F487462

General Info

Members Datasets Scaffolds Average Seq Length
983 514 819 238

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2690315906|2691513859
Length 288
Sequence APKACINSLTISSGAQTRAGAGAKIEVSQITPIYSGPSAPQNSGASFMTEAATAPRSVLITGGNRGIGLAIAEAFLANGDKVAVTYRSETKLPEGILGVKADVTDEASVDAAFKEVEAAHGPVEVLVANAGITKDTLLLRMSEDDFTSVIDTNLTGAFRVIKRASKGMIRLRKGRVVLISSVSGLYGAPGQINYSASKAGLVGIARSLTRELGSRGITANVVAPGFINTDMTAELPEATQKDYLSSIPAGRFAEASEVANVVRWISSDEAAYISGAVIPVDGGLGMGH

Samples

Sample ID Description Type Environment
1 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
2 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
3 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
4 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
5 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
6 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
7 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
8 2643221548 Streptomyces sp. Root55 Isolate Unclassified
9 2643221572 Leifsonia sp. Root60 Isolate Unclassified
10 2643221578 Streptomyces sp. Root63 Isolate Unclassified
11 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
12 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
13 2643221670 Streptomyces sp. Root431 Isolate Unclassified
14 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
15 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
16 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
17 2643221679 Angustibacter sp. Root456 Isolate Unclassified
18 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
19 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
20 2643221714 Streptomyces sp. Root264 Isolate Unclassified
21 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
22 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
23 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
24 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
25 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
26 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
27 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
28 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
29 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
30 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
31 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
32 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
33 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
34 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
35 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
36 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
37 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
38 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
39 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
40 2808606448 Streptomyces sp. 193411 Isolate Unclassified
41 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
42 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
43 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
44 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
45 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
46 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
47 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
48 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
49 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
50 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
51 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
52 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
53 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
54 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
55 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
56 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
57 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
58 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
59 2862574272 Streptomyces sp. AcE210 Isolate Nodule
60 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
61 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
62 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
63 2867428634 Streptomyces sp. RP5T Isolate Unclassified
64 2867475112 Streptomyces sp. TM32 Isolate Unclassified
65 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
66 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
67 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
68 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
69 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
70 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
71 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
72 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
73 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
74 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
75 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
76 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
77 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
78 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
79 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
80 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
81 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
82 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
83 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
84 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
85 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
86 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
87 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
88 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
89 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
90 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
91 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
92 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
93 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
94 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
95 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
96 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
97 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
98 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
99 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
100 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
101 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
102 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
103 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
104 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
105 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
106 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
107 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
108 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
109 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
110 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
111 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
112 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
113 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
114 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
115 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
116 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
117 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
118 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
119 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
120 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
121 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
122 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
123 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
124 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
125 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
126 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
127 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
128 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
129 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
130 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
131 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
132 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
133 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
134 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
135 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
136 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
137 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
138 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
139 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
140 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
141 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
142 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
143 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
144 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
145 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
146 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
147 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
148 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
149 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
150 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
151 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
152 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
153 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
154 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
155 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
156 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
157 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
158 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
159 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
160 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
161 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
162 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
163 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
164 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
165 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
166 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
167 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
168 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
169 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
170 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
171 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
172 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
173 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
174 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
175 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
176 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
177 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
178 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
179 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
180 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
181 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
182 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
183 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
184 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
185 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
186 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
187 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
188 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
189 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
190 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
191 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
192 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
193 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
194 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
195 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
196 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
197 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
198 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
199 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
201 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
202 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
203 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
231 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
232 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
235 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
236 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
237 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
238 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
239 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
240 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
241 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
242 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
243 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
244 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
245 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
246 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
247 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
248 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
249 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
250 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
251 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
252 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
253 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
254 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
255 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
256 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
257 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
258 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
259 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
260 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
261 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
262 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
263 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
264 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
265 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
266 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
267 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
268 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
269 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
270 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
271 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
272 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
273 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
274 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
275 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
276 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
277 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
278 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
279 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
280 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
281 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
282 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
283 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
284 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
285 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
286 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
287 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
288 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
289 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
290 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
291 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
292 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
293 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
294 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
295 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
296 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
297 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
298 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
299 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
300 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
301 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
302 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
303 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
304 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
305 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
306 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
307 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
308 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
309 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
310 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
311 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
312 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
313 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
314 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
315 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
316 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
317 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
318 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
319 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
320 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
321 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
322 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
323 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
324 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
325 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
326 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
327 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
328 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
329 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
330 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
331 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
332 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
333 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
334 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
335 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
336 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
337 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
338 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
339 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
340 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
341 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
342 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
343 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
344 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
345 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
346 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
347 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
348 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
349 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
350 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
351 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
352 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
353 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
354 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
355 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
356 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
357 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
358 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
359 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
360 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
361 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
362 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
363 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
364 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
365 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
366 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
367 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
368 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
369 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
370 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
371 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
372 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
373 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
374 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
375 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
376 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
377 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
378 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
379 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
380 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
381 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
382 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
383 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
384 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
385 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
386 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
387 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
388 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
389 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
390 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
391 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
392 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
393 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
394 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
395 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
396 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
397 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
398 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
399 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
400 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
401 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
402 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
403 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
404 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
405 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
406 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
407 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
408 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
409 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
410 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
411 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
412 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
413 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
414 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
415 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
416 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
420 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
421 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
439 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
440 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
445 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
446 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
447 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
448 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
449 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
450 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
451 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
452 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
453 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
454 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
455 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
456 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
457 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
458 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
459 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
460 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
461 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
462 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
464 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
465 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
466 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
467 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
468 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
469 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
470 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
471 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
472 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
473 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
474 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
475 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
476 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
477 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
478 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
479 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
480 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
481 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
482 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
483 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
484 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
485 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
487 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
488 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
489 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
490 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
491 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
492 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
493 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
494 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
495 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
496 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
497 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
498 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
499 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
500 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
501 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
502 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
503 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
504 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
505 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
506 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
507 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
508 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
509 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
510 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
511 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
512 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
513 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
514 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.18
Metatranscriptomes 2.14
Isolates 16.68

Biome Distribution

Category Percentage (%)
Aerial Root 0.1
Bulb 0
Endosphere 4.07
Nodule 0.31
Rhizoplane 5.8
Rhizosphere 79.86
Stem 0
Stem Tuber 0
Unclassified 9.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1002824 3300000549 Bacteria 2382
2 JGI24735J21928_10046827 3300002067 Bacteria 1254
3 JGI25152J39213_1000140 3300002773 Bacteria 49435
4 rootH1_10017486 3300003316 Bacteria 4579
5 rootH2_10123511 3300003320 Bacteria 4819
6 rootH1_10085405 3300003323 Bacteria 1663
7 JGI25160J50197_1014226 3300003354 Bacteria 2671
8 JGI25160J50197_1038407 3300003354 Bacteria 1133
9 Ga0055542_1002679 3300003762 Bacteria 5501
10 Ga0065714_10106553 3300005288 Bacteria 1546
11 Ga0065714_10201669 3300005288 Bacteria 893
12 Ga0070658_10002027 3300005327 Bacteria 16977
13 Ga0070676_10024958 3300005328 Bacteria 3374
14 Ga0070683_100181839 3300005329 Bacteria 1996
15 Ga0070670_100225790 3300005331 Bacteria 1629
16 Ga0070682_100234427 3300005337 Bacteria 1314
17 Ga0070660_100040078 3300005339 Bacteria 3563
18 Ga0070692_10107211 3300005345 Bacteria 1540
19 Ga0070668_100051002 3300005347 Bacteria 3187
20 Ga0070674_100055324 3300005356 Bacteria 2747
21 Ga0070659_100030588 3300005366 Bacteria 4167
22 Ga0070710_10256416 3300005437 Bacteria 1126
23 Ga0070663_100141564 3300005455 Bacteria 1837
24 Ga0070678_100053944 3300005456 Bacteria 2926
25 Ga0070678_100119284 3300005456 Bacteria 2077
26 Ga0070698_100511641 3300005471 Bacteria 1139
27 Ga0070684_100113055 3300005535 Bacteria 2436
28 Ga0068853_100096024 3300005539 Bacteria 2615
29 Ga0070672_100300824 3300005543 Bacteria 1360
30 Ga0070665_100117853 3300005548 Bacteria 2658
31 Ga0068855_100056871 3300005563 Bacteria 4586
32 Ga0068855_100176462 3300005563 Bacteria 2417
33 Ga0068856_100151928 3300005614 Bacteria 2325
34 Ga0068856_100558940 3300005614 Bacteria 1165
35 Ga0070702_100000282 3300005615 Bacteria 17359
36 Ga0075432_10002903 3300006058 Bacteria 5763
37 Ga0075432_10017063 3300006058 Bacteria 2477
38 Ga0075367_10002358 3300006178 Bacteria 8588
39 Ga0075370_10049690 3300006353 Bacteria 2378
40 Ga0068865_100084207 3300006881 Bacteria 2291
41 Ga0097620_101535116 3300006931 Bacteria 735
42 Ga0105244_10004227 3300009036 Bacteria 9982
43 Ga0105244_10006637 3300009036 Bacteria 7453
44 Ga0111539_10899260 3300009094 Bacteria 1030
45 Ga0105245_10247194 3300009098 Bacteria 1732
46 Ga0105245_10374763 3300009098 Bacteria 1416
47 Ga0114129_11267947 3300009147 Bacteria 915
48 Ga0105243_10031619 3300009148 Bacteria 4081
49 Ga0105243_10069980 3300009148 Bacteria 2832
50 Ga0105243_10462215 3300009148 Bacteria 1193
51 Ga0105243_10514215 3300009148 Bacteria 1137
52 Ga0105242_10026930 3300009176 Bacteria 4560
53 Ga0105242_10334780 3300009176 Bacteria 1393
54 Ga0105248_10198791 3300009177 Bacteria 2258
55 Ga0105248_10220468 3300009177 Bacteria 2135
56 Ga0105238_10059429 3300009551 Bacteria 3830
57 Ga0105238_10318059 3300009551 Bacteria 1542
58 Ga0105238_10418994 3300009551 Bacteria 1334
59 Ga0105249_10126193 3300009553 Bacteria 2437
60 Ga0105239_10533268 3300010375 Bacteria 1336
61 Ga0105246_10018457 3300011119 Bacteria 4446
62 Ga0105246_10019891 3300011119 Bacteria 4301
63 Ga0105246_10052080 3300011119 Bacteria 2812
64 Ga0105246_10100439 3300011119 Bacteria 2105
65 Ga0105246_10374843 3300011119 Bacteria 1174
66 Ga0157373_10005927 3300013100 Bacteria 9146
67 Ga0157371_10099947 3300013102 Bacteria 2057
68 Ga0157371_10164527 3300013102 Bacteria 1584
69 Ga0157370_10004734 3300013104 Bacteria 15512
70 Ga0157370_10020509 3300013104 Bacteria 6600
71 Ga0157370_10147021 3300013104 Bacteria 2194
72 Ga0157369_10014157 3300013105 Bacteria 9012
73 Ga0157369_10042802 3300013105 Bacteria 4940
74 Ga0157369_10054768 3300013105 Bacteria 4306
75 Ga0157369_10213736 3300013105 Bacteria 2021
76 Ga0157369_10281216 3300013105 Bacteria 1733
77 Ga0157378_10019491 3300013297 Bacteria 5964
78 Ga0157372_10110173 3300013307 Bacteria 3153
79 Ga0157375_10249541 3300013308 Bacteria 1935
80 Ga0157375_10294975 3300013308 Bacteria 1784
81 Ga0157375_10411108 3300013308 Bacteria 1519
82 Ga0157375_10735993 3300013308 Bacteria 1138
83 Ga0157375_10772039 3300013308 Bacteria 1111
84 Ga0157375_11154697 3300013308 Bacteria 908
85 Ga0163163_10087102 3300014325 Bacteria 3133
86 Ga0163163_10129257 3300014325 Bacteria 2566
87 Ga0157380_10011858 3300014326 Bacteria 6303
88 Ga0182008_10001386 3300014497 Bacteria 16403
89 Ga0182008_10012123 3300014497 Bacteria 4558
90 Ga0157379_10685339 3300014968 Bacteria 961
91 Ga0157376_10117457 3300014969 Bacteria 2352
92 Ga0182007_10002461 3300015262 Bacteria 9200
93 Ga0182007_10013236 3300015262 Bacteria 3152
94 Ga0163161_10014026 3300017792 Bacteria 5580
95 Ga0163161_10035341 3300017792 Bacteria 3576
96 Ga0163161_10449728 3300017792 Bacteria 1041
97 Ga0213875_10008509 3300021388 Bacteria 5250
98 Ga0207425_1002927 3300025245 Bacteria 5718
99 Ga0209148_1002761 3300025254 Bacteria 5534
100 Ga0209129_1000067 3300025258 Bacteria 219974
101 Ga0209025_1001395 3300025294 Bacteria 32161
102 Ga0207426_1003132 3300025302 Bacteria 9420
103 Ga0207426_1003775 3300025302 Bacteria 7879
104 Ga0207426_1004297 3300025302 Bacteria 7042
105 Ga0209051_1003979 3300025303 Bacteria 9383
106 Ga0207697_10004823 3300025315 Bacteria 6372
107 Ga0207697_10037574 3300025315 Bacteria 1984
108 Ga0207655_1005476 3300025728 Bacteria 8617
109 Ga0207655_1023324 3300025728 Bacteria 3073
110 Ga0207655_1043814 3300025728 Bacteria 1887
111 Ga0207682_10026419 3300025893 Bacteria 2308
112 Ga0207692_10136671 3300025898 Bacteria 1390
113 Ga0207647_10076822 3300025904 Bacteria 2008
114 Ga0207645_10019501 3300025907 Bacteria 4445
115 Ga0207705_10000006 3300025909 Bacteria 657147
116 Ga0207654_10337560 3300025911 Bacteria 1034
117 Ga0207657_10024467 3300025919 Bacteria 5588
118 Ga0207681_10372273 3300025923 Bacteria 1148
119 Ga0207694_10140078 3300025924 Bacteria 1945
120 Ga0207690_10036765 3300025932 Bacteria 3173
121 Ga0207686_10191184 3300025934 Bacteria 1459
122 Ga0207709_10254713 3300025935 Bacteria 1284
123 Ga0207669_10166489 3300025937 Bacteria 1564
124 Ga0207669_10377368 3300025937 Bacteria 1104
125 Ga0207704_10180517 3300025938 Bacteria 1525
126 Ga0207704_10450750 3300025938 Bacteria 1027
127 Ga0207691_10001023 3300025940 Bacteria 27673
128 Ga0207691_10277389 3300025940 Bacteria 1443
129 Ga0207691_10348912 3300025940 Bacteria 1266
130 Ga0207661_10184750 3300025944 Bacteria 1824
131 Ga0207667_10068535 3300025949 Bacteria 3694
132 Ga0207667_10116835 3300025949 Bacteria 2749
133 Ga0207668_10062894 3300025972 Bacteria 2616
134 Ga0207640_10222953 3300025981 Bacteria 1445
135 Ga0207639_10028241 3300026041 Bacteria 4094
136 Ga0207678_10131147 3300026067 Bacteria 2138
137 Ga0207678_10151959 3300026067 Bacteria 1977
138 Ga0207678_10359035 3300026067 Bacteria 1257
139 Ga0207702_10181899 3300026078 Bacteria 1936
140 Ga0207675_100082678 3300026118 Bacteria 3012
141 Ga0207683_10006538 3300026121 Bacteria 9979
142 Ga0207683_10089505 3300026121 Bacteria 2740
143 Ga0207683_10293498 3300026121 Bacteria 1487
144 Ga0207683_10425132 3300026121 Bacteria 1224
145 Ga0209813_10010366 3300027866 Bacteria 2408
146 Ga0207428_10055820 3300027907 Bacteria 3139
147 Ga0268266_10084559 3300028379 Bacteria 2771
148 Ga0268265_10454861 3300028380 Bacteria 1197
149 Ga0307517_10046625 3300028786 Bacteria 4515
150 Ga0307515_10001938 3300028794 Bacteria 45899
151 Ga0268256_1005878 3300030500 Bacteria 4698
152 Ga0307511_10125846 3300030521 Bacteria 1564
153 Ga0307408_100001200 3300031548 Bacteria 19575
154 Ga0307408_100021674 3300031548 Bacteria 4352
155 Ga0307408_100029791 3300031548 Bacteria 3785
156 Ga0307408_100059025 3300031548 Bacteria 2791
157 Ga0307408_100129695 3300031548 Bacteria 1965
158 Ga0307408_100363184 3300031548 Bacteria 1232
159 Ga0307408_100656211 3300031548 Bacteria 938
160 Ga0307508_10017045 3300031616 Bacteria 6606
161 Ga0307508_10023422 3300031616 Bacteria 5606
162 Ga0307514_10002647 3300031649 Bacteria 18263
163 Ga0307514_10008617 3300031649 Bacteria 8653
164 Ga0316579_10033842 3300031691 Bacteria 2348
165 Ga0316576_10001474 3300031727 Bacteria 12663
166 Ga0316576_10003277 3300031727 Bacteria 9449
167 Ga0316576_10004078 3300031727 Bacteria 8699
168 Ga0316576_10016422 3300031727 Bacteria 4999
169 Ga0316576_10045409 3300031727 Bacteria 3177
170 Ga0316576_10065027 3300031727 Bacteria 2679
171 Ga0316578_10036080 3300031728 Bacteria 2845
172 Ga0316578_10071604 3300031728 Bacteria 2053
173 Ga0316578_10210220 3300031728 Bacteria 1170
174 Ga0307516_10006309 3300031730 Bacteria 13932
175 Ga0307516_10130574 3300031730 Bacteria 2292
176 Ga0307405_10019060 3300031731 Bacteria 3801
177 Ga0307405_10019227 3300031731 Bacteria 3788
178 Ga0307405_10020823 3300031731 Bacteria 3673
179 Ga0307405_10107921 3300031731 Bacteria 1880
180 Ga0307405_10184430 3300031731 Bacteria 1501
181 Ga0307405_10199258 3300031731 Bacteria 1453
182 Ga0307405_10454413 3300031731 Bacteria 1016
183 Ga0316577_10046968 3300031733 Bacteria 2411
184 Ga0316577_10050990 3300031733 Bacteria 2310
185 Ga0307413_10040998 3300031824 Bacteria 2707
186 Ga0307413_10118251 3300031824 Bacteria 1789
187 Ga0307413_10167454 3300031824 Bacteria 1551
188 Ga0307413_10291289 3300031824 Bacteria 1233
189 Ga0307413_10714081 3300031824 Bacteria 834
190 Ga0307410_10063569 3300031852 Bacteria 2532
191 Ga0307410_10074478 3300031852 Bacteria 2364
192 Ga0307410_10099525 3300031852 Bacteria 2081
193 Ga0307410_10128873 3300031852 Bacteria 1856
194 Ga0307410_10216173 3300031852 Bacteria 1472
195 Ga0307410_10245932 3300031852 Bacteria 1388
196 Ga0307410_10263369 3300031852 Bacteria 1345
197 Ga0307406_10003776 3300031901 Bacteria 8239
198 Ga0307406_10098115 3300031901 Bacteria 1989
199 Ga0307407_10031870 3300031903 Bacteria 2859
200 Ga0307407_10051310 3300031903 Bacteria 2364
201 Ga0307407_10163681 3300031903 Bacteria 1458
202 Ga0307407_10231529 3300031903 Bacteria 1255
203 Ga0307407_10279467 3300031903 Bacteria 1156
204 Ga0307412_10002167 3300031911 Bacteria 10899
205 Ga0307412_10035701 3300031911 Bacteria 3178
206 Ga0307412_10054152 3300031911 Bacteria 2662
207 Ga0307412_10066367 3300031911 Bacteria 2445
208 Ga0307412_10066538 3300031911 Bacteria 2443
209 Ga0307412_10081507 3300031911 Bacteria 2238
210 Ga0307412_10109121 3300031911 Bacteria 1972
211 Ga0307412_10123610 3300031911 Bacteria 1867
212 Ga0307412_10197197 3300031911 Bacteria 1526
213 Ga0307412_10247329 3300031911 Bacteria 1383
214 Ga0307412_10427084 3300031911 Bacteria 1085
215 Ga0307409_100010515 3300031995 Bacteria 5760
216 Ga0307409_100030508 3300031995 Bacteria 3874
217 Ga0307409_100091466 3300031995 Bacteria 2493
218 Ga0307409_100238664 3300031995 Bacteria 1653
219 Ga0307409_100510694 3300031995 Bacteria 1172
220 Ga0307409_100520353 3300031995 Bacteria 1162
221 Ga0307409_101273079 3300031995 Bacteria 760
222 Ga0307416_100017801 3300032002 Bacteria 4984
223 Ga0307416_100134641 3300032002 Bacteria 2233
224 Ga0307416_100193655 3300032002 Bacteria 1920
225 Ga0307416_100195365 3300032002 Bacteria 1913
226 Ga0307416_100219906 3300032002 Bacteria 1820
227 Ga0307416_100223902 3300032002 Bacteria 1807
228 Ga0307416_100288678 3300032002 Bacteria 1623
229 Ga0307416_100418932 3300032002 Bacteria 1382
230 Ga0307416_100463054 3300032002 Bacteria 1323
231 Ga0307414_10178095 3300032004 Bacteria 1707
232 Ga0307414_10206089 3300032004 Bacteria 1604
233 Ga0307414_10247689 3300032004 Bacteria 1479
234 Ga0307411_10085090 3300032005 Bacteria 2189
235 Ga0307411_10293495 3300032005 Bacteria 1300
236 Ga0307411_10804784 3300032005 Bacteria 828
237 Ga0307415_100025727 3300032126 Bacteria 3700
238 Ga0307415_100036532 3300032126 Bacteria 3220
239 Ga0316583_10017096 3300032133 Bacteria 2609
240 Ga0316585_10008022 3300032137 Bacteria 3054
241 Ga0307507_10097159 3300033179 Bacteria 2486
242 Ga0307510_10052677 3300033180 Bacteria 4286
243 Ga0307510_10099400 3300033180 Bacteria 2708
244 Ga0316574_0005219 3300035398 Bacteria 6906
245 Ga0316574_0015037 3300035398 Bacteria 4484
246 Ga0316574_0079775 3300035398 Bacteria 2076
247 Ga0316574_0119614 3300035398 Bacteria 1691
248 Ga0316574_0125633 3300035398 Bacteria 1649
249 Ga0316574_0126968 3300035398 Bacteria 1640
250 Ga0316574_0185047 3300035398 Bacteria 1340
251 Ga0316574_0238191 3300035398 Bacteria 1164
252 Ga0316582_0002951 3300036647 Bacteria 8189
253 Ga0316584_0007287 3300036712 Bacteria 7551
254 Ga0316584_0020262 3300036712 Bacteria 4818
255 Ga0316584_0181806 3300036712 Bacteria 1556
256 Ga0316584_0397436 3300036712 Bacteria 982
257 Ga0395899_0089881 3300037312 Bacteria 2227
258 Ga0395899_0119574 3300037312 Bacteria 1888
259 Ga0395899_0264260 3300037312 Bacteria 1176
260 Ga0395900_0018741 3300037418 Bacteria 7058
261 Ga0395900_0019653 3300037418 Bacteria 6887
262 Ga0395900_0123356 3300037418 Bacteria 2657
263 Ga0395900_0136690 3300037418 Bacteria 2511
264 Ga0395898_0001614 3300037466 Bacteria 30641
265 Ga0395898_0017683 3300037466 Bacteria 7276
266 Ga0395898_0029494 3300037466 Bacteria 5495
267 Ga0395898_0035249 3300037466 Bacteria 4978
268 Ga0395898_0088602 3300037466 Bacteria 2979
269 Ga0395898_0466559 3300037466 Bacteria 1202
270 Ga0395905_0189610 3300037471 Bacteria 1929
271 Ga0436364_0879158 3300037853 Bacteria 8561
272 Ga0395901_0013220 3300038443 Bacteria 8381
273 Ga0395901_0020548 3300038443 Bacteria 6758
274 Ga0395901_0029922 3300038443 Bacteria 5609
275 Ga0395901_0032466 3300038443 Bacteria 5387
276 Ga0395901_0092197 3300038443 Bacteria 3171
277 Ga0395901_0201443 3300038443 Bacteria 2086
278 Ga0395901_0582221 3300038443 Bacteria 1130
279 Ga0439436_0001657 3300041404 Bacteria 6504
280 Ga0439436_0010633 3300041404 Bacteria 2805
281 Ga0439436_0012987 3300041404 Bacteria 2523
282 Ga0439436_0019110 3300041404 Bacteria 2047
283 Ga0439436_0029875 3300041404 Bacteria 1585
284 Ga0439436_0077606 3300041404 Bacteria 925
285 Ga0439439_0001237 3300041406 Bacteria 4961
286 Ga0439439_0004531 3300041406 Bacteria 3143
287 Ga0439447_049435 3300041407 Bacteria 1007
288 Ga0439466_0000908 3300041411 Bacteria 11277
289 Ga0439466_0005004 3300041411 Bacteria 5086
290 Ga0439466_0023369 3300041411 Bacteria 2175
291 Ga0439465_0006890 3300041413 Bacteria 3610
292 Ga0451835_0563464 3300041492 Bacteria 1207
293 Ga0451843_1388763 3300041509 Bacteria 1290
294 Ga0451853_1643492 3300041512 Bacteria 1173
295 Ga0451853_1923106 3300041512 Bacteria 2052
296 Ga0439431_0029298 3300041997 Bacteria 1359
297 Ga0439433_0000349 3300041999 Bacteria 8169
298 Ga0439433_0000441 3300041999 Bacteria 7628
299 Ga0439433_0013056 3300041999 Bacteria 1823
300 Ga0439433_0016187 3300041999 Bacteria 1650
301 Ga0439442_000043 3300042002 Bacteria 28612
302 Ga0439442_000244 3300042002 Bacteria 13232
303 Ga0439442_001405 3300042002 Bacteria 4760
304 Ga0439442_002895 3300042002 Bacteria 3380
305 Ga0439432_003697 3300042006 Bacteria 5658
306 Ga0439449_0007219 3300042007 Bacteria 4228
307 Ga0439449_0010997 3300042007 Bacteria 3414
308 Ga0439449_0011042 3300042007 Bacteria 3406
309 Ga0439449_0012687 3300042007 Bacteria 3168
310 Ga0439449_0027037 3300042007 Bacteria 2141
311 Ga0439449_0035646 3300042007 Bacteria 1851
312 Ga0439449_0053348 3300042007 Bacteria 1494
313 Ga0439452_019425 3300042010 Bacteria 1796
314 Ga0439457_000675 3300042014 Bacteria 10082
315 Ga0439457_000681 3300042014 Bacteria 10040
316 Ga0439457_001073 3300042014 Bacteria 8258
317 Ga0439457_003930 3300042014 Bacteria 3969
318 Ga0439457_013048 3300042014 Bacteria 1868
319 Ga0439462_0021119 3300042015 Bacteria 1700
320 Ga0450919_000570 3300042121 Bacteria 4643
321 Ga0450890_007900 3300042127 Bacteria 1361
322 Ga0450894_000002 3300042131 Bacteria 41005
323 Ga0450896_000446 3300042133 Bacteria 4231
324 Ga0450898_000413 3300042134 Bacteria 4969
325 Ga0450900_009014 3300042136 Bacteria 1258
326 Ga0450906_000333 3300042145 Bacteria 9609
327 Ga0450907_000198 3300042146 Bacteria 21876
328 Ga0439446_0002486 3300042156 Bacteria 4433
329 Ga0450908_000741 3300042184 Bacteria 6264
330 Ga0450908_004069 3300042184 Bacteria 2827
331 Ga0450909_000776 3300042185 Bacteria 4331
332 Ga0439434_0001553 3300042435 Bacteria 6616
333 Ga0439434_0046027 3300042435 Bacteria 1346
334 Ga0450918_031723 3300042531 Bacteria 934
335 Ga0466972_0005478 3300044658 Bacteria 6359
336 Ga0466965_0099273 3300044683 Bacteria 1488
337 Ga0466965_0247468 3300044683 Bacteria 956
338 Ga0466966_0005061 3300044684 Bacteria 8661
339 Ga0466966_0015910 3300044684 Bacteria 4972
340 Ga0466961_0003265 3300044693 Bacteria 10098
341 Ga0466961_0020736 3300044693 Bacteria 4230
342 Ga0466963_0000235 3300044694 Bacteria 23900
343 Ga0466963_0000660 3300044694 Bacteria 16639
344 Ga0466971_0000919 3300044719 Bacteria 12083
345 Ga0466971_0033209 3300044719 Bacteria 2312
346 Ga0466970_0001067 3300044765 Bacteria 13269
347 Ga0466970_0016547 3300044765 Bacteria 3805
348 Ga0466970_0025706 3300044765 Bacteria 3084
349 Ga0466957_0000208 3300044842 Bacteria 27496
350 Ga0466957_0249594 3300044842 Bacteria 1180
351 Ga0466960_0004019 3300044901 Bacteria 5719
352 Ga0466960_0079691 3300044901 Bacteria 1647
353 Ga0466959_0003279 3300045049 Bacteria 10551
354 Ga0466958_0006249 3300045836 Bacteria 6467
355 Ga0466967_0020545 3300045976 Bacteria 5342
356 Ga0466967_0027354 3300045976 Bacteria 4743
357 Ga0466967_0095240 3300045976 Bacteria 2713
358 Ga0466967_0261281 3300045976 Bacteria 1656
359 Ga0466967_0402928 3300045976 Bacteria 1331
360 Ga0466967_0773953 3300045976 Bacteria 952
361 Ga0495617_003136 3300046452 Bacteria 6294
362 Ga0495627_060426 3300046453 Bacteria 1122
363 Ga0495592_0004317 3300046454 Bacteria 10399
364 Ga0495592_0024917 3300046454 Bacteria 4546
365 Ga0495592_0094302 3300046454 Bacteria 2142
366 Ga0495603_0005260 3300046455 Bacteria 7723
367 Ga0495603_0005776 3300046455 Bacteria 7403
368 Ga0495603_0040998 3300046455 Bacteria 2770
369 Ga0495590_0013239 3300046457 Bacteria 3039
370 Ga0495629_0075331 3300046459 Bacteria 2356
371 Ga0495629_0093475 3300046459 Bacteria 2099
372 Ga0495629_0171905 3300046459 Bacteria 1503
373 Ga0495638_0140132 3300046460 Bacteria 1412
374 Ga0495651_0003166 3300046462 Bacteria 12675
375 Ga0495651_0020410 3300046462 Bacteria 5144
376 Ga0495651_0176121 3300046462 Bacteria 1518
377 Ga0495651_0324177 3300046462 Bacteria 1026
378 Ga0495653_0020578 3300046463 Bacteria 5348
379 Ga0495653_0216786 3300046463 Bacteria 1289
380 Ga0495580_0004371 3300046472 Bacteria 11866
381 Ga0495580_0016668 3300046472 Bacteria 5514
382 Ga0495580_0046984 3300046472 Bacteria 3061
383 Ga0495582_0020270 3300046473 Bacteria 3639
384 Ga0495582_0078429 3300046473 Bacteria 1832
385 Ga0495582_0084006 3300046473 Bacteria 1769
386 Ga0495605_0014983 3300046474 Bacteria 4227
387 Ga0495639_0009320 3300046475 Bacteria 4210
388 Ga0495639_0123249 3300046475 Bacteria 1237
389 Ga0495662_0000925 3300046476 Bacteria 14359
390 Ga0495662_0014134 3300046476 Bacteria 3884
391 Ga0495662_0022537 3300046476 Bacteria 3041
392 Ga0495662_0045982 3300046476 Bacteria 2108
393 Ga0495664_0000664 3300046477 Bacteria 17513
394 Ga0495664_0051009 3300046477 Bacteria 2457
395 Ga0495664_0200163 3300046477 Bacteria 1210
396 Ga0495585_0021286 3300046492 Bacteria 3724
397 Ga0495585_0047873 3300046492 Bacteria 2379
398 Ga0495585_0054493 3300046492 Bacteria 2210
399 Ga0495585_0128457 3300046492 Bacteria 1336
400 Ga0495594_0013329 3300046499 Bacteria 4290
401 Ga0495594_0033866 3300046499 Bacteria 2778
402 Ga0495594_0042576 3300046499 Bacteria 2487
403 Ga0495594_0070743 3300046499 Bacteria 1939
404 Ga0495594_0376992 3300046499 Bacteria 807
405 Ga0495596_0019518 3300046500 Bacteria 2783
406 Ga0495607_0036894 3300046501 Bacteria 2940
407 Ga0495607_0046065 3300046501 Bacteria 2563
408 Ga0495607_0122556 3300046501 Bacteria 1362
409 Ga0495583_0049174 3300046506 Bacteria 1932
410 Ga0495606_0016141 3300046507 Bacteria 5712
411 Ga0495608_0022867 3300046511 Bacteria 4289
412 Ga0495608_0267747 3300046511 Bacteria 1063
413 Ga0495616_0009847 3300046513 Bacteria 5564
414 Ga0495618_0009745 3300046514 Bacteria 5804
415 Ga0495618_0113560 3300046514 Bacteria 1734
416 Ga0495618_0127986 3300046514 Bacteria 1625
417 Ga0495628_0008429 3300046516 Bacteria 8842
418 Ga0495628_0035779 3300046516 Bacteria 3989
419 Ga0495630_0117295 3300046517 Bacteria 2018
420 Ga0495630_0372872 3300046517 Bacteria 1093
421 Ga0495631_0012088 3300046518 Bacteria 4227
422 Ga0495631_0037212 3300046518 Bacteria 2169
423 Ga0495631_0185345 3300046518 Bacteria 891
424 Ga0495632_0173830 3300046519 Bacteria 988
425 Ga0495637_0172616 3300046520 Bacteria 805
426 Ga0495643_0005652 3300046522 Bacteria 8384
427 Ga0495644_0016789 3300046523 Bacteria 2801
428 Ga0495648_0015807 3300046524 Bacteria 5458
429 Ga0495666_0040124 3300046526 Bacteria 2270
430 Ga0495666_0094899 3300046526 Bacteria 1407
431 Ga0495642_0183017 3300046528 Bacteria 912
432 Ga0495652_0008679 3300046529 Bacteria 9264
433 Ga0495652_0073914 3300046529 Bacteria 2836
434 Ga0495654_0016128 3300046530 Bacteria 3955
435 Ga0495665_0000709 3300046531 Bacteria 17165
436 Ga0495640_0010469 3300046533 Bacteria 7164
437 Ga0495640_0014466 3300046533 Bacteria 5971
438 Ga0495640_0020798 3300046533 Bacteria 4822
439 Ga0495586_0003928 3300046535 Bacteria 7975
440 Ga0495586_0013203 3300046535 Bacteria 4379
441 Ga0495586_0036644 3300046535 Bacteria 2633
442 Ga0495586_0159189 3300046535 Bacteria 1273
443 Ga0495587_0000658 3300046536 Bacteria 23139
444 Ga0495587_0022960 3300046536 Bacteria 3836
445 Ga0495609_0016813 3300046538 Bacteria 3406
446 Ga0495597_0010337 3300046542 Bacteria 4567
447 Ga0495645_0012546 3300046543 Bacteria 5973
448 Ga0495645_0025143 3300046543 Bacteria 4321
449 Ga0495622_0041053 3300046557 Bacteria 2152
450 Ga0495622_0044969 3300046557 Bacteria 2052
451 Ga0495622_0047368 3300046557 Bacteria 1997
452 Ga0495633_0008851 3300046558 Bacteria 5618
453 Ga0495667_0016886 3300046559 Bacteria 4928
454 Ga0495667_0103838 3300046559 Bacteria 1838
455 Ga0495667_0132837 3300046559 Bacteria 1605
456 Ga0495656_0002635 3300046615 Bacteria 5986
457 Ga0495634_0000101 3300046642 Bacteria 70643
458 Ga0495634_0015046 3300046642 Bacteria 5561
459 Ga0495634_0024152 3300046642 Bacteria 4268
460 Ga0495634_0053671 3300046642 Bacteria 2699
461 Ga0495634_0350107 3300046642 Bacteria 885
462 Ga0495611_0025599 3300046648 Bacteria 2572
463 Ga0495625_0007840 3300046660 Bacteria 9199
464 Ga0495635_0001452 3300046663 Bacteria 15859
465 Ga0495635_0043980 3300046663 Bacteria 3081
466 Ga0495635_0135725 3300046663 Bacteria 1677
467 Ga0495635_0160729 3300046663 Bacteria 1529
468 Ga0495635_0175284 3300046663 Bacteria 1458
469 Ga0495635_0196351 3300046663 Bacteria 1369
470 Ga0495661_0026260 3300046665 Bacteria 3752
471 Ga0495661_0176007 3300046665 Bacteria 1137
472 Ga0495661_0241508 3300046665 Bacteria 926
473 Ga0495588_0001531 3300046674 Bacteria 9890
474 Ga0495588_0007227 3300046674 Bacteria 5040
475 Ga0495588_0009869 3300046674 Bacteria 4426
476 Ga0495588_0014083 3300046674 Bacteria 3822
477 Ga0495588_0249451 3300046674 Bacteria 936
478 Ga0495588_0292286 3300046674 Bacteria 858
479 Ga0495657_0000552 3300046675 Bacteria 34564
480 Ga0495657_0004622 3300046675 Bacteria 10993
481 Ga0495657_0006650 3300046675 Bacteria 9028
482 Ga0495657_0031016 3300046675 Bacteria 3739
483 Ga0495657_0067147 3300046675 Bacteria 2354
484 Ga0495599_0027508 3300046678 Bacteria 3565
485 Ga0495646_0000429 3300046680 Bacteria 22240
486 Ga0495646_0022317 3300046680 Bacteria 3994
487 Ga0495658_0078857 3300046683 Bacteria 1928
488 Ga0495658_0080405 3300046683 Bacteria 1911
489 Ga0495658_0086017 3300046683 Bacteria 1854
490 Ga0495613_0002646 3300046689 Bacteria 13464
491 Ga0495613_0007164 3300046689 Bacteria 8305
492 Ga0495613_0013402 3300046689 Bacteria 6091
493 Ga0495613_0035627 3300046689 Bacteria 3692
494 Ga0495613_0145573 3300046689 Bacteria 1691
495 Ga0495624_0008308 3300046690 Bacteria 7256
496 Ga0495624_0054375 3300046690 Bacteria 2524
497 Ga0495624_0321137 3300046690 Bacteria 932
498 Ga0495671_0099660 3300046692 Bacteria 1420
499 Ga0495649_0131477 3300046694 Bacteria 1320
500 Ga0495649_0167644 3300046694 Bacteria 1150
501 Ga0495589_0005737 3300046794 Bacteria 6548
502 Ga0495589_0014246 3300046794 Bacteria 4097
503 Ga0495589_0141825 3300046794 Bacteria 1150
504 Ga0495600_0017269 3300046809 Bacteria 4587
505 Ga0495600_0039550 3300046809 Bacteria 3071
506 Ga0495600_0133929 3300046809 Bacteria 1610
507 Ga0495600_0164684 3300046809 Bacteria 1432
508 Ga0495660_0103924 3300046810 Bacteria 1458
509 Ga0495581_0045046 3300047315 Bacteria 2551
510 Ga0495581_0071489 3300047315 Bacteria 2007
511 Ga0495581_0089678 3300047315 Bacteria 1783
512 Ga0495581_0175076 3300047315 Bacteria 1255
513 Ga0495581_0261246 3300047315 Bacteria 1012
514 Ga0495604_0000157 3300047317 Bacteria 59668
515 Ga0495604_0000361 3300047317 Bacteria 40795
516 Ga0495604_0070386 3300047317 Bacteria 2649
517 Ga0495604_0141038 3300047317 Bacteria 1721
518 Ga0495604_0257762 3300047317 Bacteria 1186
519 Ga0495636_0004966 3300047318 Bacteria 5216
520 Ga0495636_0006595 3300047318 Bacteria 4564
521 Ga0495636_0078159 3300047318 Bacteria 1421
522 Ga0495636_0106933 3300047318 Bacteria 1228
523 Ga0495676_0002174 3300047321 Bacteria 17362
524 Ga0495676_0005356 3300047321 Bacteria 11751
525 Ga0495676_0031033 3300047321 Bacteria 4526
526 Ga0495676_0125964 3300047321 Bacteria 1856
527 Ga0495680_0003856 3300047322 Bacteria 14535
528 Ga0495680_0040734 3300047322 Bacteria 3699
529 Ga0495680_0474965 3300047322 Bacteria 852
530 Ga0495683_0032415 3300047323 Bacteria 2661
531 Ga0495687_002727 3300047443 Bacteria 13703
532 Ga0495687_011261 3300047443 Bacteria 4820
533 Ga0495675_0060083 3300047444 Bacteria 2409
534 Ga0495675_0070316 3300047444 Bacteria 2210
535 Ga0495675_0081242 3300047444 Bacteria 2041
536 Ga0495675_0323878 3300047444 Bacteria 911
537 Ga0495677_0159586 3300047445 Bacteria 870
538 Ga0495685_001913 3300047447 Bacteria 6430
539 Ga0495685_017235 3300047447 Bacteria 2472
540 Ga0495685_022354 3300047447 Bacteria 2176
541 Ga0495685_043189 3300047447 Bacteria 1538
542 Ga0495685_050387 3300047447 Bacteria 1413
543 Ga0495681_0026023 3300047470 Bacteria 3055
544 Ga0495681_0049851 3300047470 Bacteria 1977
545 Ga0495684_0061745 3300047471 Bacteria 2851
546 Ga0495684_0133444 3300047471 Bacteria 1864
547 Ga0495686_0053603 3300047472 Bacteria 2527
548 Ga0495686_0066980 3300047472 Bacteria 2218
549 Ga0495593_0000465 3300047673 Bacteria 22778
550 Ga0495593_0030095 3300047673 Bacteria 2973
551 Ga0495593_0101341 3300047673 Bacteria 1476
552 Ga0495602_0023858 3300048088 Bacteria 5948
553 Ga0495602_0225310 3300048088 Bacteria 1412
554 Ga0495614_0000093 3300048089 Bacteria 29971
555 Ga0495614_0081802 3300048089 Bacteria 1400
556 Ga0495626_0035142 3300048091 Bacteria 2393
557 Ga0496100_0030948 3300048903 Bacteria 3323
558 Ga0496100_0107858 3300048903 Bacteria 1930
559 Ga0496101_0345334 3300048904 Bacteria 1169
560 Ga0496102_0050712 3300048905 Bacteria 3780
561 Ga0496102_0056408 3300048905 Bacteria 3583
562 Ga0496102_0188511 3300048905 Bacteria 1943
563 Ga0496102_0199981 3300048905 Bacteria 1883
564 Ga0496102_0210638 3300048905 Bacteria 1832
565 Ga0496102_0532542 3300048905 Bacteria 1097
566 Ga0496102_0572523 3300048905 Bacteria 1052
567 Ga0496103_0004543 3300048906 Bacteria 8399
568 Ga0496103_0025891 3300048906 Bacteria 3548
569 Ga0496103_0050167 3300048906 Bacteria 2581
570 Ga0496103_0080157 3300048906 Bacteria 2052
571 Ga0496103_0210679 3300048906 Bacteria 1250
572 Ga0496104_0618988 3300048907 Bacteria 992
573 Ga0496105_0011201 3300048908 Bacteria 7075
574 Ga0496105_0125876 3300048908 Bacteria 2112
575 Ga0496105_0144784 3300048908 Bacteria 1954
576 Ga0496105_0279051 3300048908 Bacteria 1348
577 Ga0496105_0553624 3300048908 Bacteria 897
578 Ga0496106_0014770 3300048909 Bacteria 5774
579 Ga0496106_0015995 3300048909 Bacteria 5548
580 Ga0496106_0184502 3300048909 Bacteria 1657
581 Ga0496106_0189516 3300048909 Bacteria 1635
582 Ga0496107_0335137 3300048910 Bacteria 1125
583 Ga0496107_0422054 3300048910 Bacteria 991
584 Ga0496108_0367320 3300048911 Bacteria 1256
585 Ga0496108_0770025 3300048911 Bacteria 831
586 Ga0496109_0016561 3300048912 Bacteria 6447
587 Ga0496109_0081163 3300048912 Bacteria 2988
588 Ga0496109_0098198 3300048912 Bacteria 2715
589 Ga0496109_0119524 3300048912 Bacteria 2454
590 Ga0496109_0342937 3300048912 Bacteria 1411
591 Ga0496109_0615360 3300048912 Bacteria 1022
592 Ga0496110_0006639 3300048913 Bacteria 9191
593 Ga0496110_0078331 3300048913 Bacteria 2942
594 Ga0496110_0317796 3300048913 Bacteria 1418
595 Ga0496110_0570257 3300048913 Bacteria 1028
596 Ga0496110_0610020 3300048913 Bacteria 989
597 Ga0496110_0780047 3300048913 Bacteria 860
598 Ga0496111_0040946 3300048914 Bacteria 3323
599 Ga0496111_0062484 3300048914 Bacteria 2700
600 Ga0496111_0444587 3300048914 Bacteria 957
601 Ga0496112_0021629 3300048915 Bacteria 6118
602 Ga0496112_0065168 3300048915 Bacteria 3595
603 Ga0496113_0182803 3300048916 Bacteria 1662
604 Ga0496113_0201618 3300048916 Bacteria 1582
605 Ga0496113_0218620 3300048916 Bacteria 1518
606 Ga0496113_0218716 3300048916 Bacteria 1518
607 Ga0496114_0009438 3300048917 Bacteria 7745
608 Ga0496114_0020113 3300048917 Bacteria 5416
609 Ga0496114_0085903 3300048917 Bacteria 2665
610 Ga0496114_0152923 3300048917 Bacteria 2002
611 Ga0496114_0153933 3300048917 Bacteria 1995
612 Ga0496115_0123402 3300048918 Bacteria 2132
613 Ga0496117_0001302 3300048920 Bacteria 36720
614 Ga0496118_0001377 3300048921 Bacteria 36644
615 Ga0496119_0169294 3300048922 Bacteria 1155
616 Ga0496119_0197740 3300048922 Bacteria 1042
617 Ga0496119_0202055 3300048922 Bacteria 1028
618 Ga0496121_0215276 3300048924 Bacteria 1358
619 Ga0496122_0001610 3300048925 Bacteria 35298
620 Ga0496122_0303126 3300048925 Bacteria 860
621 Ga0496123_0071895 3300048926 Bacteria 2155
622 Ga0496124_0000037 3300048927 Bacteria 317430
623 Ga0496124_0011460 3300048927 Bacteria 8863
624 Ga0496124_0098360 3300048927 Bacteria 2374
625 Ga0496125_0187671 3300048928 Bacteria 1369
626 Ga0501309_005755 3300049129 Bacteria 1489
627 Ga0501309_010224 3300049129 Bacteria 1207
628 Ga0501310_000129 3300049130 Bacteria 7487
629 Ga0501305_005486 3300049161 Bacteria 1539
630 Ga0495678_027438 3300049459 Bacteria 2416
631 Ga0495682_0044442 3300049460 Bacteria 1625
632 Ga0501315_004345 3300049531 Bacteria 1477
633 Ga0501316_013077 3300049532 Bacteria 977
634 Ga0501317_002804 3300049533 Bacteria 1682
635 Ga0501317_021968 3300049533 Bacteria 871
636 Ga0501317_024623 3300049533 Bacteria 838
637 Ga0501318_009998 3300049534 Bacteria 1044
638 Ga0501318_015624 3300049534 Bacteria 909
639 Ga0501318_025176 3300049534 Bacteria 779
640 Ga0501321_001807 3300049537 Bacteria 1771
641 Ga0501321_003269 3300049537 Bacteria 1472
642 Ga0501321_014403 3300049537 Bacteria 920
643 Ga0501323_003533 3300049539 Bacteria 1602
644 Ga0501323_019237 3300049539 Bacteria 889
645 Ga0501324_001778 3300049540 Bacteria 1488
646 Ga0501325_005173 3300049541 Bacteria 1029
647 Ga0501031_0002670 3300049568 Bacteria 11353
648 Ga0501031_0005968 3300049568 Bacteria 7947
649 Ga0501031_0011273 3300049568 Bacteria 5825
650 Ga0501031_0044524 3300049568 Bacteria 2896
651 Ga0501031_0101938 3300049568 Bacteria 1873
652 Ga0501031_0117787 3300049568 Bacteria 1735
653 Ga0501031_0488672 3300049568 Bacteria 794
654 Ga0501032_0002322 3300049569 Bacteria 14909
655 Ga0501032_0015763 3300049569 Bacteria 5329
656 Ga0501032_0018598 3300049569 Bacteria 4865
657 Ga0501032_0090164 3300049569 Bacteria 2034
658 Ga0501032_0143424 3300049569 Bacteria 1572
659 Ga0501032_0360471 3300049569 Bacteria 936
660 Ga0501033_0001319 3300049570 Bacteria 22075
661 Ga0501033_0005404 3300049570 Bacteria 10123
662 Ga0501033_0019385 3300049570 Bacteria 5143
663 Ga0501033_0143822 3300049570 Bacteria 1723
664 Ga0501033_0186369 3300049570 Bacteria 1486
665 Ga0501033_0310759 3300049570 Bacteria 1108
666 Ga0501034_0000016 3300049571 Bacteria 289751
667 Ga0501034_0005536 3300049571 Bacteria 13773
668 Ga0501034_0009232 3300049571 Bacteria 10337
669 Ga0501034_0015502 3300049571 Bacteria 7829
670 Ga0501034_0076901 3300049571 Bacteria 3344
671 Ga0501034_0239070 3300049571 Bacteria 1762
672 Ga0501034_0243164 3300049571 Bacteria 1745
673 Ga0501036_0001160 3300049572 Bacteria 20034
674 Ga0501036_0022302 3300049572 Bacteria 5326
675 Ga0501036_0029422 3300049572 Bacteria 4640
676 Ga0501036_0046316 3300049572 Bacteria 3682
677 Ga0501036_0059965 3300049572 Bacteria 3223
678 Ga0501036_0202262 3300049572 Bacteria 1670
679 Ga0501037_0004927 3300049573 Bacteria 9714
680 Ga0501037_0018177 3300049573 Bacteria 5179
681 Ga0501037_0141209 3300049573 Bacteria 1723
682 Ga0501037_0237418 3300049573 Bacteria 1278
683 Ga0501037_0447586 3300049573 Bacteria 881
684 Ga0501038_0014610 3300049574 Bacteria 7155
685 Ga0501038_0037790 3300049574 Bacteria 4232
686 Ga0501038_0052584 3300049574 Bacteria 3511
687 Ga0501038_0093535 3300049574 Bacteria 2515
688 Ga0501038_0104229 3300049574 Bacteria 2357
689 Ga0501038_0176972 3300049574 Bacteria 1723
690 Ga0501038_0188773 3300049574 Bacteria 1659
691 Ga0501039_0002048 3300049575 Bacteria 14943
692 Ga0501039_0003912 3300049575 Bacteria 11189
693 Ga0501039_0052487 3300049575 Bacteria 3155
694 Ga0501039_0055425 3300049575 Bacteria 3070
695 Ga0501039_0067545 3300049575 Bacteria 2776
696 Ga0501039_0086315 3300049575 Bacteria 2444
697 Ga0501039_0162611 3300049575 Bacteria 1755
698 Ga0501040_0005244 3300049576 Bacteria 8377
699 Ga0501040_0021373 3300049576 Bacteria 4321
700 Ga0501040_0057853 3300049576 Bacteria 2663
701 Ga0501041_0005106 3300049577 Bacteria 7658
702 Ga0501041_0100633 3300049577 Bacteria 1789
703 Ga0501041_0128095 3300049577 Bacteria 1581
704 Ga0501042_0007416 3300049578 Bacteria 7182
705 Ga0501042_0086086 3300049578 Bacteria 2253
706 Ga0501042_0193532 3300049578 Bacteria 1467
707 Ga0501042_0195381 3300049578 Bacteria 1459
708 Ga0501043_0005857 3300049579 Bacteria 9888
709 Ga0501043_0031178 3300049579 Bacteria 4192
710 Ga0501043_0031683 3300049579 Bacteria 4156
711 Ga0501043_0050584 3300049579 Bacteria 3266
712 Ga0501043_0052441 3300049579 Bacteria 3203
713 Ga0501043_0058889 3300049579 Bacteria 3014
714 Ga0501043_0083113 3300049579 Bacteria 2517
715 Ga0501043_0132457 3300049579 Bacteria 1953
716 Ga0501046_0008062 3300049580 Bacteria 9202
717 Ga0501046_0019116 3300049580 Bacteria 5683
718 Ga0501046_0019177 3300049580 Bacteria 5674
719 Ga0501046_0047998 3300049580 Bacteria 3382
720 Ga0501047_0000055 3300049581 Bacteria 144149
721 Ga0501047_0005299 3300049581 Bacteria 12120
722 Ga0501047_0034303 3300049581 Bacteria 4899
723 Ga0501047_0050108 3300049581 Bacteria 4032
724 Ga0501047_0061090 3300049581 Bacteria 3636
725 Ga0501047_0065492 3300049581 Bacteria 3503
726 Ga0501047_0237624 3300049581 Bacteria 1673
727 Ga0501047_0296380 3300049581 Bacteria 1460
728 Ga0501048_0032810 3300049582 Bacteria 3752
729 Ga0501048_0043286 3300049582 Bacteria 3223
730 Ga0501067_0003965 3300049583 Bacteria 8165
731 Ga0501068_0016577 3300049584 Bacteria 4247
732 Ga0501068_0265838 3300049584 Bacteria 1095
733 Ga0501069_0066831 3300049585 Bacteria 2011
734 Ga0501069_0084361 3300049585 Bacteria 1792
735 Ga0501069_0091178 3300049585 Bacteria 1723
736 Ga0501070_0001349 3300049586 Bacteria 21967
737 Ga0501070_0052604 3300049586 Bacteria 3380
738 Ga0501070_0057506 3300049586 Bacteria 3223
739 Ga0501070_0146652 3300049586 Bacteria 1948
740 Ga0501071_0000571 3300049587 Bacteria 19061
741 Ga0501071_0024403 3300049587 Bacteria 4230
742 Ga0501071_0043187 3300049587 Bacteria 3231
743 Ga0501071_0485697 3300049587 Bacteria 947
744 Ga0501071_0633065 3300049587 Bacteria 823
745 Ga0501072_0000629 3300049588 Bacteria 25276
746 Ga0501072_0060975 3300049588 Bacteria 2974
747 Ga0501072_0070412 3300049588 Bacteria 2762
748 Ga0501073_0009051 3300049589 Bacteria 7350
749 Ga0501074_0001576 3300049590 Bacteria 15433
750 Ga0501074_0002907 3300049590 Bacteria 12017
751 Ga0501075_0005422 3300049591 Bacteria 8725
752 Ga0501076_0026435 3300049592 Bacteria 4497
753 Ga0501076_0027346 3300049592 Bacteria 4423
754 Ga0501077_0002763 3300049593 Bacteria 10522
755 Ga0501077_0048442 3300049593 Bacteria 2700
756 Ga0501257_022465 3300049686 Bacteria 1493
757 Ga0501079_0018036 3300049741 Bacteria 5390
758 Ga0501079_0217838 3300049741 Bacteria 1491
759 Ga0501080_0298823 3300049742 Bacteria 1460
760 Ga0501083_0006924 3300049744 Bacteria 8050
761 Ga0501083_0101351 3300049744 Bacteria 1898
762 Ga0501279_005158 3300049775 Bacteria 1715
763 Ga0501282_011401 3300049778 Bacteria 956
764 Ga0501035_0004810 3300049822 Bacteria 12798
765 Ga0501035_0006030 3300049822 Bacteria 11410
766 Ga0501035_0008263 3300049822 Bacteria 9698
767 Ga0501035_0034866 3300049822 Bacteria 4571
768 Ga0501035_0097520 3300049822 Bacteria 2581
769 Ga0501035_0162220 3300049822 Bacteria 1934
770 Ga0501035_0205867 3300049822 Bacteria 1685
771 Ga0501044_0001989 3300049823 Bacteria 23615
772 Ga0501044_0020628 3300049823 Bacteria 7036
773 Ga0501044_0073097 3300049823 Bacteria 3485
774 Ga0501044_0193987 3300049823 Bacteria 1992
775 Ga0501044_0350808 3300049823 Bacteria 1395
776 Ga0501044_0766314 3300049823 Bacteria 846
777 Ga0501044_0826534 3300049823 Bacteria 804
778 Ga0501045_0025456 3300049824 Bacteria 4253
779 Ga0501045_0123534 3300049824 Bacteria 1922
780 Ga0501045_0211800 3300049824 Bacteria 1443
781 Ga0501045_0452770 3300049824 Bacteria 954
782 nmdc:mga03n38_455215_c1 3300050490 Bacteria 712
783 nmdc:mga03n38_60489_c1 3300050490 Bacteria 1722
784 nmdc:mga00v17_46646_c1 3300050491 Bacteria 2622
785 nmdc:mga0yw44_217326_c1 3300050492 Bacteria 1266
786 nmdc:mga0yw44_613033_c1 3300050492 Bacteria 739
787 Ga0495595_0129887 3300053084 Bacteria 1231
788 Ga0495619_0259771 3300053085 Bacteria 1204
789 Ga0500643_000082 3300053087 Bacteria 101189
790 Ga0500583_0064600 3300053092 Bacteria 1736
791 Ga0500556_0000001 3300053104 Bacteria 1135060
792 Ga0500560_003205 3300053107 Bacteria 3273
793 Ga0500560_040081 3300053107 Bacteria 1464
794 Ga0500572_003899 3300053111 Bacteria 3393
795 Ga0500655_044668 3300053133 Bacteria 874
796 Ga0500559_0000295 3300053136 Bacteria 38451
797 Ga0500559_0001348 3300053136 Bacteria 14102
798 Ga0500559_0014675 3300053136 Bacteria 3309
799 Ga0500559_0049495 3300053136 Bacteria 1851
800 Ga0500568_0000016 3300053139 Bacteria 217194
801 Ga0500573_0050537 3300053140 Bacteria 2391
802 Ga0500573_0066579 3300053140 Bacteria 2059
803 Ga0500573_0134447 3300053140 Bacteria 1367
804 Ga0500577_0002895 3300053142 Bacteria 4420
805 Ga0500600_0243797 3300053149 Bacteria 810
806 Ga0500616_0000398 3300053153 Bacteria 59666
807 Ga0500624_013828 3300053157 Bacteria 1213
808 Ga0500637_0148671 3300053178 Bacteria 1354
809 Ga0501084_0162602 3300054114 Bacteria 1883
810 Ga0501084_0312756 3300054114 Bacteria 1326
811 Ga0587090_003487 3300059510 Bacteria 1832
812 Ga0587072_006472 3300059643 Bacteria 1786
813 Ga0501082_0080491 3300060353 Bacteria 2811
814 Ga0501082_0108479 3300060353 Bacteria 2402
815 Ga0501082_0285155 3300060353 Bacteria 1437
816 Ga0466962_0001558 3300061719 Bacteria 10702
817 Ga0530510_0002743 3300061734 Bacteria 12100
818 Ga0530510_0090754 3300061734 Bacteria 2229
819 Ga0530510_0431151 3300061734 Bacteria 996

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049568 Ga0501031_0002670 Ga0501031_0002670_225_944 214
2 3300049569 Ga0501032_0090164 Ga0501032_0090164_306_1025 214
3 3300049570 Ga0501033_0143822 Ga0501033_0143822_780_1499 214
4 3300049571 Ga0501034_0239070 Ga0501034_0239070_819_1538 214
5 3300049572 Ga0501036_0059965 Ga0501036_0059965_225_944 214
6 3300049573 Ga0501037_0141209 Ga0501037_0141209_225_944 214
7 3300049574 Ga0501038_0176972 Ga0501038_0176972_780_1499 214
8 3300049575 Ga0501039_0003912 Ga0501039_0003912_435_1154 214
9 3300049576 Ga0501040_0021373 Ga0501040_0021373_310_1029 214
10 3300049577 Ga0501041_0005106 Ga0501041_0005106_271_990 214
11 3300049578 Ga0501042_0086086 Ga0501042_0086086_1042_1761 214
12 3300049579 Ga0501043_0132457 Ga0501043_0132457_1010_1729 214
13 3300049580 Ga0501046_0008062 Ga0501046_0008062_3454_4173 214
14 3300049581 Ga0501047_0237624 Ga0501047_0237624_730_1449 214
15 3300049582 Ga0501048_0043286 Ga0501048_0043286_2280_2999 214
16 3300049583 Ga0501067_0003965 Ga0501067_0003965_1055_1774 214
17 3300049584 Ga0501068_0016577 Ga0501068_0016577_2813_3532 214
18 3300049585 Ga0501069_0091178 Ga0501069_0091178_780_1499 214
19 3300049586 Ga0501070_0057506 Ga0501070_0057506_2280_2999 214
20 3300049587 Ga0501071_0024403 Ga0501071_0024403_256_975 214
21 3300049588 Ga0501072_0000629 Ga0501072_0000629_1912_2631 214
22 3300049589 Ga0501073_0009051 Ga0501073_0009051_1010_1729 214
23 3300049590 Ga0501074_0002907 Ga0501074_0002907_10995_11714 214
24 3300049592 Ga0501076_0027346 Ga0501076_0027346_3292_4011 214
25 3300049593 Ga0501077_0002763 Ga0501077_0002763_831_1550 214
26 3300049741 Ga0501079_0018036 Ga0501079_0018036_3630_4349 214
27 3300049742 Ga0501080_0298823 Ga0501080_0298823_249_968 214
28 3300049744 Ga0501083_0101351 Ga0501083_0101351_833_1552 214
29 3300049822 Ga0501035_0205867 Ga0501035_0205867_742_1461 214
30 3300049823 Ga0501044_0001989 Ga0501044_0001989_352_1071 214
31 3300049824 Ga0501045_0211800 Ga0501045_0211800_493_1212 214
32 3300054114 Ga0501084_0162602 Ga0501084_0162602_940_1659 214
33 3300060353 Ga0501082_0108479 Ga0501082_0108479_17_736 214
34 3300046501 Ga0495607_0122556 Ga0495607_0122556_623_1342 217
35 3300046794 Ga0495589_0014246 Ga0495589_0014246_724_1443 217
36 3300047447 Ga0495685_043189 Ga0495685_043189_559_1278 217
37 3300049573 Ga0501037_0447586 Ga0501037_0447586_57_776 217
38 3300049578 Ga0501042_0195381 Ga0501042_0195381_352_1071 217
39 3300049581 Ga0501047_0000055 Ga0501047_0000055_112731_113450 217
40 3300049823 Ga0501044_0766314 Ga0501044_0766314_38_757 217
41 3300050490 nmdc:mga03n38_455215_c1 nmdc:mga03n38_455215_c1_10_696 226
42 iso_pu_bacteria 2643221679 2644445082 226
43 3300053104 Ga0500556_0000001 Ga0500556_0000001_204145_204879 227
44 3300053133 Ga0500655_044668 Ga0500655_044668_22_756 227
45 3300053139 Ga0500568_0000016 Ga0500568_0000016_8129_8863 227
46 3300053087 Ga0500643_000082 Ga0500643_000082_5275_6009 228
47 3300009094 Ga0111539_10899260 Ga0111539_108992602 230
48 3300031727 Ga0316576_10003277 Ga0316576_100032773 230
49 3300031728 Ga0316578_10071604 Ga0316578_100716043 230
50 iso_pu_bacteria 2547132111 2547411092 230
51 iso_pu_bacteria 2554235005 2554259233 230
52 iso_pu_bacteria 2582581312 2585298545 230
53 iso_pu_bacteria 2616644814 2616693898 230
54 iso_pu_bacteria 2616644941 2616899123 230
55 iso_pu_bacteria 2643221548 2643762628 230
56 iso_pu_bacteria 2643221578 2643897070 230
57 iso_pu_bacteria 2643221673 2644408215 230
58 iso_pu_bacteria 2643221678 2644435415 230
59 iso_pu_bacteria 2643221682 2644460948 230
60 iso_pu_bacteria 2643221714 2644631358 230
61 iso_pu_bacteria 2767802112 2768646680 230
62 iso_pu_bacteria 2784132148 2784587068 230
63 iso_pu_bacteria 2784746763 2785345347 230
64 iso_pu_bacteria 2784746768 2785367542 230
65 iso_pu_bacteria 2791355406 2793980571 230
66 iso_pu_bacteria 2795385470 2795786542 230
67 iso_pu_bacteria 2802429296 2804844139 230
68 iso_pu_bacteria 2808606359 2808848030 230
69 iso_pu_bacteria 2808606375 2808918788 230
70 iso_pu_bacteria 2808606448 2809230630 230
71 iso_pu_bacteria 2808606982 2811847308 230
72 iso_pu_bacteria 2811994879 2812359963 230
73 iso_pu_bacteria 2811994917 2812482035 230
74 iso_pu_bacteria 2818991463 2819694432 230
75 iso_pu_bacteria 2818991472 2819739983 230
76 iso_pu_bacteria 2852635781 2852638065 230
77 iso_pu_bacteria 2862178590 2862183263 230
78 iso_pu_bacteria 2862281513 2862289101 230
79 iso_pu_bacteria 2862290372 2862291030 230
80 iso_pu_bacteria 2862382967 2862388026 230
81 iso_pu_bacteria 2862507626 2862509142 230
82 iso_pu_bacteria 2862574272 2862583320 230
83 iso_pu_bacteria 2862705112 2862706665 230
84 iso_pu_bacteria 2863404153 2863406602 230
85 iso_pu_bacteria 2867346516 2867352720 230
86 iso_pu_bacteria 2867428634 2867437025 230
87 iso_pu_bacteria 2867475112 2867475791 230
88 iso_pu_bacteria 2873151551 2873157336 230
89 iso_pu_bacteria 2875391855 2875393028 230
90 iso_pu_bacteria 2877676314 2877683000 230
91 iso_pu_bacteria 2912715099 2912722010 230
92 iso_pu_bacteria 2912723979 2912725776 230
93 iso_pu_bacteria 2912757875 2912759206 230
94 iso_pu_bacteria 2918501144 2918502883 230
95 iso_pu_bacteria 2919468124 2919475103 230
96 iso_pu_bacteria 2935390628 2935394425 230
97 iso_pu_bacteria 2946045630 2946051674 230
98 iso_pu_bacteria 2946064051 2946065932 230
99 iso_pu_bacteria 2946072368 2946074261 230
100 iso_pu_bacteria 2947224130 2947231469 230
101 iso_pu_bacteria 2954002825 2954004715 230
102 iso_pu_bacteria 2954380949 2954388223 230
103 iso_pu_bacteria 2966598605 2966604036 230
104 iso_pu_bacteria 2990044586 2990044605 230
105 iso_pu_bacteria 2990059506 2990066147 230
106 iso_pu_bacteria 2990088156 2990088599 230
107 iso_pu_bacteria 2997451912 2997458842 230
108 iso_pu_bacteria 2997600082 2997606888 230
109 iso_pu_bacteria 3006321560 3006323172 230
110 iso_pu_bacteria 3006486233 3006488112 230
111 iso_pu_bacteria 3006493962 3006496659 230
112 iso_pu_bacteria 8008485437 8008489232 230
113 iso_pu_bacteria 8008558824 8008561711 230
114 iso_pu_bacteria 8023623736 8023630715 230
115 iso_pu_bacteria 8025413630 8025418884 230
116 iso_pu_bacteria 8025478263 8025480062 230
117 iso_pu_bacteria 8025524527 8025527563 230
118 iso_pu_bacteria 8025530807 8025535792 230
119 iso_pu_bacteria 8033684223 8033689884 230
120 iso_pu_bacteria 8047893842 8047899901 230
121 iso_pu_bacteria 8048127548 8048130954 230
122 iso_pu_bacteria 8048356638 8048359028 230
123 iso_pu_bacteria 8048369669 8048376850 230
124 iso_pu_bacteria 8048379754 8048385903 230
125 iso_pu_bacteria 8048406513 8048411635 230
126 iso_pu_bacteria 8054160619 8054163407 230
127 iso_pu_bacteria 8056447290 8056447781 230
128 iso_pu_bacteria 8056667051 8056667448 230
129 iso_pu_bacteria 8056829672 8056832968 230
130 3300048922 Ga0496119_0197740 Ga0496119_0197740_298_993 231
131 3300046674 Ga0495588_0249451 Ga0495588_0249451_55_765 232
132 3300049569 Ga0501032_0360471 Ga0501032_0360471_48_746 232
133 iso_pu_bacteria 2643221572 2643875272 232
134 iso_pu_bacteria 2643221669 2644382328 232
135 iso_pu_bacteria 2751185788 2753302141 232
136 iso_pu_bacteria 2784746763 2785345163 232
137 iso_pu_bacteria 2808606365 2808874336 232
138 iso_pu_bacteria 2852643534 2852645422 232
139 iso_pu_bacteria 2857733635 2857735622 232
140 iso_pu_bacteria 2904430863 2904432648 232
141 iso_pu_bacteria 2904501621 2904503095 232
142 iso_pu_bacteria 2908674828 2908675728 232
143 iso_pu_bacteria 2909074476 2909074780 232
144 iso_pu_bacteria 2919039151 2919040760 232
145 iso_pu_bacteria 2919042368 2919043825 232
146 iso_pu_bacteria 2919443155 2919446163 232
147 iso_pu_bacteria 2928104781 2928107897 232
148 iso_pu_bacteria 2928500415 2928502433 232
149 iso_pu_bacteria 2964326757 2964329672 232
150 iso_pu_bacteria 2966921586 2966922740 232
151 iso_pu_bacteria 2984551494 2984554280 232
152 iso_pu_bacteria 2990059506 2990066397 232
153 iso_pu_bacteria 2995726249 2995728110 232
154 iso_pu_bacteria 3001889506 3001891499 232
155 iso_pu_bacteria 8002811521 8002812570 232
156 iso_pu_bacteria 8055034563 8055035881 232
157 3300006931 Ga0097620_101535116 Ga0097620_1015351161 233
158 3300013308 Ga0157375_10294975 Ga0157375_102949752 233
159 3300046557 Ga0495622_0041053 Ga0495622_0041053_371_1087 233
160 3300048912 Ga0496109_0119524 Ga0496109_0119524_1348_2052 233
161 3300048913 Ga0496110_0317796 Ga0496110_0317796_613_1317 233
162 3300048913 Ga0496110_0780047 Ga0496110_0780047_56_760 233
163 3300048914 Ga0496111_0444587 Ga0496111_0444587_109_870 233
164 3300049575 Ga0501039_0055425 Ga0501039_0055425_33_737 233
165 3300049576 Ga0501040_0005244 Ga0501040_0005244_2856_3560 233
166 3300049577 Ga0501041_0128095 Ga0501041_0128095_703_1407 233
167 3300049582 Ga0501048_0032810 Ga0501048_0032810_1830_2534 233
168 3300049587 Ga0501071_0043187 Ga0501071_0043187_1503_2207 233
169 3300049588 Ga0501072_0070412 Ga0501072_0070412_817_1521 233
170 3300049591 Ga0501075_0005422 Ga0501075_0005422_5863_6567 233
171 3300049592 Ga0501076_0026435 Ga0501076_0026435_3340_4044 233
172 3300049593 Ga0501077_0048442 Ga0501077_0048442_1592_2296 233
173 3300049824 Ga0501045_0025456 Ga0501045_0025456_2864_3568 233
174 3300061734 Ga0530510_0002743 Ga0530510_0002743_9646_10350 233
175 3300061734 Ga0530510_0431151 Ga0530510_0431151_41_745 233
176 iso_pu_bacteria 2643221694 2644526693 233
177 3300002067 JGI24735J21928_10046827 JGI24735J21928_100468271 234
178 3300003316 rootH1_10017486 rootH1_100174865 234
179 3300003320 rootH2_10123511 rootH2_101235117 234
180 3300003323 rootH1_10085405 rootH1_100854052 234
181 3300003354 JGI25160J50197_1014226 JGI25160J50197_10142263 234
182 3300003354 JGI25160J50197_1038407 JGI25160J50197_10384071 234
183 3300005329 Ga0070683_100181839 Ga0070683_1001818392 234
184 3300005471 Ga0070698_100511641 Ga0070698_1005116411 234
185 3300005539 Ga0068853_100096024 Ga0068853_1000960242 234
186 3300005548 Ga0070665_100117853 Ga0070665_1001178532 234
187 3300005614 Ga0068856_100558940 Ga0068856_1005589402 234
188 3300009176 Ga0105242_10334780 Ga0105242_103347802 234
189 3300009551 Ga0105238_10418994 Ga0105238_104189942 234
190 3300010375 Ga0105239_10533268 Ga0105239_105332681 234
191 3300011119 Ga0105246_10018457 Ga0105246_100184572 234
192 3300013104 Ga0157370_10147021 Ga0157370_101470214 234
193 3300013105 Ga0157369_10054768 Ga0157369_100547682 234
194 3300013105 Ga0157369_10213736 Ga0157369_102137364 234
195 3300014497 Ga0182008_10001386 Ga0182008_1000138610 234
196 3300014497 Ga0182008_10012123 Ga0182008_100121233 234
197 3300014969 Ga0157376_10117457 Ga0157376_101174572 234
198 3300015262 Ga0182007_10002461 Ga0182007_1000246110 234
199 3300015262 Ga0182007_10013236 Ga0182007_100132362 234
200 3300017792 Ga0163161_10449728 Ga0163161_104497281 234
201 3300021388 Ga0213875_10008509 Ga0213875_100085092 234
202 3300025302 Ga0207426_1003132 Ga0207426_10031322 234
203 3300025302 Ga0207426_1003775 Ga0207426_10037751 234
204 3300025302 Ga0207426_1004297 Ga0207426_10042974 234
205 3300025911 Ga0207654_10337560 Ga0207654_103375601 234
206 3300025938 Ga0207704_10450750 Ga0207704_104507502 234
207 3300025981 Ga0207640_10222953 Ga0207640_102229532 234
208 3300026041 Ga0207639_10028241 Ga0207639_100282412 234
209 3300026067 Ga0207678_10151959 Ga0207678_101519592 234
210 3300026078 Ga0207702_10181899 Ga0207702_101818992 234
211 3300028379 Ga0268266_10084559 Ga0268266_100845594 234
212 3300030521 Ga0307511_10125846 Ga0307511_101258462 234
213 3300031616 Ga0307508_10023422 Ga0307508_100234226 234
214 3300031691 Ga0316579_10033842 Ga0316579_100338423 234
215 3300031727 Ga0316576_10001474 Ga0316576_100014749 234
216 3300031727 Ga0316576_10045409 Ga0316576_100454092 234
217 3300031727 Ga0316576_10065027 Ga0316576_100650273 234
218 3300031728 Ga0316578_10036080 Ga0316578_100360802 234
219 3300031903 Ga0307407_10279467 Ga0307407_102794671 234
220 3300032002 Ga0307416_100219906 Ga0307416_1002199062 234
221 3300032137 Ga0316585_10008022 Ga0316585_100080223 234
222 3300033180 Ga0307510_10099400 Ga0307510_100994002 234
223 3300035398 Ga0316574_0079775 Ga0316574_0079775_474_1190 234
224 3300036712 Ga0316584_0181806 Ga0316584_0181806_474_1181 234
225 3300036712 Ga0316584_0397436 Ga0316584_0397436_106_813 234
226 3300037312 Ga0395899_0264260 Ga0395899_0264260_182_886 234
227 3300037418 Ga0395900_0019653 Ga0395900_0019653_378_1097 234
228 3300037466 Ga0395898_0001614 Ga0395898_0001614_22422_23141 234
229 3300037466 Ga0395898_0466559 Ga0395898_0466559_399_1103 234
230 3300037853 Ga0436364_0879158 Ga0436364_0879158_727_1446 234
231 3300038443 Ga0395901_0029922 Ga0395901_0029922_910_1629 234
232 3300041404 Ga0439436_0012987 Ga0439436_0012987_133_852 234
233 3300041404 Ga0439436_0019110 Ga0439436_0019110_809_1528 234
234 3300041406 Ga0439439_0004531 Ga0439439_0004531_477_1196 234
235 3300041492 Ga0451835_0563464 Ga0451835_0563464_331_1050 234
236 3300041509 Ga0451843_1388763 Ga0451843_1388763_557_1276 234
237 3300041512 Ga0451853_1923106 Ga0451853_1923106_1292_2011 234
238 3300041999 Ga0439433_0000349 Ga0439433_0000349_3416_4135 234
239 3300042007 Ga0439449_0010997 Ga0439449_0010997_148_852 234
240 3300042014 Ga0439457_000681 Ga0439457_000681_2109_2828 234
241 3300042127 Ga0450890_007900 Ga0450890_007900_65_784 234
242 3300042131 Ga0450894_000002 Ga0450894_000002_32061_32780 234
243 3300042133 Ga0450896_000446 Ga0450896_000446_707_1426 234
244 3300042134 Ga0450898_000413 Ga0450898_000413_99_818 234
245 3300042136 Ga0450900_009014 Ga0450900_009014_453_1172 234
246 3300042145 Ga0450906_000333 Ga0450906_000333_8529_9248 234
247 3300042184 Ga0450908_000741 Ga0450908_000741_1448_2167 234
248 3300044658 Ga0466972_0005478 Ga0466972_0005478_933_1637 234
249 3300044684 Ga0466966_0005061 Ga0466966_0005061_4392_5096 234
250 3300044684 Ga0466966_0015910 Ga0466966_0015910_620_1339 234
251 3300044693 Ga0466961_0003265 Ga0466961_0003265_2869_3573 234
252 3300044693 Ga0466961_0020736 Ga0466961_0020736_17_736 234
253 3300044694 Ga0466963_0000235 Ga0466963_0000235_2640_3344 234
254 3300044694 Ga0466963_0000660 Ga0466963_0000660_3438_4142 234
255 3300044719 Ga0466971_0000919 Ga0466971_0000919_9557_10261 234
256 3300044719 Ga0466971_0033209 Ga0466971_0033209_1506_2225 234
257 3300044765 Ga0466970_0001067 Ga0466970_0001067_5192_5896 234
258 3300044765 Ga0466970_0016547 Ga0466970_0016547_2868_3572 234
259 3300044765 Ga0466970_0025706 Ga0466970_0025706_1600_2304 234
260 3300044842 Ga0466957_0000208 Ga0466957_0000208_3201_3905 234
261 3300044842 Ga0466957_0249594 Ga0466957_0249594_272_976 234
262 3300044901 Ga0466960_0004019 Ga0466960_0004019_1418_2122 234
263 3300045049 Ga0466959_0003279 Ga0466959_0003279_6410_7114 234
264 3300045836 Ga0466958_0006249 Ga0466958_0006249_5668_6372 234
265 3300045976 Ga0466967_0020545 Ga0466967_0020545_4287_5006 234
266 3300045976 Ga0466967_0027354 Ga0466967_0027354_1955_2659 234
267 3300045976 Ga0466967_0095240 Ga0466967_0095240_284_988 234
268 3300045976 Ga0466967_0261281 Ga0466967_0261281_131_835 234
269 3300045976 Ga0466967_0402928 Ga0466967_0402928_390_1094 234
270 3300046452 Ga0495617_003136 Ga0495617_003136_3429_4148 234
271 3300046453 Ga0495627_060426 Ga0495627_060426_253_972 234
272 3300046454 Ga0495592_0004317 Ga0495592_0004317_6296_7015 234
273 3300046454 Ga0495592_0094302 Ga0495592_0094302_664_1383 234
274 3300046455 Ga0495603_0005260 Ga0495603_0005260_1583_2302 234
275 3300046455 Ga0495603_0005776 Ga0495603_0005776_5484_6203 234
276 3300046457 Ga0495590_0013239 Ga0495590_0013239_1073_1792 234
277 3300046459 Ga0495629_0093475 Ga0495629_0093475_170_889 234
278 3300046459 Ga0495629_0171905 Ga0495629_0171905_535_1254 234
279 3300046460 Ga0495638_0140132 Ga0495638_0140132_243_962 234
280 3300046462 Ga0495651_0020410 Ga0495651_0020410_1215_1934 234
281 3300046462 Ga0495651_0176121 Ga0495651_0176121_406_1125 234
282 3300046472 Ga0495580_0046984 Ga0495580_0046984_1234_1953 234
283 3300046473 Ga0495582_0020270 Ga0495582_0020270_1000_1704 234
284 3300046474 Ga0495605_0014983 Ga0495605_0014983_2510_3229 234
285 3300046475 Ga0495639_0009320 Ga0495639_0009320_796_1515 234
286 3300046476 Ga0495662_0014134 Ga0495662_0014134_1327_2046 234
287 3300046476 Ga0495662_0045982 Ga0495662_0045982_432_1151 234
288 3300046477 Ga0495664_0200163 Ga0495664_0200163_73_792 234
289 3300046492 Ga0495585_0021286 Ga0495585_0021286_1480_2199 234
290 3300046492 Ga0495585_0047873 Ga0495585_0047873_638_1357 234
291 3300046492 Ga0495585_0054493 Ga0495585_0054493_364_1083 234
292 3300046492 Ga0495585_0128457 Ga0495585_0128457_224_943 234
293 3300046499 Ga0495594_0013329 Ga0495594_0013329_3208_3927 234
294 3300046499 Ga0495594_0033866 Ga0495594_0033866_836_1540 234
295 3300046499 Ga0495594_0070743 Ga0495594_0070743_260_979 234
296 3300046499 Ga0495594_0376992 Ga0495594_0376992_78_794 234
297 3300046500 Ga0495596_0019518 Ga0495596_0019518_848_1567 234
298 3300046501 Ga0495607_0036894 Ga0495607_0036894_1480_2199 234
299 3300046501 Ga0495607_0046065 Ga0495607_0046065_1497_2213 234
300 3300046506 Ga0495583_0049174 Ga0495583_0049174_11_730 234
301 3300046507 Ga0495606_0016141 Ga0495606_0016141_3755_4474 234
302 3300046511 Ga0495608_0022867 Ga0495608_0022867_357_1076 234
303 3300046513 Ga0495616_0009847 Ga0495616_0009847_2041_2760 234
304 3300046514 Ga0495618_0009745 Ga0495618_0009745_546_1265 234
305 3300046514 Ga0495618_0127986 Ga0495618_0127986_633_1352 234
306 3300046516 Ga0495628_0035779 Ga0495628_0035779_519_1238 234
307 3300046518 Ga0495631_0012088 Ga0495631_0012088_2510_3229 234
308 3300046518 Ga0495631_0185345 Ga0495631_0185345_145_861 234
309 3300046519 Ga0495632_0173830 Ga0495632_0173830_188_907 234
310 3300046520 Ga0495637_0172616 Ga0495637_0172616_74_793 234
311 3300046522 Ga0495643_0005652 Ga0495643_0005652_1812_2531 234
312 3300046523 Ga0495644_0016789 Ga0495644_0016789_1047_1763 234
313 3300046524 Ga0495648_0015807 Ga0495648_0015807_4336_5055 234
314 3300046526 Ga0495666_0040124 Ga0495666_0040124_364_1083 234
315 3300046526 Ga0495666_0094899 Ga0495666_0094899_573_1292 234
316 3300046529 Ga0495652_0008679 Ga0495652_0008679_4688_5407 234
317 3300046529 Ga0495652_0073914 Ga0495652_0073914_1307_2026 234
318 3300046530 Ga0495654_0016128 Ga0495654_0016128_2423_3142 234
319 3300046533 Ga0495640_0010469 Ga0495640_0010469_931_1650 234
320 3300046533 Ga0495640_0014466 Ga0495640_0014466_3403_4122 234
321 3300046533 Ga0495640_0020798 Ga0495640_0020798_3407_4126 234
322 3300046538 Ga0495609_0016813 Ga0495609_0016813_1720_2439 234
323 3300046542 Ga0495597_0010337 Ga0495597_0010337_911_1630 234
324 3300046557 Ga0495622_0044969 Ga0495622_0044969_717_1436 234
325 3300046557 Ga0495622_0047368 Ga0495622_0047368_1045_1764 234
326 3300046558 Ga0495633_0008851 Ga0495633_0008851_2345_3064 234
327 3300046559 Ga0495667_0103838 Ga0495667_0103838_982_1701 234
328 3300046559 Ga0495667_0132837 Ga0495667_0132837_585_1304 234
329 3300046642 Ga0495634_0015046 Ga0495634_0015046_1850_2569 234
330 3300046642 Ga0495634_0024152 Ga0495634_0024152_1220_1924 234
331 3300046642 Ga0495634_0053671 Ga0495634_0053671_1429_2148 234
332 3300046648 Ga0495611_0025599 Ga0495611_0025599_705_1424 234
333 3300046663 Ga0495635_0043980 Ga0495635_0043980_831_1550 234
334 3300046663 Ga0495635_0196351 Ga0495635_0196351_283_1002 234
335 3300046665 Ga0495661_0026260 Ga0495661_0026260_1037_1756 234
336 3300046665 Ga0495661_0241508 Ga0495661_0241508_64_780 234
337 3300046674 Ga0495588_0007227 Ga0495588_0007227_730_1449 234
338 3300046674 Ga0495588_0009869 Ga0495588_0009869_2910_3614 234
339 3300046674 Ga0495588_0292286 Ga0495588_0292286_20_739 234
340 3300046675 Ga0495657_0004622 Ga0495657_0004622_7766_8470 234
341 3300046675 Ga0495657_0006650 Ga0495657_0006650_1754_2473 234
342 3300046675 Ga0495657_0031016 Ga0495657_0031016_883_1602 234
343 3300046675 Ga0495657_0067147 Ga0495657_0067147_1570_2289 234
344 3300046680 Ga0495646_0022317 Ga0495646_0022317_732_1451 234
345 3300046683 Ga0495658_0078857 Ga0495658_0078857_261_980 234
346 3300046689 Ga0495613_0007164 Ga0495613_0007164_2497_3216 234
347 3300046689 Ga0495613_0013402 Ga0495613_0013402_786_1505 234
348 3300046689 Ga0495613_0035627 Ga0495613_0035627_817_1536 234
349 3300046689 Ga0495613_0145573 Ga0495613_0145573_751_1470 234
350 3300046690 Ga0495624_0008308 Ga0495624_0008308_1636_2355 234
351 3300046690 Ga0495624_0054375 Ga0495624_0054375_1607_2326 234
352 3300046690 Ga0495624_0321137 Ga0495624_0321137_44_763 234
353 3300046694 Ga0495649_0131477 Ga0495649_0131477_478_1197 234
354 3300046694 Ga0495649_0167644 Ga0495649_0167644_10_729 234
355 3300046794 Ga0495589_0005737 Ga0495589_0005737_4578_5294 234
356 3300046794 Ga0495589_0141825 Ga0495589_0141825_368_1087 234
357 3300046809 Ga0495600_0039550 Ga0495600_0039550_216_935 234
358 3300046809 Ga0495600_0164684 Ga0495600_0164684_296_1015 234
359 3300046810 Ga0495660_0103924 Ga0495660_0103924_687_1406 234
360 3300047315 Ga0495581_0045046 Ga0495581_0045046_685_1404 234
361 3300047317 Ga0495604_0000361 Ga0495604_0000361_6965_7669 234
362 3300047317 Ga0495604_0070386 Ga0495604_0070386_1254_1973 234
363 3300047317 Ga0495604_0141038 Ga0495604_0141038_250_969 234
364 3300047317 Ga0495604_0257762 Ga0495604_0257762_164_883 234
365 3300047318 Ga0495636_0004966 Ga0495636_0004966_3753_4457 234
366 3300047318 Ga0495636_0006595 Ga0495636_0006595_1741_2445 234
367 3300047318 Ga0495636_0078159 Ga0495636_0078159_322_1038 234
368 3300047318 Ga0495636_0106933 Ga0495636_0106933_439_1158 234
369 3300047321 Ga0495676_0005356 Ga0495676_0005356_1849_2568 234
370 3300047321 Ga0495676_0031033 Ga0495676_0031033_3786_4505 234
371 3300047321 Ga0495676_0125964 Ga0495676_0125964_442_1158 234
372 3300047322 Ga0495680_0003856 Ga0495680_0003856_3041_3760 234
373 3300047323 Ga0495683_0032415 Ga0495683_0032415_1256_1975 234
374 3300047443 Ga0495687_002727 Ga0495687_002727_10650_11369 234
375 3300047443 Ga0495687_011261 Ga0495687_011261_1128_1847 234
376 3300047444 Ga0495675_0060083 Ga0495675_0060083_447_1166 234
377 3300047444 Ga0495675_0081242 Ga0495675_0081242_140_859 234
378 3300047444 Ga0495675_0323878 Ga0495675_0323878_33_752 234
379 3300047447 Ga0495685_001913 Ga0495685_001913_4518_5234 234
380 3300047447 Ga0495685_017235 Ga0495685_017235_609_1313 234
381 3300047447 Ga0495685_022354 Ga0495685_022354_201_920 234
382 3300047447 Ga0495685_050387 Ga0495685_050387_122_826 234
383 3300047470 Ga0495681_0026023 Ga0495681_0026023_512_1231 234
384 3300047472 Ga0495686_0053603 Ga0495686_0053603_1572_2276 234
385 3300047472 Ga0495686_0066980 Ga0495686_0066980_1027_1746 234
386 3300047673 Ga0495593_0101341 Ga0495593_0101341_692_1411 234
387 3300048088 Ga0495602_0225310 Ga0495602_0225310_96_815 234
388 3300048089 Ga0495614_0000093 Ga0495614_0000093_6140_6859 234
389 3300048908 Ga0496105_0279051 Ga0496105_0279051_486_1211 234
390 3300048909 Ga0496106_0014770 Ga0496106_0014770_1458_2177 234
391 3300048909 Ga0496106_0189516 Ga0496106_0189516_796_1500 234
392 3300048912 Ga0496109_0016561 Ga0496109_0016561_4593_5297 234
393 3300048913 Ga0496110_0570257 Ga0496110_0570257_273_977 234
394 3300048922 Ga0496119_0202055 Ga0496119_0202055_191_910 234
395 3300048924 Ga0496121_0215276 Ga0496121_0215276_580_1284 234
396 3300049129 Ga0501309_005755 Ga0501309_005755_739_1443 234
397 3300049459 Ga0495678_027438 Ga0495678_027438_110_829 234
398 3300049460 Ga0495682_0044442 Ga0495682_0044442_180_899 234
399 3300049531 Ga0501315_004345 Ga0501315_004345_54_758 234
400 3300049532 Ga0501316_013077 Ga0501316_013077_53_757 234
401 3300049533 Ga0501317_024623 Ga0501317_024623_28_747 234
402 3300049534 Ga0501318_009998 Ga0501318_009998_311_1030 234
403 3300049534 Ga0501318_015624 Ga0501318_015624_140_844 234
404 3300049539 Ga0501323_003533 Ga0501323_003533_852_1556 234
405 3300049539 Ga0501323_019237 Ga0501323_019237_155_874 234
406 3300049540 Ga0501324_001778 Ga0501324_001778_730_1434 234
407 3300049568 Ga0501031_0005968 Ga0501031_0005968_1262_1966 234
408 3300049568 Ga0501031_0011273 Ga0501031_0011273_1926_2645 234
409 3300049568 Ga0501031_0044524 Ga0501031_0044524_1566_2285 234
410 3300049568 Ga0501031_0101938 Ga0501031_0101938_48_767 234
411 3300049568 Ga0501031_0117787 Ga0501031_0117787_134_853 234
412 3300049569 Ga0501032_0018598 Ga0501032_0018598_3876_4595 234
413 3300049569 Ga0501032_0143424 Ga0501032_0143424_837_1541 234
414 3300049570 Ga0501033_0001319 Ga0501033_0001319_14116_14820 234
415 3300049570 Ga0501033_0005404 Ga0501033_0005404_3977_4681 234
416 3300049570 Ga0501033_0019385 Ga0501033_0019385_2629_3348 234
417 3300049570 Ga0501033_0186369 Ga0501033_0186369_265_984 234
418 3300049571 Ga0501034_0005536 Ga0501034_0005536_11424_12128 234
419 3300049571 Ga0501034_0009232 Ga0501034_0009232_4632_5336 234
420 3300049571 Ga0501034_0076901 Ga0501034_0076901_1352_2071 234
421 3300049571 Ga0501034_0243164 Ga0501034_0243164_915_1634 234
422 3300049572 Ga0501036_0001160 Ga0501036_0001160_19146_19850 234
423 3300049572 Ga0501036_0029422 Ga0501036_0029422_1071_1790 234
424 3300049572 Ga0501036_0046316 Ga0501036_0046316_1166_1885 234
425 3300049572 Ga0501036_0202262 Ga0501036_0202262_251_955 234
426 3300049573 Ga0501037_0018177 Ga0501037_0018177_962_1666 234
427 3300049573 Ga0501037_0237418 Ga0501037_0237418_539_1258 234
428 3300049574 Ga0501038_0014610 Ga0501038_0014610_1785_2489 234
429 3300049574 Ga0501038_0104229 Ga0501038_0104229_62_766 234
430 3300049574 Ga0501038_0188773 Ga0501038_0188773_422_1141 234
431 3300049575 Ga0501039_0002048 Ga0501039_0002048_3979_4683 234
432 3300049575 Ga0501039_0052487 Ga0501039_0052487_1399_2118 234
433 3300049578 Ga0501042_0007416 Ga0501042_0007416_5782_6486 234
434 3300049579 Ga0501043_0031683 Ga0501043_0031683_2463_3167 234
435 3300049579 Ga0501043_0050584 Ga0501043_0050584_1911_2630 234
436 3300049579 Ga0501043_0052441 Ga0501043_0052441_1146_1865 234
437 3300049579 Ga0501043_0058889 Ga0501043_0058889_254_958 234
438 3300049580 Ga0501046_0019177 Ga0501046_0019177_1343_2062 234
439 3300049580 Ga0501046_0047998 Ga0501046_0047998_1716_2420 234
440 3300049581 Ga0501047_0034303 Ga0501047_0034303_3015_3719 234
441 3300049581 Ga0501047_0050108 Ga0501047_0050108_922_1641 234
442 3300049581 Ga0501047_0061090 Ga0501047_0061090_119_838 234
443 3300049581 Ga0501047_0065492 Ga0501047_0065492_260_964 234
444 3300049581 Ga0501047_0296380 Ga0501047_0296380_169_888 234
445 3300049585 Ga0501069_0084361 Ga0501069_0084361_769_1473 234
446 3300049586 Ga0501070_0001349 Ga0501070_0001349_18928_19632 234
447 3300049586 Ga0501070_0146652 Ga0501070_0146652_156_875 234
448 3300049587 Ga0501071_0633065 Ga0501071_0633065_95_811 234
449 3300049590 Ga0501074_0001576 Ga0501074_0001576_12418_13122 234
450 3300049686 Ga0501257_022465 Ga0501257_022465_227_931 234
451 3300049778 Ga0501282_011401 Ga0501282_011401_221_940 234
452 3300049822 Ga0501035_0004810 Ga0501035_0004810_6385_7089 234
453 3300049822 Ga0501035_0006030 Ga0501035_0006030_6368_7087 234
454 3300049822 Ga0501035_0034866 Ga0501035_0034866_2525_3244 234
455 3300049822 Ga0501035_0097520 Ga0501035_0097520_1161_1865 234
456 3300049822 Ga0501035_0162220 Ga0501035_0162220_289_993 234
457 3300049823 Ga0501044_0020628 Ga0501044_0020628_5094_5798 234
458 3300049823 Ga0501044_0073097 Ga0501044_0073097_2496_3215 234
459 3300049823 Ga0501044_0193987 Ga0501044_0193987_14_733 234
460 3300049823 Ga0501044_0826534 Ga0501044_0826534_14_733 234
461 3300049824 Ga0501045_0123534 Ga0501045_0123534_854_1558 234
462 3300049824 Ga0501045_0452770 Ga0501045_0452770_222_941 234
463 3300050490 nmdc:mga03n38_60489_c1 nmdc:mga03n38_60489_c1_881_1588 234
464 3300050491 nmdc:mga00v17_46646_c1 nmdc:mga00v17_46646_c1_1699_2406 234
465 3300050492 nmdc:mga0yw44_217326_c1 nmdc:mga0yw44_217326_c1_461_1165 234
466 3300053107 Ga0500560_003205 Ga0500560_003205_826_1545 234
467 3300053149 Ga0500600_0243797 Ga0500600_0243797_12_728 234
468 3300061719 Ga0466962_0001558 Ga0466962_0001558_6561_7265 234
469 3300044683 Ga0466965_0247468 Ga0466965_0247468_28_738 235
470 3300049570 Ga0501033_0310759 Ga0501033_0310759_307_1035 235
471 3300049572 Ga0501036_0022302 Ga0501036_0022302_320_1048 235
472 3300049574 Ga0501038_0037790 Ga0501038_0037790_2296_3024 235
473 3300049576 Ga0501040_0057853 Ga0501040_0057853_1893_2603 235
474 3300049579 Ga0501043_0005857 Ga0501043_0005857_2034_2762 235
475 3300049580 Ga0501046_0019116 Ga0501046_0019116_4443_5171 235
476 3300049581 Ga0501047_0005299 Ga0501047_0005299_4116_4844 235
477 3300049584 Ga0501068_0265838 Ga0501068_0265838_303_1070 235
478 3300049741 Ga0501079_0217838 Ga0501079_0217838_342_1070 235
479 3300049744 Ga0501083_0006924 Ga0501083_0006924_6894_7622 235
480 3300049822 Ga0501035_0008263 Ga0501035_0008263_6867_7595 235
481 3300054114 Ga0501084_0312756 Ga0501084_0312756_417_1145 235
482 3300060353 Ga0501082_0285155 Ga0501082_0285155_233_961 235
483 iso_pu_bacteria 2844852863 2844855451 235
484 iso_pu_bacteria 8056037122 8056037557 235
485 iso_pu_bacteria 8057345674 8057348679 235
486 3300005327 Ga0070658_10002027 Ga0070658_1000202716 236
487 3300005337 Ga0070682_100234427 Ga0070682_1002344272 236
488 3300005339 Ga0070660_100040078 Ga0070660_1000400782 236
489 3300005366 Ga0070659_100030588 Ga0070659_1000305885 236
490 3300005437 Ga0070710_10256416 Ga0070710_102564162 236
491 3300005455 Ga0070663_100141564 Ga0070663_1001415644 236
492 3300005456 Ga0070678_100053944 Ga0070678_1000539444 236
493 3300005563 Ga0068855_100056871 Ga0068855_1000568715 236
494 3300005563 Ga0068855_100176462 Ga0068855_1001764622 236
495 3300009098 Ga0105245_10247194 Ga0105245_102471943 236
496 3300009098 Ga0105245_10374763 Ga0105245_103747632 236
497 3300013104 Ga0157370_10004734 Ga0157370_100047346 236
498 3300013105 Ga0157369_10014157 Ga0157369_100141574 236
499 3300013307 Ga0157372_10110173 Ga0157372_101101734 236
500 3300014325 Ga0163163_10087102 Ga0163163_100871023 236
501 3300017792 Ga0163161_10035341 Ga0163161_100353413 236
502 3300025898 Ga0207692_10136671 Ga0207692_101366712 236
503 3300025904 Ga0207647_10076822 Ga0207647_100768223 236
504 3300025909 Ga0207705_10000006 Ga0207705_10000006439 236
505 3300025919 Ga0207657_10024467 Ga0207657_100244675 236
506 3300025924 Ga0207694_10140078 Ga0207694_101400782 236
507 3300025932 Ga0207690_10036765 Ga0207690_100367655 236
508 3300025938 Ga0207704_10180517 Ga0207704_101805172 236
509 3300025940 Ga0207691_10277389 Ga0207691_102773893 236
510 3300025949 Ga0207667_10068535 Ga0207667_100685355 236
511 3300025949 Ga0207667_10116835 Ga0207667_101168354 236
512 3300026067 Ga0207678_10131147 Ga0207678_101311471 236
513 3300026118 Ga0207675_100082678 Ga0207675_1000826784 236
514 3300026121 Ga0207683_10293498 Ga0207683_102934982 236
515 3300026121 Ga0207683_10425132 Ga0207683_104251322 236
516 3300031727 Ga0316576_10004078 Ga0316576_100040781 236
517 3300031728 Ga0316578_10210220 Ga0316578_102102202 236
518 3300031733 Ga0316577_10046968 Ga0316577_100469682 236
519 3300032133 Ga0316583_10017096 Ga0316583_100170962 236
520 3300035398 Ga0316574_0005219 Ga0316574_0005219_917_1630 236
521 3300035398 Ga0316574_0119614 Ga0316574_0119614_92_814 236
522 3300035398 Ga0316574_0125633 Ga0316574_0125633_598_1317 236
523 3300035398 Ga0316574_0126968 Ga0316574_0126968_657_1376 236
524 3300035398 Ga0316574_0238191 Ga0316574_0238191_322_1056 236
525 3300036647 Ga0316582_0002951 Ga0316582_0002951_6560_7273 236
526 3300036712 Ga0316584_0007287 Ga0316584_0007287_5508_6221 236
527 3300041404 Ga0439436_0010633 Ga0439436_0010633_860_1573 236
528 3300041404 Ga0439436_0029875 Ga0439436_0029875_40_756 236
529 3300041407 Ga0439447_049435 Ga0439447_049435_265_978 236
530 3300042014 Ga0439457_001073 Ga0439457_001073_7001_7717 236
531 3300042014 Ga0439457_013048 Ga0439457_013048_744_1457 236
532 3300046462 Ga0495651_0324177 Ga0495651_0324177_302_1015 236
533 3300046511 Ga0495608_0267747 Ga0495608_0267747_263_976 236
534 3300046642 Ga0495634_0350107 Ga0495634_0350107_116_829 236
535 3300046663 Ga0495635_0160729 Ga0495635_0160729_266_979 236
536 3300046809 Ga0495600_0133929 Ga0495600_0133929_329_1042 236
537 3300047315 Ga0495581_0175076 Ga0495581_0175076_364_1077 236
538 3300047322 Ga0495680_0474965 Ga0495680_0474965_12_725 236
539 3300047471 Ga0495684_0133444 Ga0495684_0133444_360_1073 236
540 3300048091 Ga0495626_0035142 Ga0495626_0035142_906_1619 236
541 3300048903 Ga0496100_0107858 Ga0496100_0107858_1024_1737 236
542 3300048904 Ga0496101_0345334 Ga0496101_0345334_197_910 236
543 3300048905 Ga0496102_0572523 Ga0496102_0572523_164_877 236
544 3300048906 Ga0496103_0210679 Ga0496103_0210679_179_892 236
545 3300048908 Ga0496105_0125876 Ga0496105_0125876_934_1647 236
546 3300048909 Ga0496106_0184502 Ga0496106_0184502_656_1369 236
547 3300048912 Ga0496109_0098198 Ga0496109_0098198_976_1689 236
548 3300048912 Ga0496109_0342937 Ga0496109_0342937_103_816 236
549 3300048913 Ga0496110_0006639 Ga0496110_0006639_3177_3890 236
550 3300048914 Ga0496111_0040946 Ga0496111_0040946_175_888 236
551 3300048916 Ga0496113_0218620 Ga0496113_0218620_589_1302 236
552 3300048917 Ga0496114_0009438 Ga0496114_0009438_5901_6614 236
553 3300048917 Ga0496114_0085903 Ga0496114_0085903_1284_1997 236
554 3300048920 Ga0496117_0001302 Ga0496117_0001302_4631_5344 236
555 3300048921 Ga0496118_0001377 Ga0496118_0001377_31315_32028 236
556 3300048925 Ga0496122_0303126 Ga0496122_0303126_101_814 236
557 3300048926 Ga0496123_0071895 Ga0496123_0071895_283_996 236
558 3300048927 Ga0496124_0000037 Ga0496124_0000037_285760_286473 236
559 3300048927 Ga0496124_0011460 Ga0496124_0011460_3876_4589 236
560 3300048927 Ga0496124_0098360 Ga0496124_0098360_495_1208 236
561 3300049575 Ga0501039_0086315 Ga0501039_0086315_359_1072 236
562 3300050492 nmdc:mga0yw44_613033_c1 nmdc:mga0yw44_613033_c1_12_725 236
563 3300053085 Ga0495619_0259771 Ga0495619_0259771_221_934 236
564 3300053136 Ga0500559_0000295 Ga0500559_0000295_33500_34210 236
565 3300053136 Ga0500559_0001348 Ga0500559_0001348_11201_11911 236
566 3300053136 Ga0500559_0014675 Ga0500559_0014675_1778_2488 236
567 3300053153 Ga0500616_0000398 Ga0500616_0000398_39445_40158 236
568 iso_pu_bacteria 2537561592 2537897866 236
569 iso_pu_bacteria 2844849076 2844852719 236
570 iso_pu_bacteria 2870622029 2870623501 236
571 3300026067 Ga0207678_10359035 Ga0207678_103590352 237
572 3300031649 Ga0307514_10008617 Ga0307514_100086178 237
573 3300031730 Ga0307516_10006309 Ga0307516_100063098 237
574 3300049571 Ga0501034_0015502 Ga0501034_0015502_3928_4641 237
575 3300049585 Ga0501069_0066831 Ga0501069_0066831_1176_1889 237
576 3300049586 Ga0501070_0052604 Ga0501070_0052604_1949_2662 237
577 3300049587 Ga0501071_0000571 Ga0501071_0000571_12506_13219 237
578 iso_pu_bacteria 2775506735 2775656912 237
579 iso_pu_bacteria 2808606357 2808831126 237
580 iso_pu_bacteria 2808606360 2808852390 237
581 iso_pu_bacteria 2808606366 2808879318 237
582 iso_pu_bacteria 2808606370 2808891180 237
583 iso_pu_bacteria 2808606371 2808896436 237
584 iso_pu_bacteria 2811994871 2812321179 237
585 iso_pu_bacteria 2857740372 2857742121 237
586 iso_pu_bacteria 2904497146 2904498232 237
587 iso_pu_bacteria 2904776348 2904777594 237
588 iso_pu_bacteria 2910809715 2910812644 237
589 iso_pu_bacteria 2919034639 2919034964 237
590 iso_pu_bacteria 2919051321 2919051448 237
591 iso_pu_bacteria 2919059106 2919059791 237
592 iso_pu_bacteria 2919391150 2919394768 237
593 iso_pu_bacteria 2919538618 2919540424 237
594 iso_pu_bacteria 2932426870 2932428278 237
595 iso_pu_bacteria 2933418574 2933421117 237
596 iso_pu_bacteria 2939598168 2939601315 237
597 iso_pu_bacteria 2939647034 2939648686 237
598 iso_pu_bacteria 2939674588 2939675265 237
599 iso_pu_bacteria 2945916053 2945918937 237
600 iso_pu_bacteria 2945920336 2945920701 237
601 iso_pu_bacteria 2945941187 2945943113 237
602 iso_pu_bacteria 2945956166 2945959145 237
603 iso_pu_bacteria 2946024296 2946025908 237
604 iso_pu_bacteria 2946037020 2946039006 237
605 iso_pu_bacteria 2946059875 2946062788 237
606 iso_pu_bacteria 2953998280 2954000413 237
607 iso_pu_bacteria 2974302888 2974306917 237
608 iso_pu_bacteria 8054107350 8054107874 237
609 3300005614 Ga0068856_100151928 Ga0068856_1001519282 238
610 3300049578 Ga0501042_0193532 Ga0501042_0193532_593_1312 238
611 3300005345 Ga0070692_10107211 Ga0070692_101072112 239
612 3300006881 Ga0068865_100084207 Ga0068865_1000842072 239
613 3300009176 Ga0105242_10026930 Ga0105242_100269302 239
614 3300011119 Ga0105246_10100439 Ga0105246_101004392 239
615 3300013297 Ga0157378_10019491 Ga0157378_100194914 239
616 3300017792 Ga0163161_10014026 Ga0163161_100140264 239
617 3300025934 Ga0207686_10191184 Ga0207686_101911841 239
618 3300025972 Ga0207668_10062894 Ga0207668_100628943 239
619 3300031727 Ga0316576_10016422 Ga0316576_100164225 239
620 3300031731 Ga0307405_10020823 Ga0307405_100208232 239
621 3300031733 Ga0316577_10050990 Ga0316577_100509902 239
622 3300031852 Ga0307410_10245932 Ga0307410_102459321 239
623 3300031901 Ga0307406_10003776 Ga0307406_1000377610 239
624 3300032002 Ga0307416_100288678 Ga0307416_1002886781 239
625 3300032004 Ga0307414_10206089 Ga0307414_102060891 239
626 3300032126 Ga0307415_100025727 Ga0307415_1000257274 239
627 3300035398 Ga0316574_0015037 Ga0316574_0015037_3380_4120 239
628 3300035398 Ga0316574_0185047 Ga0316574_0185047_159_899 239
629 3300036712 Ga0316584_0020262 Ga0316584_0020262_3686_4426 239
630 3300049130 Ga0501310_000129 Ga0501310_000129_2535_3254 239
631 3300049533 Ga0501317_002804 Ga0501317_002804_918_1640 239
632 3300049568 Ga0501031_0488672 Ga0501031_0488672_47_775 239
633 3300049587 Ga0501071_0485697 Ga0501071_0485697_119_847 239
634 3300049588 Ga0501072_0060975 Ga0501072_0060975_2225_2953 239
635 3300053136 Ga0500559_0049495 Ga0500559_0049495_806_1528 239
636 3300053140 Ga0500573_0050537 Ga0500573_0050537_1653_2375 239
637 3300053140 Ga0500573_0134447 Ga0500573_0134447_573_1295 239
638 3300053142 Ga0500577_0002895 Ga0500577_0002895_1008_1730 239
639 3300053157 Ga0500624_013828 Ga0500624_013828_29_748 239
640 3300053178 Ga0500637_0148671 Ga0500637_0148671_11_730 239
641 3300060353 Ga0501082_0080491 Ga0501082_0080491_728_1456 239
642 iso_pu_bacteria 2582581313 2585307458 239
643 iso_pu_bacteria 2786546132 2786668602 239
644 iso_pu_bacteria 2954673503 2954674878 239
645 iso_pu_bacteria 2954682443 2954689255 239
646 iso_pu_bacteria 2954711539 2954717982 239
647 iso_pu_bacteria 2954721474 2954727948 239
648 iso_pu_bacteria 2954731030 2954733856 239
649 iso_pu_bacteria 2954740390 2954746846 239
650 iso_pu_bacteria 2954749733 2954752739 239
651 iso_pu_bacteria 2954759201 2954765961 239
652 iso_pu_bacteria 8008574985 8008580413 239
653 3300002773 JGI25152J39213_1000140 JGI25152J39213_100014026 240
654 3300009148 Ga0105243_10069980 Ga0105243_100699804 240
655 3300011119 Ga0105246_10374843 Ga0105246_103748431 240
656 3300014968 Ga0157379_10685339 Ga0157379_106853391 240
657 3300025245 Ga0207425_1002927 Ga0207425_10029276 240
658 3300025258 Ga0209129_1000067 Ga0209129_1000067109 240
659 3300025294 Ga0209025_1001395 Ga0209025_100139527 240
660 3300032002 Ga0307416_100134641 Ga0307416_1001346414 240
661 3300044683 Ga0466965_0099273 Ga0466965_0099273_126_851 240
662 3300044901 Ga0466960_0079691 Ga0466960_0079691_99_857 240
663 3300045976 Ga0466967_0773953 Ga0466967_0773953_179_904 240
664 3300048925 Ga0496122_0001610 Ga0496122_0001610_2190_2939 240
665 3300049534 Ga0501318_025176 Ga0501318_025176_37_759 240
666 iso_pu_bacteria 2808606700 2810363751 240
667 iso_pu_bacteria 2884994152 2884995234 240
668 iso_pu_bacteria 2905926851 2905930889 240
669 iso_pu_bacteria 8004021418 8004022746 240
670 iso_pu_bacteria 8004025490 8004029422 240
671 3300003762 Ga0055542_1002679 Ga0055542_10026793 241
672 3300005288 Ga0065714_10106553 Ga0065714_101065531 241
673 3300005288 Ga0065714_10201669 Ga0065714_102016691 241
674 3300005328 Ga0070676_10024958 Ga0070676_100249584 241
675 3300005331 Ga0070670_100225790 Ga0070670_1002257902 241
676 3300005347 Ga0070668_100051002 Ga0070668_1000510025 241
677 3300005356 Ga0070674_100055324 Ga0070674_1000553242 241
678 3300005456 Ga0070678_100119284 Ga0070678_1001192842 241
679 3300005535 Ga0070684_100113055 Ga0070684_1001130553 241
680 3300005543 Ga0070672_100300824 Ga0070672_1003008242 241
681 3300005615 Ga0070702_100000282 Ga0070702_10000028212 241
682 3300006058 Ga0075432_10002903 Ga0075432_100029038 241
683 3300006058 Ga0075432_10017063 Ga0075432_100170634 241
684 3300006178 Ga0075367_10002358 Ga0075367_100023589 241
685 3300006353 Ga0075370_10049690 Ga0075370_100496902 241
686 3300009036 Ga0105244_10004227 Ga0105244_100042277 241
687 3300009036 Ga0105244_10006637 Ga0105244_100066371 241
688 3300009147 Ga0114129_11267947 Ga0114129_112679471 241
689 3300009148 Ga0105243_10031619 Ga0105243_100316192 241
690 3300009148 Ga0105243_10462215 Ga0105243_104622151 241
691 3300009148 Ga0105243_10514215 Ga0105243_105142151 241
692 3300009177 Ga0105248_10198791 Ga0105248_101987912 241
693 3300009177 Ga0105248_10220468 Ga0105248_102204684 241
694 3300009551 Ga0105238_10059429 Ga0105238_100594293 241
695 3300009551 Ga0105238_10318059 Ga0105238_103180592 241
696 3300009553 Ga0105249_10126193 Ga0105249_101261933 241
697 3300011119 Ga0105246_10019891 Ga0105246_100198914 241
698 3300011119 Ga0105246_10052080 Ga0105246_100520801 241
699 3300013100 Ga0157373_10005927 Ga0157373_1000592710 241
700 3300013102 Ga0157371_10164527 Ga0157371_101645271 241
701 3300013105 Ga0157369_10042802 Ga0157369_100428024 241
702 3300013105 Ga0157369_10281216 Ga0157369_102812162 241
703 3300013308 Ga0157375_10249541 Ga0157375_102495411 241
704 3300013308 Ga0157375_10411108 Ga0157375_104111082 241
705 3300013308 Ga0157375_10735993 Ga0157375_107359931 241
706 3300013308 Ga0157375_10772039 Ga0157375_107720391 241
707 3300013308 Ga0157375_11154697 Ga0157375_111546971 241
708 3300014325 Ga0163163_10129257 Ga0163163_101292573 241
709 3300014326 Ga0157380_10011858 Ga0157380_100118584 241
710 3300025254 Ga0209148_1002761 Ga0209148_10027617 241
711 3300025303 Ga0209051_1003979 Ga0209051_10039799 241
712 3300025315 Ga0207697_10004823 Ga0207697_100048234 241
713 3300025315 Ga0207697_10037574 Ga0207697_100375744 241
714 3300025728 Ga0207655_1005476 Ga0207655_10054769 241
715 3300025728 Ga0207655_1023324 Ga0207655_10233243 241
716 3300025728 Ga0207655_1043814 Ga0207655_10438141 241
717 3300025893 Ga0207682_10026419 Ga0207682_100264191 241
718 3300025907 Ga0207645_10019501 Ga0207645_100195015 241
719 3300025923 Ga0207681_10372273 Ga0207681_103722732 241
720 3300025935 Ga0207709_10254713 Ga0207709_102547132 241
721 3300025937 Ga0207669_10166489 Ga0207669_101664891 241
722 3300025937 Ga0207669_10377368 Ga0207669_103773681 241
723 3300025940 Ga0207691_10001023 Ga0207691_1000102330 241
724 3300025940 Ga0207691_10348912 Ga0207691_103489122 241
725 3300025944 Ga0207661_10184750 Ga0207661_101847502 241
726 3300026121 Ga0207683_10006538 Ga0207683_100065382 241
727 3300026121 Ga0207683_10089505 Ga0207683_100895052 241
728 3300027866 Ga0209813_10010366 Ga0209813_100103662 241
729 3300027907 Ga0207428_10055820 Ga0207428_100558204 241
730 3300028380 Ga0268265_10454861 Ga0268265_104548612 241
731 3300028786 Ga0307517_10046625 Ga0307517_100466254 241
732 3300028794 Ga0307515_10001938 Ga0307515_1000193835 241
733 3300030500 Ga0268256_1005878 Ga0268256_10058782 241
734 3300031548 Ga0307408_100001200 Ga0307408_10000120021 241
735 3300031548 Ga0307408_100021674 Ga0307408_1000216743 241
736 3300031548 Ga0307408_100029791 Ga0307408_1000297915 241
737 3300031548 Ga0307408_100059025 Ga0307408_1000590254 241
738 3300031548 Ga0307408_100129695 Ga0307408_1001296953 241
739 3300031548 Ga0307408_100363184 Ga0307408_1003631842 241
740 3300031548 Ga0307408_100656211 Ga0307408_1006562111 241
741 3300031616 Ga0307508_10017045 Ga0307508_100170453 241
742 3300031649 Ga0307514_10002647 Ga0307514_1000264717 241
743 3300031730 Ga0307516_10130574 Ga0307516_101305743 241
744 3300031731 Ga0307405_10019060 Ga0307405_100190603 241
745 3300031731 Ga0307405_10019227 Ga0307405_100192273 241
746 3300031731 Ga0307405_10107921 Ga0307405_101079212 241
747 3300031731 Ga0307405_10184430 Ga0307405_101844302 241
748 3300031731 Ga0307405_10199258 Ga0307405_101992582 241
749 3300031731 Ga0307405_10454413 Ga0307405_104544131 241
750 3300031824 Ga0307413_10040998 Ga0307413_100409981 241
751 3300031824 Ga0307413_10118251 Ga0307413_101182512 241
752 3300031824 Ga0307413_10167454 Ga0307413_101674542 241
753 3300031824 Ga0307413_10291289 Ga0307413_102912892 241
754 3300031824 Ga0307413_10714081 Ga0307413_107140811 241
755 3300031852 Ga0307410_10063569 Ga0307410_100635694 241
756 3300031852 Ga0307410_10074478 Ga0307410_100744784 241
757 3300031852 Ga0307410_10099525 Ga0307410_100995252 241
758 3300031852 Ga0307410_10128873 Ga0307410_101288732 241
759 3300031852 Ga0307410_10216173 Ga0307410_102161732 241
760 3300031852 Ga0307410_10263369 Ga0307410_102633691 241
761 3300031901 Ga0307406_10098115 Ga0307406_100981152 241
762 3300031903 Ga0307407_10031870 Ga0307407_100318702 241
763 3300031903 Ga0307407_10051310 Ga0307407_100513104 241
764 3300031903 Ga0307407_10163681 Ga0307407_101636811 241
765 3300031903 Ga0307407_10231529 Ga0307407_102315291 241
766 3300031911 Ga0307412_10002167 Ga0307412_100021677 241
767 3300031911 Ga0307412_10035701 Ga0307412_100357012 241
768 3300031911 Ga0307412_10054152 Ga0307412_100541523 241
769 3300031911 Ga0307412_10066367 Ga0307412_100663674 241
770 3300031911 Ga0307412_10066538 Ga0307412_100665383 241
771 3300031911 Ga0307412_10081507 Ga0307412_100815072 241
772 3300031911 Ga0307412_10109121 Ga0307412_101091213 241
773 3300031911 Ga0307412_10123610 Ga0307412_101236103 241
774 3300031911 Ga0307412_10197197 Ga0307412_101971972 241
775 3300031911 Ga0307412_10247329 Ga0307412_102473291 241
776 3300031911 Ga0307412_10427084 Ga0307412_104270841 241
777 3300031995 Ga0307409_100010515 Ga0307409_1000105157 241
778 3300031995 Ga0307409_100030508 Ga0307409_1000305084 241
779 3300031995 Ga0307409_100091466 Ga0307409_1000914663 241
780 3300031995 Ga0307409_100238664 Ga0307409_1002386641 241
781 3300031995 Ga0307409_100510694 Ga0307409_1005106942 241
782 3300031995 Ga0307409_100520353 Ga0307409_1005203532 241
783 3300031995 Ga0307409_101273079 Ga0307409_1012730791 241
784 3300032002 Ga0307416_100017801 Ga0307416_1000178014 241
785 3300032002 Ga0307416_100193655 Ga0307416_1001936554 241
786 3300032002 Ga0307416_100195365 Ga0307416_1001953654 241
787 3300032002 Ga0307416_100223902 Ga0307416_1002239023 241
788 3300032002 Ga0307416_100418932 Ga0307416_1004189322 241
789 3300032002 Ga0307416_100463054 Ga0307416_1004630542 241
790 3300032004 Ga0307414_10178095 Ga0307414_101780952 241
791 3300032004 Ga0307414_10247689 Ga0307414_102476892 241
792 3300032005 Ga0307411_10085090 Ga0307411_100850901 241
793 3300032005 Ga0307411_10293495 Ga0307411_102934951 241
794 3300032005 Ga0307411_10804784 Ga0307411_108047841 241
795 3300032126 Ga0307415_100036532 Ga0307415_1000365323 241
796 3300033179 Ga0307507_10097159 Ga0307507_100971592 241
797 3300033180 Ga0307510_10052677 Ga0307510_100526772 241
798 3300037312 Ga0395899_0089881 Ga0395899_0089881_344_1069 241
799 3300037312 Ga0395899_0119574 Ga0395899_0119574_1033_1758 241
800 3300037418 Ga0395900_0018741 Ga0395900_0018741_1313_2038 241
801 3300037418 Ga0395900_0123356 Ga0395900_0123356_1300_2025 241
802 3300037418 Ga0395900_0136690 Ga0395900_0136690_1591_2316 241
803 3300037466 Ga0395898_0017683 Ga0395898_0017683_4453_5178 241
804 3300037466 Ga0395898_0029494 Ga0395898_0029494_17_751 241
805 3300037466 Ga0395898_0035249 Ga0395898_0035249_3166_3891 241
806 3300037466 Ga0395898_0088602 Ga0395898_0088602_560_1285 241
807 3300037471 Ga0395905_0189610 Ga0395905_0189610_709_1434 241
808 3300038443 Ga0395901_0013220 Ga0395901_0013220_7024_7749 241
809 3300038443 Ga0395901_0020548 Ga0395901_0020548_623_1348 241
810 3300038443 Ga0395901_0032466 Ga0395901_0032466_1013_1738 241
811 3300038443 Ga0395901_0092197 Ga0395901_0092197_1551_2276 241
812 3300038443 Ga0395901_0201443 Ga0395901_0201443_1342_2067 241
813 3300038443 Ga0395901_0582221 Ga0395901_0582221_123_848 241
814 3300041404 Ga0439436_0001657 Ga0439436_0001657_3258_3983 241
815 3300041404 Ga0439436_0077606 Ga0439436_0077606_82_807 241
816 3300041406 Ga0439439_0001237 Ga0439439_0001237_266_991 241
817 3300041411 Ga0439466_0000908 Ga0439466_0000908_10250_10975 241
818 3300041411 Ga0439466_0005004 Ga0439466_0005004_2423_3148 241
819 3300041411 Ga0439466_0023369 Ga0439466_0023369_236_961 241
820 3300041413 Ga0439465_0006890 Ga0439465_0006890_420_1145 241
821 3300041512 Ga0451853_1643492 Ga0451853_1643492_366_1100 241
822 3300041997 Ga0439431_0029298 Ga0439431_0029298_587_1312 241
823 3300041999 Ga0439433_0000441 Ga0439433_0000441_4442_5167 241
824 3300041999 Ga0439433_0013056 Ga0439433_0013056_881_1606 241
825 3300041999 Ga0439433_0016187 Ga0439433_0016187_637_1362 241
826 3300042002 Ga0439442_000043 Ga0439442_000043_3613_4338 241
827 3300042002 Ga0439442_000244 Ga0439442_000244_6178_6903 241
828 3300042002 Ga0439442_001405 Ga0439442_001405_2794_3519 241
829 3300042002 Ga0439442_002895 Ga0439442_002895_251_976 241
830 3300042006 Ga0439432_003697 Ga0439432_003697_4158_4883 241
831 3300042007 Ga0439449_0007219 Ga0439449_0007219_1934_2659 241
832 3300042007 Ga0439449_0011042 Ga0439449_0011042_955_1680 241
833 3300042007 Ga0439449_0012687 Ga0439449_0012687_1147_1872 241
834 3300042007 Ga0439449_0027037 Ga0439449_0027037_178_903 241
835 3300042007 Ga0439449_0035646 Ga0439449_0035646_881_1606 241
836 3300042007 Ga0439449_0053348 Ga0439449_0053348_699_1424 241
837 3300042010 Ga0439452_019425 Ga0439452_019425_481_1206 241
838 3300042014 Ga0439457_000675 Ga0439457_000675_5710_6435 241
839 3300042014 Ga0439457_003930 Ga0439457_003930_2981_3706 241
840 3300042015 Ga0439462_0021119 Ga0439462_0021119_369_1094 241
841 3300042121 Ga0450919_000570 Ga0450919_000570_2624_3349 241
842 3300042146 Ga0450907_000198 Ga0450907_000198_6204_6929 241
843 3300042156 Ga0439446_0002486 Ga0439446_0002486_764_1489 241
844 3300042184 Ga0450908_004069 Ga0450908_004069_960_1685 241
845 3300042185 Ga0450909_000776 Ga0450909_000776_3451_4176 241
846 3300042435 Ga0439434_0001553 Ga0439434_0001553_3371_4096 241
847 3300042435 Ga0439434_0046027 Ga0439434_0046027_138_863 241
848 3300042531 Ga0450918_031723 Ga0450918_031723_181_906 241
849 3300046454 Ga0495592_0024917 Ga0495592_0024917_237_986 241
850 3300046455 Ga0495603_0040998 Ga0495603_0040998_1142_1876 241
851 3300046459 Ga0495629_0075331 Ga0495629_0075331_935_1684 241
852 3300046462 Ga0495651_0003166 Ga0495651_0003166_5232_5981 241
853 3300046463 Ga0495653_0020578 Ga0495653_0020578_2500_3225 241
854 3300046463 Ga0495653_0216786 Ga0495653_0216786_340_1074 241
855 3300046472 Ga0495580_0004371 Ga0495580_0004371_6582_7367 241
856 3300046472 Ga0495580_0016668 Ga0495580_0016668_4745_5470 241
857 3300046473 Ga0495582_0078429 Ga0495582_0078429_28_753 241
858 3300046473 Ga0495582_0084006 Ga0495582_0084006_332_1057 241
859 3300046475 Ga0495639_0123249 Ga0495639_0123249_55_780 241
860 3300046476 Ga0495662_0000925 Ga0495662_0000925_6741_7490 241
861 3300046476 Ga0495662_0022537 Ga0495662_0022537_294_1019 241
862 3300046477 Ga0495664_0000664 Ga0495664_0000664_3202_3951 241
863 3300046477 Ga0495664_0051009 Ga0495664_0051009_22_747 241
864 3300046499 Ga0495594_0042576 Ga0495594_0042576_1190_1915 241
865 3300046514 Ga0495618_0113560 Ga0495618_0113560_207_956 241
866 3300046516 Ga0495628_0008429 Ga0495628_0008429_7437_8186 241
867 3300046517 Ga0495630_0117295 Ga0495630_0117295_613_1362 241
868 3300046517 Ga0495630_0372872 Ga0495630_0372872_293_1018 241
869 3300046518 Ga0495631_0037212 Ga0495631_0037212_1104_1829 241
870 3300046528 Ga0495642_0183017 Ga0495642_0183017_95_820 241
871 3300046531 Ga0495665_0000709 Ga0495665_0000709_4800_5525 241
872 3300046535 Ga0495586_0003928 Ga0495586_0003928_4542_5267 241
873 3300046535 Ga0495586_0013203 Ga0495586_0013203_2817_3542 241
874 3300046535 Ga0495586_0036644 Ga0495586_0036644_1719_2444 241
875 3300046535 Ga0495586_0159189 Ga0495586_0159189_265_1050 241
876 3300046536 Ga0495587_0000658 Ga0495587_0000658_1090_1839 241
877 3300046536 Ga0495587_0022960 Ga0495587_0022960_2528_3253 241
878 3300046543 Ga0495645_0012546 Ga0495645_0012546_562_1287 241
879 3300046543 Ga0495645_0025143 Ga0495645_0025143_3114_3863 241
880 3300046559 Ga0495667_0016886 Ga0495667_0016886_2474_3199 241
881 3300046615 Ga0495656_0002635 Ga0495656_0002635_2798_3523 241
882 3300046642 Ga0495634_0000101 Ga0495634_0000101_45977_46726 241
883 3300046660 Ga0495625_0007840 Ga0495625_0007840_1882_2631 241
884 3300046663 Ga0495635_0001452 Ga0495635_0001452_11843_12592 241
885 3300046663 Ga0495635_0135725 Ga0495635_0135725_505_1239 241
886 3300046663 Ga0495635_0175284 Ga0495635_0175284_532_1257 241
887 3300046665 Ga0495661_0176007 Ga0495661_0176007_382_1107 241
888 3300046674 Ga0495588_0001531 Ga0495588_0001531_673_1422 241
889 3300046674 Ga0495588_0014083 Ga0495588_0014083_1478_2203 241
890 3300046675 Ga0495657_0000552 Ga0495657_0000552_24149_24898 241
891 3300046678 Ga0495599_0027508 Ga0495599_0027508_1541_2290 241
892 3300046680 Ga0495646_0000429 Ga0495646_0000429_17281_18030 241
893 3300046683 Ga0495658_0080405 Ga0495658_0080405_298_1047 241
894 3300046683 Ga0495658_0086017 Ga0495658_0086017_215_949 241
895 3300046689 Ga0495613_0002646 Ga0495613_0002646_4504_5253 241
896 3300046692 Ga0495671_0099660 Ga0495671_0099660_298_1047 241
897 3300046809 Ga0495600_0017269 Ga0495600_0017269_415_1140 241
898 3300047315 Ga0495581_0071489 Ga0495581_0071489_389_1138 241
899 3300047315 Ga0495581_0089678 Ga0495581_0089678_995_1720 241
900 3300047315 Ga0495581_0261246 Ga0495581_0261246_246_971 241
901 3300047317 Ga0495604_0000157 Ga0495604_0000157_23903_24652 241
902 3300047321 Ga0495676_0002174 Ga0495676_0002174_6667_7416 241
903 3300047322 Ga0495680_0040734 Ga0495680_0040734_854_1588 241
904 3300047444 Ga0495675_0070316 Ga0495675_0070316_1444_2169 241
905 3300047445 Ga0495677_0159586 Ga0495677_0159586_33_758 241
906 3300047470 Ga0495681_0049851 Ga0495681_0049851_48_773 241
907 3300047471 Ga0495684_0061745 Ga0495684_0061745_1668_2393 241
908 3300047673 Ga0495593_0000465 Ga0495593_0000465_6167_6916 241
909 3300047673 Ga0495593_0030095 Ga0495593_0030095_2142_2867 241
910 3300048088 Ga0495602_0023858 Ga0495602_0023858_648_1397 241
911 3300048089 Ga0495614_0081802 Ga0495614_0081802_364_1098 241
912 3300048903 Ga0496100_0030948 Ga0496100_0030948_42_767 241
913 3300048905 Ga0496102_0050712 Ga0496102_0050712_2182_2967 241
914 3300048905 Ga0496102_0056408 Ga0496102_0056408_2347_3072 241
915 3300048905 Ga0496102_0188511 Ga0496102_0188511_1010_1735 241
916 3300048905 Ga0496102_0199981 Ga0496102_0199981_950_1675 241
917 3300048905 Ga0496102_0210638 Ga0496102_0210638_979_1704 241
918 3300048905 Ga0496102_0532542 Ga0496102_0532542_166_900 241
919 3300048906 Ga0496103_0004543 Ga0496103_0004543_2311_3036 241
920 3300048906 Ga0496103_0025891 Ga0496103_0025891_95_820 241
921 3300048906 Ga0496103_0050167 Ga0496103_0050167_873_1598 241
922 3300048906 Ga0496103_0080157 Ga0496103_0080157_232_957 241
923 3300048907 Ga0496104_0618988 Ga0496104_0618988_133_867 241
924 3300048908 Ga0496105_0011201 Ga0496105_0011201_371_1096 241
925 3300048908 Ga0496105_0144784 Ga0496105_0144784_252_977 241
926 3300048908 Ga0496105_0553624 Ga0496105_0553624_126_860 241
927 3300048909 Ga0496106_0015995 Ga0496106_0015995_3233_3958 241
928 3300048910 Ga0496107_0335137 Ga0496107_0335137_207_932 241
929 3300048910 Ga0496107_0422054 Ga0496107_0422054_207_932 241
930 3300048911 Ga0496108_0367320 Ga0496108_0367320_235_960 241
931 3300048911 Ga0496108_0770025 Ga0496108_0770025_86_811 241
932 3300048912 Ga0496109_0081163 Ga0496109_0081163_762_1487 241
933 3300048912 Ga0496109_0615360 Ga0496109_0615360_207_932 241
934 3300048913 Ga0496110_0078331 Ga0496110_0078331_1251_1976 241
935 3300048913 Ga0496110_0610020 Ga0496110_0610020_209_934 241
936 3300048914 Ga0496111_0062484 Ga0496111_0062484_784_1509 241
937 3300048915 Ga0496112_0021629 Ga0496112_0021629_4415_5200 241
938 3300048915 Ga0496112_0065168 Ga0496112_0065168_1140_1865 241
939 3300048916 Ga0496113_0182803 Ga0496113_0182803_313_1038 241
940 3300048916 Ga0496113_0201618 Ga0496113_0201618_55_780 241
941 3300048916 Ga0496113_0218716 Ga0496113_0218716_101_880 241
942 3300048917 Ga0496114_0020113 Ga0496114_0020113_3898_4632 241
943 3300048917 Ga0496114_0152923 Ga0496114_0152923_190_942 241
944 3300048917 Ga0496114_0153933 Ga0496114_0153933_293_1018 241
945 3300048918 Ga0496115_0123402 Ga0496115_0123402_1366_2091 241
946 3300048922 Ga0496119_0169294 Ga0496119_0169294_67_792 241
947 3300048928 Ga0496125_0187671 Ga0496125_0187671_628_1353 241
948 3300049129 Ga0501309_010224 Ga0501309_010224_21_773 241
949 3300049161 Ga0501305_005486 Ga0501305_005486_40_765 241
950 3300049533 Ga0501317_021968 Ga0501317_021968_43_768 241
951 3300049537 Ga0501321_001807 Ga0501321_001807_1006_1731 241
952 3300049537 Ga0501321_003269 Ga0501321_003269_35_760 241
953 3300049537 Ga0501321_014403 Ga0501321_014403_47_772 241
954 3300049541 Ga0501325_005173 Ga0501325_005173_42_767 241
955 3300049569 Ga0501032_0002322 Ga0501032_0002322_13305_14030 241
956 3300049569 Ga0501032_0015763 Ga0501032_0015763_2822_3547 241
957 3300049571 Ga0501034_0000016 Ga0501034_0000016_85889_86614 241
958 3300049573 Ga0501037_0004927 Ga0501037_0004927_3494_4219 241
959 3300049574 Ga0501038_0052584 Ga0501038_0052584_2195_2920 241
960 3300049574 Ga0501038_0093535 Ga0501038_0093535_1474_2199 241
961 3300049575 Ga0501039_0067545 Ga0501039_0067545_780_1505 241
962 3300049575 Ga0501039_0162611 Ga0501039_0162611_106_831 241
963 3300049577 Ga0501041_0100633 Ga0501041_0100633_1006_1764 241
964 3300049579 Ga0501043_0031178 Ga0501043_0031178_892_1617 241
965 3300049579 Ga0501043_0083113 Ga0501043_0083113_934_1659 241
966 3300049775 Ga0501279_005158 Ga0501279_005158_479_1204 241
967 3300049823 Ga0501044_0350808 Ga0501044_0350808_390_1115 241
968 3300053084 Ga0495595_0129887 Ga0495595_0129887_171_920 241
969 3300053092 Ga0500583_0064600 Ga0500583_0064600_653_1417 241
970 3300053107 Ga0500560_040081 Ga0500560_040081_465_1214 241
971 3300053111 Ga0500572_003899 Ga0500572_003899_1057_1806 241
972 3300053140 Ga0500573_0066579 Ga0500573_0066579_934_1683 241
973 3300059510 Ga0587090_003487 Ga0587090_003487_113_838 241
974 3300059643 Ga0587072_006472 Ga0587072_006472_66_791 241
975 3300061734 Ga0530510_0090754 Ga0530510_0090754_1062_1820 241
976 iso_pu_bacteria 2643221587 2643945468 241
977 iso_pu_bacteria 2643221670 2644387692 241
978 iso_pu_bacteria 2643221677 2644432367 241
979 iso_pu_bacteria 2690315906 2691513859 241
980 iso_pu_bacteria 3006425503 3006426319 241
981 3300000549 LJQas_1002824 LJQas_10028242 242
982 3300013102 Ga0157371_10099947 Ga0157371_100999472 242
983 3300013104 Ga0157370_10020509 Ga0157370_100205095 242

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

56

240

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

62

285

0.95

PF08659

KR

KR domain

56

228

0.85

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

58

233

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rzi-assembly1.cif.gz_B crystal structure of phab from synechocystis sp. pcc 6803 0.981 10 238
1uzn-assembly1.cif.gz_A-2 maba from mycobacterium tuberculosis 0.9777 9 242
6t77-assembly1.cif.gz_A crystal structure of klebsiella pneumoniae fabg(nadph-dependent) nadp-complex at 1.75 a resolution 0.9772 10 238
1uzn-assembly1.cif.gz_B-2 maba from mycobacterium tuberculosis 0.9764 9 242
6t7m-assembly1.cif.gz_C crystal structure of salmonella typhimurium fabg at 2.65 a resolution 0.9763 10 238
ID Description Score Start End Superfamily
4rziB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.981 10 238 3.40.50.720
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.98 75 238 3.40.50.720
2ntnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9703 9 240 3.40.50.720
af_B7FAC8_69_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.967 12 238 3.40.50.720
5ovlC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9661 9 242 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1Q8KQI7-F1-model_v4 Acetoacetyl-CoA reductase (EC 1.1.1.36) 0.9906 9 242 GO:0018454
AF-A0A4Y8JYE8-F1-model_v4 SDR family oxidoreductase 0.9895 9 242
AF-A0A2S0WWH0-F1-model_v4 Beta-ketoacyl-ACP reductase 0.9892 9 242
AF-A0A7J7AK78-F1-model_v4 deleted 0.9875 9 242
AF-A1R6K2-F1-model_v4 3-oxoacyl-(Acyl-carrier-protein) reductase (EC 1.1.1.100) 0.9873 1 242 GO:0004316

Feature Viewer

pLDDT pTM Quality
92.14 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map