F487462
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 983 | 514 | 819 | 238 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2690315906|2691513859 |
| Length | 288 |
| Sequence | APKACINSLTISSGAQTRAGAGAKIEVSQITPIYSGPSAPQNSGASFMTEAATAPRSVLITGGNRGIGLAIAEAFLANGDKVAVTYRSETKLPEGILGVKADVTDEASVDAAFKEVEAAHGPVEVLVANAGITKDTLLLRMSEDDFTSVIDTNLTGAFRVIKRASKGMIRLRKGRVVLISSVSGLYGAPGQINYSASKAGLVGIARSLTRELGSRGITANVVAPGFINTDMTAELPEATQKDYLSSIPAGRFAEASEVANVVRWISSDEAAYISGAVIPVDGGLGMGH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 2 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 3 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 4 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 5 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 6 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 7 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 8 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 9 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 10 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 11 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 12 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 13 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 14 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 15 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 16 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 17 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 18 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 19 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 20 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 21 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 22 | 2751185788 | Curtobacterium pusillum AA3 | Isolate | Unclassified |
| 23 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 24 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 25 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 26 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 27 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 28 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 29 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 30 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 31 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 32 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 33 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 34 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 35 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 36 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 37 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 38 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 39 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 40 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 41 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 42 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 43 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 44 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 45 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 46 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 47 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 48 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 49 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 50 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 51 | 2852643534 | Leifsonia sp. AK011 | Isolate | Rhizosphere |
| 52 | 2857733635 | Salinibacterium sp. R-73062 | Isolate | Unclassified |
| 53 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 54 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 55 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 56 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 57 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 58 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 59 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 60 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 61 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 62 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 63 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 64 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 65 | 2870622029 | Conyzicola lurida DSM 105784 | Isolate | Unclassified |
| 66 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 67 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 68 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 69 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 70 | 2904430863 | Curtobacterium oceanosedimentum 1519 | Isolate | Rhizosphere |
| 71 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 72 | 2904501621 | Curtobacterium sp. 1909 | Isolate | Unclassified |
| 73 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 74 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 75 | 2908674828 | Curtobacterium sp. 1517 | Isolate | Rhizosphere |
| 76 | 2909074476 | Curtobacterium sp. 1310 | Isolate | Rhizosphere |
| 77 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 78 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 79 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 80 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 81 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 82 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 83 | 2919039151 | Curtobacterium sp. 260 | Isolate | Rhizosphere |
| 84 | 2919042368 | Curtobacterium sp. 320 | Isolate | Rhizosphere |
| 85 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 86 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 87 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 88 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 89 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 90 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 91 | 2928104781 | Curtobacterium sp. 1544 | Isolate | Rhizosphere |
| 92 | 2928500415 | Curtobacterium oceanosedimentum 1257 | Isolate | Rhizosphere |
| 93 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 94 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 95 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 96 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 97 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 98 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 99 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 100 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 101 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 102 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 103 | 2946024296 | Arthrobacter woluwensis W4I2 | Isolate | Rhizosphere |
| 104 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 105 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 106 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 107 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 108 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 109 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 110 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 111 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 112 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 113 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 114 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 115 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 116 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 117 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 118 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 119 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 120 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 121 | 2964326757 | Planctomonas psychrotolerans J5903 | Isolate | Rhizosphere |
| 122 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 123 | 2966921586 | Rathayibacter agropyri 617 | Isolate | Rhizosphere |
| 124 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 125 | 2984551494 | Curtobacterium sp. SORGH_AS776 | Isolate | Aerial Root |
| 126 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 127 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 128 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 129 | 2995726249 | Leucobacter zeae CC-MF41 | Isolate | Rhizosphere |
| 130 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 131 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 132 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 133 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 134 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 135 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 136 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 137 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 138 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 139 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 140 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 141 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 142 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 143 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 144 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 145 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 146 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 149 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 150 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 151 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 153 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 157 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 160 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 161 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 162 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 165 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 166 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 168 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 169 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 170 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 171 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 180 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 181 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 182 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 183 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 193 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 195 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 196 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 197 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 198 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 199 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 201 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 232 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 235 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 236 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 237 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 238 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 239 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 240 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 241 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 242 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 243 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 244 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 245 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 246 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 247 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 248 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 249 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 250 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 251 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 252 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 253 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 254 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 255 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 256 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 257 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 258 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 259 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 260 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 261 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 262 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 263 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 264 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 265 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 266 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 267 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 268 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 269 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 270 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 271 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 272 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 273 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 274 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 275 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 276 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 277 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 278 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 279 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 280 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 281 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 282 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 283 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 284 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 285 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 286 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 287 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 288 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 289 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 290 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 291 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 292 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 293 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 294 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 295 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 296 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 297 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 298 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 299 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 300 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 301 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 302 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 303 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 304 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 305 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 306 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 307 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 308 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 309 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 310 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 311 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 393 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 394 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 395 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 396 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 397 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 398 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 399 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 400 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 401 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 402 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 403 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 404 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 405 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 406 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 407 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 408 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 409 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 410 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 411 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 412 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 413 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 414 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 415 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 416 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 422 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 427 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 428 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 429 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 456 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 457 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 460 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 461 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 465 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 466 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 467 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 470 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 471 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 472 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 473 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 474 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 475 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 476 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 477 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 478 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 479 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 480 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 481 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 482 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 483 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 484 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 485 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 486 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 487 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 488 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 489 | 8002811521 | Leucobacter chinensis NC76-1 | Isolate | Rhizosphere |
| 490 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 491 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 492 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 493 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 494 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 495 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 496 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 497 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 498 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 499 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 500 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 501 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 502 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 503 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 504 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 505 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 506 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 507 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
| 508 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 509 | 8055034563 | Leucobacter allii H21R-40 | Isolate | Rhizosphere |
| 510 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
| 511 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 512 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 513 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
| 514 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.18 |
| Metatranscriptomes | 2.14 |
| Isolates | 16.68 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.1 |
| Bulb | 0 |
| Endosphere | 4.07 |
| Nodule | 0.31 |
| Rhizoplane | 5.8 |
| Rhizosphere | 79.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1002824 | 3300000549 | Bacteria | 2382 |
| 2 | JGI24735J21928_10046827 | 3300002067 | Bacteria | 1254 |
| 3 | JGI25152J39213_1000140 | 3300002773 | Bacteria | 49435 |
| 4 | rootH1_10017486 | 3300003316 | Bacteria | 4579 |
| 5 | rootH2_10123511 | 3300003320 | Bacteria | 4819 |
| 6 | rootH1_10085405 | 3300003323 | Bacteria | 1663 |
| 7 | JGI25160J50197_1014226 | 3300003354 | Bacteria | 2671 |
| 8 | JGI25160J50197_1038407 | 3300003354 | Bacteria | 1133 |
| 9 | Ga0055542_1002679 | 3300003762 | Bacteria | 5501 |
| 10 | Ga0065714_10106553 | 3300005288 | Bacteria | 1546 |
| 11 | Ga0065714_10201669 | 3300005288 | Bacteria | 893 |
| 12 | Ga0070658_10002027 | 3300005327 | Bacteria | 16977 |
| 13 | Ga0070676_10024958 | 3300005328 | Bacteria | 3374 |
| 14 | Ga0070683_100181839 | 3300005329 | Bacteria | 1996 |
| 15 | Ga0070670_100225790 | 3300005331 | Bacteria | 1629 |
| 16 | Ga0070682_100234427 | 3300005337 | Bacteria | 1314 |
| 17 | Ga0070660_100040078 | 3300005339 | Bacteria | 3563 |
| 18 | Ga0070692_10107211 | 3300005345 | Bacteria | 1540 |
| 19 | Ga0070668_100051002 | 3300005347 | Bacteria | 3187 |
| 20 | Ga0070674_100055324 | 3300005356 | Bacteria | 2747 |
| 21 | Ga0070659_100030588 | 3300005366 | Bacteria | 4167 |
| 22 | Ga0070710_10256416 | 3300005437 | Bacteria | 1126 |
| 23 | Ga0070663_100141564 | 3300005455 | Bacteria | 1837 |
| 24 | Ga0070678_100053944 | 3300005456 | Bacteria | 2926 |
| 25 | Ga0070678_100119284 | 3300005456 | Bacteria | 2077 |
| 26 | Ga0070698_100511641 | 3300005471 | Bacteria | 1139 |
| 27 | Ga0070684_100113055 | 3300005535 | Bacteria | 2436 |
| 28 | Ga0068853_100096024 | 3300005539 | Bacteria | 2615 |
| 29 | Ga0070672_100300824 | 3300005543 | Bacteria | 1360 |
| 30 | Ga0070665_100117853 | 3300005548 | Bacteria | 2658 |
| 31 | Ga0068855_100056871 | 3300005563 | Bacteria | 4586 |
| 32 | Ga0068855_100176462 | 3300005563 | Bacteria | 2417 |
| 33 | Ga0068856_100151928 | 3300005614 | Bacteria | 2325 |
| 34 | Ga0068856_100558940 | 3300005614 | Bacteria | 1165 |
| 35 | Ga0070702_100000282 | 3300005615 | Bacteria | 17359 |
| 36 | Ga0075432_10002903 | 3300006058 | Bacteria | 5763 |
| 37 | Ga0075432_10017063 | 3300006058 | Bacteria | 2477 |
| 38 | Ga0075367_10002358 | 3300006178 | Bacteria | 8588 |
| 39 | Ga0075370_10049690 | 3300006353 | Bacteria | 2378 |
| 40 | Ga0068865_100084207 | 3300006881 | Bacteria | 2291 |
| 41 | Ga0097620_101535116 | 3300006931 | Bacteria | 735 |
| 42 | Ga0105244_10004227 | 3300009036 | Bacteria | 9982 |
| 43 | Ga0105244_10006637 | 3300009036 | Bacteria | 7453 |
| 44 | Ga0111539_10899260 | 3300009094 | Bacteria | 1030 |
| 45 | Ga0105245_10247194 | 3300009098 | Bacteria | 1732 |
| 46 | Ga0105245_10374763 | 3300009098 | Bacteria | 1416 |
| 47 | Ga0114129_11267947 | 3300009147 | Bacteria | 915 |
| 48 | Ga0105243_10031619 | 3300009148 | Bacteria | 4081 |
| 49 | Ga0105243_10069980 | 3300009148 | Bacteria | 2832 |
| 50 | Ga0105243_10462215 | 3300009148 | Bacteria | 1193 |
| 51 | Ga0105243_10514215 | 3300009148 | Bacteria | 1137 |
| 52 | Ga0105242_10026930 | 3300009176 | Bacteria | 4560 |
| 53 | Ga0105242_10334780 | 3300009176 | Bacteria | 1393 |
| 54 | Ga0105248_10198791 | 3300009177 | Bacteria | 2258 |
| 55 | Ga0105248_10220468 | 3300009177 | Bacteria | 2135 |
| 56 | Ga0105238_10059429 | 3300009551 | Bacteria | 3830 |
| 57 | Ga0105238_10318059 | 3300009551 | Bacteria | 1542 |
| 58 | Ga0105238_10418994 | 3300009551 | Bacteria | 1334 |
| 59 | Ga0105249_10126193 | 3300009553 | Bacteria | 2437 |
| 60 | Ga0105239_10533268 | 3300010375 | Bacteria | 1336 |
| 61 | Ga0105246_10018457 | 3300011119 | Bacteria | 4446 |
| 62 | Ga0105246_10019891 | 3300011119 | Bacteria | 4301 |
| 63 | Ga0105246_10052080 | 3300011119 | Bacteria | 2812 |
| 64 | Ga0105246_10100439 | 3300011119 | Bacteria | 2105 |
| 65 | Ga0105246_10374843 | 3300011119 | Bacteria | 1174 |
| 66 | Ga0157373_10005927 | 3300013100 | Bacteria | 9146 |
| 67 | Ga0157371_10099947 | 3300013102 | Bacteria | 2057 |
| 68 | Ga0157371_10164527 | 3300013102 | Bacteria | 1584 |
| 69 | Ga0157370_10004734 | 3300013104 | Bacteria | 15512 |
| 70 | Ga0157370_10020509 | 3300013104 | Bacteria | 6600 |
| 71 | Ga0157370_10147021 | 3300013104 | Bacteria | 2194 |
| 72 | Ga0157369_10014157 | 3300013105 | Bacteria | 9012 |
| 73 | Ga0157369_10042802 | 3300013105 | Bacteria | 4940 |
| 74 | Ga0157369_10054768 | 3300013105 | Bacteria | 4306 |
| 75 | Ga0157369_10213736 | 3300013105 | Bacteria | 2021 |
| 76 | Ga0157369_10281216 | 3300013105 | Bacteria | 1733 |
| 77 | Ga0157378_10019491 | 3300013297 | Bacteria | 5964 |
| 78 | Ga0157372_10110173 | 3300013307 | Bacteria | 3153 |
| 79 | Ga0157375_10249541 | 3300013308 | Bacteria | 1935 |
| 80 | Ga0157375_10294975 | 3300013308 | Bacteria | 1784 |
| 81 | Ga0157375_10411108 | 3300013308 | Bacteria | 1519 |
| 82 | Ga0157375_10735993 | 3300013308 | Bacteria | 1138 |
| 83 | Ga0157375_10772039 | 3300013308 | Bacteria | 1111 |
| 84 | Ga0157375_11154697 | 3300013308 | Bacteria | 908 |
| 85 | Ga0163163_10087102 | 3300014325 | Bacteria | 3133 |
| 86 | Ga0163163_10129257 | 3300014325 | Bacteria | 2566 |
| 87 | Ga0157380_10011858 | 3300014326 | Bacteria | 6303 |
| 88 | Ga0182008_10001386 | 3300014497 | Bacteria | 16403 |
| 89 | Ga0182008_10012123 | 3300014497 | Bacteria | 4558 |
| 90 | Ga0157379_10685339 | 3300014968 | Bacteria | 961 |
| 91 | Ga0157376_10117457 | 3300014969 | Bacteria | 2352 |
| 92 | Ga0182007_10002461 | 3300015262 | Bacteria | 9200 |
| 93 | Ga0182007_10013236 | 3300015262 | Bacteria | 3152 |
| 94 | Ga0163161_10014026 | 3300017792 | Bacteria | 5580 |
| 95 | Ga0163161_10035341 | 3300017792 | Bacteria | 3576 |
| 96 | Ga0163161_10449728 | 3300017792 | Bacteria | 1041 |
| 97 | Ga0213875_10008509 | 3300021388 | Bacteria | 5250 |
| 98 | Ga0207425_1002927 | 3300025245 | Bacteria | 5718 |
| 99 | Ga0209148_1002761 | 3300025254 | Bacteria | 5534 |
| 100 | Ga0209129_1000067 | 3300025258 | Bacteria | 219974 |
| 101 | Ga0209025_1001395 | 3300025294 | Bacteria | 32161 |
| 102 | Ga0207426_1003132 | 3300025302 | Bacteria | 9420 |
| 103 | Ga0207426_1003775 | 3300025302 | Bacteria | 7879 |
| 104 | Ga0207426_1004297 | 3300025302 | Bacteria | 7042 |
| 105 | Ga0209051_1003979 | 3300025303 | Bacteria | 9383 |
| 106 | Ga0207697_10004823 | 3300025315 | Bacteria | 6372 |
| 107 | Ga0207697_10037574 | 3300025315 | Bacteria | 1984 |
| 108 | Ga0207655_1005476 | 3300025728 | Bacteria | 8617 |
| 109 | Ga0207655_1023324 | 3300025728 | Bacteria | 3073 |
| 110 | Ga0207655_1043814 | 3300025728 | Bacteria | 1887 |
| 111 | Ga0207682_10026419 | 3300025893 | Bacteria | 2308 |
| 112 | Ga0207692_10136671 | 3300025898 | Bacteria | 1390 |
| 113 | Ga0207647_10076822 | 3300025904 | Bacteria | 2008 |
| 114 | Ga0207645_10019501 | 3300025907 | Bacteria | 4445 |
| 115 | Ga0207705_10000006 | 3300025909 | Bacteria | 657147 |
| 116 | Ga0207654_10337560 | 3300025911 | Bacteria | 1034 |
| 117 | Ga0207657_10024467 | 3300025919 | Bacteria | 5588 |
| 118 | Ga0207681_10372273 | 3300025923 | Bacteria | 1148 |
| 119 | Ga0207694_10140078 | 3300025924 | Bacteria | 1945 |
| 120 | Ga0207690_10036765 | 3300025932 | Bacteria | 3173 |
| 121 | Ga0207686_10191184 | 3300025934 | Bacteria | 1459 |
| 122 | Ga0207709_10254713 | 3300025935 | Bacteria | 1284 |
| 123 | Ga0207669_10166489 | 3300025937 | Bacteria | 1564 |
| 124 | Ga0207669_10377368 | 3300025937 | Bacteria | 1104 |
| 125 | Ga0207704_10180517 | 3300025938 | Bacteria | 1525 |
| 126 | Ga0207704_10450750 | 3300025938 | Bacteria | 1027 |
| 127 | Ga0207691_10001023 | 3300025940 | Bacteria | 27673 |
| 128 | Ga0207691_10277389 | 3300025940 | Bacteria | 1443 |
| 129 | Ga0207691_10348912 | 3300025940 | Bacteria | 1266 |
| 130 | Ga0207661_10184750 | 3300025944 | Bacteria | 1824 |
| 131 | Ga0207667_10068535 | 3300025949 | Bacteria | 3694 |
| 132 | Ga0207667_10116835 | 3300025949 | Bacteria | 2749 |
| 133 | Ga0207668_10062894 | 3300025972 | Bacteria | 2616 |
| 134 | Ga0207640_10222953 | 3300025981 | Bacteria | 1445 |
| 135 | Ga0207639_10028241 | 3300026041 | Bacteria | 4094 |
| 136 | Ga0207678_10131147 | 3300026067 | Bacteria | 2138 |
| 137 | Ga0207678_10151959 | 3300026067 | Bacteria | 1977 |
| 138 | Ga0207678_10359035 | 3300026067 | Bacteria | 1257 |
| 139 | Ga0207702_10181899 | 3300026078 | Bacteria | 1936 |
| 140 | Ga0207675_100082678 | 3300026118 | Bacteria | 3012 |
| 141 | Ga0207683_10006538 | 3300026121 | Bacteria | 9979 |
| 142 | Ga0207683_10089505 | 3300026121 | Bacteria | 2740 |
| 143 | Ga0207683_10293498 | 3300026121 | Bacteria | 1487 |
| 144 | Ga0207683_10425132 | 3300026121 | Bacteria | 1224 |
| 145 | Ga0209813_10010366 | 3300027866 | Bacteria | 2408 |
| 146 | Ga0207428_10055820 | 3300027907 | Bacteria | 3139 |
| 147 | Ga0268266_10084559 | 3300028379 | Bacteria | 2771 |
| 148 | Ga0268265_10454861 | 3300028380 | Bacteria | 1197 |
| 149 | Ga0307517_10046625 | 3300028786 | Bacteria | 4515 |
| 150 | Ga0307515_10001938 | 3300028794 | Bacteria | 45899 |
| 151 | Ga0268256_1005878 | 3300030500 | Bacteria | 4698 |
| 152 | Ga0307511_10125846 | 3300030521 | Bacteria | 1564 |
| 153 | Ga0307408_100001200 | 3300031548 | Bacteria | 19575 |
| 154 | Ga0307408_100021674 | 3300031548 | Bacteria | 4352 |
| 155 | Ga0307408_100029791 | 3300031548 | Bacteria | 3785 |
| 156 | Ga0307408_100059025 | 3300031548 | Bacteria | 2791 |
| 157 | Ga0307408_100129695 | 3300031548 | Bacteria | 1965 |
| 158 | Ga0307408_100363184 | 3300031548 | Bacteria | 1232 |
| 159 | Ga0307408_100656211 | 3300031548 | Bacteria | 938 |
| 160 | Ga0307508_10017045 | 3300031616 | Bacteria | 6606 |
| 161 | Ga0307508_10023422 | 3300031616 | Bacteria | 5606 |
| 162 | Ga0307514_10002647 | 3300031649 | Bacteria | 18263 |
| 163 | Ga0307514_10008617 | 3300031649 | Bacteria | 8653 |
| 164 | Ga0316579_10033842 | 3300031691 | Bacteria | 2348 |
| 165 | Ga0316576_10001474 | 3300031727 | Bacteria | 12663 |
| 166 | Ga0316576_10003277 | 3300031727 | Bacteria | 9449 |
| 167 | Ga0316576_10004078 | 3300031727 | Bacteria | 8699 |
| 168 | Ga0316576_10016422 | 3300031727 | Bacteria | 4999 |
| 169 | Ga0316576_10045409 | 3300031727 | Bacteria | 3177 |
| 170 | Ga0316576_10065027 | 3300031727 | Bacteria | 2679 |
| 171 | Ga0316578_10036080 | 3300031728 | Bacteria | 2845 |
| 172 | Ga0316578_10071604 | 3300031728 | Bacteria | 2053 |
| 173 | Ga0316578_10210220 | 3300031728 | Bacteria | 1170 |
| 174 | Ga0307516_10006309 | 3300031730 | Bacteria | 13932 |
| 175 | Ga0307516_10130574 | 3300031730 | Bacteria | 2292 |
| 176 | Ga0307405_10019060 | 3300031731 | Bacteria | 3801 |
| 177 | Ga0307405_10019227 | 3300031731 | Bacteria | 3788 |
| 178 | Ga0307405_10020823 | 3300031731 | Bacteria | 3673 |
| 179 | Ga0307405_10107921 | 3300031731 | Bacteria | 1880 |
| 180 | Ga0307405_10184430 | 3300031731 | Bacteria | 1501 |
| 181 | Ga0307405_10199258 | 3300031731 | Bacteria | 1453 |
| 182 | Ga0307405_10454413 | 3300031731 | Bacteria | 1016 |
| 183 | Ga0316577_10046968 | 3300031733 | Bacteria | 2411 |
| 184 | Ga0316577_10050990 | 3300031733 | Bacteria | 2310 |
| 185 | Ga0307413_10040998 | 3300031824 | Bacteria | 2707 |
| 186 | Ga0307413_10118251 | 3300031824 | Bacteria | 1789 |
| 187 | Ga0307413_10167454 | 3300031824 | Bacteria | 1551 |
| 188 | Ga0307413_10291289 | 3300031824 | Bacteria | 1233 |
| 189 | Ga0307413_10714081 | 3300031824 | Bacteria | 834 |
| 190 | Ga0307410_10063569 | 3300031852 | Bacteria | 2532 |
| 191 | Ga0307410_10074478 | 3300031852 | Bacteria | 2364 |
| 192 | Ga0307410_10099525 | 3300031852 | Bacteria | 2081 |
| 193 | Ga0307410_10128873 | 3300031852 | Bacteria | 1856 |
| 194 | Ga0307410_10216173 | 3300031852 | Bacteria | 1472 |
| 195 | Ga0307410_10245932 | 3300031852 | Bacteria | 1388 |
| 196 | Ga0307410_10263369 | 3300031852 | Bacteria | 1345 |
| 197 | Ga0307406_10003776 | 3300031901 | Bacteria | 8239 |
| 198 | Ga0307406_10098115 | 3300031901 | Bacteria | 1989 |
| 199 | Ga0307407_10031870 | 3300031903 | Bacteria | 2859 |
| 200 | Ga0307407_10051310 | 3300031903 | Bacteria | 2364 |
| 201 | Ga0307407_10163681 | 3300031903 | Bacteria | 1458 |
| 202 | Ga0307407_10231529 | 3300031903 | Bacteria | 1255 |
| 203 | Ga0307407_10279467 | 3300031903 | Bacteria | 1156 |
| 204 | Ga0307412_10002167 | 3300031911 | Bacteria | 10899 |
| 205 | Ga0307412_10035701 | 3300031911 | Bacteria | 3178 |
| 206 | Ga0307412_10054152 | 3300031911 | Bacteria | 2662 |
| 207 | Ga0307412_10066367 | 3300031911 | Bacteria | 2445 |
| 208 | Ga0307412_10066538 | 3300031911 | Bacteria | 2443 |
| 209 | Ga0307412_10081507 | 3300031911 | Bacteria | 2238 |
| 210 | Ga0307412_10109121 | 3300031911 | Bacteria | 1972 |
| 211 | Ga0307412_10123610 | 3300031911 | Bacteria | 1867 |
| 212 | Ga0307412_10197197 | 3300031911 | Bacteria | 1526 |
| 213 | Ga0307412_10247329 | 3300031911 | Bacteria | 1383 |
| 214 | Ga0307412_10427084 | 3300031911 | Bacteria | 1085 |
| 215 | Ga0307409_100010515 | 3300031995 | Bacteria | 5760 |
| 216 | Ga0307409_100030508 | 3300031995 | Bacteria | 3874 |
| 217 | Ga0307409_100091466 | 3300031995 | Bacteria | 2493 |
| 218 | Ga0307409_100238664 | 3300031995 | Bacteria | 1653 |
| 219 | Ga0307409_100510694 | 3300031995 | Bacteria | 1172 |
| 220 | Ga0307409_100520353 | 3300031995 | Bacteria | 1162 |
| 221 | Ga0307409_101273079 | 3300031995 | Bacteria | 760 |
| 222 | Ga0307416_100017801 | 3300032002 | Bacteria | 4984 |
| 223 | Ga0307416_100134641 | 3300032002 | Bacteria | 2233 |
| 224 | Ga0307416_100193655 | 3300032002 | Bacteria | 1920 |
| 225 | Ga0307416_100195365 | 3300032002 | Bacteria | 1913 |
| 226 | Ga0307416_100219906 | 3300032002 | Bacteria | 1820 |
| 227 | Ga0307416_100223902 | 3300032002 | Bacteria | 1807 |
| 228 | Ga0307416_100288678 | 3300032002 | Bacteria | 1623 |
| 229 | Ga0307416_100418932 | 3300032002 | Bacteria | 1382 |
| 230 | Ga0307416_100463054 | 3300032002 | Bacteria | 1323 |
| 231 | Ga0307414_10178095 | 3300032004 | Bacteria | 1707 |
| 232 | Ga0307414_10206089 | 3300032004 | Bacteria | 1604 |
| 233 | Ga0307414_10247689 | 3300032004 | Bacteria | 1479 |
| 234 | Ga0307411_10085090 | 3300032005 | Bacteria | 2189 |
| 235 | Ga0307411_10293495 | 3300032005 | Bacteria | 1300 |
| 236 | Ga0307411_10804784 | 3300032005 | Bacteria | 828 |
| 237 | Ga0307415_100025727 | 3300032126 | Bacteria | 3700 |
| 238 | Ga0307415_100036532 | 3300032126 | Bacteria | 3220 |
| 239 | Ga0316583_10017096 | 3300032133 | Bacteria | 2609 |
| 240 | Ga0316585_10008022 | 3300032137 | Bacteria | 3054 |
| 241 | Ga0307507_10097159 | 3300033179 | Bacteria | 2486 |
| 242 | Ga0307510_10052677 | 3300033180 | Bacteria | 4286 |
| 243 | Ga0307510_10099400 | 3300033180 | Bacteria | 2708 |
| 244 | Ga0316574_0005219 | 3300035398 | Bacteria | 6906 |
| 245 | Ga0316574_0015037 | 3300035398 | Bacteria | 4484 |
| 246 | Ga0316574_0079775 | 3300035398 | Bacteria | 2076 |
| 247 | Ga0316574_0119614 | 3300035398 | Bacteria | 1691 |
| 248 | Ga0316574_0125633 | 3300035398 | Bacteria | 1649 |
| 249 | Ga0316574_0126968 | 3300035398 | Bacteria | 1640 |
| 250 | Ga0316574_0185047 | 3300035398 | Bacteria | 1340 |
| 251 | Ga0316574_0238191 | 3300035398 | Bacteria | 1164 |
| 252 | Ga0316582_0002951 | 3300036647 | Bacteria | 8189 |
| 253 | Ga0316584_0007287 | 3300036712 | Bacteria | 7551 |
| 254 | Ga0316584_0020262 | 3300036712 | Bacteria | 4818 |
| 255 | Ga0316584_0181806 | 3300036712 | Bacteria | 1556 |
| 256 | Ga0316584_0397436 | 3300036712 | Bacteria | 982 |
| 257 | Ga0395899_0089881 | 3300037312 | Bacteria | 2227 |
| 258 | Ga0395899_0119574 | 3300037312 | Bacteria | 1888 |
| 259 | Ga0395899_0264260 | 3300037312 | Bacteria | 1176 |
| 260 | Ga0395900_0018741 | 3300037418 | Bacteria | 7058 |
| 261 | Ga0395900_0019653 | 3300037418 | Bacteria | 6887 |
| 262 | Ga0395900_0123356 | 3300037418 | Bacteria | 2657 |
| 263 | Ga0395900_0136690 | 3300037418 | Bacteria | 2511 |
| 264 | Ga0395898_0001614 | 3300037466 | Bacteria | 30641 |
| 265 | Ga0395898_0017683 | 3300037466 | Bacteria | 7276 |
| 266 | Ga0395898_0029494 | 3300037466 | Bacteria | 5495 |
| 267 | Ga0395898_0035249 | 3300037466 | Bacteria | 4978 |
| 268 | Ga0395898_0088602 | 3300037466 | Bacteria | 2979 |
| 269 | Ga0395898_0466559 | 3300037466 | Bacteria | 1202 |
| 270 | Ga0395905_0189610 | 3300037471 | Bacteria | 1929 |
| 271 | Ga0436364_0879158 | 3300037853 | Bacteria | 8561 |
| 272 | Ga0395901_0013220 | 3300038443 | Bacteria | 8381 |
| 273 | Ga0395901_0020548 | 3300038443 | Bacteria | 6758 |
| 274 | Ga0395901_0029922 | 3300038443 | Bacteria | 5609 |
| 275 | Ga0395901_0032466 | 3300038443 | Bacteria | 5387 |
| 276 | Ga0395901_0092197 | 3300038443 | Bacteria | 3171 |
| 277 | Ga0395901_0201443 | 3300038443 | Bacteria | 2086 |
| 278 | Ga0395901_0582221 | 3300038443 | Bacteria | 1130 |
| 279 | Ga0439436_0001657 | 3300041404 | Bacteria | 6504 |
| 280 | Ga0439436_0010633 | 3300041404 | Bacteria | 2805 |
| 281 | Ga0439436_0012987 | 3300041404 | Bacteria | 2523 |
| 282 | Ga0439436_0019110 | 3300041404 | Bacteria | 2047 |
| 283 | Ga0439436_0029875 | 3300041404 | Bacteria | 1585 |
| 284 | Ga0439436_0077606 | 3300041404 | Bacteria | 925 |
| 285 | Ga0439439_0001237 | 3300041406 | Bacteria | 4961 |
| 286 | Ga0439439_0004531 | 3300041406 | Bacteria | 3143 |
| 287 | Ga0439447_049435 | 3300041407 | Bacteria | 1007 |
| 288 | Ga0439466_0000908 | 3300041411 | Bacteria | 11277 |
| 289 | Ga0439466_0005004 | 3300041411 | Bacteria | 5086 |
| 290 | Ga0439466_0023369 | 3300041411 | Bacteria | 2175 |
| 291 | Ga0439465_0006890 | 3300041413 | Bacteria | 3610 |
| 292 | Ga0451835_0563464 | 3300041492 | Bacteria | 1207 |
| 293 | Ga0451843_1388763 | 3300041509 | Bacteria | 1290 |
| 294 | Ga0451853_1643492 | 3300041512 | Bacteria | 1173 |
| 295 | Ga0451853_1923106 | 3300041512 | Bacteria | 2052 |
| 296 | Ga0439431_0029298 | 3300041997 | Bacteria | 1359 |
| 297 | Ga0439433_0000349 | 3300041999 | Bacteria | 8169 |
| 298 | Ga0439433_0000441 | 3300041999 | Bacteria | 7628 |
| 299 | Ga0439433_0013056 | 3300041999 | Bacteria | 1823 |
| 300 | Ga0439433_0016187 | 3300041999 | Bacteria | 1650 |
| 301 | Ga0439442_000043 | 3300042002 | Bacteria | 28612 |
| 302 | Ga0439442_000244 | 3300042002 | Bacteria | 13232 |
| 303 | Ga0439442_001405 | 3300042002 | Bacteria | 4760 |
| 304 | Ga0439442_002895 | 3300042002 | Bacteria | 3380 |
| 305 | Ga0439432_003697 | 3300042006 | Bacteria | 5658 |
| 306 | Ga0439449_0007219 | 3300042007 | Bacteria | 4228 |
| 307 | Ga0439449_0010997 | 3300042007 | Bacteria | 3414 |
| 308 | Ga0439449_0011042 | 3300042007 | Bacteria | 3406 |
| 309 | Ga0439449_0012687 | 3300042007 | Bacteria | 3168 |
| 310 | Ga0439449_0027037 | 3300042007 | Bacteria | 2141 |
| 311 | Ga0439449_0035646 | 3300042007 | Bacteria | 1851 |
| 312 | Ga0439449_0053348 | 3300042007 | Bacteria | 1494 |
| 313 | Ga0439452_019425 | 3300042010 | Bacteria | 1796 |
| 314 | Ga0439457_000675 | 3300042014 | Bacteria | 10082 |
| 315 | Ga0439457_000681 | 3300042014 | Bacteria | 10040 |
| 316 | Ga0439457_001073 | 3300042014 | Bacteria | 8258 |
| 317 | Ga0439457_003930 | 3300042014 | Bacteria | 3969 |
| 318 | Ga0439457_013048 | 3300042014 | Bacteria | 1868 |
| 319 | Ga0439462_0021119 | 3300042015 | Bacteria | 1700 |
| 320 | Ga0450919_000570 | 3300042121 | Bacteria | 4643 |
| 321 | Ga0450890_007900 | 3300042127 | Bacteria | 1361 |
| 322 | Ga0450894_000002 | 3300042131 | Bacteria | 41005 |
| 323 | Ga0450896_000446 | 3300042133 | Bacteria | 4231 |
| 324 | Ga0450898_000413 | 3300042134 | Bacteria | 4969 |
| 325 | Ga0450900_009014 | 3300042136 | Bacteria | 1258 |
| 326 | Ga0450906_000333 | 3300042145 | Bacteria | 9609 |
| 327 | Ga0450907_000198 | 3300042146 | Bacteria | 21876 |
| 328 | Ga0439446_0002486 | 3300042156 | Bacteria | 4433 |
| 329 | Ga0450908_000741 | 3300042184 | Bacteria | 6264 |
| 330 | Ga0450908_004069 | 3300042184 | Bacteria | 2827 |
| 331 | Ga0450909_000776 | 3300042185 | Bacteria | 4331 |
| 332 | Ga0439434_0001553 | 3300042435 | Bacteria | 6616 |
| 333 | Ga0439434_0046027 | 3300042435 | Bacteria | 1346 |
| 334 | Ga0450918_031723 | 3300042531 | Bacteria | 934 |
| 335 | Ga0466972_0005478 | 3300044658 | Bacteria | 6359 |
| 336 | Ga0466965_0099273 | 3300044683 | Bacteria | 1488 |
| 337 | Ga0466965_0247468 | 3300044683 | Bacteria | 956 |
| 338 | Ga0466966_0005061 | 3300044684 | Bacteria | 8661 |
| 339 | Ga0466966_0015910 | 3300044684 | Bacteria | 4972 |
| 340 | Ga0466961_0003265 | 3300044693 | Bacteria | 10098 |
| 341 | Ga0466961_0020736 | 3300044693 | Bacteria | 4230 |
| 342 | Ga0466963_0000235 | 3300044694 | Bacteria | 23900 |
| 343 | Ga0466963_0000660 | 3300044694 | Bacteria | 16639 |
| 344 | Ga0466971_0000919 | 3300044719 | Bacteria | 12083 |
| 345 | Ga0466971_0033209 | 3300044719 | Bacteria | 2312 |
| 346 | Ga0466970_0001067 | 3300044765 | Bacteria | 13269 |
| 347 | Ga0466970_0016547 | 3300044765 | Bacteria | 3805 |
| 348 | Ga0466970_0025706 | 3300044765 | Bacteria | 3084 |
| 349 | Ga0466957_0000208 | 3300044842 | Bacteria | 27496 |
| 350 | Ga0466957_0249594 | 3300044842 | Bacteria | 1180 |
| 351 | Ga0466960_0004019 | 3300044901 | Bacteria | 5719 |
| 352 | Ga0466960_0079691 | 3300044901 | Bacteria | 1647 |
| 353 | Ga0466959_0003279 | 3300045049 | Bacteria | 10551 |
| 354 | Ga0466958_0006249 | 3300045836 | Bacteria | 6467 |
| 355 | Ga0466967_0020545 | 3300045976 | Bacteria | 5342 |
| 356 | Ga0466967_0027354 | 3300045976 | Bacteria | 4743 |
| 357 | Ga0466967_0095240 | 3300045976 | Bacteria | 2713 |
| 358 | Ga0466967_0261281 | 3300045976 | Bacteria | 1656 |
| 359 | Ga0466967_0402928 | 3300045976 | Bacteria | 1331 |
| 360 | Ga0466967_0773953 | 3300045976 | Bacteria | 952 |
| 361 | Ga0495617_003136 | 3300046452 | Bacteria | 6294 |
| 362 | Ga0495627_060426 | 3300046453 | Bacteria | 1122 |
| 363 | Ga0495592_0004317 | 3300046454 | Bacteria | 10399 |
| 364 | Ga0495592_0024917 | 3300046454 | Bacteria | 4546 |
| 365 | Ga0495592_0094302 | 3300046454 | Bacteria | 2142 |
| 366 | Ga0495603_0005260 | 3300046455 | Bacteria | 7723 |
| 367 | Ga0495603_0005776 | 3300046455 | Bacteria | 7403 |
| 368 | Ga0495603_0040998 | 3300046455 | Bacteria | 2770 |
| 369 | Ga0495590_0013239 | 3300046457 | Bacteria | 3039 |
| 370 | Ga0495629_0075331 | 3300046459 | Bacteria | 2356 |
| 371 | Ga0495629_0093475 | 3300046459 | Bacteria | 2099 |
| 372 | Ga0495629_0171905 | 3300046459 | Bacteria | 1503 |
| 373 | Ga0495638_0140132 | 3300046460 | Bacteria | 1412 |
| 374 | Ga0495651_0003166 | 3300046462 | Bacteria | 12675 |
| 375 | Ga0495651_0020410 | 3300046462 | Bacteria | 5144 |
| 376 | Ga0495651_0176121 | 3300046462 | Bacteria | 1518 |
| 377 | Ga0495651_0324177 | 3300046462 | Bacteria | 1026 |
| 378 | Ga0495653_0020578 | 3300046463 | Bacteria | 5348 |
| 379 | Ga0495653_0216786 | 3300046463 | Bacteria | 1289 |
| 380 | Ga0495580_0004371 | 3300046472 | Bacteria | 11866 |
| 381 | Ga0495580_0016668 | 3300046472 | Bacteria | 5514 |
| 382 | Ga0495580_0046984 | 3300046472 | Bacteria | 3061 |
| 383 | Ga0495582_0020270 | 3300046473 | Bacteria | 3639 |
| 384 | Ga0495582_0078429 | 3300046473 | Bacteria | 1832 |
| 385 | Ga0495582_0084006 | 3300046473 | Bacteria | 1769 |
| 386 | Ga0495605_0014983 | 3300046474 | Bacteria | 4227 |
| 387 | Ga0495639_0009320 | 3300046475 | Bacteria | 4210 |
| 388 | Ga0495639_0123249 | 3300046475 | Bacteria | 1237 |
| 389 | Ga0495662_0000925 | 3300046476 | Bacteria | 14359 |
| 390 | Ga0495662_0014134 | 3300046476 | Bacteria | 3884 |
| 391 | Ga0495662_0022537 | 3300046476 | Bacteria | 3041 |
| 392 | Ga0495662_0045982 | 3300046476 | Bacteria | 2108 |
| 393 | Ga0495664_0000664 | 3300046477 | Bacteria | 17513 |
| 394 | Ga0495664_0051009 | 3300046477 | Bacteria | 2457 |
| 395 | Ga0495664_0200163 | 3300046477 | Bacteria | 1210 |
| 396 | Ga0495585_0021286 | 3300046492 | Bacteria | 3724 |
| 397 | Ga0495585_0047873 | 3300046492 | Bacteria | 2379 |
| 398 | Ga0495585_0054493 | 3300046492 | Bacteria | 2210 |
| 399 | Ga0495585_0128457 | 3300046492 | Bacteria | 1336 |
| 400 | Ga0495594_0013329 | 3300046499 | Bacteria | 4290 |
| 401 | Ga0495594_0033866 | 3300046499 | Bacteria | 2778 |
| 402 | Ga0495594_0042576 | 3300046499 | Bacteria | 2487 |
| 403 | Ga0495594_0070743 | 3300046499 | Bacteria | 1939 |
| 404 | Ga0495594_0376992 | 3300046499 | Bacteria | 807 |
| 405 | Ga0495596_0019518 | 3300046500 | Bacteria | 2783 |
| 406 | Ga0495607_0036894 | 3300046501 | Bacteria | 2940 |
| 407 | Ga0495607_0046065 | 3300046501 | Bacteria | 2563 |
| 408 | Ga0495607_0122556 | 3300046501 | Bacteria | 1362 |
| 409 | Ga0495583_0049174 | 3300046506 | Bacteria | 1932 |
| 410 | Ga0495606_0016141 | 3300046507 | Bacteria | 5712 |
| 411 | Ga0495608_0022867 | 3300046511 | Bacteria | 4289 |
| 412 | Ga0495608_0267747 | 3300046511 | Bacteria | 1063 |
| 413 | Ga0495616_0009847 | 3300046513 | Bacteria | 5564 |
| 414 | Ga0495618_0009745 | 3300046514 | Bacteria | 5804 |
| 415 | Ga0495618_0113560 | 3300046514 | Bacteria | 1734 |
| 416 | Ga0495618_0127986 | 3300046514 | Bacteria | 1625 |
| 417 | Ga0495628_0008429 | 3300046516 | Bacteria | 8842 |
| 418 | Ga0495628_0035779 | 3300046516 | Bacteria | 3989 |
| 419 | Ga0495630_0117295 | 3300046517 | Bacteria | 2018 |
| 420 | Ga0495630_0372872 | 3300046517 | Bacteria | 1093 |
| 421 | Ga0495631_0012088 | 3300046518 | Bacteria | 4227 |
| 422 | Ga0495631_0037212 | 3300046518 | Bacteria | 2169 |
| 423 | Ga0495631_0185345 | 3300046518 | Bacteria | 891 |
| 424 | Ga0495632_0173830 | 3300046519 | Bacteria | 988 |
| 425 | Ga0495637_0172616 | 3300046520 | Bacteria | 805 |
| 426 | Ga0495643_0005652 | 3300046522 | Bacteria | 8384 |
| 427 | Ga0495644_0016789 | 3300046523 | Bacteria | 2801 |
| 428 | Ga0495648_0015807 | 3300046524 | Bacteria | 5458 |
| 429 | Ga0495666_0040124 | 3300046526 | Bacteria | 2270 |
| 430 | Ga0495666_0094899 | 3300046526 | Bacteria | 1407 |
| 431 | Ga0495642_0183017 | 3300046528 | Bacteria | 912 |
| 432 | Ga0495652_0008679 | 3300046529 | Bacteria | 9264 |
| 433 | Ga0495652_0073914 | 3300046529 | Bacteria | 2836 |
| 434 | Ga0495654_0016128 | 3300046530 | Bacteria | 3955 |
| 435 | Ga0495665_0000709 | 3300046531 | Bacteria | 17165 |
| 436 | Ga0495640_0010469 | 3300046533 | Bacteria | 7164 |
| 437 | Ga0495640_0014466 | 3300046533 | Bacteria | 5971 |
| 438 | Ga0495640_0020798 | 3300046533 | Bacteria | 4822 |
| 439 | Ga0495586_0003928 | 3300046535 | Bacteria | 7975 |
| 440 | Ga0495586_0013203 | 3300046535 | Bacteria | 4379 |
| 441 | Ga0495586_0036644 | 3300046535 | Bacteria | 2633 |
| 442 | Ga0495586_0159189 | 3300046535 | Bacteria | 1273 |
| 443 | Ga0495587_0000658 | 3300046536 | Bacteria | 23139 |
| 444 | Ga0495587_0022960 | 3300046536 | Bacteria | 3836 |
| 445 | Ga0495609_0016813 | 3300046538 | Bacteria | 3406 |
| 446 | Ga0495597_0010337 | 3300046542 | Bacteria | 4567 |
| 447 | Ga0495645_0012546 | 3300046543 | Bacteria | 5973 |
| 448 | Ga0495645_0025143 | 3300046543 | Bacteria | 4321 |
| 449 | Ga0495622_0041053 | 3300046557 | Bacteria | 2152 |
| 450 | Ga0495622_0044969 | 3300046557 | Bacteria | 2052 |
| 451 | Ga0495622_0047368 | 3300046557 | Bacteria | 1997 |
| 452 | Ga0495633_0008851 | 3300046558 | Bacteria | 5618 |
| 453 | Ga0495667_0016886 | 3300046559 | Bacteria | 4928 |
| 454 | Ga0495667_0103838 | 3300046559 | Bacteria | 1838 |
| 455 | Ga0495667_0132837 | 3300046559 | Bacteria | 1605 |
| 456 | Ga0495656_0002635 | 3300046615 | Bacteria | 5986 |
| 457 | Ga0495634_0000101 | 3300046642 | Bacteria | 70643 |
| 458 | Ga0495634_0015046 | 3300046642 | Bacteria | 5561 |
| 459 | Ga0495634_0024152 | 3300046642 | Bacteria | 4268 |
| 460 | Ga0495634_0053671 | 3300046642 | Bacteria | 2699 |
| 461 | Ga0495634_0350107 | 3300046642 | Bacteria | 885 |
| 462 | Ga0495611_0025599 | 3300046648 | Bacteria | 2572 |
| 463 | Ga0495625_0007840 | 3300046660 | Bacteria | 9199 |
| 464 | Ga0495635_0001452 | 3300046663 | Bacteria | 15859 |
| 465 | Ga0495635_0043980 | 3300046663 | Bacteria | 3081 |
| 466 | Ga0495635_0135725 | 3300046663 | Bacteria | 1677 |
| 467 | Ga0495635_0160729 | 3300046663 | Bacteria | 1529 |
| 468 | Ga0495635_0175284 | 3300046663 | Bacteria | 1458 |
| 469 | Ga0495635_0196351 | 3300046663 | Bacteria | 1369 |
| 470 | Ga0495661_0026260 | 3300046665 | Bacteria | 3752 |
| 471 | Ga0495661_0176007 | 3300046665 | Bacteria | 1137 |
| 472 | Ga0495661_0241508 | 3300046665 | Bacteria | 926 |
| 473 | Ga0495588_0001531 | 3300046674 | Bacteria | 9890 |
| 474 | Ga0495588_0007227 | 3300046674 | Bacteria | 5040 |
| 475 | Ga0495588_0009869 | 3300046674 | Bacteria | 4426 |
| 476 | Ga0495588_0014083 | 3300046674 | Bacteria | 3822 |
| 477 | Ga0495588_0249451 | 3300046674 | Bacteria | 936 |
| 478 | Ga0495588_0292286 | 3300046674 | Bacteria | 858 |
| 479 | Ga0495657_0000552 | 3300046675 | Bacteria | 34564 |
| 480 | Ga0495657_0004622 | 3300046675 | Bacteria | 10993 |
| 481 | Ga0495657_0006650 | 3300046675 | Bacteria | 9028 |
| 482 | Ga0495657_0031016 | 3300046675 | Bacteria | 3739 |
| 483 | Ga0495657_0067147 | 3300046675 | Bacteria | 2354 |
| 484 | Ga0495599_0027508 | 3300046678 | Bacteria | 3565 |
| 485 | Ga0495646_0000429 | 3300046680 | Bacteria | 22240 |
| 486 | Ga0495646_0022317 | 3300046680 | Bacteria | 3994 |
| 487 | Ga0495658_0078857 | 3300046683 | Bacteria | 1928 |
| 488 | Ga0495658_0080405 | 3300046683 | Bacteria | 1911 |
| 489 | Ga0495658_0086017 | 3300046683 | Bacteria | 1854 |
| 490 | Ga0495613_0002646 | 3300046689 | Bacteria | 13464 |
| 491 | Ga0495613_0007164 | 3300046689 | Bacteria | 8305 |
| 492 | Ga0495613_0013402 | 3300046689 | Bacteria | 6091 |
| 493 | Ga0495613_0035627 | 3300046689 | Bacteria | 3692 |
| 494 | Ga0495613_0145573 | 3300046689 | Bacteria | 1691 |
| 495 | Ga0495624_0008308 | 3300046690 | Bacteria | 7256 |
| 496 | Ga0495624_0054375 | 3300046690 | Bacteria | 2524 |
| 497 | Ga0495624_0321137 | 3300046690 | Bacteria | 932 |
| 498 | Ga0495671_0099660 | 3300046692 | Bacteria | 1420 |
| 499 | Ga0495649_0131477 | 3300046694 | Bacteria | 1320 |
| 500 | Ga0495649_0167644 | 3300046694 | Bacteria | 1150 |
| 501 | Ga0495589_0005737 | 3300046794 | Bacteria | 6548 |
| 502 | Ga0495589_0014246 | 3300046794 | Bacteria | 4097 |
| 503 | Ga0495589_0141825 | 3300046794 | Bacteria | 1150 |
| 504 | Ga0495600_0017269 | 3300046809 | Bacteria | 4587 |
| 505 | Ga0495600_0039550 | 3300046809 | Bacteria | 3071 |
| 506 | Ga0495600_0133929 | 3300046809 | Bacteria | 1610 |
| 507 | Ga0495600_0164684 | 3300046809 | Bacteria | 1432 |
| 508 | Ga0495660_0103924 | 3300046810 | Bacteria | 1458 |
| 509 | Ga0495581_0045046 | 3300047315 | Bacteria | 2551 |
| 510 | Ga0495581_0071489 | 3300047315 | Bacteria | 2007 |
| 511 | Ga0495581_0089678 | 3300047315 | Bacteria | 1783 |
| 512 | Ga0495581_0175076 | 3300047315 | Bacteria | 1255 |
| 513 | Ga0495581_0261246 | 3300047315 | Bacteria | 1012 |
| 514 | Ga0495604_0000157 | 3300047317 | Bacteria | 59668 |
| 515 | Ga0495604_0000361 | 3300047317 | Bacteria | 40795 |
| 516 | Ga0495604_0070386 | 3300047317 | Bacteria | 2649 |
| 517 | Ga0495604_0141038 | 3300047317 | Bacteria | 1721 |
| 518 | Ga0495604_0257762 | 3300047317 | Bacteria | 1186 |
| 519 | Ga0495636_0004966 | 3300047318 | Bacteria | 5216 |
| 520 | Ga0495636_0006595 | 3300047318 | Bacteria | 4564 |
| 521 | Ga0495636_0078159 | 3300047318 | Bacteria | 1421 |
| 522 | Ga0495636_0106933 | 3300047318 | Bacteria | 1228 |
| 523 | Ga0495676_0002174 | 3300047321 | Bacteria | 17362 |
| 524 | Ga0495676_0005356 | 3300047321 | Bacteria | 11751 |
| 525 | Ga0495676_0031033 | 3300047321 | Bacteria | 4526 |
| 526 | Ga0495676_0125964 | 3300047321 | Bacteria | 1856 |
| 527 | Ga0495680_0003856 | 3300047322 | Bacteria | 14535 |
| 528 | Ga0495680_0040734 | 3300047322 | Bacteria | 3699 |
| 529 | Ga0495680_0474965 | 3300047322 | Bacteria | 852 |
| 530 | Ga0495683_0032415 | 3300047323 | Bacteria | 2661 |
| 531 | Ga0495687_002727 | 3300047443 | Bacteria | 13703 |
| 532 | Ga0495687_011261 | 3300047443 | Bacteria | 4820 |
| 533 | Ga0495675_0060083 | 3300047444 | Bacteria | 2409 |
| 534 | Ga0495675_0070316 | 3300047444 | Bacteria | 2210 |
| 535 | Ga0495675_0081242 | 3300047444 | Bacteria | 2041 |
| 536 | Ga0495675_0323878 | 3300047444 | Bacteria | 911 |
| 537 | Ga0495677_0159586 | 3300047445 | Bacteria | 870 |
| 538 | Ga0495685_001913 | 3300047447 | Bacteria | 6430 |
| 539 | Ga0495685_017235 | 3300047447 | Bacteria | 2472 |
| 540 | Ga0495685_022354 | 3300047447 | Bacteria | 2176 |
| 541 | Ga0495685_043189 | 3300047447 | Bacteria | 1538 |
| 542 | Ga0495685_050387 | 3300047447 | Bacteria | 1413 |
| 543 | Ga0495681_0026023 | 3300047470 | Bacteria | 3055 |
| 544 | Ga0495681_0049851 | 3300047470 | Bacteria | 1977 |
| 545 | Ga0495684_0061745 | 3300047471 | Bacteria | 2851 |
| 546 | Ga0495684_0133444 | 3300047471 | Bacteria | 1864 |
| 547 | Ga0495686_0053603 | 3300047472 | Bacteria | 2527 |
| 548 | Ga0495686_0066980 | 3300047472 | Bacteria | 2218 |
| 549 | Ga0495593_0000465 | 3300047673 | Bacteria | 22778 |
| 550 | Ga0495593_0030095 | 3300047673 | Bacteria | 2973 |
| 551 | Ga0495593_0101341 | 3300047673 | Bacteria | 1476 |
| 552 | Ga0495602_0023858 | 3300048088 | Bacteria | 5948 |
| 553 | Ga0495602_0225310 | 3300048088 | Bacteria | 1412 |
| 554 | Ga0495614_0000093 | 3300048089 | Bacteria | 29971 |
| 555 | Ga0495614_0081802 | 3300048089 | Bacteria | 1400 |
| 556 | Ga0495626_0035142 | 3300048091 | Bacteria | 2393 |
| 557 | Ga0496100_0030948 | 3300048903 | Bacteria | 3323 |
| 558 | Ga0496100_0107858 | 3300048903 | Bacteria | 1930 |
| 559 | Ga0496101_0345334 | 3300048904 | Bacteria | 1169 |
| 560 | Ga0496102_0050712 | 3300048905 | Bacteria | 3780 |
| 561 | Ga0496102_0056408 | 3300048905 | Bacteria | 3583 |
| 562 | Ga0496102_0188511 | 3300048905 | Bacteria | 1943 |
| 563 | Ga0496102_0199981 | 3300048905 | Bacteria | 1883 |
| 564 | Ga0496102_0210638 | 3300048905 | Bacteria | 1832 |
| 565 | Ga0496102_0532542 | 3300048905 | Bacteria | 1097 |
| 566 | Ga0496102_0572523 | 3300048905 | Bacteria | 1052 |
| 567 | Ga0496103_0004543 | 3300048906 | Bacteria | 8399 |
| 568 | Ga0496103_0025891 | 3300048906 | Bacteria | 3548 |
| 569 | Ga0496103_0050167 | 3300048906 | Bacteria | 2581 |
| 570 | Ga0496103_0080157 | 3300048906 | Bacteria | 2052 |
| 571 | Ga0496103_0210679 | 3300048906 | Bacteria | 1250 |
| 572 | Ga0496104_0618988 | 3300048907 | Bacteria | 992 |
| 573 | Ga0496105_0011201 | 3300048908 | Bacteria | 7075 |
| 574 | Ga0496105_0125876 | 3300048908 | Bacteria | 2112 |
| 575 | Ga0496105_0144784 | 3300048908 | Bacteria | 1954 |
| 576 | Ga0496105_0279051 | 3300048908 | Bacteria | 1348 |
| 577 | Ga0496105_0553624 | 3300048908 | Bacteria | 897 |
| 578 | Ga0496106_0014770 | 3300048909 | Bacteria | 5774 |
| 579 | Ga0496106_0015995 | 3300048909 | Bacteria | 5548 |
| 580 | Ga0496106_0184502 | 3300048909 | Bacteria | 1657 |
| 581 | Ga0496106_0189516 | 3300048909 | Bacteria | 1635 |
| 582 | Ga0496107_0335137 | 3300048910 | Bacteria | 1125 |
| 583 | Ga0496107_0422054 | 3300048910 | Bacteria | 991 |
| 584 | Ga0496108_0367320 | 3300048911 | Bacteria | 1256 |
| 585 | Ga0496108_0770025 | 3300048911 | Bacteria | 831 |
| 586 | Ga0496109_0016561 | 3300048912 | Bacteria | 6447 |
| 587 | Ga0496109_0081163 | 3300048912 | Bacteria | 2988 |
| 588 | Ga0496109_0098198 | 3300048912 | Bacteria | 2715 |
| 589 | Ga0496109_0119524 | 3300048912 | Bacteria | 2454 |
| 590 | Ga0496109_0342937 | 3300048912 | Bacteria | 1411 |
| 591 | Ga0496109_0615360 | 3300048912 | Bacteria | 1022 |
| 592 | Ga0496110_0006639 | 3300048913 | Bacteria | 9191 |
| 593 | Ga0496110_0078331 | 3300048913 | Bacteria | 2942 |
| 594 | Ga0496110_0317796 | 3300048913 | Bacteria | 1418 |
| 595 | Ga0496110_0570257 | 3300048913 | Bacteria | 1028 |
| 596 | Ga0496110_0610020 | 3300048913 | Bacteria | 989 |
| 597 | Ga0496110_0780047 | 3300048913 | Bacteria | 860 |
| 598 | Ga0496111_0040946 | 3300048914 | Bacteria | 3323 |
| 599 | Ga0496111_0062484 | 3300048914 | Bacteria | 2700 |
| 600 | Ga0496111_0444587 | 3300048914 | Bacteria | 957 |
| 601 | Ga0496112_0021629 | 3300048915 | Bacteria | 6118 |
| 602 | Ga0496112_0065168 | 3300048915 | Bacteria | 3595 |
| 603 | Ga0496113_0182803 | 3300048916 | Bacteria | 1662 |
| 604 | Ga0496113_0201618 | 3300048916 | Bacteria | 1582 |
| 605 | Ga0496113_0218620 | 3300048916 | Bacteria | 1518 |
| 606 | Ga0496113_0218716 | 3300048916 | Bacteria | 1518 |
| 607 | Ga0496114_0009438 | 3300048917 | Bacteria | 7745 |
| 608 | Ga0496114_0020113 | 3300048917 | Bacteria | 5416 |
| 609 | Ga0496114_0085903 | 3300048917 | Bacteria | 2665 |
| 610 | Ga0496114_0152923 | 3300048917 | Bacteria | 2002 |
| 611 | Ga0496114_0153933 | 3300048917 | Bacteria | 1995 |
| 612 | Ga0496115_0123402 | 3300048918 | Bacteria | 2132 |
| 613 | Ga0496117_0001302 | 3300048920 | Bacteria | 36720 |
| 614 | Ga0496118_0001377 | 3300048921 | Bacteria | 36644 |
| 615 | Ga0496119_0169294 | 3300048922 | Bacteria | 1155 |
| 616 | Ga0496119_0197740 | 3300048922 | Bacteria | 1042 |
| 617 | Ga0496119_0202055 | 3300048922 | Bacteria | 1028 |
| 618 | Ga0496121_0215276 | 3300048924 | Bacteria | 1358 |
| 619 | Ga0496122_0001610 | 3300048925 | Bacteria | 35298 |
| 620 | Ga0496122_0303126 | 3300048925 | Bacteria | 860 |
| 621 | Ga0496123_0071895 | 3300048926 | Bacteria | 2155 |
| 622 | Ga0496124_0000037 | 3300048927 | Bacteria | 317430 |
| 623 | Ga0496124_0011460 | 3300048927 | Bacteria | 8863 |
| 624 | Ga0496124_0098360 | 3300048927 | Bacteria | 2374 |
| 625 | Ga0496125_0187671 | 3300048928 | Bacteria | 1369 |
| 626 | Ga0501309_005755 | 3300049129 | Bacteria | 1489 |
| 627 | Ga0501309_010224 | 3300049129 | Bacteria | 1207 |
| 628 | Ga0501310_000129 | 3300049130 | Bacteria | 7487 |
| 629 | Ga0501305_005486 | 3300049161 | Bacteria | 1539 |
| 630 | Ga0495678_027438 | 3300049459 | Bacteria | 2416 |
| 631 | Ga0495682_0044442 | 3300049460 | Bacteria | 1625 |
| 632 | Ga0501315_004345 | 3300049531 | Bacteria | 1477 |
| 633 | Ga0501316_013077 | 3300049532 | Bacteria | 977 |
| 634 | Ga0501317_002804 | 3300049533 | Bacteria | 1682 |
| 635 | Ga0501317_021968 | 3300049533 | Bacteria | 871 |
| 636 | Ga0501317_024623 | 3300049533 | Bacteria | 838 |
| 637 | Ga0501318_009998 | 3300049534 | Bacteria | 1044 |
| 638 | Ga0501318_015624 | 3300049534 | Bacteria | 909 |
| 639 | Ga0501318_025176 | 3300049534 | Bacteria | 779 |
| 640 | Ga0501321_001807 | 3300049537 | Bacteria | 1771 |
| 641 | Ga0501321_003269 | 3300049537 | Bacteria | 1472 |
| 642 | Ga0501321_014403 | 3300049537 | Bacteria | 920 |
| 643 | Ga0501323_003533 | 3300049539 | Bacteria | 1602 |
| 644 | Ga0501323_019237 | 3300049539 | Bacteria | 889 |
| 645 | Ga0501324_001778 | 3300049540 | Bacteria | 1488 |
| 646 | Ga0501325_005173 | 3300049541 | Bacteria | 1029 |
| 647 | Ga0501031_0002670 | 3300049568 | Bacteria | 11353 |
| 648 | Ga0501031_0005968 | 3300049568 | Bacteria | 7947 |
| 649 | Ga0501031_0011273 | 3300049568 | Bacteria | 5825 |
| 650 | Ga0501031_0044524 | 3300049568 | Bacteria | 2896 |
| 651 | Ga0501031_0101938 | 3300049568 | Bacteria | 1873 |
| 652 | Ga0501031_0117787 | 3300049568 | Bacteria | 1735 |
| 653 | Ga0501031_0488672 | 3300049568 | Bacteria | 794 |
| 654 | Ga0501032_0002322 | 3300049569 | Bacteria | 14909 |
| 655 | Ga0501032_0015763 | 3300049569 | Bacteria | 5329 |
| 656 | Ga0501032_0018598 | 3300049569 | Bacteria | 4865 |
| 657 | Ga0501032_0090164 | 3300049569 | Bacteria | 2034 |
| 658 | Ga0501032_0143424 | 3300049569 | Bacteria | 1572 |
| 659 | Ga0501032_0360471 | 3300049569 | Bacteria | 936 |
| 660 | Ga0501033_0001319 | 3300049570 | Bacteria | 22075 |
| 661 | Ga0501033_0005404 | 3300049570 | Bacteria | 10123 |
| 662 | Ga0501033_0019385 | 3300049570 | Bacteria | 5143 |
| 663 | Ga0501033_0143822 | 3300049570 | Bacteria | 1723 |
| 664 | Ga0501033_0186369 | 3300049570 | Bacteria | 1486 |
| 665 | Ga0501033_0310759 | 3300049570 | Bacteria | 1108 |
| 666 | Ga0501034_0000016 | 3300049571 | Bacteria | 289751 |
| 667 | Ga0501034_0005536 | 3300049571 | Bacteria | 13773 |
| 668 | Ga0501034_0009232 | 3300049571 | Bacteria | 10337 |
| 669 | Ga0501034_0015502 | 3300049571 | Bacteria | 7829 |
| 670 | Ga0501034_0076901 | 3300049571 | Bacteria | 3344 |
| 671 | Ga0501034_0239070 | 3300049571 | Bacteria | 1762 |
| 672 | Ga0501034_0243164 | 3300049571 | Bacteria | 1745 |
| 673 | Ga0501036_0001160 | 3300049572 | Bacteria | 20034 |
| 674 | Ga0501036_0022302 | 3300049572 | Bacteria | 5326 |
| 675 | Ga0501036_0029422 | 3300049572 | Bacteria | 4640 |
| 676 | Ga0501036_0046316 | 3300049572 | Bacteria | 3682 |
| 677 | Ga0501036_0059965 | 3300049572 | Bacteria | 3223 |
| 678 | Ga0501036_0202262 | 3300049572 | Bacteria | 1670 |
| 679 | Ga0501037_0004927 | 3300049573 | Bacteria | 9714 |
| 680 | Ga0501037_0018177 | 3300049573 | Bacteria | 5179 |
| 681 | Ga0501037_0141209 | 3300049573 | Bacteria | 1723 |
| 682 | Ga0501037_0237418 | 3300049573 | Bacteria | 1278 |
| 683 | Ga0501037_0447586 | 3300049573 | Bacteria | 881 |
| 684 | Ga0501038_0014610 | 3300049574 | Bacteria | 7155 |
| 685 | Ga0501038_0037790 | 3300049574 | Bacteria | 4232 |
| 686 | Ga0501038_0052584 | 3300049574 | Bacteria | 3511 |
| 687 | Ga0501038_0093535 | 3300049574 | Bacteria | 2515 |
| 688 | Ga0501038_0104229 | 3300049574 | Bacteria | 2357 |
| 689 | Ga0501038_0176972 | 3300049574 | Bacteria | 1723 |
| 690 | Ga0501038_0188773 | 3300049574 | Bacteria | 1659 |
| 691 | Ga0501039_0002048 | 3300049575 | Bacteria | 14943 |
| 692 | Ga0501039_0003912 | 3300049575 | Bacteria | 11189 |
| 693 | Ga0501039_0052487 | 3300049575 | Bacteria | 3155 |
| 694 | Ga0501039_0055425 | 3300049575 | Bacteria | 3070 |
| 695 | Ga0501039_0067545 | 3300049575 | Bacteria | 2776 |
| 696 | Ga0501039_0086315 | 3300049575 | Bacteria | 2444 |
| 697 | Ga0501039_0162611 | 3300049575 | Bacteria | 1755 |
| 698 | Ga0501040_0005244 | 3300049576 | Bacteria | 8377 |
| 699 | Ga0501040_0021373 | 3300049576 | Bacteria | 4321 |
| 700 | Ga0501040_0057853 | 3300049576 | Bacteria | 2663 |
| 701 | Ga0501041_0005106 | 3300049577 | Bacteria | 7658 |
| 702 | Ga0501041_0100633 | 3300049577 | Bacteria | 1789 |
| 703 | Ga0501041_0128095 | 3300049577 | Bacteria | 1581 |
| 704 | Ga0501042_0007416 | 3300049578 | Bacteria | 7182 |
| 705 | Ga0501042_0086086 | 3300049578 | Bacteria | 2253 |
| 706 | Ga0501042_0193532 | 3300049578 | Bacteria | 1467 |
| 707 | Ga0501042_0195381 | 3300049578 | Bacteria | 1459 |
| 708 | Ga0501043_0005857 | 3300049579 | Bacteria | 9888 |
| 709 | Ga0501043_0031178 | 3300049579 | Bacteria | 4192 |
| 710 | Ga0501043_0031683 | 3300049579 | Bacteria | 4156 |
| 711 | Ga0501043_0050584 | 3300049579 | Bacteria | 3266 |
| 712 | Ga0501043_0052441 | 3300049579 | Bacteria | 3203 |
| 713 | Ga0501043_0058889 | 3300049579 | Bacteria | 3014 |
| 714 | Ga0501043_0083113 | 3300049579 | Bacteria | 2517 |
| 715 | Ga0501043_0132457 | 3300049579 | Bacteria | 1953 |
| 716 | Ga0501046_0008062 | 3300049580 | Bacteria | 9202 |
| 717 | Ga0501046_0019116 | 3300049580 | Bacteria | 5683 |
| 718 | Ga0501046_0019177 | 3300049580 | Bacteria | 5674 |
| 719 | Ga0501046_0047998 | 3300049580 | Bacteria | 3382 |
| 720 | Ga0501047_0000055 | 3300049581 | Bacteria | 144149 |
| 721 | Ga0501047_0005299 | 3300049581 | Bacteria | 12120 |
| 722 | Ga0501047_0034303 | 3300049581 | Bacteria | 4899 |
| 723 | Ga0501047_0050108 | 3300049581 | Bacteria | 4032 |
| 724 | Ga0501047_0061090 | 3300049581 | Bacteria | 3636 |
| 725 | Ga0501047_0065492 | 3300049581 | Bacteria | 3503 |
| 726 | Ga0501047_0237624 | 3300049581 | Bacteria | 1673 |
| 727 | Ga0501047_0296380 | 3300049581 | Bacteria | 1460 |
| 728 | Ga0501048_0032810 | 3300049582 | Bacteria | 3752 |
| 729 | Ga0501048_0043286 | 3300049582 | Bacteria | 3223 |
| 730 | Ga0501067_0003965 | 3300049583 | Bacteria | 8165 |
| 731 | Ga0501068_0016577 | 3300049584 | Bacteria | 4247 |
| 732 | Ga0501068_0265838 | 3300049584 | Bacteria | 1095 |
| 733 | Ga0501069_0066831 | 3300049585 | Bacteria | 2011 |
| 734 | Ga0501069_0084361 | 3300049585 | Bacteria | 1792 |
| 735 | Ga0501069_0091178 | 3300049585 | Bacteria | 1723 |
| 736 | Ga0501070_0001349 | 3300049586 | Bacteria | 21967 |
| 737 | Ga0501070_0052604 | 3300049586 | Bacteria | 3380 |
| 738 | Ga0501070_0057506 | 3300049586 | Bacteria | 3223 |
| 739 | Ga0501070_0146652 | 3300049586 | Bacteria | 1948 |
| 740 | Ga0501071_0000571 | 3300049587 | Bacteria | 19061 |
| 741 | Ga0501071_0024403 | 3300049587 | Bacteria | 4230 |
| 742 | Ga0501071_0043187 | 3300049587 | Bacteria | 3231 |
| 743 | Ga0501071_0485697 | 3300049587 | Bacteria | 947 |
| 744 | Ga0501071_0633065 | 3300049587 | Bacteria | 823 |
| 745 | Ga0501072_0000629 | 3300049588 | Bacteria | 25276 |
| 746 | Ga0501072_0060975 | 3300049588 | Bacteria | 2974 |
| 747 | Ga0501072_0070412 | 3300049588 | Bacteria | 2762 |
| 748 | Ga0501073_0009051 | 3300049589 | Bacteria | 7350 |
| 749 | Ga0501074_0001576 | 3300049590 | Bacteria | 15433 |
| 750 | Ga0501074_0002907 | 3300049590 | Bacteria | 12017 |
| 751 | Ga0501075_0005422 | 3300049591 | Bacteria | 8725 |
| 752 | Ga0501076_0026435 | 3300049592 | Bacteria | 4497 |
| 753 | Ga0501076_0027346 | 3300049592 | Bacteria | 4423 |
| 754 | Ga0501077_0002763 | 3300049593 | Bacteria | 10522 |
| 755 | Ga0501077_0048442 | 3300049593 | Bacteria | 2700 |
| 756 | Ga0501257_022465 | 3300049686 | Bacteria | 1493 |
| 757 | Ga0501079_0018036 | 3300049741 | Bacteria | 5390 |
| 758 | Ga0501079_0217838 | 3300049741 | Bacteria | 1491 |
| 759 | Ga0501080_0298823 | 3300049742 | Bacteria | 1460 |
| 760 | Ga0501083_0006924 | 3300049744 | Bacteria | 8050 |
| 761 | Ga0501083_0101351 | 3300049744 | Bacteria | 1898 |
| 762 | Ga0501279_005158 | 3300049775 | Bacteria | 1715 |
| 763 | Ga0501282_011401 | 3300049778 | Bacteria | 956 |
| 764 | Ga0501035_0004810 | 3300049822 | Bacteria | 12798 |
| 765 | Ga0501035_0006030 | 3300049822 | Bacteria | 11410 |
| 766 | Ga0501035_0008263 | 3300049822 | Bacteria | 9698 |
| 767 | Ga0501035_0034866 | 3300049822 | Bacteria | 4571 |
| 768 | Ga0501035_0097520 | 3300049822 | Bacteria | 2581 |
| 769 | Ga0501035_0162220 | 3300049822 | Bacteria | 1934 |
| 770 | Ga0501035_0205867 | 3300049822 | Bacteria | 1685 |
| 771 | Ga0501044_0001989 | 3300049823 | Bacteria | 23615 |
| 772 | Ga0501044_0020628 | 3300049823 | Bacteria | 7036 |
| 773 | Ga0501044_0073097 | 3300049823 | Bacteria | 3485 |
| 774 | Ga0501044_0193987 | 3300049823 | Bacteria | 1992 |
| 775 | Ga0501044_0350808 | 3300049823 | Bacteria | 1395 |
| 776 | Ga0501044_0766314 | 3300049823 | Bacteria | 846 |
| 777 | Ga0501044_0826534 | 3300049823 | Bacteria | 804 |
| 778 | Ga0501045_0025456 | 3300049824 | Bacteria | 4253 |
| 779 | Ga0501045_0123534 | 3300049824 | Bacteria | 1922 |
| 780 | Ga0501045_0211800 | 3300049824 | Bacteria | 1443 |
| 781 | Ga0501045_0452770 | 3300049824 | Bacteria | 954 |
| 782 | nmdc:mga03n38_455215_c1 | 3300050490 | Bacteria | 712 |
| 783 | nmdc:mga03n38_60489_c1 | 3300050490 | Bacteria | 1722 |
| 784 | nmdc:mga00v17_46646_c1 | 3300050491 | Bacteria | 2622 |
| 785 | nmdc:mga0yw44_217326_c1 | 3300050492 | Bacteria | 1266 |
| 786 | nmdc:mga0yw44_613033_c1 | 3300050492 | Bacteria | 739 |
| 787 | Ga0495595_0129887 | 3300053084 | Bacteria | 1231 |
| 788 | Ga0495619_0259771 | 3300053085 | Bacteria | 1204 |
| 789 | Ga0500643_000082 | 3300053087 | Bacteria | 101189 |
| 790 | Ga0500583_0064600 | 3300053092 | Bacteria | 1736 |
| 791 | Ga0500556_0000001 | 3300053104 | Bacteria | 1135060 |
| 792 | Ga0500560_003205 | 3300053107 | Bacteria | 3273 |
| 793 | Ga0500560_040081 | 3300053107 | Bacteria | 1464 |
| 794 | Ga0500572_003899 | 3300053111 | Bacteria | 3393 |
| 795 | Ga0500655_044668 | 3300053133 | Bacteria | 874 |
| 796 | Ga0500559_0000295 | 3300053136 | Bacteria | 38451 |
| 797 | Ga0500559_0001348 | 3300053136 | Bacteria | 14102 |
| 798 | Ga0500559_0014675 | 3300053136 | Bacteria | 3309 |
| 799 | Ga0500559_0049495 | 3300053136 | Bacteria | 1851 |
| 800 | Ga0500568_0000016 | 3300053139 | Bacteria | 217194 |
| 801 | Ga0500573_0050537 | 3300053140 | Bacteria | 2391 |
| 802 | Ga0500573_0066579 | 3300053140 | Bacteria | 2059 |
| 803 | Ga0500573_0134447 | 3300053140 | Bacteria | 1367 |
| 804 | Ga0500577_0002895 | 3300053142 | Bacteria | 4420 |
| 805 | Ga0500600_0243797 | 3300053149 | Bacteria | 810 |
| 806 | Ga0500616_0000398 | 3300053153 | Bacteria | 59666 |
| 807 | Ga0500624_013828 | 3300053157 | Bacteria | 1213 |
| 808 | Ga0500637_0148671 | 3300053178 | Bacteria | 1354 |
| 809 | Ga0501084_0162602 | 3300054114 | Bacteria | 1883 |
| 810 | Ga0501084_0312756 | 3300054114 | Bacteria | 1326 |
| 811 | Ga0587090_003487 | 3300059510 | Bacteria | 1832 |
| 812 | Ga0587072_006472 | 3300059643 | Bacteria | 1786 |
| 813 | Ga0501082_0080491 | 3300060353 | Bacteria | 2811 |
| 814 | Ga0501082_0108479 | 3300060353 | Bacteria | 2402 |
| 815 | Ga0501082_0285155 | 3300060353 | Bacteria | 1437 |
| 816 | Ga0466962_0001558 | 3300061719 | Bacteria | 10702 |
| 817 | Ga0530510_0002743 | 3300061734 | Bacteria | 12100 |
| 818 | Ga0530510_0090754 | 3300061734 | Bacteria | 2229 |
| 819 | Ga0530510_0431151 | 3300061734 | Bacteria | 996 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049568 | Ga0501031_0002670 | Ga0501031_0002670_225_944 | 214 |
| 2 | 3300049569 | Ga0501032_0090164 | Ga0501032_0090164_306_1025 | 214 |
| 3 | 3300049570 | Ga0501033_0143822 | Ga0501033_0143822_780_1499 | 214 |
| 4 | 3300049571 | Ga0501034_0239070 | Ga0501034_0239070_819_1538 | 214 |
| 5 | 3300049572 | Ga0501036_0059965 | Ga0501036_0059965_225_944 | 214 |
| 6 | 3300049573 | Ga0501037_0141209 | Ga0501037_0141209_225_944 | 214 |
| 7 | 3300049574 | Ga0501038_0176972 | Ga0501038_0176972_780_1499 | 214 |
| 8 | 3300049575 | Ga0501039_0003912 | Ga0501039_0003912_435_1154 | 214 |
| 9 | 3300049576 | Ga0501040_0021373 | Ga0501040_0021373_310_1029 | 214 |
| 10 | 3300049577 | Ga0501041_0005106 | Ga0501041_0005106_271_990 | 214 |
| 11 | 3300049578 | Ga0501042_0086086 | Ga0501042_0086086_1042_1761 | 214 |
| 12 | 3300049579 | Ga0501043_0132457 | Ga0501043_0132457_1010_1729 | 214 |
| 13 | 3300049580 | Ga0501046_0008062 | Ga0501046_0008062_3454_4173 | 214 |
| 14 | 3300049581 | Ga0501047_0237624 | Ga0501047_0237624_730_1449 | 214 |
| 15 | 3300049582 | Ga0501048_0043286 | Ga0501048_0043286_2280_2999 | 214 |
| 16 | 3300049583 | Ga0501067_0003965 | Ga0501067_0003965_1055_1774 | 214 |
| 17 | 3300049584 | Ga0501068_0016577 | Ga0501068_0016577_2813_3532 | 214 |
| 18 | 3300049585 | Ga0501069_0091178 | Ga0501069_0091178_780_1499 | 214 |
| 19 | 3300049586 | Ga0501070_0057506 | Ga0501070_0057506_2280_2999 | 214 |
| 20 | 3300049587 | Ga0501071_0024403 | Ga0501071_0024403_256_975 | 214 |
| 21 | 3300049588 | Ga0501072_0000629 | Ga0501072_0000629_1912_2631 | 214 |
| 22 | 3300049589 | Ga0501073_0009051 | Ga0501073_0009051_1010_1729 | 214 |
| 23 | 3300049590 | Ga0501074_0002907 | Ga0501074_0002907_10995_11714 | 214 |
| 24 | 3300049592 | Ga0501076_0027346 | Ga0501076_0027346_3292_4011 | 214 |
| 25 | 3300049593 | Ga0501077_0002763 | Ga0501077_0002763_831_1550 | 214 |
| 26 | 3300049741 | Ga0501079_0018036 | Ga0501079_0018036_3630_4349 | 214 |
| 27 | 3300049742 | Ga0501080_0298823 | Ga0501080_0298823_249_968 | 214 |
| 28 | 3300049744 | Ga0501083_0101351 | Ga0501083_0101351_833_1552 | 214 |
| 29 | 3300049822 | Ga0501035_0205867 | Ga0501035_0205867_742_1461 | 214 |
| 30 | 3300049823 | Ga0501044_0001989 | Ga0501044_0001989_352_1071 | 214 |
| 31 | 3300049824 | Ga0501045_0211800 | Ga0501045_0211800_493_1212 | 214 |
| 32 | 3300054114 | Ga0501084_0162602 | Ga0501084_0162602_940_1659 | 214 |
| 33 | 3300060353 | Ga0501082_0108479 | Ga0501082_0108479_17_736 | 214 |
| 34 | 3300046501 | Ga0495607_0122556 | Ga0495607_0122556_623_1342 | 217 |
| 35 | 3300046794 | Ga0495589_0014246 | Ga0495589_0014246_724_1443 | 217 |
| 36 | 3300047447 | Ga0495685_043189 | Ga0495685_043189_559_1278 | 217 |
| 37 | 3300049573 | Ga0501037_0447586 | Ga0501037_0447586_57_776 | 217 |
| 38 | 3300049578 | Ga0501042_0195381 | Ga0501042_0195381_352_1071 | 217 |
| 39 | 3300049581 | Ga0501047_0000055 | Ga0501047_0000055_112731_113450 | 217 |
| 40 | 3300049823 | Ga0501044_0766314 | Ga0501044_0766314_38_757 | 217 |
| 41 | 3300050490 | nmdc:mga03n38_455215_c1 | nmdc:mga03n38_455215_c1_10_696 | 226 |
| 42 | iso_pu_bacteria | 2643221679 | 2644445082 | 226 |
| 43 | 3300053104 | Ga0500556_0000001 | Ga0500556_0000001_204145_204879 | 227 |
| 44 | 3300053133 | Ga0500655_044668 | Ga0500655_044668_22_756 | 227 |
| 45 | 3300053139 | Ga0500568_0000016 | Ga0500568_0000016_8129_8863 | 227 |
| 46 | 3300053087 | Ga0500643_000082 | Ga0500643_000082_5275_6009 | 228 |
| 47 | 3300009094 | Ga0111539_10899260 | Ga0111539_108992602 | 230 |
| 48 | 3300031727 | Ga0316576_10003277 | Ga0316576_100032773 | 230 |
| 49 | 3300031728 | Ga0316578_10071604 | Ga0316578_100716043 | 230 |
| 50 | iso_pu_bacteria | 2547132111 | 2547411092 | 230 |
| 51 | iso_pu_bacteria | 2554235005 | 2554259233 | 230 |
| 52 | iso_pu_bacteria | 2582581312 | 2585298545 | 230 |
| 53 | iso_pu_bacteria | 2616644814 | 2616693898 | 230 |
| 54 | iso_pu_bacteria | 2616644941 | 2616899123 | 230 |
| 55 | iso_pu_bacteria | 2643221548 | 2643762628 | 230 |
| 56 | iso_pu_bacteria | 2643221578 | 2643897070 | 230 |
| 57 | iso_pu_bacteria | 2643221673 | 2644408215 | 230 |
| 58 | iso_pu_bacteria | 2643221678 | 2644435415 | 230 |
| 59 | iso_pu_bacteria | 2643221682 | 2644460948 | 230 |
| 60 | iso_pu_bacteria | 2643221714 | 2644631358 | 230 |
| 61 | iso_pu_bacteria | 2767802112 | 2768646680 | 230 |
| 62 | iso_pu_bacteria | 2784132148 | 2784587068 | 230 |
| 63 | iso_pu_bacteria | 2784746763 | 2785345347 | 230 |
| 64 | iso_pu_bacteria | 2784746768 | 2785367542 | 230 |
| 65 | iso_pu_bacteria | 2791355406 | 2793980571 | 230 |
| 66 | iso_pu_bacteria | 2795385470 | 2795786542 | 230 |
| 67 | iso_pu_bacteria | 2802429296 | 2804844139 | 230 |
| 68 | iso_pu_bacteria | 2808606359 | 2808848030 | 230 |
| 69 | iso_pu_bacteria | 2808606375 | 2808918788 | 230 |
| 70 | iso_pu_bacteria | 2808606448 | 2809230630 | 230 |
| 71 | iso_pu_bacteria | 2808606982 | 2811847308 | 230 |
| 72 | iso_pu_bacteria | 2811994879 | 2812359963 | 230 |
| 73 | iso_pu_bacteria | 2811994917 | 2812482035 | 230 |
| 74 | iso_pu_bacteria | 2818991463 | 2819694432 | 230 |
| 75 | iso_pu_bacteria | 2818991472 | 2819739983 | 230 |
| 76 | iso_pu_bacteria | 2852635781 | 2852638065 | 230 |
| 77 | iso_pu_bacteria | 2862178590 | 2862183263 | 230 |
| 78 | iso_pu_bacteria | 2862281513 | 2862289101 | 230 |
| 79 | iso_pu_bacteria | 2862290372 | 2862291030 | 230 |
| 80 | iso_pu_bacteria | 2862382967 | 2862388026 | 230 |
| 81 | iso_pu_bacteria | 2862507626 | 2862509142 | 230 |
| 82 | iso_pu_bacteria | 2862574272 | 2862583320 | 230 |
| 83 | iso_pu_bacteria | 2862705112 | 2862706665 | 230 |
| 84 | iso_pu_bacteria | 2863404153 | 2863406602 | 230 |
| 85 | iso_pu_bacteria | 2867346516 | 2867352720 | 230 |
| 86 | iso_pu_bacteria | 2867428634 | 2867437025 | 230 |
| 87 | iso_pu_bacteria | 2867475112 | 2867475791 | 230 |
| 88 | iso_pu_bacteria | 2873151551 | 2873157336 | 230 |
| 89 | iso_pu_bacteria | 2875391855 | 2875393028 | 230 |
| 90 | iso_pu_bacteria | 2877676314 | 2877683000 | 230 |
| 91 | iso_pu_bacteria | 2912715099 | 2912722010 | 230 |
| 92 | iso_pu_bacteria | 2912723979 | 2912725776 | 230 |
| 93 | iso_pu_bacteria | 2912757875 | 2912759206 | 230 |
| 94 | iso_pu_bacteria | 2918501144 | 2918502883 | 230 |
| 95 | iso_pu_bacteria | 2919468124 | 2919475103 | 230 |
| 96 | iso_pu_bacteria | 2935390628 | 2935394425 | 230 |
| 97 | iso_pu_bacteria | 2946045630 | 2946051674 | 230 |
| 98 | iso_pu_bacteria | 2946064051 | 2946065932 | 230 |
| 99 | iso_pu_bacteria | 2946072368 | 2946074261 | 230 |
| 100 | iso_pu_bacteria | 2947224130 | 2947231469 | 230 |
| 101 | iso_pu_bacteria | 2954002825 | 2954004715 | 230 |
| 102 | iso_pu_bacteria | 2954380949 | 2954388223 | 230 |
| 103 | iso_pu_bacteria | 2966598605 | 2966604036 | 230 |
| 104 | iso_pu_bacteria | 2990044586 | 2990044605 | 230 |
| 105 | iso_pu_bacteria | 2990059506 | 2990066147 | 230 |
| 106 | iso_pu_bacteria | 2990088156 | 2990088599 | 230 |
| 107 | iso_pu_bacteria | 2997451912 | 2997458842 | 230 |
| 108 | iso_pu_bacteria | 2997600082 | 2997606888 | 230 |
| 109 | iso_pu_bacteria | 3006321560 | 3006323172 | 230 |
| 110 | iso_pu_bacteria | 3006486233 | 3006488112 | 230 |
| 111 | iso_pu_bacteria | 3006493962 | 3006496659 | 230 |
| 112 | iso_pu_bacteria | 8008485437 | 8008489232 | 230 |
| 113 | iso_pu_bacteria | 8008558824 | 8008561711 | 230 |
| 114 | iso_pu_bacteria | 8023623736 | 8023630715 | 230 |
| 115 | iso_pu_bacteria | 8025413630 | 8025418884 | 230 |
| 116 | iso_pu_bacteria | 8025478263 | 8025480062 | 230 |
| 117 | iso_pu_bacteria | 8025524527 | 8025527563 | 230 |
| 118 | iso_pu_bacteria | 8025530807 | 8025535792 | 230 |
| 119 | iso_pu_bacteria | 8033684223 | 8033689884 | 230 |
| 120 | iso_pu_bacteria | 8047893842 | 8047899901 | 230 |
| 121 | iso_pu_bacteria | 8048127548 | 8048130954 | 230 |
| 122 | iso_pu_bacteria | 8048356638 | 8048359028 | 230 |
| 123 | iso_pu_bacteria | 8048369669 | 8048376850 | 230 |
| 124 | iso_pu_bacteria | 8048379754 | 8048385903 | 230 |
| 125 | iso_pu_bacteria | 8048406513 | 8048411635 | 230 |
| 126 | iso_pu_bacteria | 8054160619 | 8054163407 | 230 |
| 127 | iso_pu_bacteria | 8056447290 | 8056447781 | 230 |
| 128 | iso_pu_bacteria | 8056667051 | 8056667448 | 230 |
| 129 | iso_pu_bacteria | 8056829672 | 8056832968 | 230 |
| 130 | 3300048922 | Ga0496119_0197740 | Ga0496119_0197740_298_993 | 231 |
| 131 | 3300046674 | Ga0495588_0249451 | Ga0495588_0249451_55_765 | 232 |
| 132 | 3300049569 | Ga0501032_0360471 | Ga0501032_0360471_48_746 | 232 |
| 133 | iso_pu_bacteria | 2643221572 | 2643875272 | 232 |
| 134 | iso_pu_bacteria | 2643221669 | 2644382328 | 232 |
| 135 | iso_pu_bacteria | 2751185788 | 2753302141 | 232 |
| 136 | iso_pu_bacteria | 2784746763 | 2785345163 | 232 |
| 137 | iso_pu_bacteria | 2808606365 | 2808874336 | 232 |
| 138 | iso_pu_bacteria | 2852643534 | 2852645422 | 232 |
| 139 | iso_pu_bacteria | 2857733635 | 2857735622 | 232 |
| 140 | iso_pu_bacteria | 2904430863 | 2904432648 | 232 |
| 141 | iso_pu_bacteria | 2904501621 | 2904503095 | 232 |
| 142 | iso_pu_bacteria | 2908674828 | 2908675728 | 232 |
| 143 | iso_pu_bacteria | 2909074476 | 2909074780 | 232 |
| 144 | iso_pu_bacteria | 2919039151 | 2919040760 | 232 |
| 145 | iso_pu_bacteria | 2919042368 | 2919043825 | 232 |
| 146 | iso_pu_bacteria | 2919443155 | 2919446163 | 232 |
| 147 | iso_pu_bacteria | 2928104781 | 2928107897 | 232 |
| 148 | iso_pu_bacteria | 2928500415 | 2928502433 | 232 |
| 149 | iso_pu_bacteria | 2964326757 | 2964329672 | 232 |
| 150 | iso_pu_bacteria | 2966921586 | 2966922740 | 232 |
| 151 | iso_pu_bacteria | 2984551494 | 2984554280 | 232 |
| 152 | iso_pu_bacteria | 2990059506 | 2990066397 | 232 |
| 153 | iso_pu_bacteria | 2995726249 | 2995728110 | 232 |
| 154 | iso_pu_bacteria | 3001889506 | 3001891499 | 232 |
| 155 | iso_pu_bacteria | 8002811521 | 8002812570 | 232 |
| 156 | iso_pu_bacteria | 8055034563 | 8055035881 | 232 |
| 157 | 3300006931 | Ga0097620_101535116 | Ga0097620_1015351161 | 233 |
| 158 | 3300013308 | Ga0157375_10294975 | Ga0157375_102949752 | 233 |
| 159 | 3300046557 | Ga0495622_0041053 | Ga0495622_0041053_371_1087 | 233 |
| 160 | 3300048912 | Ga0496109_0119524 | Ga0496109_0119524_1348_2052 | 233 |
| 161 | 3300048913 | Ga0496110_0317796 | Ga0496110_0317796_613_1317 | 233 |
| 162 | 3300048913 | Ga0496110_0780047 | Ga0496110_0780047_56_760 | 233 |
| 163 | 3300048914 | Ga0496111_0444587 | Ga0496111_0444587_109_870 | 233 |
| 164 | 3300049575 | Ga0501039_0055425 | Ga0501039_0055425_33_737 | 233 |
| 165 | 3300049576 | Ga0501040_0005244 | Ga0501040_0005244_2856_3560 | 233 |
| 166 | 3300049577 | Ga0501041_0128095 | Ga0501041_0128095_703_1407 | 233 |
| 167 | 3300049582 | Ga0501048_0032810 | Ga0501048_0032810_1830_2534 | 233 |
| 168 | 3300049587 | Ga0501071_0043187 | Ga0501071_0043187_1503_2207 | 233 |
| 169 | 3300049588 | Ga0501072_0070412 | Ga0501072_0070412_817_1521 | 233 |
| 170 | 3300049591 | Ga0501075_0005422 | Ga0501075_0005422_5863_6567 | 233 |
| 171 | 3300049592 | Ga0501076_0026435 | Ga0501076_0026435_3340_4044 | 233 |
| 172 | 3300049593 | Ga0501077_0048442 | Ga0501077_0048442_1592_2296 | 233 |
| 173 | 3300049824 | Ga0501045_0025456 | Ga0501045_0025456_2864_3568 | 233 |
| 174 | 3300061734 | Ga0530510_0002743 | Ga0530510_0002743_9646_10350 | 233 |
| 175 | 3300061734 | Ga0530510_0431151 | Ga0530510_0431151_41_745 | 233 |
| 176 | iso_pu_bacteria | 2643221694 | 2644526693 | 233 |
| 177 | 3300002067 | JGI24735J21928_10046827 | JGI24735J21928_100468271 | 234 |
| 178 | 3300003316 | rootH1_10017486 | rootH1_100174865 | 234 |
| 179 | 3300003320 | rootH2_10123511 | rootH2_101235117 | 234 |
| 180 | 3300003323 | rootH1_10085405 | rootH1_100854052 | 234 |
| 181 | 3300003354 | JGI25160J50197_1014226 | JGI25160J50197_10142263 | 234 |
| 182 | 3300003354 | JGI25160J50197_1038407 | JGI25160J50197_10384071 | 234 |
| 183 | 3300005329 | Ga0070683_100181839 | Ga0070683_1001818392 | 234 |
| 184 | 3300005471 | Ga0070698_100511641 | Ga0070698_1005116411 | 234 |
| 185 | 3300005539 | Ga0068853_100096024 | Ga0068853_1000960242 | 234 |
| 186 | 3300005548 | Ga0070665_100117853 | Ga0070665_1001178532 | 234 |
| 187 | 3300005614 | Ga0068856_100558940 | Ga0068856_1005589402 | 234 |
| 188 | 3300009176 | Ga0105242_10334780 | Ga0105242_103347802 | 234 |
| 189 | 3300009551 | Ga0105238_10418994 | Ga0105238_104189942 | 234 |
| 190 | 3300010375 | Ga0105239_10533268 | Ga0105239_105332681 | 234 |
| 191 | 3300011119 | Ga0105246_10018457 | Ga0105246_100184572 | 234 |
| 192 | 3300013104 | Ga0157370_10147021 | Ga0157370_101470214 | 234 |
| 193 | 3300013105 | Ga0157369_10054768 | Ga0157369_100547682 | 234 |
| 194 | 3300013105 | Ga0157369_10213736 | Ga0157369_102137364 | 234 |
| 195 | 3300014497 | Ga0182008_10001386 | Ga0182008_1000138610 | 234 |
| 196 | 3300014497 | Ga0182008_10012123 | Ga0182008_100121233 | 234 |
| 197 | 3300014969 | Ga0157376_10117457 | Ga0157376_101174572 | 234 |
| 198 | 3300015262 | Ga0182007_10002461 | Ga0182007_1000246110 | 234 |
| 199 | 3300015262 | Ga0182007_10013236 | Ga0182007_100132362 | 234 |
| 200 | 3300017792 | Ga0163161_10449728 | Ga0163161_104497281 | 234 |
| 201 | 3300021388 | Ga0213875_10008509 | Ga0213875_100085092 | 234 |
| 202 | 3300025302 | Ga0207426_1003132 | Ga0207426_10031322 | 234 |
| 203 | 3300025302 | Ga0207426_1003775 | Ga0207426_10037751 | 234 |
| 204 | 3300025302 | Ga0207426_1004297 | Ga0207426_10042974 | 234 |
| 205 | 3300025911 | Ga0207654_10337560 | Ga0207654_103375601 | 234 |
| 206 | 3300025938 | Ga0207704_10450750 | Ga0207704_104507502 | 234 |
| 207 | 3300025981 | Ga0207640_10222953 | Ga0207640_102229532 | 234 |
| 208 | 3300026041 | Ga0207639_10028241 | Ga0207639_100282412 | 234 |
| 209 | 3300026067 | Ga0207678_10151959 | Ga0207678_101519592 | 234 |
| 210 | 3300026078 | Ga0207702_10181899 | Ga0207702_101818992 | 234 |
| 211 | 3300028379 | Ga0268266_10084559 | Ga0268266_100845594 | 234 |
| 212 | 3300030521 | Ga0307511_10125846 | Ga0307511_101258462 | 234 |
| 213 | 3300031616 | Ga0307508_10023422 | Ga0307508_100234226 | 234 |
| 214 | 3300031691 | Ga0316579_10033842 | Ga0316579_100338423 | 234 |
| 215 | 3300031727 | Ga0316576_10001474 | Ga0316576_100014749 | 234 |
| 216 | 3300031727 | Ga0316576_10045409 | Ga0316576_100454092 | 234 |
| 217 | 3300031727 | Ga0316576_10065027 | Ga0316576_100650273 | 234 |
| 218 | 3300031728 | Ga0316578_10036080 | Ga0316578_100360802 | 234 |
| 219 | 3300031903 | Ga0307407_10279467 | Ga0307407_102794671 | 234 |
| 220 | 3300032002 | Ga0307416_100219906 | Ga0307416_1002199062 | 234 |
| 221 | 3300032137 | Ga0316585_10008022 | Ga0316585_100080223 | 234 |
| 222 | 3300033180 | Ga0307510_10099400 | Ga0307510_100994002 | 234 |
| 223 | 3300035398 | Ga0316574_0079775 | Ga0316574_0079775_474_1190 | 234 |
| 224 | 3300036712 | Ga0316584_0181806 | Ga0316584_0181806_474_1181 | 234 |
| 225 | 3300036712 | Ga0316584_0397436 | Ga0316584_0397436_106_813 | 234 |
| 226 | 3300037312 | Ga0395899_0264260 | Ga0395899_0264260_182_886 | 234 |
| 227 | 3300037418 | Ga0395900_0019653 | Ga0395900_0019653_378_1097 | 234 |
| 228 | 3300037466 | Ga0395898_0001614 | Ga0395898_0001614_22422_23141 | 234 |
| 229 | 3300037466 | Ga0395898_0466559 | Ga0395898_0466559_399_1103 | 234 |
| 230 | 3300037853 | Ga0436364_0879158 | Ga0436364_0879158_727_1446 | 234 |
| 231 | 3300038443 | Ga0395901_0029922 | Ga0395901_0029922_910_1629 | 234 |
| 232 | 3300041404 | Ga0439436_0012987 | Ga0439436_0012987_133_852 | 234 |
| 233 | 3300041404 | Ga0439436_0019110 | Ga0439436_0019110_809_1528 | 234 |
| 234 | 3300041406 | Ga0439439_0004531 | Ga0439439_0004531_477_1196 | 234 |
| 235 | 3300041492 | Ga0451835_0563464 | Ga0451835_0563464_331_1050 | 234 |
| 236 | 3300041509 | Ga0451843_1388763 | Ga0451843_1388763_557_1276 | 234 |
| 237 | 3300041512 | Ga0451853_1923106 | Ga0451853_1923106_1292_2011 | 234 |
| 238 | 3300041999 | Ga0439433_0000349 | Ga0439433_0000349_3416_4135 | 234 |
| 239 | 3300042007 | Ga0439449_0010997 | Ga0439449_0010997_148_852 | 234 |
| 240 | 3300042014 | Ga0439457_000681 | Ga0439457_000681_2109_2828 | 234 |
| 241 | 3300042127 | Ga0450890_007900 | Ga0450890_007900_65_784 | 234 |
| 242 | 3300042131 | Ga0450894_000002 | Ga0450894_000002_32061_32780 | 234 |
| 243 | 3300042133 | Ga0450896_000446 | Ga0450896_000446_707_1426 | 234 |
| 244 | 3300042134 | Ga0450898_000413 | Ga0450898_000413_99_818 | 234 |
| 245 | 3300042136 | Ga0450900_009014 | Ga0450900_009014_453_1172 | 234 |
| 246 | 3300042145 | Ga0450906_000333 | Ga0450906_000333_8529_9248 | 234 |
| 247 | 3300042184 | Ga0450908_000741 | Ga0450908_000741_1448_2167 | 234 |
| 248 | 3300044658 | Ga0466972_0005478 | Ga0466972_0005478_933_1637 | 234 |
| 249 | 3300044684 | Ga0466966_0005061 | Ga0466966_0005061_4392_5096 | 234 |
| 250 | 3300044684 | Ga0466966_0015910 | Ga0466966_0015910_620_1339 | 234 |
| 251 | 3300044693 | Ga0466961_0003265 | Ga0466961_0003265_2869_3573 | 234 |
| 252 | 3300044693 | Ga0466961_0020736 | Ga0466961_0020736_17_736 | 234 |
| 253 | 3300044694 | Ga0466963_0000235 | Ga0466963_0000235_2640_3344 | 234 |
| 254 | 3300044694 | Ga0466963_0000660 | Ga0466963_0000660_3438_4142 | 234 |
| 255 | 3300044719 | Ga0466971_0000919 | Ga0466971_0000919_9557_10261 | 234 |
| 256 | 3300044719 | Ga0466971_0033209 | Ga0466971_0033209_1506_2225 | 234 |
| 257 | 3300044765 | Ga0466970_0001067 | Ga0466970_0001067_5192_5896 | 234 |
| 258 | 3300044765 | Ga0466970_0016547 | Ga0466970_0016547_2868_3572 | 234 |
| 259 | 3300044765 | Ga0466970_0025706 | Ga0466970_0025706_1600_2304 | 234 |
| 260 | 3300044842 | Ga0466957_0000208 | Ga0466957_0000208_3201_3905 | 234 |
| 261 | 3300044842 | Ga0466957_0249594 | Ga0466957_0249594_272_976 | 234 |
| 262 | 3300044901 | Ga0466960_0004019 | Ga0466960_0004019_1418_2122 | 234 |
| 263 | 3300045049 | Ga0466959_0003279 | Ga0466959_0003279_6410_7114 | 234 |
| 264 | 3300045836 | Ga0466958_0006249 | Ga0466958_0006249_5668_6372 | 234 |
| 265 | 3300045976 | Ga0466967_0020545 | Ga0466967_0020545_4287_5006 | 234 |
| 266 | 3300045976 | Ga0466967_0027354 | Ga0466967_0027354_1955_2659 | 234 |
| 267 | 3300045976 | Ga0466967_0095240 | Ga0466967_0095240_284_988 | 234 |
| 268 | 3300045976 | Ga0466967_0261281 | Ga0466967_0261281_131_835 | 234 |
| 269 | 3300045976 | Ga0466967_0402928 | Ga0466967_0402928_390_1094 | 234 |
| 270 | 3300046452 | Ga0495617_003136 | Ga0495617_003136_3429_4148 | 234 |
| 271 | 3300046453 | Ga0495627_060426 | Ga0495627_060426_253_972 | 234 |
| 272 | 3300046454 | Ga0495592_0004317 | Ga0495592_0004317_6296_7015 | 234 |
| 273 | 3300046454 | Ga0495592_0094302 | Ga0495592_0094302_664_1383 | 234 |
| 274 | 3300046455 | Ga0495603_0005260 | Ga0495603_0005260_1583_2302 | 234 |
| 275 | 3300046455 | Ga0495603_0005776 | Ga0495603_0005776_5484_6203 | 234 |
| 276 | 3300046457 | Ga0495590_0013239 | Ga0495590_0013239_1073_1792 | 234 |
| 277 | 3300046459 | Ga0495629_0093475 | Ga0495629_0093475_170_889 | 234 |
| 278 | 3300046459 | Ga0495629_0171905 | Ga0495629_0171905_535_1254 | 234 |
| 279 | 3300046460 | Ga0495638_0140132 | Ga0495638_0140132_243_962 | 234 |
| 280 | 3300046462 | Ga0495651_0020410 | Ga0495651_0020410_1215_1934 | 234 |
| 281 | 3300046462 | Ga0495651_0176121 | Ga0495651_0176121_406_1125 | 234 |
| 282 | 3300046472 | Ga0495580_0046984 | Ga0495580_0046984_1234_1953 | 234 |
| 283 | 3300046473 | Ga0495582_0020270 | Ga0495582_0020270_1000_1704 | 234 |
| 284 | 3300046474 | Ga0495605_0014983 | Ga0495605_0014983_2510_3229 | 234 |
| 285 | 3300046475 | Ga0495639_0009320 | Ga0495639_0009320_796_1515 | 234 |
| 286 | 3300046476 | Ga0495662_0014134 | Ga0495662_0014134_1327_2046 | 234 |
| 287 | 3300046476 | Ga0495662_0045982 | Ga0495662_0045982_432_1151 | 234 |
| 288 | 3300046477 | Ga0495664_0200163 | Ga0495664_0200163_73_792 | 234 |
| 289 | 3300046492 | Ga0495585_0021286 | Ga0495585_0021286_1480_2199 | 234 |
| 290 | 3300046492 | Ga0495585_0047873 | Ga0495585_0047873_638_1357 | 234 |
| 291 | 3300046492 | Ga0495585_0054493 | Ga0495585_0054493_364_1083 | 234 |
| 292 | 3300046492 | Ga0495585_0128457 | Ga0495585_0128457_224_943 | 234 |
| 293 | 3300046499 | Ga0495594_0013329 | Ga0495594_0013329_3208_3927 | 234 |
| 294 | 3300046499 | Ga0495594_0033866 | Ga0495594_0033866_836_1540 | 234 |
| 295 | 3300046499 | Ga0495594_0070743 | Ga0495594_0070743_260_979 | 234 |
| 296 | 3300046499 | Ga0495594_0376992 | Ga0495594_0376992_78_794 | 234 |
| 297 | 3300046500 | Ga0495596_0019518 | Ga0495596_0019518_848_1567 | 234 |
| 298 | 3300046501 | Ga0495607_0036894 | Ga0495607_0036894_1480_2199 | 234 |
| 299 | 3300046501 | Ga0495607_0046065 | Ga0495607_0046065_1497_2213 | 234 |
| 300 | 3300046506 | Ga0495583_0049174 | Ga0495583_0049174_11_730 | 234 |
| 301 | 3300046507 | Ga0495606_0016141 | Ga0495606_0016141_3755_4474 | 234 |
| 302 | 3300046511 | Ga0495608_0022867 | Ga0495608_0022867_357_1076 | 234 |
| 303 | 3300046513 | Ga0495616_0009847 | Ga0495616_0009847_2041_2760 | 234 |
| 304 | 3300046514 | Ga0495618_0009745 | Ga0495618_0009745_546_1265 | 234 |
| 305 | 3300046514 | Ga0495618_0127986 | Ga0495618_0127986_633_1352 | 234 |
| 306 | 3300046516 | Ga0495628_0035779 | Ga0495628_0035779_519_1238 | 234 |
| 307 | 3300046518 | Ga0495631_0012088 | Ga0495631_0012088_2510_3229 | 234 |
| 308 | 3300046518 | Ga0495631_0185345 | Ga0495631_0185345_145_861 | 234 |
| 309 | 3300046519 | Ga0495632_0173830 | Ga0495632_0173830_188_907 | 234 |
| 310 | 3300046520 | Ga0495637_0172616 | Ga0495637_0172616_74_793 | 234 |
| 311 | 3300046522 | Ga0495643_0005652 | Ga0495643_0005652_1812_2531 | 234 |
| 312 | 3300046523 | Ga0495644_0016789 | Ga0495644_0016789_1047_1763 | 234 |
| 313 | 3300046524 | Ga0495648_0015807 | Ga0495648_0015807_4336_5055 | 234 |
| 314 | 3300046526 | Ga0495666_0040124 | Ga0495666_0040124_364_1083 | 234 |
| 315 | 3300046526 | Ga0495666_0094899 | Ga0495666_0094899_573_1292 | 234 |
| 316 | 3300046529 | Ga0495652_0008679 | Ga0495652_0008679_4688_5407 | 234 |
| 317 | 3300046529 | Ga0495652_0073914 | Ga0495652_0073914_1307_2026 | 234 |
| 318 | 3300046530 | Ga0495654_0016128 | Ga0495654_0016128_2423_3142 | 234 |
| 319 | 3300046533 | Ga0495640_0010469 | Ga0495640_0010469_931_1650 | 234 |
| 320 | 3300046533 | Ga0495640_0014466 | Ga0495640_0014466_3403_4122 | 234 |
| 321 | 3300046533 | Ga0495640_0020798 | Ga0495640_0020798_3407_4126 | 234 |
| 322 | 3300046538 | Ga0495609_0016813 | Ga0495609_0016813_1720_2439 | 234 |
| 323 | 3300046542 | Ga0495597_0010337 | Ga0495597_0010337_911_1630 | 234 |
| 324 | 3300046557 | Ga0495622_0044969 | Ga0495622_0044969_717_1436 | 234 |
| 325 | 3300046557 | Ga0495622_0047368 | Ga0495622_0047368_1045_1764 | 234 |
| 326 | 3300046558 | Ga0495633_0008851 | Ga0495633_0008851_2345_3064 | 234 |
| 327 | 3300046559 | Ga0495667_0103838 | Ga0495667_0103838_982_1701 | 234 |
| 328 | 3300046559 | Ga0495667_0132837 | Ga0495667_0132837_585_1304 | 234 |
| 329 | 3300046642 | Ga0495634_0015046 | Ga0495634_0015046_1850_2569 | 234 |
| 330 | 3300046642 | Ga0495634_0024152 | Ga0495634_0024152_1220_1924 | 234 |
| 331 | 3300046642 | Ga0495634_0053671 | Ga0495634_0053671_1429_2148 | 234 |
| 332 | 3300046648 | Ga0495611_0025599 | Ga0495611_0025599_705_1424 | 234 |
| 333 | 3300046663 | Ga0495635_0043980 | Ga0495635_0043980_831_1550 | 234 |
| 334 | 3300046663 | Ga0495635_0196351 | Ga0495635_0196351_283_1002 | 234 |
| 335 | 3300046665 | Ga0495661_0026260 | Ga0495661_0026260_1037_1756 | 234 |
| 336 | 3300046665 | Ga0495661_0241508 | Ga0495661_0241508_64_780 | 234 |
| 337 | 3300046674 | Ga0495588_0007227 | Ga0495588_0007227_730_1449 | 234 |
| 338 | 3300046674 | Ga0495588_0009869 | Ga0495588_0009869_2910_3614 | 234 |
| 339 | 3300046674 | Ga0495588_0292286 | Ga0495588_0292286_20_739 | 234 |
| 340 | 3300046675 | Ga0495657_0004622 | Ga0495657_0004622_7766_8470 | 234 |
| 341 | 3300046675 | Ga0495657_0006650 | Ga0495657_0006650_1754_2473 | 234 |
| 342 | 3300046675 | Ga0495657_0031016 | Ga0495657_0031016_883_1602 | 234 |
| 343 | 3300046675 | Ga0495657_0067147 | Ga0495657_0067147_1570_2289 | 234 |
| 344 | 3300046680 | Ga0495646_0022317 | Ga0495646_0022317_732_1451 | 234 |
| 345 | 3300046683 | Ga0495658_0078857 | Ga0495658_0078857_261_980 | 234 |
| 346 | 3300046689 | Ga0495613_0007164 | Ga0495613_0007164_2497_3216 | 234 |
| 347 | 3300046689 | Ga0495613_0013402 | Ga0495613_0013402_786_1505 | 234 |
| 348 | 3300046689 | Ga0495613_0035627 | Ga0495613_0035627_817_1536 | 234 |
| 349 | 3300046689 | Ga0495613_0145573 | Ga0495613_0145573_751_1470 | 234 |
| 350 | 3300046690 | Ga0495624_0008308 | Ga0495624_0008308_1636_2355 | 234 |
| 351 | 3300046690 | Ga0495624_0054375 | Ga0495624_0054375_1607_2326 | 234 |
| 352 | 3300046690 | Ga0495624_0321137 | Ga0495624_0321137_44_763 | 234 |
| 353 | 3300046694 | Ga0495649_0131477 | Ga0495649_0131477_478_1197 | 234 |
| 354 | 3300046694 | Ga0495649_0167644 | Ga0495649_0167644_10_729 | 234 |
| 355 | 3300046794 | Ga0495589_0005737 | Ga0495589_0005737_4578_5294 | 234 |
| 356 | 3300046794 | Ga0495589_0141825 | Ga0495589_0141825_368_1087 | 234 |
| 357 | 3300046809 | Ga0495600_0039550 | Ga0495600_0039550_216_935 | 234 |
| 358 | 3300046809 | Ga0495600_0164684 | Ga0495600_0164684_296_1015 | 234 |
| 359 | 3300046810 | Ga0495660_0103924 | Ga0495660_0103924_687_1406 | 234 |
| 360 | 3300047315 | Ga0495581_0045046 | Ga0495581_0045046_685_1404 | 234 |
| 361 | 3300047317 | Ga0495604_0000361 | Ga0495604_0000361_6965_7669 | 234 |
| 362 | 3300047317 | Ga0495604_0070386 | Ga0495604_0070386_1254_1973 | 234 |
| 363 | 3300047317 | Ga0495604_0141038 | Ga0495604_0141038_250_969 | 234 |
| 364 | 3300047317 | Ga0495604_0257762 | Ga0495604_0257762_164_883 | 234 |
| 365 | 3300047318 | Ga0495636_0004966 | Ga0495636_0004966_3753_4457 | 234 |
| 366 | 3300047318 | Ga0495636_0006595 | Ga0495636_0006595_1741_2445 | 234 |
| 367 | 3300047318 | Ga0495636_0078159 | Ga0495636_0078159_322_1038 | 234 |
| 368 | 3300047318 | Ga0495636_0106933 | Ga0495636_0106933_439_1158 | 234 |
| 369 | 3300047321 | Ga0495676_0005356 | Ga0495676_0005356_1849_2568 | 234 |
| 370 | 3300047321 | Ga0495676_0031033 | Ga0495676_0031033_3786_4505 | 234 |
| 371 | 3300047321 | Ga0495676_0125964 | Ga0495676_0125964_442_1158 | 234 |
| 372 | 3300047322 | Ga0495680_0003856 | Ga0495680_0003856_3041_3760 | 234 |
| 373 | 3300047323 | Ga0495683_0032415 | Ga0495683_0032415_1256_1975 | 234 |
| 374 | 3300047443 | Ga0495687_002727 | Ga0495687_002727_10650_11369 | 234 |
| 375 | 3300047443 | Ga0495687_011261 | Ga0495687_011261_1128_1847 | 234 |
| 376 | 3300047444 | Ga0495675_0060083 | Ga0495675_0060083_447_1166 | 234 |
| 377 | 3300047444 | Ga0495675_0081242 | Ga0495675_0081242_140_859 | 234 |
| 378 | 3300047444 | Ga0495675_0323878 | Ga0495675_0323878_33_752 | 234 |
| 379 | 3300047447 | Ga0495685_001913 | Ga0495685_001913_4518_5234 | 234 |
| 380 | 3300047447 | Ga0495685_017235 | Ga0495685_017235_609_1313 | 234 |
| 381 | 3300047447 | Ga0495685_022354 | Ga0495685_022354_201_920 | 234 |
| 382 | 3300047447 | Ga0495685_050387 | Ga0495685_050387_122_826 | 234 |
| 383 | 3300047470 | Ga0495681_0026023 | Ga0495681_0026023_512_1231 | 234 |
| 384 | 3300047472 | Ga0495686_0053603 | Ga0495686_0053603_1572_2276 | 234 |
| 385 | 3300047472 | Ga0495686_0066980 | Ga0495686_0066980_1027_1746 | 234 |
| 386 | 3300047673 | Ga0495593_0101341 | Ga0495593_0101341_692_1411 | 234 |
| 387 | 3300048088 | Ga0495602_0225310 | Ga0495602_0225310_96_815 | 234 |
| 388 | 3300048089 | Ga0495614_0000093 | Ga0495614_0000093_6140_6859 | 234 |
| 389 | 3300048908 | Ga0496105_0279051 | Ga0496105_0279051_486_1211 | 234 |
| 390 | 3300048909 | Ga0496106_0014770 | Ga0496106_0014770_1458_2177 | 234 |
| 391 | 3300048909 | Ga0496106_0189516 | Ga0496106_0189516_796_1500 | 234 |
| 392 | 3300048912 | Ga0496109_0016561 | Ga0496109_0016561_4593_5297 | 234 |
| 393 | 3300048913 | Ga0496110_0570257 | Ga0496110_0570257_273_977 | 234 |
| 394 | 3300048922 | Ga0496119_0202055 | Ga0496119_0202055_191_910 | 234 |
| 395 | 3300048924 | Ga0496121_0215276 | Ga0496121_0215276_580_1284 | 234 |
| 396 | 3300049129 | Ga0501309_005755 | Ga0501309_005755_739_1443 | 234 |
| 397 | 3300049459 | Ga0495678_027438 | Ga0495678_027438_110_829 | 234 |
| 398 | 3300049460 | Ga0495682_0044442 | Ga0495682_0044442_180_899 | 234 |
| 399 | 3300049531 | Ga0501315_004345 | Ga0501315_004345_54_758 | 234 |
| 400 | 3300049532 | Ga0501316_013077 | Ga0501316_013077_53_757 | 234 |
| 401 | 3300049533 | Ga0501317_024623 | Ga0501317_024623_28_747 | 234 |
| 402 | 3300049534 | Ga0501318_009998 | Ga0501318_009998_311_1030 | 234 |
| 403 | 3300049534 | Ga0501318_015624 | Ga0501318_015624_140_844 | 234 |
| 404 | 3300049539 | Ga0501323_003533 | Ga0501323_003533_852_1556 | 234 |
| 405 | 3300049539 | Ga0501323_019237 | Ga0501323_019237_155_874 | 234 |
| 406 | 3300049540 | Ga0501324_001778 | Ga0501324_001778_730_1434 | 234 |
| 407 | 3300049568 | Ga0501031_0005968 | Ga0501031_0005968_1262_1966 | 234 |
| 408 | 3300049568 | Ga0501031_0011273 | Ga0501031_0011273_1926_2645 | 234 |
| 409 | 3300049568 | Ga0501031_0044524 | Ga0501031_0044524_1566_2285 | 234 |
| 410 | 3300049568 | Ga0501031_0101938 | Ga0501031_0101938_48_767 | 234 |
| 411 | 3300049568 | Ga0501031_0117787 | Ga0501031_0117787_134_853 | 234 |
| 412 | 3300049569 | Ga0501032_0018598 | Ga0501032_0018598_3876_4595 | 234 |
| 413 | 3300049569 | Ga0501032_0143424 | Ga0501032_0143424_837_1541 | 234 |
| 414 | 3300049570 | Ga0501033_0001319 | Ga0501033_0001319_14116_14820 | 234 |
| 415 | 3300049570 | Ga0501033_0005404 | Ga0501033_0005404_3977_4681 | 234 |
| 416 | 3300049570 | Ga0501033_0019385 | Ga0501033_0019385_2629_3348 | 234 |
| 417 | 3300049570 | Ga0501033_0186369 | Ga0501033_0186369_265_984 | 234 |
| 418 | 3300049571 | Ga0501034_0005536 | Ga0501034_0005536_11424_12128 | 234 |
| 419 | 3300049571 | Ga0501034_0009232 | Ga0501034_0009232_4632_5336 | 234 |
| 420 | 3300049571 | Ga0501034_0076901 | Ga0501034_0076901_1352_2071 | 234 |
| 421 | 3300049571 | Ga0501034_0243164 | Ga0501034_0243164_915_1634 | 234 |
| 422 | 3300049572 | Ga0501036_0001160 | Ga0501036_0001160_19146_19850 | 234 |
| 423 | 3300049572 | Ga0501036_0029422 | Ga0501036_0029422_1071_1790 | 234 |
| 424 | 3300049572 | Ga0501036_0046316 | Ga0501036_0046316_1166_1885 | 234 |
| 425 | 3300049572 | Ga0501036_0202262 | Ga0501036_0202262_251_955 | 234 |
| 426 | 3300049573 | Ga0501037_0018177 | Ga0501037_0018177_962_1666 | 234 |
| 427 | 3300049573 | Ga0501037_0237418 | Ga0501037_0237418_539_1258 | 234 |
| 428 | 3300049574 | Ga0501038_0014610 | Ga0501038_0014610_1785_2489 | 234 |
| 429 | 3300049574 | Ga0501038_0104229 | Ga0501038_0104229_62_766 | 234 |
| 430 | 3300049574 | Ga0501038_0188773 | Ga0501038_0188773_422_1141 | 234 |
| 431 | 3300049575 | Ga0501039_0002048 | Ga0501039_0002048_3979_4683 | 234 |
| 432 | 3300049575 | Ga0501039_0052487 | Ga0501039_0052487_1399_2118 | 234 |
| 433 | 3300049578 | Ga0501042_0007416 | Ga0501042_0007416_5782_6486 | 234 |
| 434 | 3300049579 | Ga0501043_0031683 | Ga0501043_0031683_2463_3167 | 234 |
| 435 | 3300049579 | Ga0501043_0050584 | Ga0501043_0050584_1911_2630 | 234 |
| 436 | 3300049579 | Ga0501043_0052441 | Ga0501043_0052441_1146_1865 | 234 |
| 437 | 3300049579 | Ga0501043_0058889 | Ga0501043_0058889_254_958 | 234 |
| 438 | 3300049580 | Ga0501046_0019177 | Ga0501046_0019177_1343_2062 | 234 |
| 439 | 3300049580 | Ga0501046_0047998 | Ga0501046_0047998_1716_2420 | 234 |
| 440 | 3300049581 | Ga0501047_0034303 | Ga0501047_0034303_3015_3719 | 234 |
| 441 | 3300049581 | Ga0501047_0050108 | Ga0501047_0050108_922_1641 | 234 |
| 442 | 3300049581 | Ga0501047_0061090 | Ga0501047_0061090_119_838 | 234 |
| 443 | 3300049581 | Ga0501047_0065492 | Ga0501047_0065492_260_964 | 234 |
| 444 | 3300049581 | Ga0501047_0296380 | Ga0501047_0296380_169_888 | 234 |
| 445 | 3300049585 | Ga0501069_0084361 | Ga0501069_0084361_769_1473 | 234 |
| 446 | 3300049586 | Ga0501070_0001349 | Ga0501070_0001349_18928_19632 | 234 |
| 447 | 3300049586 | Ga0501070_0146652 | Ga0501070_0146652_156_875 | 234 |
| 448 | 3300049587 | Ga0501071_0633065 | Ga0501071_0633065_95_811 | 234 |
| 449 | 3300049590 | Ga0501074_0001576 | Ga0501074_0001576_12418_13122 | 234 |
| 450 | 3300049686 | Ga0501257_022465 | Ga0501257_022465_227_931 | 234 |
| 451 | 3300049778 | Ga0501282_011401 | Ga0501282_011401_221_940 | 234 |
| 452 | 3300049822 | Ga0501035_0004810 | Ga0501035_0004810_6385_7089 | 234 |
| 453 | 3300049822 | Ga0501035_0006030 | Ga0501035_0006030_6368_7087 | 234 |
| 454 | 3300049822 | Ga0501035_0034866 | Ga0501035_0034866_2525_3244 | 234 |
| 455 | 3300049822 | Ga0501035_0097520 | Ga0501035_0097520_1161_1865 | 234 |
| 456 | 3300049822 | Ga0501035_0162220 | Ga0501035_0162220_289_993 | 234 |
| 457 | 3300049823 | Ga0501044_0020628 | Ga0501044_0020628_5094_5798 | 234 |
| 458 | 3300049823 | Ga0501044_0073097 | Ga0501044_0073097_2496_3215 | 234 |
| 459 | 3300049823 | Ga0501044_0193987 | Ga0501044_0193987_14_733 | 234 |
| 460 | 3300049823 | Ga0501044_0826534 | Ga0501044_0826534_14_733 | 234 |
| 461 | 3300049824 | Ga0501045_0123534 | Ga0501045_0123534_854_1558 | 234 |
| 462 | 3300049824 | Ga0501045_0452770 | Ga0501045_0452770_222_941 | 234 |
| 463 | 3300050490 | nmdc:mga03n38_60489_c1 | nmdc:mga03n38_60489_c1_881_1588 | 234 |
| 464 | 3300050491 | nmdc:mga00v17_46646_c1 | nmdc:mga00v17_46646_c1_1699_2406 | 234 |
| 465 | 3300050492 | nmdc:mga0yw44_217326_c1 | nmdc:mga0yw44_217326_c1_461_1165 | 234 |
| 466 | 3300053107 | Ga0500560_003205 | Ga0500560_003205_826_1545 | 234 |
| 467 | 3300053149 | Ga0500600_0243797 | Ga0500600_0243797_12_728 | 234 |
| 468 | 3300061719 | Ga0466962_0001558 | Ga0466962_0001558_6561_7265 | 234 |
| 469 | 3300044683 | Ga0466965_0247468 | Ga0466965_0247468_28_738 | 235 |
| 470 | 3300049570 | Ga0501033_0310759 | Ga0501033_0310759_307_1035 | 235 |
| 471 | 3300049572 | Ga0501036_0022302 | Ga0501036_0022302_320_1048 | 235 |
| 472 | 3300049574 | Ga0501038_0037790 | Ga0501038_0037790_2296_3024 | 235 |
| 473 | 3300049576 | Ga0501040_0057853 | Ga0501040_0057853_1893_2603 | 235 |
| 474 | 3300049579 | Ga0501043_0005857 | Ga0501043_0005857_2034_2762 | 235 |
| 475 | 3300049580 | Ga0501046_0019116 | Ga0501046_0019116_4443_5171 | 235 |
| 476 | 3300049581 | Ga0501047_0005299 | Ga0501047_0005299_4116_4844 | 235 |
| 477 | 3300049584 | Ga0501068_0265838 | Ga0501068_0265838_303_1070 | 235 |
| 478 | 3300049741 | Ga0501079_0217838 | Ga0501079_0217838_342_1070 | 235 |
| 479 | 3300049744 | Ga0501083_0006924 | Ga0501083_0006924_6894_7622 | 235 |
| 480 | 3300049822 | Ga0501035_0008263 | Ga0501035_0008263_6867_7595 | 235 |
| 481 | 3300054114 | Ga0501084_0312756 | Ga0501084_0312756_417_1145 | 235 |
| 482 | 3300060353 | Ga0501082_0285155 | Ga0501082_0285155_233_961 | 235 |
| 483 | iso_pu_bacteria | 2844852863 | 2844855451 | 235 |
| 484 | iso_pu_bacteria | 8056037122 | 8056037557 | 235 |
| 485 | iso_pu_bacteria | 8057345674 | 8057348679 | 235 |
| 486 | 3300005327 | Ga0070658_10002027 | Ga0070658_1000202716 | 236 |
| 487 | 3300005337 | Ga0070682_100234427 | Ga0070682_1002344272 | 236 |
| 488 | 3300005339 | Ga0070660_100040078 | Ga0070660_1000400782 | 236 |
| 489 | 3300005366 | Ga0070659_100030588 | Ga0070659_1000305885 | 236 |
| 490 | 3300005437 | Ga0070710_10256416 | Ga0070710_102564162 | 236 |
| 491 | 3300005455 | Ga0070663_100141564 | Ga0070663_1001415644 | 236 |
| 492 | 3300005456 | Ga0070678_100053944 | Ga0070678_1000539444 | 236 |
| 493 | 3300005563 | Ga0068855_100056871 | Ga0068855_1000568715 | 236 |
| 494 | 3300005563 | Ga0068855_100176462 | Ga0068855_1001764622 | 236 |
| 495 | 3300009098 | Ga0105245_10247194 | Ga0105245_102471943 | 236 |
| 496 | 3300009098 | Ga0105245_10374763 | Ga0105245_103747632 | 236 |
| 497 | 3300013104 | Ga0157370_10004734 | Ga0157370_100047346 | 236 |
| 498 | 3300013105 | Ga0157369_10014157 | Ga0157369_100141574 | 236 |
| 499 | 3300013307 | Ga0157372_10110173 | Ga0157372_101101734 | 236 |
| 500 | 3300014325 | Ga0163163_10087102 | Ga0163163_100871023 | 236 |
| 501 | 3300017792 | Ga0163161_10035341 | Ga0163161_100353413 | 236 |
| 502 | 3300025898 | Ga0207692_10136671 | Ga0207692_101366712 | 236 |
| 503 | 3300025904 | Ga0207647_10076822 | Ga0207647_100768223 | 236 |
| 504 | 3300025909 | Ga0207705_10000006 | Ga0207705_10000006439 | 236 |
| 505 | 3300025919 | Ga0207657_10024467 | Ga0207657_100244675 | 236 |
| 506 | 3300025924 | Ga0207694_10140078 | Ga0207694_101400782 | 236 |
| 507 | 3300025932 | Ga0207690_10036765 | Ga0207690_100367655 | 236 |
| 508 | 3300025938 | Ga0207704_10180517 | Ga0207704_101805172 | 236 |
| 509 | 3300025940 | Ga0207691_10277389 | Ga0207691_102773893 | 236 |
| 510 | 3300025949 | Ga0207667_10068535 | Ga0207667_100685355 | 236 |
| 511 | 3300025949 | Ga0207667_10116835 | Ga0207667_101168354 | 236 |
| 512 | 3300026067 | Ga0207678_10131147 | Ga0207678_101311471 | 236 |
| 513 | 3300026118 | Ga0207675_100082678 | Ga0207675_1000826784 | 236 |
| 514 | 3300026121 | Ga0207683_10293498 | Ga0207683_102934982 | 236 |
| 515 | 3300026121 | Ga0207683_10425132 | Ga0207683_104251322 | 236 |
| 516 | 3300031727 | Ga0316576_10004078 | Ga0316576_100040781 | 236 |
| 517 | 3300031728 | Ga0316578_10210220 | Ga0316578_102102202 | 236 |
| 518 | 3300031733 | Ga0316577_10046968 | Ga0316577_100469682 | 236 |
| 519 | 3300032133 | Ga0316583_10017096 | Ga0316583_100170962 | 236 |
| 520 | 3300035398 | Ga0316574_0005219 | Ga0316574_0005219_917_1630 | 236 |
| 521 | 3300035398 | Ga0316574_0119614 | Ga0316574_0119614_92_814 | 236 |
| 522 | 3300035398 | Ga0316574_0125633 | Ga0316574_0125633_598_1317 | 236 |
| 523 | 3300035398 | Ga0316574_0126968 | Ga0316574_0126968_657_1376 | 236 |
| 524 | 3300035398 | Ga0316574_0238191 | Ga0316574_0238191_322_1056 | 236 |
| 525 | 3300036647 | Ga0316582_0002951 | Ga0316582_0002951_6560_7273 | 236 |
| 526 | 3300036712 | Ga0316584_0007287 | Ga0316584_0007287_5508_6221 | 236 |
| 527 | 3300041404 | Ga0439436_0010633 | Ga0439436_0010633_860_1573 | 236 |
| 528 | 3300041404 | Ga0439436_0029875 | Ga0439436_0029875_40_756 | 236 |
| 529 | 3300041407 | Ga0439447_049435 | Ga0439447_049435_265_978 | 236 |
| 530 | 3300042014 | Ga0439457_001073 | Ga0439457_001073_7001_7717 | 236 |
| 531 | 3300042014 | Ga0439457_013048 | Ga0439457_013048_744_1457 | 236 |
| 532 | 3300046462 | Ga0495651_0324177 | Ga0495651_0324177_302_1015 | 236 |
| 533 | 3300046511 | Ga0495608_0267747 | Ga0495608_0267747_263_976 | 236 |
| 534 | 3300046642 | Ga0495634_0350107 | Ga0495634_0350107_116_829 | 236 |
| 535 | 3300046663 | Ga0495635_0160729 | Ga0495635_0160729_266_979 | 236 |
| 536 | 3300046809 | Ga0495600_0133929 | Ga0495600_0133929_329_1042 | 236 |
| 537 | 3300047315 | Ga0495581_0175076 | Ga0495581_0175076_364_1077 | 236 |
| 538 | 3300047322 | Ga0495680_0474965 | Ga0495680_0474965_12_725 | 236 |
| 539 | 3300047471 | Ga0495684_0133444 | Ga0495684_0133444_360_1073 | 236 |
| 540 | 3300048091 | Ga0495626_0035142 | Ga0495626_0035142_906_1619 | 236 |
| 541 | 3300048903 | Ga0496100_0107858 | Ga0496100_0107858_1024_1737 | 236 |
| 542 | 3300048904 | Ga0496101_0345334 | Ga0496101_0345334_197_910 | 236 |
| 543 | 3300048905 | Ga0496102_0572523 | Ga0496102_0572523_164_877 | 236 |
| 544 | 3300048906 | Ga0496103_0210679 | Ga0496103_0210679_179_892 | 236 |
| 545 | 3300048908 | Ga0496105_0125876 | Ga0496105_0125876_934_1647 | 236 |
| 546 | 3300048909 | Ga0496106_0184502 | Ga0496106_0184502_656_1369 | 236 |
| 547 | 3300048912 | Ga0496109_0098198 | Ga0496109_0098198_976_1689 | 236 |
| 548 | 3300048912 | Ga0496109_0342937 | Ga0496109_0342937_103_816 | 236 |
| 549 | 3300048913 | Ga0496110_0006639 | Ga0496110_0006639_3177_3890 | 236 |
| 550 | 3300048914 | Ga0496111_0040946 | Ga0496111_0040946_175_888 | 236 |
| 551 | 3300048916 | Ga0496113_0218620 | Ga0496113_0218620_589_1302 | 236 |
| 552 | 3300048917 | Ga0496114_0009438 | Ga0496114_0009438_5901_6614 | 236 |
| 553 | 3300048917 | Ga0496114_0085903 | Ga0496114_0085903_1284_1997 | 236 |
| 554 | 3300048920 | Ga0496117_0001302 | Ga0496117_0001302_4631_5344 | 236 |
| 555 | 3300048921 | Ga0496118_0001377 | Ga0496118_0001377_31315_32028 | 236 |
| 556 | 3300048925 | Ga0496122_0303126 | Ga0496122_0303126_101_814 | 236 |
| 557 | 3300048926 | Ga0496123_0071895 | Ga0496123_0071895_283_996 | 236 |
| 558 | 3300048927 | Ga0496124_0000037 | Ga0496124_0000037_285760_286473 | 236 |
| 559 | 3300048927 | Ga0496124_0011460 | Ga0496124_0011460_3876_4589 | 236 |
| 560 | 3300048927 | Ga0496124_0098360 | Ga0496124_0098360_495_1208 | 236 |
| 561 | 3300049575 | Ga0501039_0086315 | Ga0501039_0086315_359_1072 | 236 |
| 562 | 3300050492 | nmdc:mga0yw44_613033_c1 | nmdc:mga0yw44_613033_c1_12_725 | 236 |
| 563 | 3300053085 | Ga0495619_0259771 | Ga0495619_0259771_221_934 | 236 |
| 564 | 3300053136 | Ga0500559_0000295 | Ga0500559_0000295_33500_34210 | 236 |
| 565 | 3300053136 | Ga0500559_0001348 | Ga0500559_0001348_11201_11911 | 236 |
| 566 | 3300053136 | Ga0500559_0014675 | Ga0500559_0014675_1778_2488 | 236 |
| 567 | 3300053153 | Ga0500616_0000398 | Ga0500616_0000398_39445_40158 | 236 |
| 568 | iso_pu_bacteria | 2537561592 | 2537897866 | 236 |
| 569 | iso_pu_bacteria | 2844849076 | 2844852719 | 236 |
| 570 | iso_pu_bacteria | 2870622029 | 2870623501 | 236 |
| 571 | 3300026067 | Ga0207678_10359035 | Ga0207678_103590352 | 237 |
| 572 | 3300031649 | Ga0307514_10008617 | Ga0307514_100086178 | 237 |
| 573 | 3300031730 | Ga0307516_10006309 | Ga0307516_100063098 | 237 |
| 574 | 3300049571 | Ga0501034_0015502 | Ga0501034_0015502_3928_4641 | 237 |
| 575 | 3300049585 | Ga0501069_0066831 | Ga0501069_0066831_1176_1889 | 237 |
| 576 | 3300049586 | Ga0501070_0052604 | Ga0501070_0052604_1949_2662 | 237 |
| 577 | 3300049587 | Ga0501071_0000571 | Ga0501071_0000571_12506_13219 | 237 |
| 578 | iso_pu_bacteria | 2775506735 | 2775656912 | 237 |
| 579 | iso_pu_bacteria | 2808606357 | 2808831126 | 237 |
| 580 | iso_pu_bacteria | 2808606360 | 2808852390 | 237 |
| 581 | iso_pu_bacteria | 2808606366 | 2808879318 | 237 |
| 582 | iso_pu_bacteria | 2808606370 | 2808891180 | 237 |
| 583 | iso_pu_bacteria | 2808606371 | 2808896436 | 237 |
| 584 | iso_pu_bacteria | 2811994871 | 2812321179 | 237 |
| 585 | iso_pu_bacteria | 2857740372 | 2857742121 | 237 |
| 586 | iso_pu_bacteria | 2904497146 | 2904498232 | 237 |
| 587 | iso_pu_bacteria | 2904776348 | 2904777594 | 237 |
| 588 | iso_pu_bacteria | 2910809715 | 2910812644 | 237 |
| 589 | iso_pu_bacteria | 2919034639 | 2919034964 | 237 |
| 590 | iso_pu_bacteria | 2919051321 | 2919051448 | 237 |
| 591 | iso_pu_bacteria | 2919059106 | 2919059791 | 237 |
| 592 | iso_pu_bacteria | 2919391150 | 2919394768 | 237 |
| 593 | iso_pu_bacteria | 2919538618 | 2919540424 | 237 |
| 594 | iso_pu_bacteria | 2932426870 | 2932428278 | 237 |
| 595 | iso_pu_bacteria | 2933418574 | 2933421117 | 237 |
| 596 | iso_pu_bacteria | 2939598168 | 2939601315 | 237 |
| 597 | iso_pu_bacteria | 2939647034 | 2939648686 | 237 |
| 598 | iso_pu_bacteria | 2939674588 | 2939675265 | 237 |
| 599 | iso_pu_bacteria | 2945916053 | 2945918937 | 237 |
| 600 | iso_pu_bacteria | 2945920336 | 2945920701 | 237 |
| 601 | iso_pu_bacteria | 2945941187 | 2945943113 | 237 |
| 602 | iso_pu_bacteria | 2945956166 | 2945959145 | 237 |
| 603 | iso_pu_bacteria | 2946024296 | 2946025908 | 237 |
| 604 | iso_pu_bacteria | 2946037020 | 2946039006 | 237 |
| 605 | iso_pu_bacteria | 2946059875 | 2946062788 | 237 |
| 606 | iso_pu_bacteria | 2953998280 | 2954000413 | 237 |
| 607 | iso_pu_bacteria | 2974302888 | 2974306917 | 237 |
| 608 | iso_pu_bacteria | 8054107350 | 8054107874 | 237 |
| 609 | 3300005614 | Ga0068856_100151928 | Ga0068856_1001519282 | 238 |
| 610 | 3300049578 | Ga0501042_0193532 | Ga0501042_0193532_593_1312 | 238 |
| 611 | 3300005345 | Ga0070692_10107211 | Ga0070692_101072112 | 239 |
| 612 | 3300006881 | Ga0068865_100084207 | Ga0068865_1000842072 | 239 |
| 613 | 3300009176 | Ga0105242_10026930 | Ga0105242_100269302 | 239 |
| 614 | 3300011119 | Ga0105246_10100439 | Ga0105246_101004392 | 239 |
| 615 | 3300013297 | Ga0157378_10019491 | Ga0157378_100194914 | 239 |
| 616 | 3300017792 | Ga0163161_10014026 | Ga0163161_100140264 | 239 |
| 617 | 3300025934 | Ga0207686_10191184 | Ga0207686_101911841 | 239 |
| 618 | 3300025972 | Ga0207668_10062894 | Ga0207668_100628943 | 239 |
| 619 | 3300031727 | Ga0316576_10016422 | Ga0316576_100164225 | 239 |
| 620 | 3300031731 | Ga0307405_10020823 | Ga0307405_100208232 | 239 |
| 621 | 3300031733 | Ga0316577_10050990 | Ga0316577_100509902 | 239 |
| 622 | 3300031852 | Ga0307410_10245932 | Ga0307410_102459321 | 239 |
| 623 | 3300031901 | Ga0307406_10003776 | Ga0307406_1000377610 | 239 |
| 624 | 3300032002 | Ga0307416_100288678 | Ga0307416_1002886781 | 239 |
| 625 | 3300032004 | Ga0307414_10206089 | Ga0307414_102060891 | 239 |
| 626 | 3300032126 | Ga0307415_100025727 | Ga0307415_1000257274 | 239 |
| 627 | 3300035398 | Ga0316574_0015037 | Ga0316574_0015037_3380_4120 | 239 |
| 628 | 3300035398 | Ga0316574_0185047 | Ga0316574_0185047_159_899 | 239 |
| 629 | 3300036712 | Ga0316584_0020262 | Ga0316584_0020262_3686_4426 | 239 |
| 630 | 3300049130 | Ga0501310_000129 | Ga0501310_000129_2535_3254 | 239 |
| 631 | 3300049533 | Ga0501317_002804 | Ga0501317_002804_918_1640 | 239 |
| 632 | 3300049568 | Ga0501031_0488672 | Ga0501031_0488672_47_775 | 239 |
| 633 | 3300049587 | Ga0501071_0485697 | Ga0501071_0485697_119_847 | 239 |
| 634 | 3300049588 | Ga0501072_0060975 | Ga0501072_0060975_2225_2953 | 239 |
| 635 | 3300053136 | Ga0500559_0049495 | Ga0500559_0049495_806_1528 | 239 |
| 636 | 3300053140 | Ga0500573_0050537 | Ga0500573_0050537_1653_2375 | 239 |
| 637 | 3300053140 | Ga0500573_0134447 | Ga0500573_0134447_573_1295 | 239 |
| 638 | 3300053142 | Ga0500577_0002895 | Ga0500577_0002895_1008_1730 | 239 |
| 639 | 3300053157 | Ga0500624_013828 | Ga0500624_013828_29_748 | 239 |
| 640 | 3300053178 | Ga0500637_0148671 | Ga0500637_0148671_11_730 | 239 |
| 641 | 3300060353 | Ga0501082_0080491 | Ga0501082_0080491_728_1456 | 239 |
| 642 | iso_pu_bacteria | 2582581313 | 2585307458 | 239 |
| 643 | iso_pu_bacteria | 2786546132 | 2786668602 | 239 |
| 644 | iso_pu_bacteria | 2954673503 | 2954674878 | 239 |
| 645 | iso_pu_bacteria | 2954682443 | 2954689255 | 239 |
| 646 | iso_pu_bacteria | 2954711539 | 2954717982 | 239 |
| 647 | iso_pu_bacteria | 2954721474 | 2954727948 | 239 |
| 648 | iso_pu_bacteria | 2954731030 | 2954733856 | 239 |
| 649 | iso_pu_bacteria | 2954740390 | 2954746846 | 239 |
| 650 | iso_pu_bacteria | 2954749733 | 2954752739 | 239 |
| 651 | iso_pu_bacteria | 2954759201 | 2954765961 | 239 |
| 652 | iso_pu_bacteria | 8008574985 | 8008580413 | 239 |
| 653 | 3300002773 | JGI25152J39213_1000140 | JGI25152J39213_100014026 | 240 |
| 654 | 3300009148 | Ga0105243_10069980 | Ga0105243_100699804 | 240 |
| 655 | 3300011119 | Ga0105246_10374843 | Ga0105246_103748431 | 240 |
| 656 | 3300014968 | Ga0157379_10685339 | Ga0157379_106853391 | 240 |
| 657 | 3300025245 | Ga0207425_1002927 | Ga0207425_10029276 | 240 |
| 658 | 3300025258 | Ga0209129_1000067 | Ga0209129_1000067109 | 240 |
| 659 | 3300025294 | Ga0209025_1001395 | Ga0209025_100139527 | 240 |
| 660 | 3300032002 | Ga0307416_100134641 | Ga0307416_1001346414 | 240 |
| 661 | 3300044683 | Ga0466965_0099273 | Ga0466965_0099273_126_851 | 240 |
| 662 | 3300044901 | Ga0466960_0079691 | Ga0466960_0079691_99_857 | 240 |
| 663 | 3300045976 | Ga0466967_0773953 | Ga0466967_0773953_179_904 | 240 |
| 664 | 3300048925 | Ga0496122_0001610 | Ga0496122_0001610_2190_2939 | 240 |
| 665 | 3300049534 | Ga0501318_025176 | Ga0501318_025176_37_759 | 240 |
| 666 | iso_pu_bacteria | 2808606700 | 2810363751 | 240 |
| 667 | iso_pu_bacteria | 2884994152 | 2884995234 | 240 |
| 668 | iso_pu_bacteria | 2905926851 | 2905930889 | 240 |
| 669 | iso_pu_bacteria | 8004021418 | 8004022746 | 240 |
| 670 | iso_pu_bacteria | 8004025490 | 8004029422 | 240 |
| 671 | 3300003762 | Ga0055542_1002679 | Ga0055542_10026793 | 241 |
| 672 | 3300005288 | Ga0065714_10106553 | Ga0065714_101065531 | 241 |
| 673 | 3300005288 | Ga0065714_10201669 | Ga0065714_102016691 | 241 |
| 674 | 3300005328 | Ga0070676_10024958 | Ga0070676_100249584 | 241 |
| 675 | 3300005331 | Ga0070670_100225790 | Ga0070670_1002257902 | 241 |
| 676 | 3300005347 | Ga0070668_100051002 | Ga0070668_1000510025 | 241 |
| 677 | 3300005356 | Ga0070674_100055324 | Ga0070674_1000553242 | 241 |
| 678 | 3300005456 | Ga0070678_100119284 | Ga0070678_1001192842 | 241 |
| 679 | 3300005535 | Ga0070684_100113055 | Ga0070684_1001130553 | 241 |
| 680 | 3300005543 | Ga0070672_100300824 | Ga0070672_1003008242 | 241 |
| 681 | 3300005615 | Ga0070702_100000282 | Ga0070702_10000028212 | 241 |
| 682 | 3300006058 | Ga0075432_10002903 | Ga0075432_100029038 | 241 |
| 683 | 3300006058 | Ga0075432_10017063 | Ga0075432_100170634 | 241 |
| 684 | 3300006178 | Ga0075367_10002358 | Ga0075367_100023589 | 241 |
| 685 | 3300006353 | Ga0075370_10049690 | Ga0075370_100496902 | 241 |
| 686 | 3300009036 | Ga0105244_10004227 | Ga0105244_100042277 | 241 |
| 687 | 3300009036 | Ga0105244_10006637 | Ga0105244_100066371 | 241 |
| 688 | 3300009147 | Ga0114129_11267947 | Ga0114129_112679471 | 241 |
| 689 | 3300009148 | Ga0105243_10031619 | Ga0105243_100316192 | 241 |
| 690 | 3300009148 | Ga0105243_10462215 | Ga0105243_104622151 | 241 |
| 691 | 3300009148 | Ga0105243_10514215 | Ga0105243_105142151 | 241 |
| 692 | 3300009177 | Ga0105248_10198791 | Ga0105248_101987912 | 241 |
| 693 | 3300009177 | Ga0105248_10220468 | Ga0105248_102204684 | 241 |
| 694 | 3300009551 | Ga0105238_10059429 | Ga0105238_100594293 | 241 |
| 695 | 3300009551 | Ga0105238_10318059 | Ga0105238_103180592 | 241 |
| 696 | 3300009553 | Ga0105249_10126193 | Ga0105249_101261933 | 241 |
| 697 | 3300011119 | Ga0105246_10019891 | Ga0105246_100198914 | 241 |
| 698 | 3300011119 | Ga0105246_10052080 | Ga0105246_100520801 | 241 |
| 699 | 3300013100 | Ga0157373_10005927 | Ga0157373_1000592710 | 241 |
| 700 | 3300013102 | Ga0157371_10164527 | Ga0157371_101645271 | 241 |
| 701 | 3300013105 | Ga0157369_10042802 | Ga0157369_100428024 | 241 |
| 702 | 3300013105 | Ga0157369_10281216 | Ga0157369_102812162 | 241 |
| 703 | 3300013308 | Ga0157375_10249541 | Ga0157375_102495411 | 241 |
| 704 | 3300013308 | Ga0157375_10411108 | Ga0157375_104111082 | 241 |
| 705 | 3300013308 | Ga0157375_10735993 | Ga0157375_107359931 | 241 |
| 706 | 3300013308 | Ga0157375_10772039 | Ga0157375_107720391 | 241 |
| 707 | 3300013308 | Ga0157375_11154697 | Ga0157375_111546971 | 241 |
| 708 | 3300014325 | Ga0163163_10129257 | Ga0163163_101292573 | 241 |
| 709 | 3300014326 | Ga0157380_10011858 | Ga0157380_100118584 | 241 |
| 710 | 3300025254 | Ga0209148_1002761 | Ga0209148_10027617 | 241 |
| 711 | 3300025303 | Ga0209051_1003979 | Ga0209051_10039799 | 241 |
| 712 | 3300025315 | Ga0207697_10004823 | Ga0207697_100048234 | 241 |
| 713 | 3300025315 | Ga0207697_10037574 | Ga0207697_100375744 | 241 |
| 714 | 3300025728 | Ga0207655_1005476 | Ga0207655_10054769 | 241 |
| 715 | 3300025728 | Ga0207655_1023324 | Ga0207655_10233243 | 241 |
| 716 | 3300025728 | Ga0207655_1043814 | Ga0207655_10438141 | 241 |
| 717 | 3300025893 | Ga0207682_10026419 | Ga0207682_100264191 | 241 |
| 718 | 3300025907 | Ga0207645_10019501 | Ga0207645_100195015 | 241 |
| 719 | 3300025923 | Ga0207681_10372273 | Ga0207681_103722732 | 241 |
| 720 | 3300025935 | Ga0207709_10254713 | Ga0207709_102547132 | 241 |
| 721 | 3300025937 | Ga0207669_10166489 | Ga0207669_101664891 | 241 |
| 722 | 3300025937 | Ga0207669_10377368 | Ga0207669_103773681 | 241 |
| 723 | 3300025940 | Ga0207691_10001023 | Ga0207691_1000102330 | 241 |
| 724 | 3300025940 | Ga0207691_10348912 | Ga0207691_103489122 | 241 |
| 725 | 3300025944 | Ga0207661_10184750 | Ga0207661_101847502 | 241 |
| 726 | 3300026121 | Ga0207683_10006538 | Ga0207683_100065382 | 241 |
| 727 | 3300026121 | Ga0207683_10089505 | Ga0207683_100895052 | 241 |
| 728 | 3300027866 | Ga0209813_10010366 | Ga0209813_100103662 | 241 |
| 729 | 3300027907 | Ga0207428_10055820 | Ga0207428_100558204 | 241 |
| 730 | 3300028380 | Ga0268265_10454861 | Ga0268265_104548612 | 241 |
| 731 | 3300028786 | Ga0307517_10046625 | Ga0307517_100466254 | 241 |
| 732 | 3300028794 | Ga0307515_10001938 | Ga0307515_1000193835 | 241 |
| 733 | 3300030500 | Ga0268256_1005878 | Ga0268256_10058782 | 241 |
| 734 | 3300031548 | Ga0307408_100001200 | Ga0307408_10000120021 | 241 |
| 735 | 3300031548 | Ga0307408_100021674 | Ga0307408_1000216743 | 241 |
| 736 | 3300031548 | Ga0307408_100029791 | Ga0307408_1000297915 | 241 |
| 737 | 3300031548 | Ga0307408_100059025 | Ga0307408_1000590254 | 241 |
| 738 | 3300031548 | Ga0307408_100129695 | Ga0307408_1001296953 | 241 |
| 739 | 3300031548 | Ga0307408_100363184 | Ga0307408_1003631842 | 241 |
| 740 | 3300031548 | Ga0307408_100656211 | Ga0307408_1006562111 | 241 |
| 741 | 3300031616 | Ga0307508_10017045 | Ga0307508_100170453 | 241 |
| 742 | 3300031649 | Ga0307514_10002647 | Ga0307514_1000264717 | 241 |
| 743 | 3300031730 | Ga0307516_10130574 | Ga0307516_101305743 | 241 |
| 744 | 3300031731 | Ga0307405_10019060 | Ga0307405_100190603 | 241 |
| 745 | 3300031731 | Ga0307405_10019227 | Ga0307405_100192273 | 241 |
| 746 | 3300031731 | Ga0307405_10107921 | Ga0307405_101079212 | 241 |
| 747 | 3300031731 | Ga0307405_10184430 | Ga0307405_101844302 | 241 |
| 748 | 3300031731 | Ga0307405_10199258 | Ga0307405_101992582 | 241 |
| 749 | 3300031731 | Ga0307405_10454413 | Ga0307405_104544131 | 241 |
| 750 | 3300031824 | Ga0307413_10040998 | Ga0307413_100409981 | 241 |
| 751 | 3300031824 | Ga0307413_10118251 | Ga0307413_101182512 | 241 |
| 752 | 3300031824 | Ga0307413_10167454 | Ga0307413_101674542 | 241 |
| 753 | 3300031824 | Ga0307413_10291289 | Ga0307413_102912892 | 241 |
| 754 | 3300031824 | Ga0307413_10714081 | Ga0307413_107140811 | 241 |
| 755 | 3300031852 | Ga0307410_10063569 | Ga0307410_100635694 | 241 |
| 756 | 3300031852 | Ga0307410_10074478 | Ga0307410_100744784 | 241 |
| 757 | 3300031852 | Ga0307410_10099525 | Ga0307410_100995252 | 241 |
| 758 | 3300031852 | Ga0307410_10128873 | Ga0307410_101288732 | 241 |
| 759 | 3300031852 | Ga0307410_10216173 | Ga0307410_102161732 | 241 |
| 760 | 3300031852 | Ga0307410_10263369 | Ga0307410_102633691 | 241 |
| 761 | 3300031901 | Ga0307406_10098115 | Ga0307406_100981152 | 241 |
| 762 | 3300031903 | Ga0307407_10031870 | Ga0307407_100318702 | 241 |
| 763 | 3300031903 | Ga0307407_10051310 | Ga0307407_100513104 | 241 |
| 764 | 3300031903 | Ga0307407_10163681 | Ga0307407_101636811 | 241 |
| 765 | 3300031903 | Ga0307407_10231529 | Ga0307407_102315291 | 241 |
| 766 | 3300031911 | Ga0307412_10002167 | Ga0307412_100021677 | 241 |
| 767 | 3300031911 | Ga0307412_10035701 | Ga0307412_100357012 | 241 |
| 768 | 3300031911 | Ga0307412_10054152 | Ga0307412_100541523 | 241 |
| 769 | 3300031911 | Ga0307412_10066367 | Ga0307412_100663674 | 241 |
| 770 | 3300031911 | Ga0307412_10066538 | Ga0307412_100665383 | 241 |
| 771 | 3300031911 | Ga0307412_10081507 | Ga0307412_100815072 | 241 |
| 772 | 3300031911 | Ga0307412_10109121 | Ga0307412_101091213 | 241 |
| 773 | 3300031911 | Ga0307412_10123610 | Ga0307412_101236103 | 241 |
| 774 | 3300031911 | Ga0307412_10197197 | Ga0307412_101971972 | 241 |
| 775 | 3300031911 | Ga0307412_10247329 | Ga0307412_102473291 | 241 |
| 776 | 3300031911 | Ga0307412_10427084 | Ga0307412_104270841 | 241 |
| 777 | 3300031995 | Ga0307409_100010515 | Ga0307409_1000105157 | 241 |
| 778 | 3300031995 | Ga0307409_100030508 | Ga0307409_1000305084 | 241 |
| 779 | 3300031995 | Ga0307409_100091466 | Ga0307409_1000914663 | 241 |
| 780 | 3300031995 | Ga0307409_100238664 | Ga0307409_1002386641 | 241 |
| 781 | 3300031995 | Ga0307409_100510694 | Ga0307409_1005106942 | 241 |
| 782 | 3300031995 | Ga0307409_100520353 | Ga0307409_1005203532 | 241 |
| 783 | 3300031995 | Ga0307409_101273079 | Ga0307409_1012730791 | 241 |
| 784 | 3300032002 | Ga0307416_100017801 | Ga0307416_1000178014 | 241 |
| 785 | 3300032002 | Ga0307416_100193655 | Ga0307416_1001936554 | 241 |
| 786 | 3300032002 | Ga0307416_100195365 | Ga0307416_1001953654 | 241 |
| 787 | 3300032002 | Ga0307416_100223902 | Ga0307416_1002239023 | 241 |
| 788 | 3300032002 | Ga0307416_100418932 | Ga0307416_1004189322 | 241 |
| 789 | 3300032002 | Ga0307416_100463054 | Ga0307416_1004630542 | 241 |
| 790 | 3300032004 | Ga0307414_10178095 | Ga0307414_101780952 | 241 |
| 791 | 3300032004 | Ga0307414_10247689 | Ga0307414_102476892 | 241 |
| 792 | 3300032005 | Ga0307411_10085090 | Ga0307411_100850901 | 241 |
| 793 | 3300032005 | Ga0307411_10293495 | Ga0307411_102934951 | 241 |
| 794 | 3300032005 | Ga0307411_10804784 | Ga0307411_108047841 | 241 |
| 795 | 3300032126 | Ga0307415_100036532 | Ga0307415_1000365323 | 241 |
| 796 | 3300033179 | Ga0307507_10097159 | Ga0307507_100971592 | 241 |
| 797 | 3300033180 | Ga0307510_10052677 | Ga0307510_100526772 | 241 |
| 798 | 3300037312 | Ga0395899_0089881 | Ga0395899_0089881_344_1069 | 241 |
| 799 | 3300037312 | Ga0395899_0119574 | Ga0395899_0119574_1033_1758 | 241 |
| 800 | 3300037418 | Ga0395900_0018741 | Ga0395900_0018741_1313_2038 | 241 |
| 801 | 3300037418 | Ga0395900_0123356 | Ga0395900_0123356_1300_2025 | 241 |
| 802 | 3300037418 | Ga0395900_0136690 | Ga0395900_0136690_1591_2316 | 241 |
| 803 | 3300037466 | Ga0395898_0017683 | Ga0395898_0017683_4453_5178 | 241 |
| 804 | 3300037466 | Ga0395898_0029494 | Ga0395898_0029494_17_751 | 241 |
| 805 | 3300037466 | Ga0395898_0035249 | Ga0395898_0035249_3166_3891 | 241 |
| 806 | 3300037466 | Ga0395898_0088602 | Ga0395898_0088602_560_1285 | 241 |
| 807 | 3300037471 | Ga0395905_0189610 | Ga0395905_0189610_709_1434 | 241 |
| 808 | 3300038443 | Ga0395901_0013220 | Ga0395901_0013220_7024_7749 | 241 |
| 809 | 3300038443 | Ga0395901_0020548 | Ga0395901_0020548_623_1348 | 241 |
| 810 | 3300038443 | Ga0395901_0032466 | Ga0395901_0032466_1013_1738 | 241 |
| 811 | 3300038443 | Ga0395901_0092197 | Ga0395901_0092197_1551_2276 | 241 |
| 812 | 3300038443 | Ga0395901_0201443 | Ga0395901_0201443_1342_2067 | 241 |
| 813 | 3300038443 | Ga0395901_0582221 | Ga0395901_0582221_123_848 | 241 |
| 814 | 3300041404 | Ga0439436_0001657 | Ga0439436_0001657_3258_3983 | 241 |
| 815 | 3300041404 | Ga0439436_0077606 | Ga0439436_0077606_82_807 | 241 |
| 816 | 3300041406 | Ga0439439_0001237 | Ga0439439_0001237_266_991 | 241 |
| 817 | 3300041411 | Ga0439466_0000908 | Ga0439466_0000908_10250_10975 | 241 |
| 818 | 3300041411 | Ga0439466_0005004 | Ga0439466_0005004_2423_3148 | 241 |
| 819 | 3300041411 | Ga0439466_0023369 | Ga0439466_0023369_236_961 | 241 |
| 820 | 3300041413 | Ga0439465_0006890 | Ga0439465_0006890_420_1145 | 241 |
| 821 | 3300041512 | Ga0451853_1643492 | Ga0451853_1643492_366_1100 | 241 |
| 822 | 3300041997 | Ga0439431_0029298 | Ga0439431_0029298_587_1312 | 241 |
| 823 | 3300041999 | Ga0439433_0000441 | Ga0439433_0000441_4442_5167 | 241 |
| 824 | 3300041999 | Ga0439433_0013056 | Ga0439433_0013056_881_1606 | 241 |
| 825 | 3300041999 | Ga0439433_0016187 | Ga0439433_0016187_637_1362 | 241 |
| 826 | 3300042002 | Ga0439442_000043 | Ga0439442_000043_3613_4338 | 241 |
| 827 | 3300042002 | Ga0439442_000244 | Ga0439442_000244_6178_6903 | 241 |
| 828 | 3300042002 | Ga0439442_001405 | Ga0439442_001405_2794_3519 | 241 |
| 829 | 3300042002 | Ga0439442_002895 | Ga0439442_002895_251_976 | 241 |
| 830 | 3300042006 | Ga0439432_003697 | Ga0439432_003697_4158_4883 | 241 |
| 831 | 3300042007 | Ga0439449_0007219 | Ga0439449_0007219_1934_2659 | 241 |
| 832 | 3300042007 | Ga0439449_0011042 | Ga0439449_0011042_955_1680 | 241 |
| 833 | 3300042007 | Ga0439449_0012687 | Ga0439449_0012687_1147_1872 | 241 |
| 834 | 3300042007 | Ga0439449_0027037 | Ga0439449_0027037_178_903 | 241 |
| 835 | 3300042007 | Ga0439449_0035646 | Ga0439449_0035646_881_1606 | 241 |
| 836 | 3300042007 | Ga0439449_0053348 | Ga0439449_0053348_699_1424 | 241 |
| 837 | 3300042010 | Ga0439452_019425 | Ga0439452_019425_481_1206 | 241 |
| 838 | 3300042014 | Ga0439457_000675 | Ga0439457_000675_5710_6435 | 241 |
| 839 | 3300042014 | Ga0439457_003930 | Ga0439457_003930_2981_3706 | 241 |
| 840 | 3300042015 | Ga0439462_0021119 | Ga0439462_0021119_369_1094 | 241 |
| 841 | 3300042121 | Ga0450919_000570 | Ga0450919_000570_2624_3349 | 241 |
| 842 | 3300042146 | Ga0450907_000198 | Ga0450907_000198_6204_6929 | 241 |
| 843 | 3300042156 | Ga0439446_0002486 | Ga0439446_0002486_764_1489 | 241 |
| 844 | 3300042184 | Ga0450908_004069 | Ga0450908_004069_960_1685 | 241 |
| 845 | 3300042185 | Ga0450909_000776 | Ga0450909_000776_3451_4176 | 241 |
| 846 | 3300042435 | Ga0439434_0001553 | Ga0439434_0001553_3371_4096 | 241 |
| 847 | 3300042435 | Ga0439434_0046027 | Ga0439434_0046027_138_863 | 241 |
| 848 | 3300042531 | Ga0450918_031723 | Ga0450918_031723_181_906 | 241 |
| 849 | 3300046454 | Ga0495592_0024917 | Ga0495592_0024917_237_986 | 241 |
| 850 | 3300046455 | Ga0495603_0040998 | Ga0495603_0040998_1142_1876 | 241 |
| 851 | 3300046459 | Ga0495629_0075331 | Ga0495629_0075331_935_1684 | 241 |
| 852 | 3300046462 | Ga0495651_0003166 | Ga0495651_0003166_5232_5981 | 241 |
| 853 | 3300046463 | Ga0495653_0020578 | Ga0495653_0020578_2500_3225 | 241 |
| 854 | 3300046463 | Ga0495653_0216786 | Ga0495653_0216786_340_1074 | 241 |
| 855 | 3300046472 | Ga0495580_0004371 | Ga0495580_0004371_6582_7367 | 241 |
| 856 | 3300046472 | Ga0495580_0016668 | Ga0495580_0016668_4745_5470 | 241 |
| 857 | 3300046473 | Ga0495582_0078429 | Ga0495582_0078429_28_753 | 241 |
| 858 | 3300046473 | Ga0495582_0084006 | Ga0495582_0084006_332_1057 | 241 |
| 859 | 3300046475 | Ga0495639_0123249 | Ga0495639_0123249_55_780 | 241 |
| 860 | 3300046476 | Ga0495662_0000925 | Ga0495662_0000925_6741_7490 | 241 |
| 861 | 3300046476 | Ga0495662_0022537 | Ga0495662_0022537_294_1019 | 241 |
| 862 | 3300046477 | Ga0495664_0000664 | Ga0495664_0000664_3202_3951 | 241 |
| 863 | 3300046477 | Ga0495664_0051009 | Ga0495664_0051009_22_747 | 241 |
| 864 | 3300046499 | Ga0495594_0042576 | Ga0495594_0042576_1190_1915 | 241 |
| 865 | 3300046514 | Ga0495618_0113560 | Ga0495618_0113560_207_956 | 241 |
| 866 | 3300046516 | Ga0495628_0008429 | Ga0495628_0008429_7437_8186 | 241 |
| 867 | 3300046517 | Ga0495630_0117295 | Ga0495630_0117295_613_1362 | 241 |
| 868 | 3300046517 | Ga0495630_0372872 | Ga0495630_0372872_293_1018 | 241 |
| 869 | 3300046518 | Ga0495631_0037212 | Ga0495631_0037212_1104_1829 | 241 |
| 870 | 3300046528 | Ga0495642_0183017 | Ga0495642_0183017_95_820 | 241 |
| 871 | 3300046531 | Ga0495665_0000709 | Ga0495665_0000709_4800_5525 | 241 |
| 872 | 3300046535 | Ga0495586_0003928 | Ga0495586_0003928_4542_5267 | 241 |
| 873 | 3300046535 | Ga0495586_0013203 | Ga0495586_0013203_2817_3542 | 241 |
| 874 | 3300046535 | Ga0495586_0036644 | Ga0495586_0036644_1719_2444 | 241 |
| 875 | 3300046535 | Ga0495586_0159189 | Ga0495586_0159189_265_1050 | 241 |
| 876 | 3300046536 | Ga0495587_0000658 | Ga0495587_0000658_1090_1839 | 241 |
| 877 | 3300046536 | Ga0495587_0022960 | Ga0495587_0022960_2528_3253 | 241 |
| 878 | 3300046543 | Ga0495645_0012546 | Ga0495645_0012546_562_1287 | 241 |
| 879 | 3300046543 | Ga0495645_0025143 | Ga0495645_0025143_3114_3863 | 241 |
| 880 | 3300046559 | Ga0495667_0016886 | Ga0495667_0016886_2474_3199 | 241 |
| 881 | 3300046615 | Ga0495656_0002635 | Ga0495656_0002635_2798_3523 | 241 |
| 882 | 3300046642 | Ga0495634_0000101 | Ga0495634_0000101_45977_46726 | 241 |
| 883 | 3300046660 | Ga0495625_0007840 | Ga0495625_0007840_1882_2631 | 241 |
| 884 | 3300046663 | Ga0495635_0001452 | Ga0495635_0001452_11843_12592 | 241 |
| 885 | 3300046663 | Ga0495635_0135725 | Ga0495635_0135725_505_1239 | 241 |
| 886 | 3300046663 | Ga0495635_0175284 | Ga0495635_0175284_532_1257 | 241 |
| 887 | 3300046665 | Ga0495661_0176007 | Ga0495661_0176007_382_1107 | 241 |
| 888 | 3300046674 | Ga0495588_0001531 | Ga0495588_0001531_673_1422 | 241 |
| 889 | 3300046674 | Ga0495588_0014083 | Ga0495588_0014083_1478_2203 | 241 |
| 890 | 3300046675 | Ga0495657_0000552 | Ga0495657_0000552_24149_24898 | 241 |
| 891 | 3300046678 | Ga0495599_0027508 | Ga0495599_0027508_1541_2290 | 241 |
| 892 | 3300046680 | Ga0495646_0000429 | Ga0495646_0000429_17281_18030 | 241 |
| 893 | 3300046683 | Ga0495658_0080405 | Ga0495658_0080405_298_1047 | 241 |
| 894 | 3300046683 | Ga0495658_0086017 | Ga0495658_0086017_215_949 | 241 |
| 895 | 3300046689 | Ga0495613_0002646 | Ga0495613_0002646_4504_5253 | 241 |
| 896 | 3300046692 | Ga0495671_0099660 | Ga0495671_0099660_298_1047 | 241 |
| 897 | 3300046809 | Ga0495600_0017269 | Ga0495600_0017269_415_1140 | 241 |
| 898 | 3300047315 | Ga0495581_0071489 | Ga0495581_0071489_389_1138 | 241 |
| 899 | 3300047315 | Ga0495581_0089678 | Ga0495581_0089678_995_1720 | 241 |
| 900 | 3300047315 | Ga0495581_0261246 | Ga0495581_0261246_246_971 | 241 |
| 901 | 3300047317 | Ga0495604_0000157 | Ga0495604_0000157_23903_24652 | 241 |
| 902 | 3300047321 | Ga0495676_0002174 | Ga0495676_0002174_6667_7416 | 241 |
| 903 | 3300047322 | Ga0495680_0040734 | Ga0495680_0040734_854_1588 | 241 |
| 904 | 3300047444 | Ga0495675_0070316 | Ga0495675_0070316_1444_2169 | 241 |
| 905 | 3300047445 | Ga0495677_0159586 | Ga0495677_0159586_33_758 | 241 |
| 906 | 3300047470 | Ga0495681_0049851 | Ga0495681_0049851_48_773 | 241 |
| 907 | 3300047471 | Ga0495684_0061745 | Ga0495684_0061745_1668_2393 | 241 |
| 908 | 3300047673 | Ga0495593_0000465 | Ga0495593_0000465_6167_6916 | 241 |
| 909 | 3300047673 | Ga0495593_0030095 | Ga0495593_0030095_2142_2867 | 241 |
| 910 | 3300048088 | Ga0495602_0023858 | Ga0495602_0023858_648_1397 | 241 |
| 911 | 3300048089 | Ga0495614_0081802 | Ga0495614_0081802_364_1098 | 241 |
| 912 | 3300048903 | Ga0496100_0030948 | Ga0496100_0030948_42_767 | 241 |
| 913 | 3300048905 | Ga0496102_0050712 | Ga0496102_0050712_2182_2967 | 241 |
| 914 | 3300048905 | Ga0496102_0056408 | Ga0496102_0056408_2347_3072 | 241 |
| 915 | 3300048905 | Ga0496102_0188511 | Ga0496102_0188511_1010_1735 | 241 |
| 916 | 3300048905 | Ga0496102_0199981 | Ga0496102_0199981_950_1675 | 241 |
| 917 | 3300048905 | Ga0496102_0210638 | Ga0496102_0210638_979_1704 | 241 |
| 918 | 3300048905 | Ga0496102_0532542 | Ga0496102_0532542_166_900 | 241 |
| 919 | 3300048906 | Ga0496103_0004543 | Ga0496103_0004543_2311_3036 | 241 |
| 920 | 3300048906 | Ga0496103_0025891 | Ga0496103_0025891_95_820 | 241 |
| 921 | 3300048906 | Ga0496103_0050167 | Ga0496103_0050167_873_1598 | 241 |
| 922 | 3300048906 | Ga0496103_0080157 | Ga0496103_0080157_232_957 | 241 |
| 923 | 3300048907 | Ga0496104_0618988 | Ga0496104_0618988_133_867 | 241 |
| 924 | 3300048908 | Ga0496105_0011201 | Ga0496105_0011201_371_1096 | 241 |
| 925 | 3300048908 | Ga0496105_0144784 | Ga0496105_0144784_252_977 | 241 |
| 926 | 3300048908 | Ga0496105_0553624 | Ga0496105_0553624_126_860 | 241 |
| 927 | 3300048909 | Ga0496106_0015995 | Ga0496106_0015995_3233_3958 | 241 |
| 928 | 3300048910 | Ga0496107_0335137 | Ga0496107_0335137_207_932 | 241 |
| 929 | 3300048910 | Ga0496107_0422054 | Ga0496107_0422054_207_932 | 241 |
| 930 | 3300048911 | Ga0496108_0367320 | Ga0496108_0367320_235_960 | 241 |
| 931 | 3300048911 | Ga0496108_0770025 | Ga0496108_0770025_86_811 | 241 |
| 932 | 3300048912 | Ga0496109_0081163 | Ga0496109_0081163_762_1487 | 241 |
| 933 | 3300048912 | Ga0496109_0615360 | Ga0496109_0615360_207_932 | 241 |
| 934 | 3300048913 | Ga0496110_0078331 | Ga0496110_0078331_1251_1976 | 241 |
| 935 | 3300048913 | Ga0496110_0610020 | Ga0496110_0610020_209_934 | 241 |
| 936 | 3300048914 | Ga0496111_0062484 | Ga0496111_0062484_784_1509 | 241 |
| 937 | 3300048915 | Ga0496112_0021629 | Ga0496112_0021629_4415_5200 | 241 |
| 938 | 3300048915 | Ga0496112_0065168 | Ga0496112_0065168_1140_1865 | 241 |
| 939 | 3300048916 | Ga0496113_0182803 | Ga0496113_0182803_313_1038 | 241 |
| 940 | 3300048916 | Ga0496113_0201618 | Ga0496113_0201618_55_780 | 241 |
| 941 | 3300048916 | Ga0496113_0218716 | Ga0496113_0218716_101_880 | 241 |
| 942 | 3300048917 | Ga0496114_0020113 | Ga0496114_0020113_3898_4632 | 241 |
| 943 | 3300048917 | Ga0496114_0152923 | Ga0496114_0152923_190_942 | 241 |
| 944 | 3300048917 | Ga0496114_0153933 | Ga0496114_0153933_293_1018 | 241 |
| 945 | 3300048918 | Ga0496115_0123402 | Ga0496115_0123402_1366_2091 | 241 |
| 946 | 3300048922 | Ga0496119_0169294 | Ga0496119_0169294_67_792 | 241 |
| 947 | 3300048928 | Ga0496125_0187671 | Ga0496125_0187671_628_1353 | 241 |
| 948 | 3300049129 | Ga0501309_010224 | Ga0501309_010224_21_773 | 241 |
| 949 | 3300049161 | Ga0501305_005486 | Ga0501305_005486_40_765 | 241 |
| 950 | 3300049533 | Ga0501317_021968 | Ga0501317_021968_43_768 | 241 |
| 951 | 3300049537 | Ga0501321_001807 | Ga0501321_001807_1006_1731 | 241 |
| 952 | 3300049537 | Ga0501321_003269 | Ga0501321_003269_35_760 | 241 |
| 953 | 3300049537 | Ga0501321_014403 | Ga0501321_014403_47_772 | 241 |
| 954 | 3300049541 | Ga0501325_005173 | Ga0501325_005173_42_767 | 241 |
| 955 | 3300049569 | Ga0501032_0002322 | Ga0501032_0002322_13305_14030 | 241 |
| 956 | 3300049569 | Ga0501032_0015763 | Ga0501032_0015763_2822_3547 | 241 |
| 957 | 3300049571 | Ga0501034_0000016 | Ga0501034_0000016_85889_86614 | 241 |
| 958 | 3300049573 | Ga0501037_0004927 | Ga0501037_0004927_3494_4219 | 241 |
| 959 | 3300049574 | Ga0501038_0052584 | Ga0501038_0052584_2195_2920 | 241 |
| 960 | 3300049574 | Ga0501038_0093535 | Ga0501038_0093535_1474_2199 | 241 |
| 961 | 3300049575 | Ga0501039_0067545 | Ga0501039_0067545_780_1505 | 241 |
| 962 | 3300049575 | Ga0501039_0162611 | Ga0501039_0162611_106_831 | 241 |
| 963 | 3300049577 | Ga0501041_0100633 | Ga0501041_0100633_1006_1764 | 241 |
| 964 | 3300049579 | Ga0501043_0031178 | Ga0501043_0031178_892_1617 | 241 |
| 965 | 3300049579 | Ga0501043_0083113 | Ga0501043_0083113_934_1659 | 241 |
| 966 | 3300049775 | Ga0501279_005158 | Ga0501279_005158_479_1204 | 241 |
| 967 | 3300049823 | Ga0501044_0350808 | Ga0501044_0350808_390_1115 | 241 |
| 968 | 3300053084 | Ga0495595_0129887 | Ga0495595_0129887_171_920 | 241 |
| 969 | 3300053092 | Ga0500583_0064600 | Ga0500583_0064600_653_1417 | 241 |
| 970 | 3300053107 | Ga0500560_040081 | Ga0500560_040081_465_1214 | 241 |
| 971 | 3300053111 | Ga0500572_003899 | Ga0500572_003899_1057_1806 | 241 |
| 972 | 3300053140 | Ga0500573_0066579 | Ga0500573_0066579_934_1683 | 241 |
| 973 | 3300059510 | Ga0587090_003487 | Ga0587090_003487_113_838 | 241 |
| 974 | 3300059643 | Ga0587072_006472 | Ga0587072_006472_66_791 | 241 |
| 975 | 3300061734 | Ga0530510_0090754 | Ga0530510_0090754_1062_1820 | 241 |
| 976 | iso_pu_bacteria | 2643221587 | 2643945468 | 241 |
| 977 | iso_pu_bacteria | 2643221670 | 2644387692 | 241 |
| 978 | iso_pu_bacteria | 2643221677 | 2644432367 | 241 |
| 979 | iso_pu_bacteria | 2690315906 | 2691513859 | 241 |
| 980 | iso_pu_bacteria | 3006425503 | 3006426319 | 241 |
| 981 | 3300000549 | LJQas_1002824 | LJQas_10028242 | 242 |
| 982 | 3300013102 | Ga0157371_10099947 | Ga0157371_100999472 | 242 |
| 983 | 3300013104 | Ga0157370_10020509 | Ga0157370_100205095 | 242 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4rzi-assembly1.cif.gz_B | crystal structure of phab from synechocystis sp. pcc 6803 | 0.981 | 10 | 238 |
| 1uzn-assembly1.cif.gz_A-2 | maba from mycobacterium tuberculosis | 0.9777 | 9 | 242 |
| 6t77-assembly1.cif.gz_A | crystal structure of klebsiella pneumoniae fabg(nadph-dependent) nadp-complex at 1.75 a resolution | 0.9772 | 10 | 238 |
| 1uzn-assembly1.cif.gz_B-2 | maba from mycobacterium tuberculosis | 0.9764 | 9 | 242 |
| 6t7m-assembly1.cif.gz_C | crystal structure of salmonella typhimurium fabg at 2.65 a resolution | 0.9763 | 10 | 238 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4rziB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.981 | 10 | 238 | 3.40.50.720 |
| af_Q0JDU3_1_168_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.98 | 75 | 238 | 3.40.50.720 |
| 2ntnB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9703 | 9 | 240 | 3.40.50.720 |
| af_B7FAC8_69_312_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.967 | 12 | 238 | 3.40.50.720 |
| 5ovlC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9661 | 9 | 242 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q8KQI7-F1-model_v4 | Acetoacetyl-CoA reductase (EC 1.1.1.36) | 0.9906 | 9 | 242 |
GO:0018454
|
| AF-A0A4Y8JYE8-F1-model_v4 | SDR family oxidoreductase | 0.9895 | 9 | 242 |
|
| AF-A0A2S0WWH0-F1-model_v4 | Beta-ketoacyl-ACP reductase | 0.9892 | 9 | 242 |
|
| AF-A0A7J7AK78-F1-model_v4 | deleted | 0.9875 | 9 | 242 |
|
| AF-A1R6K2-F1-model_v4 | 3-oxoacyl-(Acyl-carrier-protein) reductase (EC 1.1.1.100) | 0.9873 | 1 | 242 |
GO:0004316
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar