Ga0114129_1000402711 | 323 |
| 521 | 3300009147 | Ga0114129_10104050 | Ga0114129_101040506 | 323 |
| 522 | 3300009147 | Ga0114129_10228476 | Ga0114129_102284763 | 323 |
| 523 | 3300009148 | Ga0105243_10015705 | Ga0105243_100157054 | 323 |
| 524 | 3300009148 | Ga0105243_10096694 | Ga0105243_100966941 | 323 |
| 525 | 3300009174 | Ga0105241_10189001 | Ga0105241_101890012 | 323 |
| 526 | 3300009176 | Ga0105242_10002478 | Ga0105242_1000247810 | 323 |
| 527 | 3300009177 | Ga0105248_10000678 | Ga0105248_100006783 | 323 |
| 528 | 3300009177 | Ga0105248_10009353 | Ga0105248_1000935315 | 323 |
| 529 | 3300009177 | Ga0105248_10026767 | Ga0105248_100267677 | 323 |
| 530 | 3300009177 | Ga0105248_10070017 | Ga0105248_100700175 | 323 |
| 531 | 3300009177 | Ga0105248_10126579 | Ga0105248_101265792 | 323 |
| 532 | 3300009545 | Ga0105237_10031477 | Ga0105237_100314773 | 323 |
| 533 | 3300009545 | Ga0105237_10236066 | Ga0105237_102360661 | 323 |
| 534 | 3300009545 | Ga0105237_10258997 | Ga0105237_102589972 | 323 |
| 535 | 3300009551 | Ga0105238_10049920 | Ga0105238_100499205 | 323 |
| 536 | 3300009553 | Ga0105249_10027834 | Ga0105249_100278345 | 323 |
| 537 | 3300010375 | Ga0105239_10007473 | Ga0105239_100074739 | 323 |
| 538 | 3300010375 | Ga0105239_10020777 | Ga0105239_100207772 | 323 |
| 539 | 3300010375 | Ga0105239_10104541 | Ga0105239_101045413 | 323 |
| 540 | 3300010375 | Ga0105239_10451819 | Ga0105239_104518191 | 323 |
| 541 | 3300010375 | Ga0105239_10590234 | Ga0105239_105902342 | 323 |
| 542 | 3300013100 | Ga0157373_10007561 | Ga0157373_1000756110 | 323 |
| 543 | 3300013100 | Ga0157373_10011891 | Ga0157373_100118916 | 323 |
| 544 | 3300013100 | Ga0157373_10068938 | Ga0157373_100689382 | 323 |
| 545 | 3300013102 | Ga0157371_10000519 | Ga0157371_100005194 | 323 |
| 546 | 3300013102 | Ga0157371_10059902 | Ga0157371_100599022 | 323 |
| 547 | 3300013104 | Ga0157370_10007274 | Ga0157370_1000727414 | 323 |
| 548 | 3300013104 | Ga0157370_10007847 | Ga0157370_1000784712 | 323 |
| 549 | 3300013104 | Ga0157370_10060465 | Ga0157370_100604652 | 323 |
| 550 | 3300013105 | Ga0157369_10000446 | Ga0157369_1000044647 | 323 |
| 551 | 3300013105 | Ga0157369_10036941 | Ga0157369_100369415 | 323 |
| 552 | 3300013105 | Ga0157369_10070248 | Ga0157369_100702483 | 323 |
| 553 | 3300013296 | Ga0157374_10005832 | Ga0157374_100058326 | 323 |
| 554 | 3300013296 | Ga0157374_10006763 | Ga0157374_100067632 | 323 |
| 555 | 3300013296 | Ga0157374_10109303 | Ga0157374_101093032 | 323 |
| 556 | 3300013296 | Ga0157374_10189179 | Ga0157374_101891792 | 323 |
| 557 | 3300013297 | Ga0157378_10001394 | Ga0157378_100013947 | 323 |
| 558 | 3300013297 | Ga0157378_10016784 | Ga0157378_100167846 | 323 |
| 559 | 3300013297 | Ga0157378_10035108 | Ga0157378_100351083 | 323 |
| 560 | 3300013297 | Ga0157378_10262048 | Ga0157378_102620482 | 323 |
| 561 | 3300013306 | Ga0163162_10002009 | Ga0163162_1000200911 | 323 |
| 562 | 3300013307 | Ga0157372_10012255 | Ga0157372_1001225510 | 323 |
| 563 | 3300013307 | Ga0157372_10123775 | Ga0157372_101237751 | 323 |
| 564 | 3300013308 | Ga0157375_10197358 | Ga0157375_101973583 | 323 |
| 565 | 3300013308 | Ga0157375_10508447 | Ga0157375_105084471 | 323 |
| 566 | 3300014326 | Ga0157380_10081078 | Ga0157380_100810783 | 323 |
| 567 | 3300014326 | Ga0157380_10409641 | Ga0157380_104096412 | 323 |
| 568 | 3300014969 | Ga0157376_10002533 | Ga0157376_100025338 | 323 |
| 569 | 3300021388 | Ga0213875_10000007 | Ga0213875_10000007495 | 323 |
| 570 | 3300024225 | Ga0224572_1010860 | Ga0224572_10108602 | 323 |
| 571 | 3300025302 | Ga0207426_1024319 | Ga0207426_10243193 | 323 |
| 572 | 3300025321 | Ga0207656_10068084 | Ga0207656_100680842 | 323 |
| 573 | 3300025885 | Ga0207653_10004551 | Ga0207653_100045512 | 323 |
| 574 | 3300025899 | Ga0207642_10001203 | Ga0207642_100012036 | 323 |
| 575 | 3300025900 | Ga0207710_10043175 | Ga0207710_100431752 | 323 |
| 576 | 3300025901 | Ga0207688_10030810 | Ga0207688_100308103 | 323 |
| 577 | 3300025903 | Ga0207680_10116532 | Ga0207680_101165322 | 323 |
| 578 | 3300025903 | Ga0207680_10125030 | Ga0207680_101250302 | 323 |
| 579 | 3300025903 | Ga0207680_10278301 | Ga0207680_102783011 | 323 |
| 580 | 3300025904 | Ga0207647_10003843 | Ga0207647_100038437 | 323 |
| 581 | 3300025904 | Ga0207647_10028865 | Ga0207647_100288653 | 323 |
| 582 | 3300025906 | Ga0207699_10272933 | Ga0207699_102729331 | 323 |
| 583 | 3300025907 | Ga0207645_10007535 | Ga0207645_100075357 | 323 |
| 584 | 3300025909 | Ga0207705_10013584 | Ga0207705_100135846 | 323 |
| 585 | 3300025909 | Ga0207705_10023953 | Ga0207705_100239535 | 323 |
| 586 | 3300025910 | Ga0207684_10000028 | Ga0207684_10000028202 | 323 |
| 587 | 3300025910 | Ga0207684_10004597 | Ga0207684_100045979 | 323 |
| 588 | 3300025910 | Ga0207684_10005982 | Ga0207684_100059829 | 323 |
| 589 | 3300025910 | Ga0207684_10007109 | Ga0207684_100071092 | 323 |
| 590 | 3300025910 | Ga0207684_10019108 | Ga0207684_100191082 | 323 |
| 591 | 3300025910 | Ga0207684_10021323 | Ga0207684_100213232 | 323 |
| 592 | 3300025910 | Ga0207684_10067231 | Ga0207684_100672313 | 323 |
| 593 | 3300025910 | Ga0207684_10099636 | Ga0207684_100996362 | 323 |
| 594 | 3300025912 | Ga0207707_10004133 | Ga0207707_1000413311 | 323 |
| 595 | 3300025912 | Ga0207707_10142118 | Ga0207707_101421181 | 323 |
| 596 | 3300025912 | Ga0207707_10187540 | Ga0207707_101875403 | 323 |
| 597 | 3300025913 | Ga0207695_10041027 | Ga0207695_100410273 | 323 |
| 598 | 3300025913 | Ga0207695_10082248 | Ga0207695_100822483 | 323 |
| 599 | 3300025913 | Ga0207695_10137527 | Ga0207695_101375272 | 323 |
| 600 | 3300025913 | Ga0207695_10388196 | Ga0207695_103881961 | 323 |
| 601 | 3300025914 | Ga0207671_10019228 | Ga0207671_100192283 | 323 |
| 602 | 3300025914 | Ga0207671_10356497 | Ga0207671_103564971 | 323 |
| 603 | 3300025915 | Ga0207693_10037971 | Ga0207693_100379713 | 323 |
| 604 | 3300025915 | Ga0207693_10043720 | Ga0207693_100437203 | 323 |
| 605 | 3300025916 | Ga0207663_10019692 | Ga0207663_100196924 | 323 |
| 606 | 3300025916 | Ga0207663_10153594 | Ga0207663_101535941 | 323 |
| 607 | 3300025916 | Ga0207663_10198662 | Ga0207663_101986622 | 323 |
| 608 | 3300025917 | Ga0207660_10009213 | Ga0207660_100092133 | 323 |
| 609 | 3300025917 | Ga0207660_10035529 | Ga0207660_100355295 | 323 |
| 610 | 3300025917 | Ga0207660_10165683 | Ga0207660_101656832 | 323 |
| 611 | 3300025918 | Ga0207662_10067724 | Ga0207662_100677242 | 323 |
| 612 | 3300025918 | Ga0207662_10101803 | Ga0207662_101018032 | 323 |
| 613 | 3300025919 | Ga0207657_10000420 | Ga0207657_1000042015 | 323 |
| 614 | 3300025919 | Ga0207657_10003570 | Ga0207657_1000357013 | 323 |
| 615 | 3300025919 | Ga0207657_10022872 | Ga0207657_100228725 | 323 |
| 616 | 3300025919 | Ga0207657_10027113 | Ga0207657_100271134 | 323 |
| 617 | 3300025919 | Ga0207657_10027978 | Ga0207657_100279784 | 323 |
| 618 | 3300025920 | Ga0207649_10002746 | Ga0207649_100027463 | 323 |
| 619 | 3300025920 | Ga0207649_10175789 | Ga0207649_101757892 | 323 |
| 620 | 3300025921 | Ga0207652_10007755 | Ga0207652_1000775510 | 323 |
| 621 | 3300025922 | Ga0207646_10020654 | Ga0207646_100206543 | 323 |
| 622 | 3300025922 | Ga0207646_10022826 | Ga0207646_100228261 | 323 |
| 623 | 3300025922 | Ga0207646_10046252 | Ga0207646_100462522 | 323 |
| 624 | 3300025922 | Ga0207646_10124745 | Ga0207646_101247451 | 323 |
| 625 | 3300025922 | Ga0207646_10343735 | Ga0207646_103437352 | 323 |
| 626 | 3300025924 | Ga0207694_10012057 | Ga0207694_100120575 | 323 |
| 627 | 3300025926 | Ga0207659_10116169 | Ga0207659_101161691 | 323 |
| 628 | 3300025927 | Ga0207687_10035887 | Ga0207687_100358873 | 323 |
| 629 | 3300025927 | Ga0207687_10070667 | Ga0207687_100706672 | 323 |
| 630 | 3300025928 | Ga0207700_10446364 | Ga0207700_104463641 | 323 |
| 631 | 3300025929 | Ga0207664_10424914 | Ga0207664_104249141 | 323 |
| 632 | 3300025931 | Ga0207644_10055646 | Ga0207644_100556464 | 323 |
| 633 | 3300025931 | Ga0207644_10069404 | Ga0207644_100694043 | 323 |
| 634 | 3300025931 | Ga0207644_10083858 | Ga0207644_100838583 | 323 |
| 635 | 3300025932 | Ga0207690_10000043 | Ga0207690_1000004321 | 323 |
| 636 | 3300025932 | Ga0207690_10024907 | Ga0207690_100249074 | 323 |
| 637 | 3300025932 | Ga0207690_10032999 | Ga0207690_100329992 | 323 |
| 638 | 3300025932 | Ga0207690_10091256 | Ga0207690_100912562 | 323 |
| 639 | 3300025933 | Ga0207706_10002041 | Ga0207706_1000204115 | 323 |
| 640 | 3300025933 | Ga0207706_10032471 | Ga0207706_100324713 | 323 |
| 641 | 3300025933 | Ga0207706_10140416 | Ga0207706_101404162 | 323 |
| 642 | 3300025934 | Ga0207686_10002827 | Ga0207686_100028274 | 323 |
| 643 | 3300025935 | Ga0207709_10002160 | Ga0207709_100021605 | 323 |
| 644 | 3300025936 | Ga0207670_10060833 | Ga0207670_100608333 | 323 |
| 645 | 3300025937 | Ga0207669_10002299 | Ga0207669_100022995 | 323 |
| 646 | 3300025937 | Ga0207669_10074887 | Ga0207669_100748873 | 323 |
| 647 | 3300025937 | Ga0207669_10110976 | Ga0207669_101109763 | 323 |
| 648 | 3300025938 | Ga0207704_10022889 | Ga0207704_100228894 | 323 |
| 649 | 3300025939 | Ga0207665_10276793 | Ga0207665_102767932 | 323 |
| 650 | 3300025941 | Ga0207711_10000762 | Ga0207711_1000076215 | 323 |
| 651 | 3300025941 | Ga0207711_10020386 | Ga0207711_100203869 | 323 |
| 652 | 3300025941 | Ga0207711_10191464 | Ga0207711_101914642 | 323 |
| 653 | 3300025942 | Ga0207689_10049102 | Ga0207689_100491023 | 323 |
| 654 | 3300025944 | Ga0207661_10049429 | Ga0207661_100494293 | 323 |
| 655 | 3300025944 | Ga0207661_10060499 | Ga0207661_100604993 | 323 |
| 656 | 3300025944 | Ga0207661_10079270 | Ga0207661_100792702 | 323 |
| 657 | 3300025944 | Ga0207661_10097021 | Ga0207661_100970212 | 323 |
| 658 | 3300025945 | Ga0207679_10012735 | Ga0207679_100127354 | 323 |
| 659 | 3300025945 | Ga0207679_10199796 | Ga0207679_101997962 | 323 |
| 660 | 3300025945 | Ga0207679_10487482 | Ga0207679_104874821 | 323 |
| 661 | 3300025949 | Ga0207667_10002233 | Ga0207667_1000223315 | 323 |
| 662 | 3300025949 | Ga0207667_10010740 | Ga0207667_100107405 | 323 |
| 663 | 3300025949 | Ga0207667_10028104 | Ga0207667_100281044 | 323 |
| 664 | 3300025949 | Ga0207667_10044182 | Ga0207667_100441825 | 323 |
| 665 | 3300025949 | Ga0207667_10079623 | Ga0207667_100796232 | 323 |
| 666 | 3300025949 | Ga0207667_10097935 | Ga0207667_100979353 | 323 |
| 667 | 3300025949 | Ga0207667_10182149 | Ga0207667_101821492 | 323 |
| 668 | 3300025949 | Ga0207667_10514159 | Ga0207667_105141591 | 323 |
| 669 | 3300025960 | Ga0207651_10098023 | Ga0207651_100980232 | 323 |
| 670 | 3300025960 | Ga0207651_10192470 | Ga0207651_101924702 | 323 |
| 671 | 3300025961 | Ga0207712_10022707 | Ga0207712_100227075 | 323 |
| 672 | 3300025972 | Ga0207668_10129137 | Ga0207668_101291371 | 323 |
| 673 | 3300025981 | Ga0207640_10015620 | Ga0207640_100156203 | 323 |
| 674 | 3300025986 | Ga0207658_10038578 | Ga0207658_100385782 | 323 |
| 675 | 3300026023 | Ga0207677_10026863 | Ga0207677_100268631 | 323 |
| 676 | 3300026035 | Ga0207703_10077754 | Ga0207703_100777542 | 323 |
| 677 | 3300026035 | Ga0207703_10095494 | Ga0207703_100954942 | 323 |
| 678 | 3300026041 | Ga0207639_10002164 | Ga0207639_1000216415 | 323 |
| 679 | 3300026041 | Ga0207639_10019890 | Ga0207639_100198905 | 323 |
| 680 | 3300026041 | Ga0207639_10085664 | Ga0207639_100856642 | 323 |
| 681 | 3300026041 | Ga0207639_10208441 | Ga0207639_102084412 | 323 |
| 682 | 3300026075 | Ga0207708_10000321 | Ga0207708_1000032117 | 323 |
| 683 | 3300026078 | Ga0207702_10005057 | Ga0207702_100050573 | 323 |
| 684 | 3300026078 | Ga0207702_10019131 | Ga0207702_100191314 | 323 |
| 685 | 3300026078 | Ga0207702_10056522 | Ga0207702_100565223 | 323 |
| 686 | 3300026078 | Ga0207702_10103461 | Ga0207702_101034612 | 323 |
| 687 | 3300026088 | Ga0207641_10060610 | Ga0207641_100606102 | 323 |
| 688 | 3300026088 | Ga0207641_10113230 | Ga0207641_101132301 | 323 |
| 689 | 3300026089 | Ga0207648_10000214 | Ga0207648_1000021438 | 323 |
| 690 | 3300026089 | Ga0207648_10148162 | Ga0207648_101481623 | 323 |
| 691 | 3300026095 | Ga0207676_10003644 | Ga0207676_100036447 | 323 |
| 692 | 3300026116 | Ga0207674_10002976 | Ga0207674_100029769 | 323 |
| 693 | 3300026116 | Ga0207674_10014624 | Ga0207674_100146245 | 323 |
| 694 | 3300026116 | Ga0207674_10049444 | Ga0207674_100494443 | 323 |
| 695 | 3300026116 | Ga0207674_10224347 | Ga0207674_102243472 | 323 |
| 696 | 3300026118 | Ga0207675_100123393 | Ga0207675_1001233932 | 323 |
| 697 | 3300026118 | Ga0207675_100149024 | Ga0207675_1001490241 | 323 |
| 698 | 3300026121 | Ga0207683_10003051 | Ga0207683_100030519 | 323 |
| 699 | 3300026121 | Ga0207683_10059808 | Ga0207683_100598083 | 323 |
| 700 | 3300026121 | Ga0207683_10128929 | Ga0207683_101289292 | 323 |
| 701 | 3300026142 | Ga0207698_10002617 | Ga0207698_100026177 | 323 |
| 702 | 3300026142 | Ga0207698_10043170 | Ga0207698_100431704 | 323 |
| 703 | 3300026142 | Ga0207698_10170483 | Ga0207698_101704832 | 323 |
| 704 | 3300026142 | Ga0207698_10306357 | Ga0207698_103063572 | 323 |
| 705 | 3300027907 | Ga0207428_10050740 | Ga0207428_100507403 | 323 |
| 706 | 3300028379 | Ga0268266_10021111 | Ga0268266_100211113 | 323 |
| 707 | 3300028381 | Ga0268264_10036627 | Ga0268264_100366273 | 323 |
| 708 | 3300028381 | Ga0268264_10046483 | Ga0268264_100464833 | 323 |
| 709 | 3300028794 | Ga0307515_10128015 | Ga0307515_101280153 | 323 |
| 710 | 3300028800 | Ga0265338_10019630 | Ga0265338_100196304 | 323 |
| 711 | 3300031238 | Ga0265332_10003415 | Ga0265332_100034156 | 323 |
| 712 | 3300031240 | Ga0265320_10003891 | Ga0265320_100038919 | 323 |
| 713 | 3300031242 | Ga0265329_10005833 | Ga0265329_100058332 | 323 |
| 714 | 3300031247 | Ga0265340_10018468 | Ga0265340_100184682 | 323 |
| 715 | 3300031249 | Ga0265339_10016294 | Ga0265339_100162942 | 323 |
| 716 | 3300031250 | Ga0265331_10008726 | Ga0265331_100087264 | 323 |
| 717 | 3300031251 | Ga0265327_10000384 | Ga0265327_1000038413 | 323 |
| 718 | 3300031344 | Ga0265316_10002294 | Ga0265316_100022941 | 323 |
| 719 | 3300031344 | Ga0265316_10007923 | Ga0265316_100079236 | 323 |
| 720 | 3300031595 | Ga0265313_10012835 | Ga0265313_100128353 | 323 |
| 721 | 3300031711 | Ga0265314_10003142 | Ga0265314_100031429 | 323 |
| 722 | 3300031711 | Ga0265314_10034195 | Ga0265314_100341953 | 323 |
| 723 | 3300031727 | Ga0316576_10016157 | Ga0316576_100161575 | 323 |
| 724 | 3300031903 | Ga0307407_10016068 | Ga0307407_100160681 | 323 |
| 725 | 3300031903 | Ga0307407_10033881 | Ga0307407_100338812 | 323 |
| 726 | 3300031995 | Ga0307409_100011526 | Ga0307409_1000115263 | 323 |
| 727 | 3300031995 | Ga0307409_100027326 | Ga0307409_1000273262 | 323 |
| 728 | 3300032002 | Ga0307416_100013464 | Ga0307416_1000134642 | 323 |
| 729 | 3300032002 | Ga0307416_100017520 | Ga0307416_1000175203 | 323 |
| 730 | 3300032004 | Ga0307414_10013692 | Ga0307414_100136922 | 323 |
| 731 | 3300032004 | Ga0307414_10015850 | Ga0307414_100158505 | 323 |
| 732 | 3300032126 | Ga0307415_100006916 | Ga0307415_1000069163 | 323 |
| 733 | 3300032126 | Ga0307415_100077036 | Ga0307415_1000770362 | 323 |
| 734 | 3300032126 | Ga0307415_100100564 | Ga0307415_1001005642 | 323 |
| 735 | 3300032133 | Ga0316583_10017380 | Ga0316583_100173802 | 323 |
| 736 | 3300035085 | Ga0373929_0004162 | Ga0373929_0004162_240_1223 | 323 |
| 737 | 3300035111 | Ga0373923_0002168 | Ga0373923_0002168_4412_5407 | 323 |
| 738 | 3300035118 | Ga0373954_0120648 | Ga0373954_0120648_168_1142 | 323 |
| 739 | 3300035170 | Ga0373943_0049256 | Ga0373943_0049256_619_1617 | 323 |
| 740 | 3300035241 | Ga0373961_0004269 | Ga0373961_0004269_350_1333 | 323 |
| 741 | 3300035691 | Ga0373931_0022373 | Ga0373931_0022373_1901_2884 | 323 |
| 742 | 3300035691 | Ga0373931_0025681 | Ga0373931_0025681_345_1337 | 323 |
| 743 | 3300035691 | Ga0373931_0064125 | Ga0373931_0064125_961_1965 | 323 |
| 744 | 3300035695 | Ga0373927_0001790 | Ga0373927_0001790_2839_3834 | 323 |
| 745 | 3300035725 | Ga0373947_0067658 | Ga0373947_0067658_302_1276 | 323 |
| 746 | 3300036401 | Ga0373937_0097073 | Ga0373937_0097073_71_1057 | 323 |
| 747 | 3300036647 | Ga0316582_0004251 | Ga0316582_0004251_3728_4774 | 323 |
| 748 | 3300036712 | Ga0316584_0009352 | Ga0316584_0009352_5560_6555 | 323 |
| 749 | 3300037068 | Ga0373925_0444600 | Ga0373925_0444600_16_1020 | 323 |
| 750 | 3300037312 | Ga0395899_0000103 | Ga0395899_0000103_125822_126793 | 323 |
| 751 | 3300037312 | Ga0395899_0011626 | Ga0395899_0011626_1293_2330 | 323 |
| 752 | 3300037312 | Ga0395899_0027843 | Ga0395899_0027843_2865_3854 | 323 |
| 753 | 3300037312 | Ga0395899_0117109 | Ga0395899_0117109_859_1830 | 323 |
| 754 | 3300037312 | Ga0395899_0148931 | Ga0395899_0148931_301_1272 | 323 |
| 755 | 3300037312 | Ga0395899_0157022 | Ga0395899_0157022_83_1054 | 323 |
| 756 | 3300037312 | Ga0395899_0169415 | Ga0395899_0169415_10_1005 | 323 |
| 757 | 3300037418 | Ga0395900_0002384 | Ga0395900_0002384_14045_15016 | 323 |
| 758 | 3300037418 | Ga0395900_0002717 | Ga0395900_0002717_6121_7092 | 323 |
| 759 | 3300037418 | Ga0395900_0003073 | Ga0395900_0003073_4144_5115 | 323 |
| 760 | 3300037418 | Ga0395900_0023201 | Ga0395900_0023201_1038_2009 | 323 |
| 761 | 3300037418 | Ga0395900_0046164 | Ga0395900_0046164_1617_2603 | 323 |
| 762 | 3300037418 | Ga0395900_0047090 | Ga0395900_0047090_2639_3619 | 323 |
| 763 | 3300037418 | Ga0395900_0058657 | Ga0395900_0058657_1746_2717 | 323 |
| 764 | 3300037418 | Ga0395900_0101453 | Ga0395900_0101453_640_1641 | 323 |
| 765 | 3300037418 | Ga0395900_0103496 | Ga0395900_0103496_509_1480 | 323 |
| 766 | 3300037418 | Ga0395900_0114137 | Ga0395900_0114137_1746_2741 | 323 |
| 767 | 3300037418 | Ga0395900_0178595 | Ga0395900_0178595_704_1693 | 323 |
| 768 | 3300037418 | Ga0395900_0237484 | Ga0395900_0237484_830_1816 | 323 |
| 769 | 3300037466 | Ga0395898_0000053 | Ga0395898_0000053_180423_181394 | 323 |
| 770 | 3300037466 | Ga0395898_0012329 | Ga0395898_0012329_3312_4349 | 323 |
| 771 | 3300037466 | Ga0395898_0024232 | Ga0395898_0024232_2936_3907 | 323 |
| 772 | 3300037466 | Ga0395898_0052265 | Ga0395898_0052265_323_1294 | 323 |
| 773 | 3300037466 | Ga0395898_0081494 | Ga0395898_0081494_523_1494 | 323 |
| 774 | 3300037466 | Ga0395898_0129444 | Ga0395898_0129444_442_1413 | 323 |
| 775 | 3300037466 | Ga0395898_0249665 | Ga0395898_0249665_134_1129 | 323 |
| 776 | 3300037466 | Ga0395898_0257387 | Ga0395898_0257387_213_1184 | 323 |
| 777 | 3300037466 | Ga0395898_0348051 | Ga0395898_0348051_81_1067 | 323 |
| 778 | 3300037471 | Ga0395905_0000031 | Ga0395905_0000031_105364_106335 | 323 |
| 779 | 3300037471 | Ga0395905_0002933 | Ga0395905_0002933_15481_16470 | 323 |
| 780 | 3300037471 | Ga0395905_0011028 | Ga0395905_0011028_6526_7497 | 323 |
| 781 | 3300037471 | Ga0395905_0014041 | Ga0395905_0014041_4804_5835 | 323 |
| 782 | 3300037471 | Ga0395905_0017320 | Ga0395905_0017320_1986_2972 | 323 |
| 783 | 3300037471 | Ga0395905_0019078 | Ga0395905_0019078_978_1964 | 323 |
| 784 | 3300037471 | Ga0395905_0028173 | Ga0395905_0028173_1715_2716 | 323 |
| 785 | 3300037471 | Ga0395905_0035912 | Ga0395905_0035912_1911_2882 | 323 |
| 786 | 3300037471 | Ga0395905_0051072 | Ga0395905_0051072_1656_2627 | 323 |
| 787 | 3300037471 | Ga0395905_0069555 | Ga0395905_0069555_1177_2148 | 323 |
| 788 | 3300037471 | Ga0395905_0171086 | Ga0395905_0171086_84_1079 | 323 |
| 789 | 3300037853 | Ga0436364_0536128 | Ga0436364_0536128_30162_31151 | 323 |
| 790 | 3300038443 | Ga0395901_0000163 | Ga0395901_0000163_66180_67151 | 323 |
| 791 | 3300038443 | Ga0395901_0003692 | Ga0395901_0003692_4298_5269 | 323 |
| 792 | 3300038443 | Ga0395901_0006699 | Ga0395901_0006699_4916_5887 | 323 |
| 793 | 3300038443 | Ga0395901_0011095 | Ga0395901_0011095_2052_3023 | 323 |
| 794 | 3300038443 | Ga0395901_0014941 | Ga0395901_0014941_5719_6705 | 323 |
| 795 | 3300038443 | Ga0395901_0037660 | Ga0395901_0037660_2577_3548 | 323 |
| 796 | 3300038443 | Ga0395901_0104621 | Ga0395901_0104621_1398_2429 | 323 |
| 797 | 3300038443 | Ga0395901_0109031 | Ga0395901_0109031_529_1566 | 323 |
| 798 | 3300038443 | Ga0395901_0124654 | Ga0395901_0124654_139_1125 | 323 |
| 799 | 3300038443 | Ga0395901_0413734 | Ga0395901_0413734_194_1204 | 323 |
| 800 | 3300038443 | Ga0395901_0463862 | Ga0395901_0463862_269_1270 | 323 |
| 801 | 3300038443 | Ga0395901_0537671 | Ga0395901_0537671_161_1156 | 323 |
| 802 | 3300042005 | Ga0439448_0004115 | Ga0439448_0004115_1210_2196 | 323 |
| 803 | 3300042157 | Ga0439458_0000121 | Ga0439458_0000121_12715_13701 | 323 |
| 804 | 3300042157 | Ga0439458_0001367 | Ga0439458_0001367_2615_3601 | 323 |
| 805 | 3300044656 | Ga0466969_0006178 | Ga0466969_0006178_3581_4567 | 323 |
| 806 | 3300044658 | Ga0466972_0000063 | Ga0466972_0000063_64967_66004 | 323 |
| 807 | 3300044658 | Ga0466972_0047556 | Ga0466972_0047556_1037_2017 | 323 |
| 808 | 3300044683 | Ga0466965_0019715 | Ga0466965_0019715_2223_3194 | 323 |
| 809 | 3300044684 | Ga0466966_0002883 | Ga0466966_0002883_8973_9977 | 323 |
| 810 | 3300044684 | Ga0466966_0013797 | Ga0466966_0013797_1372_2358 | 323 |
| 811 | 3300044684 | Ga0466966_0018101 | Ga0466966_0018101_560_1549 | 323 |
| 812 | 3300044684 | Ga0466966_0190441 | Ga0466966_0190441_193_1191 | 323 |
| 813 | 3300044693 | Ga0466961_0058869 | Ga0466961_0058869_1156_2127 | 323 |
| 814 | 3300044694 | Ga0466963_0010554 | Ga0466963_0010554_137_1138 | 323 |
| 815 | 3300044694 | Ga0466963_0010868 | Ga0466963_0010868_1484_2455 | 323 |
| 816 | 3300044694 | Ga0466963_0053411 | Ga0466963_0053411_1033_2025 | 323 |
| 817 | 3300044694 | Ga0466963_0126448 | Ga0466963_0126448_104_1084 | 323 |
| 818 | 3300044706 | Ga0466964_0116042 | Ga0466964_0116042_162_1166 | 323 |
| 819 | 3300044719 | Ga0466971_0021851 | Ga0466971_0021851_1232_2290 | 323 |
| 820 | 3300044842 | Ga0466957_0015688 | Ga0466957_0015688_1553_2545 | 323 |
| 821 | 3300044842 | Ga0466957_0041916 | Ga0466957_0041916_1217_2197 | 323 |
| 822 | 3300044901 | Ga0466960_0190397 | Ga0466960_0190397_34_1035 | 323 |
| 823 | 3300045049 | Ga0466959_0020934 | Ga0466959_0020934_2907_3893 | 323 |
| 824 | 3300045049 | Ga0466959_0025616 | Ga0466959_0025616_2622_3680 | 323 |
| 825 | 3300045049 | Ga0466959_0039918 | Ga0466959_0039918_1507_2511 | 323 |
| 826 | 3300045049 | Ga0466959_0177015 | Ga0466959_0177015_302_1393 | 323 |
| 827 | 3300045049 | Ga0466959_0238537 | Ga0466959_0238537_259_1230 | 323 |
| 828 | 3300045836 | Ga0466958_0001875 | Ga0466958_0001875_1312_2304 | 323 |
| 829 | 3300045976 | Ga0466967_0013401 | Ga0466967_0013401_880_1860 | 323 |
| 830 | 3300045976 | Ga0466967_0026278 | Ga0466967_0026278_1191_2213 | 323 |
| 831 | 3300045976 | Ga0466967_0097081 | Ga0466967_0097081_60_1049 | 323 |
| 832 | 3300045976 | Ga0466967_0122672 | Ga0466967_0122672_1287_2288 | 323 |
| 833 | 3300045976 | Ga0466967_0139563 | Ga0466967_0139563_446_1444 | 323 |
| 834 | 3300046455 | Ga0495603_0027959 | Ga0495603_0027959_1534_2520 | 323 |
| 835 | 3300046461 | Ga0495641_0096699 | Ga0495641_0096699_204_1190 | 323 |
| 836 | 3300046462 | Ga0495651_0002911 | Ga0495651_0002911_100_1134 | 323 |
| 837 | 3300046462 | Ga0495651_0003862 | Ga0495651_0003862_4792_5796 | 323 |
| 838 | 3300046463 | Ga0495653_0001994 | Ga0495653_0001994_14575_15579 | 323 |
| 839 | 3300046472 | Ga0495580_0018482 | Ga0495580_0018482_3636_4640 | 323 |
| 840 | 3300046473 | Ga0495582_0000431 | Ga0495582_0000431_14305_15303 | 323 |
| 841 | 3300046516 | Ga0495628_0000515 | Ga0495628_0000515_14510_15514 | 323 |
| 842 | 3300046516 | Ga0495628_0003485 | Ga0495628_0003485_2263_3264 | 323 |
| 843 | 3300046517 | Ga0495630_0043576 | Ga0495630_0043576_245_1249 | 323 |
| 844 | 3300046522 | Ga0495643_0005167 | Ga0495643_0005167_3130_4149 | 323 |
| 845 | 3300046523 | Ga0495644_0099088 | Ga0495644_0099088_57_1043 | 323 |
| 846 | 3300046525 | Ga0495663_0029883 | Ga0495663_0029883_59_1120 | 323 |
| 847 | 3300046529 | Ga0495652_0002256 | Ga0495652_0002256_16771_17775 | 323 |
| 848 | 3300046529 | Ga0495652_0010026 | Ga0495652_0010026_2502_3497 | 323 |
| 849 | 3300046533 | Ga0495640_0038052 | Ga0495640_0038052_1032_2042 | 323 |
| 850 | 3300046536 | Ga0495587_0001271 | Ga0495587_0001271_3845_4849 | 323 |
| 851 | 3300046543 | Ga0495645_0016848 | Ga0495645_0016848_2163_3167 | 323 |
| 852 | 3300046559 | Ga0495667_0002732 | Ga0495667_0002732_4312_5316 | 323 |
| 853 | 3300046615 | Ga0495656_0022141 | Ga0495656_0022141_714_1697 | 323 |
| 854 | 3300046663 | Ga0495635_0006423 | Ga0495635_0006423_4929_5924 | 323 |
| 855 | 3300046674 | Ga0495588_0033165 | Ga0495588_0033165_747_1721 | 323 |
| 856 | 3300046675 | Ga0495657_0017798 | Ga0495657_0017798_2846_3850 | 323 |
| 857 | 3300046678 | Ga0495599_0029392 | Ga0495599_0029392_182_1186 | 323 |
| 858 | 3300046683 | Ga0495658_0233540 | Ga0495658_0233540_94_1104 | 323 |
| 859 | 3300046684 | Ga0495669_0007954 | Ga0495669_0007954_2543_3604 | 323 |
| 860 | 3300046689 | Ga0495613_0184803 | Ga0495613_0184803_231_1241 | 323 |
| 861 | 3300046690 | Ga0495624_0011960 | Ga0495624_0011960_4748_5743 | 323 |
| 862 | 3300046794 | Ga0495589_0132728 | Ga0495589_0132728_142_1128 | 323 |
| 863 | 3300046809 | Ga0495600_0238797 | Ga0495600_0238797_81_1085 | 323 |
| 864 | 3300047315 | Ga0495581_0010437 | Ga0495581_0010437_199_1197 | 323 |
| 865 | 3300047315 | Ga0495581_0024575 | Ga0495581_0024575_1014_2000 | 323 |
| 866 | 3300047315 | Ga0495581_0102798 | Ga0495581_0102798_393_1379 | 323 |
| 867 | 3300047317 | Ga0495604_0007212 | Ga0495604_0007212_615_1619 | 323 |
| 868 | 3300047317 | Ga0495604_0183788 | Ga0495604_0183788_412_1395 | 323 |
| 869 | 3300047317 | Ga0495604_0253631 | Ga0495604_0253631_57_1058 | 323 |
| 870 | 3300047319 | Ga0495674_0003664 | Ga0495674_0003664_10807_11811 | 323 |
| 871 | 3300047319 | Ga0495674_0204775 | Ga0495674_0204775_495_1496 | 323 |
| 872 | 3300047321 | Ga0495676_0030058 | Ga0495676_0030058_297_1283 | 323 |
| 873 | 3300047321 | Ga0495676_0063564 | Ga0495676_0063564_356_1390 | 323 |
| 874 | 3300047322 | Ga0495680_0000563 | Ga0495680_0000563_40749_41783 | 323 |
| 875 | 3300047444 | Ga0495675_0000371 | Ga0495675_0000371_20918_21922 | 323 |
| 876 | 3300047444 | Ga0495675_0205191 | Ga0495675_0205191_46_1080 | 323 |
| 877 | 3300048088 | Ga0495602_0012470 | Ga0495602_0012470_4326_5330 | 323 |
| 878 | 3300048903 | Ga0496100_0016696 | Ga0496100_0016696_2036_3097 | 323 |
| 879 | 3300048903 | Ga0496100_0033944 | Ga0496100_0033944_2148_3134 | 323 |
| 880 | 3300048903 | Ga0496100_0047207 | Ga0496100_0047207_1130_2131 | 323 |
| 881 | 3300048904 | Ga0496101_0005176 | Ga0496101_0005176_1492_2478 | 323 |
| 882 | 3300048904 | Ga0496101_0014355 | Ga0496101_0014355_3789_4850 | 323 |
| 883 | 3300048904 | Ga0496101_0018589 | Ga0496101_0018589_2783_3784 | 323 |
| 884 | 3300048904 | Ga0496101_0035794 | Ga0496101_0035794_958_1968 | 323 |
| 885 | 3300048905 | Ga0496102_0002662 | Ga0496102_0002662_6811_7797 | 323 |
| 886 | 3300048905 | Ga0496102_0025629 | Ga0496102_0025629_1437_2438 | 323 |
| 887 | 3300048905 | Ga0496102_0121851 | Ga0496102_0121851_211_1224 | 323 |
| 888 | 3300048905 | Ga0496102_0181694 | Ga0496102_0181694_943_1926 | 323 |
| 889 | 3300048906 | Ga0496103_0002178 | Ga0496103_0002178_2911_3897 | 323 |
| 890 | 3300048906 | Ga0496103_0185753 | Ga0496103_0185753_264_1277 | 323 |
| 891 | 3300048907 | Ga0496104_0003563 | Ga0496104_0003563_556_1557 | 323 |
| 892 | 3300048907 | Ga0496104_0084553 | Ga0496104_0084553_1005_2039 | 323 |
| 893 | 3300048907 | Ga0496104_0086658 | Ga0496104_0086658_172_1155 | 323 |
| 894 | 3300048908 | Ga0496105_0250381 | Ga0496105_0250381_287_1321 | 323 |
| 895 | 3300048909 | Ga0496106_0005635 | Ga0496106_0005635_300_1286 | 323 |
| 896 | 3300048909 | Ga0496106_0008543 | Ga0496106_0008543_3111_4172 | 323 |
| 897 | 3300048909 | Ga0496106_0019985 | Ga0496106_0019985_1657_2658 | 323 |
| 898 | 3300048909 | Ga0496106_0352466 | Ga0496106_0352466_63_1073 | 323 |
| 899 | 3300048910 | Ga0496107_0001105 | Ga0496107_0001105_12413_13399 | 323 |
| 900 | 3300048910 | Ga0496107_0006260 | Ga0496107_0006260_2347_3408 | 323 |
| 901 | 3300048910 | Ga0496107_0031185 | Ga0496107_0031185_932_1933 | 323 |
| 902 | 3300048910 | Ga0496107_0081601 | Ga0496107_0081601_144_1202 | 323 |
| 903 | 3300048911 | Ga0496108_0034303 | Ga0496108_0034303_1609_2622 | 323 |
| 904 | 3300048911 | Ga0496108_0105031 | Ga0496108_0105031_898_1899 | 323 |
| 905 | 3300048911 | Ga0496108_0130404 | Ga0496108_0130404_213_1196 | 323 |
| 906 | 3300048911 | Ga0496108_0332614 | Ga0496108_0332614_43_1023 | 323 |
| 907 | 3300048912 | Ga0496109_0004861 | Ga0496109_0004861_6962_8023 | 323 |
| 908 | 3300048912 | Ga0496109_0020529 | Ga0496109_0020529_2325_3359 | 323 |
| 909 | 3300048912 | Ga0496109_0256591 | Ga0496109_0256591_571_1569 | 323 |
| 910 | 3300048913 | Ga0496110_0004040 | Ga0496110_0004040_5156_6217 | 323 |
| 911 | 3300048913 | Ga0496110_0109228 | Ga0496110_0109228_1319_2320 | 323 |
| 912 | 3300048914 | Ga0496111_0021701 | Ga0496111_0021701_2542_3603 | 323 |
| 913 | 3300048915 | Ga0496112_0015372 | Ga0496112_0015372_3776_4789 | 323 |
| 914 | 3300048915 | Ga0496112_0029020 | Ga0496112_0029020_2285_3295 | 323 |
| 915 | 3300048915 | Ga0496112_0031498 | Ga0496112_0031498_1280_2305 | 323 |
| 916 | 3300048915 | Ga0496112_0231686 | Ga0496112_0231686_139_1110 | 323 |
| 917 | 3300048916 | Ga0496113_0003062 | Ga0496113_0003062_6381_7442 | 323 |
| 918 | 3300048916 | Ga0496113_0053500 | Ga0496113_0053500_1562_2575 | 323 |
| 919 | 3300048917 | Ga0496114_0038112 | Ga0496114_0038112_2846_3832 | 323 |
| 920 | 3300048917 | Ga0496114_0041232 | Ga0496114_0041232_1869_2870 | 323 |
| 921 | 3300048917 | Ga0496114_0146056 | Ga0496114_0146056_141_1151 | 323 |
| 922 | 3300048918 | Ga0496115_0001296 | Ga0496115_0001296_2873_3859 | 323 |
| 923 | 3300048918 | Ga0496115_0015566 | Ga0496115_0015566_501_1502 | 323 |
| 924 | 3300048918 | Ga0496115_0018307 | Ga0496115_0018307_881_1864 | 323 |
| 925 | 3300048918 | Ga0496115_0422398 | Ga0496115_0422398_74_1054 | 323 |
| 926 | 3300048920 | Ga0496117_0000310 | Ga0496117_0000310_9807_10793 | 323 |
| 927 | 3300048924 | Ga0496121_0082601 | Ga0496121_0082601_1153_2136 | 323 |
| 928 | 3300049568 | Ga0501031_0060415 | Ga0501031_0060415_129_1112 | 323 |
| 929 | 3300049571 | Ga0501034_0016634 | Ga0501034_0016634_5674_6657 | 323 |
| 930 | 3300049571 | Ga0501034_0145372 | Ga0501034_0145372_1152_2135 | 323 |
| 931 | 3300049572 | Ga0501036_0078371 | Ga0501036_0078371_419_1393 | 323 |
| 932 | 3300049574 | Ga0501038_0082872 | Ga0501038_0082872_1589_2572 | 323 |
| 933 | 3300049574 | Ga0501038_0170545 | Ga0501038_0170545_739_1722 | 323 |
| 934 | 3300049574 | Ga0501038_0291304 | Ga0501038_0291304_28_1032 | 323 |
| 935 | 3300049575 | Ga0501039_0049828 | Ga0501039_0049828_423_1427 | 323 |
| 936 | 3300049575 | Ga0501039_0053881 | Ga0501039_0053881_695_1678 | 323 |
| 937 | 3300049577 | Ga0501041_0004801 | Ga0501041_0004801_6683_7666 | 323 |
| 938 | 3300049578 | Ga0501042_0016971 | Ga0501042_0016971_3467_4450 | 323 |
| 939 | 3300049581 | Ga0501047_0052879 | Ga0501047_0052879_727_1779 | 323 |
| 940 | 3300049581 | Ga0501047_0068672 | Ga0501047_0068672_854_1828 | 323 |
| 941 | 3300049581 | Ga0501047_0345343 | Ga0501047_0345343_306_1289 | 323 |
| 942 | 3300049582 | Ga0501048_0050071 | Ga0501048_0050071_1393_2376 | 323 |
| 943 | 3300049587 | Ga0501071_0071018 | Ga0501071_0071018_1269_2252 | 323 |
| 944 | 3300049588 | Ga0501072_0060560 | Ga0501072_0060560_1429_2412 | 323 |
| 945 | 3300049588 | Ga0501072_0065057 | Ga0501072_0065057_95_1105 | 323 |
| 946 | 3300049590 | Ga0501074_0039427 | Ga0501074_0039427_124_1134 | 323 |
| 947 | 3300049591 | Ga0501075_0129121 | Ga0501075_0129121_599_1609 | 323 |
| 948 | 3300049592 | Ga0501076_0009014 | Ga0501076_0009014_2942_3925 | 323 |
| 949 | 3300049593 | Ga0501077_0007642 | Ga0501077_0007642_523_1533 | 323 |
| 950 | 3300049741 | Ga0501079_0010528 | Ga0501079_0010528_1327_2337 | 323 |
| 951 | 3300049742 | Ga0501080_0020624 | Ga0501080_0020624_4622_5632 | 323 |
| 952 | 3300049742 | Ga0501080_0428309 | Ga0501080_0428309_37_1023 | 323 |
| 953 | 3300049743 | Ga0501081_0020935 | Ga0501081_0020935_2888_3871 | 323 |
| 954 | 3300049743 | Ga0501081_0145909 | Ga0501081_0145909_36_1031 | 323 |
| 955 | 3300049744 | Ga0501083_0050079 | Ga0501083_0050079_1453_2436 | 323 |
| 956 | 3300049822 | Ga0501035_0051047 | Ga0501035_0051047_1008_1991 | 323 |
| 957 | 3300049822 | Ga0501035_0202314 | Ga0501035_0202314_417_1400 | 323 |
| 958 | 3300049823 | Ga0501044_0065971 | Ga0501044_0065971_1714_2697 | 323 |
| 959 | 3300049823 | Ga0501044_0113267 | Ga0501044_0113267_240_1223 | 323 |
| 960 | 3300049824 | Ga0501045_0003237 | Ga0501045_0003237_1064_2047 | 323 |
| 961 | 3300050507 | nmdc:mga05p37_210272_c1 | nmdc:mga05p37_210272_c1_227_1210 | 323 |
| 962 | 3300050507 | nmdc:mga05p37_33473_c1 | nmdc:mga05p37_33473_c1_4829_5818 | 323 |
| 963 | 3300050507 | nmdc:mga05p37_83042_c1 | nmdc:mga05p37_83042_c1_2795_3799 | 323 |
| 964 | 3300050512 | nmdc:mga0n895_8149_c1 | nmdc:mga0n895_8149_c1_33_1016 | 323 |
| 965 | 3300050513 | nmdc:mga0rr50_233833_c1 | nmdc:mga0rr50_233833_c1_338_1324 | 323 |
| 966 | 3300050513 | nmdc:mga0rr50_68941_c1 | nmdc:mga0rr50_68941_c1_1531_2523 | 323 |
| 967 | 3300050513 | nmdc:mga0rr50_77661_c1 | nmdc:mga0rr50_77661_c1_279_1262 | 323 |
| 968 | 3300050514 | nmdc:mga08x19_38967_c1 | nmdc:mga08x19_38967_c1_1543_2526 | 323 |
| 969 | 3300050515 | nmdc:mga0a205_330456_c1 | nmdc:mga0a205_330456_c1_110_1096 | 323 |
| 970 | 3300053077 | Ga0495601_0001675 | Ga0495601_0001675_2541_3524 | 323 |
| 971 | 3300053083 | Ga0495655_0005262 | Ga0495655_0005262_863_1840 | 323 |
| 972 | 3300053158 | Ga0500627_0000020 | Ga0500627_0000020_56319_57335 | 323 |
| 973 | 3300054114 | Ga0501084_0004952 | Ga0501084_0004952_81_1091 | 323 |
| 974 | 3300054114 | Ga0501084_0014118 | Ga0501084_0014118_2973_3956 | 323 |
| 975 | 3300059421 | Ga0590071_007661 | Ga0590071_007661_1132_2115 | 323 |
| 976 | 3300059424 | Ga0590075_010614 | Ga0590075_010614_613_1590 | 323 |
| 977 | 3300060353 | Ga0501082_0061992 | Ga0501082_0061992_717_1700 | 323 |
| 978 | 3300060353 | Ga0501082_0090622 | Ga0501082_0090622_1398_2408 | 323 |
| 979 | 3300060353 | Ga0501082_0322712 | Ga0501082_0322712_225_1208 | 323 |
| 980 | 3300061719 | Ga0466962_0027009 | Ga0466962_0027009_825_1796 | 323 |
| 981 | 3300061719 | Ga0466962_0076654 | Ga0466962_0076654_79_1050 | 323 |
| 982 | 3300061734 | Ga0530510_0051841 | Ga0530510_0051841_798_1808 | 323 |
| 983 | 3300061734 | Ga0530510_0087979 | Ga0530510_0087979_841_1824 | 323 |
| 984 | iso_pu_bacteria | 2643221563 | 2643832623 | 323 |
| 985 | iso_pu_bacteria | 2643221608 | 2644053582 | 323 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4z6k-assembly1.cif.gz_B | alcohol dehydrogenase from the antarctic psychrophile moraxella sp. tae 123 | 0.9484 | 2 | 323 |
| 1llu-assembly1.cif.gz_A | the ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate | 0.9474 | 2 | 323 |
| 6iqd-assembly1.cif.gz_A | crystal structure of alcohol dehydrogenase from geobacillus stearothermophilus | 0.947 | 2 | 323 |
| 3s2i-assembly2.cif.gz_H | crystal structure of furx nadh+:furfuryl alcohol ii | 0.9431 | 2 | 323 |
| 4z6k-assembly1.cif.gz_B | alcohol dehydrogenase from the antarctic psychrophile moraxella sp. tae 123 | 0.9427 | 2 | 323 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WQC1_8_164_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9707 | 2 | 142 | 3.90.180.10 |
| af_P9WQC1_165_293_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9598 | 143 | 270 | 3.40.50.720 |
| 2hcyB01 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9466 | 2 | 142 | 3.90.180.10 |
| af_P9WQC1_165_293_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9453 | 143 | 270 | 3.40.50.720 |
| af_Q86AG4_1_164_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9411 | 4 | 156 | 3.90.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F3ZE52-F1-model_v4 | Alcohol dehydrogenase | 0.9919 | 1 | 272 |
GO:0004022
GO:0005737 |
| AF-A0A559Q2V2-F1-model_v4 | deleted | 0.9907 | 1 | 323 |
|
| AF-A0A1Q7R5G0-F1-model_v4 | alcohol dehydrogenase (EC 1.1.1.1) | 0.9903 | 1 | 279 |
GO:0004022
GO:0005737 GO:0008270 |
| AF-A0A1H2GHW8-F1-model_v4 | alcohol dehydrogenase (EC 1.1.1.1) | 0.9901 | 1 | 323 |
GO:0004022
GO:0005737 GO:0008270 |
| AF-A0A6P5UT19-F1-model_v4 | deleted | 0.9898 | 1 | 323 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar