F487282
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 977 | 295 | 1954 | 80 |
Family's Representative Sequence
| Representative Sequence | 3300037418|Ga0395900_1098436|Ga0395900_1098436_204_464 |
| Length | 86 |
| Sequence | MKRNGSVPTEKRTLDEILDLAAIQFKVPREKLSPDDDFFKTLRIDSLQALSLLTRLEQHFNVELPDYELQGVSDFRTLADRIQARL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 92 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 93 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 128 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 129 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 130 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 131 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 132 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 193 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 194 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 200 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 202 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 206 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 207 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 208 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 209 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 210 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 211 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 213 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 215 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 216 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 217 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 219 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 222 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 223 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 225 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 226 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 227 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 231 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 232 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 233 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 236 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 237 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 238 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 239 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 240 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 241 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 242 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 243 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 244 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 245 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 246 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 247 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 248 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 249 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 250 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 251 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 252 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 253 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 275 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 276 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 277 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 278 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 279 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 280 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 283 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 284 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 285 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 286 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 287 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.39 |
| Metatranscriptomes | 0.61 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.73 |
| Rhizosphere | 93.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 34.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395900_1098436 | 3300037418 | Bacteria | 713 |
| 2 | Ga0065712_10120769 | 3300005290 | Bacteria | 1674 |
| 3 | Ga0065712_10770360 | 3300005290 | Unclassified | 522 |
| 4 | Ga0065715_10717049 | 3300005293 | Unclassified | 645 |
| 5 | Ga0065707_10364680 | 3300005295 | Bacteria | 899 |
| 6 | Ga0070676_10002367 | 3300005328 | Bacteria | 9655 |
| 7 | Ga0070683_100116342 | 3300005329 | Bacteria | 2524 |
| 8 | Ga0070683_100521406 | 3300005329 | Unclassified | 1136 |
| 9 | Ga0070690_100604834 | 3300005330 | Unclassified | 833 |
| 10 | Ga0070670_100011355 | 3300005331 | Bacteria | 7613 |
| 11 | Ga0068869_100083221 | 3300005334 | Bacteria | 2393 |
| 12 | Ga0068869_101451373 | 3300005334 | Unclassified | 608 |
| 13 | Ga0068869_101498839 | 3300005334 | Bacteria | 599 |
| 14 | Ga0070666_10064179 | 3300005335 | Bacteria | 2490 |
| 15 | Ga0070680_100071375 | 3300005336 | Bacteria | 2853 |
| 16 | Ga0070680_100129333 | 3300005336 | Bacteria | 2111 |
| 17 | Ga0070680_100280675 | 3300005336 | Bacteria | 1411 |
| 18 | Ga0070682_100024949 | 3300005337 | Unclassified | 3564 |
| 19 | Ga0068868_100001273 | 3300005338 | Bacteria | 17368 |
| 20 | Ga0068868_100012002 | 3300005338 | Bacteria | 6323 |
| 21 | Ga0068868_100157662 | 3300005338 | Bacteria | 1873 |
| 22 | Ga0068868_100895602 | 3300005338 | Unclassified | 806 |
| 23 | Ga0068868_101584242 | 3300005338 | Unclassified | 615 |
| 24 | Ga0070660_100125313 | 3300005339 | Bacteria | 2052 |
| 25 | Ga0070660_100277780 | 3300005339 | Unclassified | 1370 |
| 26 | Ga0070660_101706163 | 3300005339 | Unclassified | 536 |
| 27 | Ga0070689_100079619 | 3300005340 | Bacteria | 2570 |
| 28 | Ga0070691_10254511 | 3300005341 | Bacteria | 943 |
| 29 | Ga0070661_100167071 | 3300005344 | Bacteria | 1669 |
| 30 | Ga0070661_100584755 | 3300005344 | Bacteria | 901 |
| 31 | Ga0070692_10418498 | 3300005345 | Unclassified | 850 |
| 32 | Ga0070692_10596174 | 3300005345 | Bacteria | 730 |
| 33 | Ga0070668_100021068 | 3300005347 | Unclassified | 4926 |
| 34 | Ga0070669_100114684 | 3300005353 | Bacteria | 2049 |
| 35 | Ga0070675_100591016 | 3300005354 | Unclassified | 1006 |
| 36 | Ga0070671_101212451 | 3300005355 | Bacteria | 664 |
| 37 | Ga0070674_100302941 | 3300005356 | Unclassified | 1275 |
| 38 | Ga0070673_100182094 | 3300005364 | Bacteria | 1799 |
| 39 | Ga0070673_101816789 | 3300005364 | Unclassified | 577 |
| 40 | Ga0070688_100279213 | 3300005365 | Bacteria | 1199 |
| 41 | Ga0070659_100009578 | 3300005366 | Bacteria | 7119 |
| 42 | Ga0070659_100253752 | 3300005366 | Bacteria | 1458 |
| 43 | Ga0070667_100273641 | 3300005367 | Bacteria | 1515 |
| 44 | Ga0070667_100386855 | 3300005367 | Bacteria | 1271 |
| 45 | Ga0070703_10252975 | 3300005406 | Unclassified | 715 |
| 46 | Ga0070709_10000974 | 3300005434 | Bacteria | 15878 |
| 47 | Ga0070709_10016355 | 3300005434 | Unclassified | 4232 |
| 48 | Ga0070709_10081981 | 3300005434 | Bacteria | 2107 |
| 49 | Ga0070709_10094647 | 3300005434 | Unclassified | 1977 |
| 50 | Ga0070709_10142647 | 3300005434 | Bacteria | 1647 |
| 51 | Ga0070709_10339576 | 3300005434 | Unclassified | 1107 |
| 52 | Ga0070709_10382894 | 3300005434 | Bacteria | 1046 |
| 53 | Ga0070709_10460908 | 3300005434 | Unclassified | 959 |
| 54 | Ga0070709_11134546 | 3300005434 | Unclassified | 626 |
| 55 | Ga0070709_11255929 | 3300005434 | Unclassified | 596 |
| 56 | Ga0070714_100026803 | 3300005435 | Bacteria | 4765 |
| 57 | Ga0070714_100048541 | 3300005435 | Bacteria | 3611 |
| 58 | Ga0070714_100051479 | 3300005435 | Unclassified | 3511 |
| 59 | Ga0070714_100163160 | 3300005435 | Bacteria | 2017 |
| 60 | Ga0070714_100164098 | 3300005435 | Bacteria | 2012 |
| 61 | Ga0070714_100380501 | 3300005435 | Unclassified | 1331 |
| 62 | Ga0070714_100670545 | 3300005435 | Bacteria | 999 |
| 63 | Ga0070714_100943388 | 3300005435 | Unclassified | 838 |
| 64 | Ga0070714_100961971 | 3300005435 | Bacteria | 830 |
| 65 | Ga0070714_101078121 | 3300005435 | Bacteria | 783 |
| 66 | Ga0070714_102068822 | 3300005435 | Unclassified | 555 |
| 67 | Ga0070713_100000034 | 3300005436 | Bacteria | 86671 |
| 68 | Ga0070713_100041044 | 3300005436 | Bacteria | 3767 |
| 69 | Ga0070713_100049038 | 3300005436 | Bacteria | 3481 |
| 70 | Ga0070713_100078119 | 3300005436 | Bacteria | 2816 |
| 71 | Ga0070713_100079639 | 3300005436 | Unclassified | 2791 |
| 72 | Ga0070713_100100991 | 3300005436 | Unclassified | 2498 |
| 73 | Ga0070713_100274660 | 3300005436 | Bacteria | 1544 |
| 74 | Ga0070713_100302295 | 3300005436 | Bacteria | 1473 |
| 75 | Ga0070713_100313998 | 3300005436 | Bacteria | 1446 |
| 76 | Ga0070713_100392593 | 3300005436 | Bacteria | 1294 |
| 77 | Ga0070713_100467966 | 3300005436 | Bacteria | 1186 |
| 78 | Ga0070713_100728612 | 3300005436 | Unclassified | 948 |
| 79 | Ga0070713_100939664 | 3300005436 | Bacteria | 833 |
| 80 | Ga0070713_101490312 | 3300005436 | Unclassified | 656 |
| 81 | Ga0070713_101630695 | 3300005436 | Bacteria | 626 |
| 82 | Ga0070713_101805904 | 3300005436 | Unclassified | 593 |
| 83 | Ga0070710_10012360 | 3300005437 | Unclassified | 4238 |
| 84 | Ga0070710_10020111 | 3300005437 | Bacteria | 3459 |
| 85 | Ga0070710_10026854 | 3300005437 | Unclassified | 3065 |
| 86 | Ga0070710_10341970 | 3300005437 | Bacteria | 988 |
| 87 | Ga0070710_10527453 | 3300005437 | Unclassified | 812 |
| 88 | Ga0070710_11057260 | 3300005437 | Unclassified | 594 |
| 89 | Ga0070701_10035602 | 3300005438 | Bacteria | 2502 |
| 90 | Ga0070711_100000146 | 3300005439 | Bacteria | 37986 |
| 91 | Ga0070711_100009798 | 3300005439 | Bacteria | 5909 |
| 92 | Ga0070711_100022658 | 3300005439 | Unclassified | 4074 |
| 93 | Ga0070711_100069134 | 3300005439 | Bacteria | 2484 |
| 94 | Ga0070711_100122145 | 3300005439 | Bacteria | 1928 |
| 95 | Ga0070711_100383483 | 3300005439 | Bacteria | 1137 |
| 96 | Ga0070711_101511281 | 3300005439 | Unclassified | 586 |
| 97 | Ga0070711_101629070 | 3300005439 | Unclassified | 565 |
| 98 | Ga0070711_101912421 | 3300005439 | Unclassified | 521 |
| 99 | Ga0070705_100812432 | 3300005440 | Unclassified | 745 |
| 100 | Ga0070694_100048822 | 3300005444 | Bacteria | 2848 |
| 101 | Ga0070694_100286547 | 3300005444 | Bacteria | 1257 |
| 102 | Ga0070708_100000650 | 3300005445 | Bacteria | 26303 |
| 103 | Ga0070708_100009490 | 3300005445 | Bacteria | 7842 |
| 104 | Ga0070708_100148845 | 3300005445 | Bacteria | 2176 |
| 105 | Ga0070708_100180519 | 3300005445 | Unclassified | 1973 |
| 106 | Ga0070708_100195638 | 3300005445 | Archaea | 1892 |
| 107 | Ga0070708_101020170 | 3300005445 | Unclassified | 776 |
| 108 | Ga0070708_101098894 | 3300005445 | Unclassified | 745 |
| 109 | Ga0070708_101247174 | 3300005445 | Unclassified | 695 |
| 110 | Ga0070708_101786702 | 3300005445 | Bacteria | 571 |
| 111 | Ga0070663_100570099 | 3300005455 | Unclassified | 948 |
| 112 | Ga0070678_100150560 | 3300005456 | Bacteria | 1874 |
| 113 | Ga0070678_100605833 | 3300005456 | Bacteria | 978 |
| 114 | Ga0070662_100898603 | 3300005457 | Unclassified | 756 |
| 115 | Ga0070681_10000377 | 3300005458 | Bacteria | 36039 |
| 116 | Ga0070681_10028330 | 3300005458 | Bacteria | 5631 |
| 117 | Ga0070681_10166543 | 3300005458 | Unclassified | 2126 |
| 118 | Ga0068867_100014152 | 3300005459 | Bacteria | 5651 |
| 119 | Ga0068867_100090433 | 3300005459 | Bacteria | 2322 |
| 120 | Ga0068867_101192018 | 3300005459 | Unclassified | 699 |
| 121 | Ga0070685_10633677 | 3300005466 | Bacteria | 773 |
| 122 | Ga0070706_100075176 | 3300005467 | Bacteria | 3126 |
| 123 | Ga0070706_100327234 | 3300005467 | Bacteria | 1429 |
| 124 | Ga0070706_100401864 | 3300005467 | Unclassified | 1275 |
| 125 | Ga0070706_100482795 | 3300005467 | Bacteria | 1153 |
| 126 | Ga0070707_100006085 | 3300005468 | Bacteria | 11257 |
| 127 | Ga0070707_100018634 | 3300005468 | Bacteria | 6532 |
| 128 | Ga0070707_100307075 | 3300005468 | Unclassified | 1542 |
| 129 | Ga0070707_100312705 | 3300005468 | Unclassified | 1527 |
| 130 | Ga0070707_100462916 | 3300005468 | Bacteria | 1229 |
| 131 | Ga0070707_100973476 | 3300005468 | Unclassified | 814 |
| 132 | Ga0070707_101502183 | 3300005468 | Bacteria | 640 |
| 133 | Ga0070707_101519233 | 3300005468 | Bacteria | 636 |
| 134 | Ga0070707_101531467 | 3300005468 | Bacteria | 634 |
| 135 | Ga0070698_100231122 | 3300005471 | Bacteria | 1782 |
| 136 | Ga0070698_100671062 | 3300005471 | Unclassified | 978 |
| 137 | Ga0070698_101525288 | 3300005471 | Unclassified | 620 |
| 138 | Ga0070699_100388680 | 3300005518 | Bacteria | 1260 |
| 139 | Ga0070699_101440218 | 3300005518 | Unclassified | 632 |
| 140 | Ga0070699_101674528 | 3300005518 | Unclassified | 583 |
| 141 | Ga0070699_101960718 | 3300005518 | Unclassified | 535 |
| 142 | Ga0070679_100009688 | 3300005530 | Bacteria | 9113 |
| 143 | Ga0070679_100120514 | 3300005530 | Bacteria | 2608 |
| 144 | Ga0070679_100320985 | 3300005530 | Bacteria | 1498 |
| 145 | Ga0070679_100601215 | 3300005530 | Unclassified | 1043 |
| 146 | Ga0070684_100187574 | 3300005535 | Bacteria | 1881 |
| 147 | Ga0070684_101565390 | 3300005535 | Unclassified | 621 |
| 148 | Ga0070684_102143536 | 3300005535 | Unclassified | 527 |
| 149 | Ga0070697_100000054 | 3300005536 | Bacteria | 88022 |
| 150 | Ga0070697_100017898 | 3300005536 | Bacteria | 5582 |
| 151 | Ga0070697_100196733 | 3300005536 | Bacteria | 1712 |
| 152 | Ga0070697_100224367 | 3300005536 | Unclassified | 1602 |
| 153 | Ga0070697_100313027 | 3300005536 | Bacteria | 1351 |
| 154 | Ga0070697_100489116 | 3300005536 | Unclassified | 1075 |
| 155 | Ga0070697_100524919 | 3300005536 | Unclassified | 1037 |
| 156 | Ga0070697_101069367 | 3300005536 | Unclassified | 718 |
| 157 | Ga0070697_101563402 | 3300005536 | Unclassified | 590 |
| 158 | Ga0068853_100017902 | 3300005539 | Bacteria | 5855 |
| 159 | Ga0068853_100148874 | 3300005539 | Bacteria | 2106 |
| 160 | Ga0068853_100209068 | 3300005539 | Bacteria | 1778 |
| 161 | Ga0068853_100694156 | 3300005539 | Unclassified | 970 |
| 162 | Ga0070672_100297271 | 3300005543 | Bacteria | 1368 |
| 163 | Ga0070686_100788128 | 3300005544 | Bacteria | 765 |
| 164 | Ga0070695_100079673 | 3300005545 | Unclassified | 2163 |
| 165 | Ga0070695_100438380 | 3300005545 | Bacteria | 998 |
| 166 | Ga0070695_100909232 | 3300005545 | Unclassified | 711 |
| 167 | Ga0070696_100158453 | 3300005546 | Bacteria | 1666 |
| 168 | Ga0070696_100446788 | 3300005546 | Bacteria | 1019 |
| 169 | Ga0070696_101750127 | 3300005546 | Unclassified | 536 |
| 170 | Ga0070693_100240083 | 3300005547 | Unclassified | 1196 |
| 171 | Ga0070693_100300934 | 3300005547 | Bacteria | 1081 |
| 172 | Ga0070693_101277284 | 3300005547 | Unclassified | 567 |
| 173 | Ga0070665_100025769 | 3300005548 | Bacteria | 5923 |
| 174 | Ga0070704_100648819 | 3300005549 | Unclassified | 932 |
| 175 | Ga0070704_101131612 | 3300005549 | Unclassified | 712 |
| 176 | Ga0068855_100001121 | 3300005563 | Bacteria | 33253 |
| 177 | Ga0068855_100003109 | 3300005563 | Bacteria | 20315 |
| 178 | Ga0068855_100070544 | 3300005563 | Bacteria | 4065 |
| 179 | Ga0068855_100260828 | 3300005563 | Bacteria | 1930 |
| 180 | Ga0068855_101287332 | 3300005563 | Unclassified | 757 |
| 181 | Ga0070664_100003491 | 3300005564 | Bacteria | 12699 |
| 182 | Ga0070664_100159389 | 3300005564 | Bacteria | 1996 |
| 183 | Ga0068857_100001087 | 3300005577 | Bacteria | 21082 |
| 184 | Ga0068857_100006322 | 3300005577 | Bacteria | 10143 |
| 185 | Ga0068857_100017859 | 3300005577 | Bacteria | 6221 |
| 186 | Ga0068857_101451029 | 3300005577 | Bacteria | 668 |
| 187 | Ga0068857_101701870 | 3300005577 | Unclassified | 617 |
| 188 | Ga0068854_100001857 | 3300005578 | Bacteria | 12871 |
| 189 | Ga0068854_100018005 | 3300005578 | Bacteria | 4736 |
| 190 | Ga0068854_100932982 | 3300005578 | Bacteria | 765 |
| 191 | Ga0068854_102011753 | 3300005578 | Unclassified | 532 |
| 192 | Ga0068856_100001572 | 3300005614 | Bacteria | 23908 |
| 193 | Ga0068856_100004735 | 3300005614 | Bacteria | 13509 |
| 194 | Ga0068856_100030022 | 3300005614 | Bacteria | 5313 |
| 195 | Ga0068856_100069904 | 3300005614 | Bacteria | 3472 |
| 196 | Ga0068856_100121562 | 3300005614 | Bacteria | 2613 |
| 197 | Ga0068856_100190538 | 3300005614 | Unclassified | 2064 |
| 198 | Ga0068856_100342117 | 3300005614 | Bacteria | 1514 |
| 199 | Ga0068856_100386871 | 3300005614 | Unclassified | 1418 |
| 200 | Ga0068856_100917036 | 3300005614 | Unclassified | 895 |
| 201 | Ga0070702_101650852 | 3300005615 | Unclassified | 531 |
| 202 | Ga0068852_100166359 | 3300005616 | Bacteria | 2063 |
| 203 | Ga0068852_101171454 | 3300005616 | Unclassified | 789 |
| 204 | Ga0068852_101302895 | 3300005616 | Bacteria | 748 |
| 205 | Ga0068859_100000212 | 3300005617 | Bacteria | 58021 |
| 206 | Ga0068859_100012600 | 3300005617 | Bacteria | 8504 |
| 207 | Ga0068859_101358363 | 3300005617 | Unclassified | 783 |
| 208 | Ga0068864_100005484 | 3300005618 | Bacteria | 10401 |
| 209 | Ga0068864_100101200 | 3300005618 | Unclassified | 2556 |
| 210 | Ga0068864_100458419 | 3300005618 | Bacteria | 1220 |
| 211 | Ga0068864_100817087 | 3300005618 | Bacteria | 917 |
| 212 | Ga0068866_10002561 | 3300005718 | Bacteria | 7495 |
| 213 | Ga0068866_10136615 | 3300005718 | Unclassified | 1402 |
| 214 | Ga0068866_10207359 | 3300005718 | Bacteria | 1174 |
| 215 | Ga0068866_10216270 | 3300005718 | Bacteria | 1153 |
| 216 | Ga0068861_100261937 | 3300005719 | Bacteria | 1481 |
| 217 | Ga0068861_100309728 | 3300005719 | Bacteria | 1371 |
| 218 | Ga0068851_10007013 | 3300005834 | Bacteria | 5167 |
| 219 | Ga0068851_10448930 | 3300005834 | Bacteria | 766 |
| 220 | Ga0068870_10181351 | 3300005840 | Bacteria | 1264 |
| 221 | Ga0068863_100022000 | 3300005841 | Bacteria | 6086 |
| 222 | Ga0068863_100052481 | 3300005841 | Bacteria | 3864 |
| 223 | Ga0068863_100158640 | 3300005841 | Bacteria | 2166 |
| 224 | Ga0068863_100177775 | 3300005841 | Bacteria | 2043 |
| 225 | Ga0068863_100191173 | 3300005841 | Bacteria | 1967 |
| 226 | Ga0068863_100501767 | 3300005841 | Bacteria | 1195 |
| 227 | Ga0068858_100004036 | 3300005842 | Bacteria | 14485 |
| 228 | Ga0068858_100041953 | 3300005842 | Bacteria | 4242 |
| 229 | Ga0068858_100384442 | 3300005842 | Unclassified | 1347 |
| 230 | Ga0068858_100631046 | 3300005842 | Unclassified | 1040 |
| 231 | Ga0068858_102418901 | 3300005842 | Bacteria | 519 |
| 232 | Ga0068860_100145523 | 3300005843 | Bacteria | 2280 |
| 233 | Ga0068860_100339588 | 3300005843 | Bacteria | 1477 |
| 234 | Ga0068860_100572145 | 3300005843 | Bacteria | 1133 |
| 235 | Ga0068860_101282780 | 3300005843 | Bacteria | 753 |
| 236 | Ga0068860_101626291 | 3300005843 | Unclassified | 668 |
| 237 | Ga0068862_100140377 | 3300005844 | Bacteria | 2144 |
| 238 | Ga0068862_100268300 | 3300005844 | Bacteria | 1560 |
| 239 | Ga0068862_101424674 | 3300005844 | Unclassified | 697 |
| 240 | Ga0081540_1056259 | 3300005983 | Bacteria | 1910 |
| 241 | Ga0070717_10000783 | 3300006028 | Bacteria | 20846 |
| 242 | Ga0070717_10001830 | 3300006028 | Bacteria | 14861 |
| 243 | Ga0070717_10015827 | 3300006028 | Bacteria | 5831 |
| 244 | Ga0070717_10027647 | 3300006028 | Bacteria | 4534 |
| 245 | Ga0070717_10028400 | 3300006028 | Bacteria | 4478 |
| 246 | Ga0070717_10034022 | 3300006028 | Bacteria | 4116 |
| 247 | Ga0070717_10042990 | 3300006028 | Bacteria | 3686 |
| 248 | Ga0070717_10053292 | 3300006028 | Bacteria | 3334 |
| 249 | Ga0070717_10069754 | 3300006028 | Unclassified | 2928 |
| 250 | Ga0070717_10087653 | 3300006028 | Bacteria | 2622 |
| 251 | Ga0070717_10247820 | 3300006028 | Unclassified | 1573 |
| 252 | Ga0070717_10380763 | 3300006028 | Bacteria | 1265 |
| 253 | Ga0070717_10408917 | 3300006028 | Bacteria | 1220 |
| 254 | Ga0070717_10495216 | 3300006028 | Unclassified | 1104 |
| 255 | Ga0070717_11131185 | 3300006028 | Unclassified | 713 |
| 256 | Ga0070717_11881944 | 3300006028 | Unclassified | 540 |
| 257 | Ga0070715_10020921 | 3300006163 | Bacteria | 2530 |
| 258 | Ga0070715_10022382 | 3300006163 | Bacteria | 2464 |
| 259 | Ga0070715_10090119 | 3300006163 | Bacteria | 1409 |
| 260 | Ga0070715_10110651 | 3300006163 | Bacteria | 1295 |
| 261 | Ga0070715_10237985 | 3300006163 | Unclassified | 945 |
| 262 | Ga0070715_10369812 | 3300006163 | Unclassified | 788 |
| 263 | Ga0070715_10792930 | 3300006163 | Bacteria | 574 |
| 264 | Ga0070716_100000923 | 3300006173 | Bacteria | 12724 |
| 265 | Ga0070716_100007179 | 3300006173 | Bacteria | 5478 |
| 266 | Ga0070716_100007927 | 3300006173 | Bacteria | 5258 |
| 267 | Ga0070716_100008906 | 3300006173 | Unclassified | 4990 |
| 268 | Ga0070716_100046037 | 3300006173 | Bacteria | 2453 |
| 269 | Ga0070716_100127741 | 3300006173 | Bacteria | 1602 |
| 270 | Ga0070716_100213147 | 3300006173 | Bacteria | 1292 |
| 271 | Ga0070716_100242529 | 3300006173 | Unclassified | 1223 |
| 272 | Ga0070716_100426417 | 3300006173 | Unclassified | 961 |
| 273 | Ga0070716_100530219 | 3300006173 | Unclassified | 874 |
| 274 | Ga0070716_101492507 | 3300006173 | Unclassified | 552 |
| 275 | Ga0070712_100000020 | 3300006175 | Bacteria | 84120 |
| 276 | Ga0070712_100001031 | 3300006175 | Bacteria | 16810 |
| 277 | Ga0070712_100002971 | 3300006175 | Bacteria | 10496 |
| 278 | Ga0070712_100072046 | 3300006175 | Bacteria | 2474 |
| 279 | Ga0070712_100086934 | 3300006175 | Bacteria | 2279 |
| 280 | Ga0070712_100103143 | 3300006175 | Bacteria | 2114 |
| 281 | Ga0070712_100116259 | 3300006175 | Bacteria | 2006 |
| 282 | Ga0070712_100481776 | 3300006175 | Unclassified | 1037 |
| 283 | Ga0070712_100581626 | 3300006175 | Bacteria | 946 |
| 284 | Ga0070712_100819713 | 3300006175 | Bacteria | 799 |
| 285 | Ga0097621_100002049 | 3300006237 | Bacteria | 13792 |
| 286 | Ga0097621_100004009 | 3300006237 | Bacteria | 10209 |
| 287 | Ga0097621_100058344 | 3300006237 | Bacteria | 3158 |
| 288 | Ga0097621_100183041 | 3300006237 | Bacteria | 1811 |
| 289 | Ga0097621_100286834 | 3300006237 | Bacteria | 1450 |
| 290 | Ga0097621_100775720 | 3300006237 | Bacteria | 887 |
| 291 | Ga0097621_101129161 | 3300006237 | Unclassified | 737 |
| 292 | Ga0097621_101560671 | 3300006237 | Bacteria | 627 |
| 293 | Ga0068871_100002003 | 3300006358 | Bacteria | 13784 |
| 294 | Ga0068871_100032606 | 3300006358 | Bacteria | 4117 |
| 295 | Ga0068871_100035240 | 3300006358 | Unclassified | 3975 |
| 296 | Ga0068871_100056574 | 3300006358 | Bacteria | 3189 |
| 297 | Ga0068871_100216798 | 3300006358 | Unclassified | 1657 |
| 298 | Ga0068871_100673143 | 3300006358 | Unclassified | 946 |
| 299 | Ga0068871_101041880 | 3300006358 | Unclassified | 763 |
| 300 | Ga0068871_101560866 | 3300006358 | Unclassified | 624 |
| 301 | Ga0075428_100008382 | 3300006844 | Bacteria | 11459 |
| 302 | Ga0075431_100046799 | 3300006847 | Bacteria | 4462 |
| 303 | Ga0075433_11523332 | 3300006852 | Unclassified | 577 |
| 304 | Ga0075434_100028248 | 3300006871 | Bacteria | 5510 |
| 305 | Ga0075434_100236454 | 3300006871 | Bacteria | 1847 |
| 306 | Ga0068865_100199141 | 3300006881 | Bacteria | 1554 |
| 307 | Ga0075436_100000876 | 3300006914 | Bacteria | 19978 |
| 308 | Ga0075436_100002383 | 3300006914 | Bacteria | 12963 |
| 309 | Ga0075436_100085157 | 3300006914 | Unclassified | 2194 |
| 310 | Ga0075436_100090407 | 3300006914 | Archaea | 2128 |
| 311 | Ga0075436_100522543 | 3300006914 | Bacteria | 870 |
| 312 | Ga0097620_100000212 | 3300006931 | Bacteria | 58021 |
| 313 | Ga0097620_100012600 | 3300006931 | Bacteria | 8504 |
| 314 | Ga0097620_101358352 | 3300006931 | Unclassified | 783 |
| 315 | Ga0075435_100000708 | 3300007076 | Bacteria | 20652 |
| 316 | Ga0075435_100011313 | 3300007076 | Bacteria | 6558 |
| 317 | Ga0075435_100483743 | 3300007076 | Unclassified | 1069 |
| 318 | Ga0075435_100742539 | 3300007076 | Unclassified | 854 |
| 319 | Ga0075435_100901228 | 3300007076 | Unclassified | 771 |
| 320 | Ga0099794_10020695 | 3300007265 | Bacteria | 2980 |
| 321 | Ga0099794_10276002 | 3300007265 | Unclassified | 869 |
| 322 | Ga0099795_10071744 | 3300007788 | Unclassified | 1308 |
| 323 | Ga0099795_10279114 | 3300007788 | Bacteria | 729 |
| 324 | Ga0099795_10300733 | 3300007788 | Bacteria | 705 |
| 325 | Ga0099795_10660326 | 3300007788 | Unclassified | 501 |
| 326 | Ga0105251_10142815 | 3300009011 | Unclassified | 1083 |
| 327 | Ga0105250_10098912 | 3300009092 | Unclassified | 1190 |
| 328 | Ga0105250_10132821 | 3300009092 | Bacteria | 1028 |
| 329 | Ga0105250_10162909 | 3300009092 | Unclassified | 932 |
| 330 | Ga0105240_10010302 | 3300009093 | Bacteria | 13160 |
| 331 | Ga0105240_10019089 | 3300009093 | Bacteria | 9167 |
| 332 | Ga0105240_10022087 | 3300009093 | Bacteria | 8444 |
| 333 | Ga0105240_10026956 | 3300009093 | Bacteria | 7533 |
| 334 | Ga0105240_10043487 | 3300009093 | Bacteria | 5715 |
| 335 | Ga0105240_10088373 | 3300009093 | Bacteria | 3792 |
| 336 | Ga0105240_10149523 | 3300009093 | Bacteria | 2783 |
| 337 | Ga0105240_10228754 | 3300009093 | Unclassified | 2162 |
| 338 | Ga0105240_10501666 | 3300009093 | Bacteria | 1349 |
| 339 | Ga0105240_11821688 | 3300009093 | Bacteria | 634 |
| 340 | Ga0105240_12620801 | 3300009093 | Unclassified | 521 |
| 341 | Ga0111539_10275868 | 3300009094 | Bacteria | 1956 |
| 342 | Ga0105245_10089104 | 3300009098 | Bacteria | 2836 |
| 343 | Ga0105245_10145895 | 3300009098 | Bacteria | 2233 |
| 344 | Ga0105245_10364718 | 3300009098 | Unclassified | 1435 |
| 345 | Ga0105245_11326194 | 3300009098 | Bacteria | 769 |
| 346 | Ga0105245_11718262 | 3300009098 | Unclassified | 680 |
| 347 | Ga0105245_13203829 | 3300009098 | Unclassified | 507 |
| 348 | Ga0105247_10004327 | 3300009101 | Bacteria | 9073 |
| 349 | Ga0105247_10205696 | 3300009101 | Bacteria | 1325 |
| 350 | Ga0105247_10595172 | 3300009101 | Bacteria | 819 |
| 351 | Ga0105247_11848767 | 3300009101 | Unclassified | 504 |
| 352 | Ga0114129_10995017 | 3300009147 | Unclassified | 1056 |
| 353 | Ga0105243_10049197 | 3300009148 | Bacteria | 3325 |
| 354 | Ga0105241_10004302 | 3300009174 | Bacteria | 10529 |
| 355 | Ga0105241_10007461 | 3300009174 | Bacteria | 8049 |
| 356 | Ga0105241_10015748 | 3300009174 | Bacteria | 5540 |
| 357 | Ga0105241_10071397 | 3300009174 | Unclassified | 2695 |
| 358 | Ga0105241_10126226 | 3300009174 | Unclassified | 2066 |
| 359 | Ga0105241_10136533 | 3300009174 | Unclassified | 1992 |
| 360 | Ga0105241_10213905 | 3300009174 | Unclassified | 1616 |
| 361 | Ga0105241_10477070 | 3300009174 | Unclassified | 1108 |
| 362 | Ga0105241_10529823 | 3300009174 | Unclassified | 1054 |
| 363 | Ga0105241_11467703 | 3300009174 | Unclassified | 655 |
| 364 | Ga0105242_10063427 | 3300009176 | Bacteria | 3043 |
| 365 | Ga0105242_10760952 | 3300009176 | Bacteria | 955 |
| 366 | Ga0105242_12212778 | 3300009176 | Unclassified | 595 |
| 367 | Ga0105248_10032421 | 3300009177 | Bacteria | 5839 |
| 368 | Ga0105248_10035583 | 3300009177 | Bacteria | 5572 |
| 369 | Ga0105248_10309338 | 3300009177 | Bacteria | 1780 |
| 370 | Ga0105248_10333883 | 3300009177 | Bacteria | 1707 |
| 371 | Ga0105237_10049900 | 3300009545 | Unclassified | 4205 |
| 372 | Ga0105237_10058035 | 3300009545 | Bacteria | 3873 |
| 373 | Ga0105237_10258721 | 3300009545 | Bacteria | 1743 |
| 374 | Ga0105237_10334053 | 3300009545 | Unclassified | 1520 |
| 375 | Ga0105237_10365371 | 3300009545 | Bacteria | 1448 |
| 376 | Ga0105237_10543417 | 3300009545 | Unclassified | 1169 |
| 377 | Ga0105237_10596661 | 3300009545 | Unclassified | 1111 |
| 378 | Ga0105237_11047160 | 3300009545 | Unclassified | 823 |
| 379 | Ga0105237_11135093 | 3300009545 | Unclassified | 788 |
| 380 | Ga0105237_11507023 | 3300009545 | Bacteria | 679 |
| 381 | Ga0105237_11895213 | 3300009545 | Unclassified | 604 |
| 382 | Ga0105237_12599440 | 3300009545 | Unclassified | 517 |
| 383 | Ga0105238_10000064 | 3300009551 | Bacteria | 122380 |
| 384 | Ga0105238_10029631 | 3300009551 | Bacteria | 5574 |
| 385 | Ga0105238_10102411 | 3300009551 | Bacteria | 2845 |
| 386 | Ga0105238_10372482 | 3300009551 | Bacteria | 1418 |
| 387 | Ga0105238_10405307 | 3300009551 | Unclassified | 1357 |
| 388 | Ga0105238_10712117 | 3300009551 | Bacteria | 1016 |
| 389 | Ga0105238_12199816 | 3300009551 | Unclassified | 586 |
| 390 | Ga0105249_10010752 | 3300009553 | Bacteria | 8041 |
| 391 | Ga0105249_10138087 | 3300009553 | Bacteria | 2335 |
| 392 | Ga0105249_10480618 | 3300009553 | Bacteria | 1285 |
| 393 | Ga0105249_12080113 | 3300009553 | Unclassified | 641 |
| 394 | Ga0099796_10426806 | 3300010159 | Bacteria | 586 |
| 395 | Ga0099796_10563963 | 3300010159 | Unclassified | 512 |
| 396 | Ga0105239_10027920 | 3300010375 | Bacteria | 6209 |
| 397 | Ga0105239_10077907 | 3300010375 | Bacteria | 3647 |
| 398 | Ga0105239_10155923 | 3300010375 | Unclassified | 2550 |
| 399 | Ga0105239_10228131 | 3300010375 | Bacteria | 2089 |
| 400 | Ga0105239_10466707 | 3300010375 | Unclassified | 1433 |
| 401 | Ga0105239_11278799 | 3300010375 | Unclassified | 846 |
| 402 | Ga0105239_12437921 | 3300010375 | Unclassified | 609 |
| 403 | Ga0105246_10191097 | 3300011119 | Bacteria | 1585 |
| 404 | Ga0105246_10232936 | 3300011119 | Bacteria | 1451 |
| 405 | Ga0105246_10743852 | 3300011119 | Bacteria | 864 |
| 406 | Ga0157373_10009390 | 3300013100 | Bacteria | 7223 |
| 407 | Ga0157373_10092244 | 3300013100 | Bacteria | 2133 |
| 408 | Ga0157373_10207408 | 3300013100 | Unclassified | 1382 |
| 409 | Ga0157373_10233970 | 3300013100 | Bacteria | 1298 |
| 410 | Ga0157373_10283949 | 3300013100 | Bacteria | 1173 |
| 411 | Ga0157373_10332904 | 3300013100 | Bacteria | 1081 |
| 412 | Ga0157373_10527078 | 3300013100 | Bacteria | 855 |
| 413 | Ga0157373_11582943 | 3300013100 | Unclassified | 501 |
| 414 | Ga0157371_10009629 | 3300013102 | Bacteria | 7598 |
| 415 | Ga0157371_10090948 | 3300013102 | Bacteria | 2161 |
| 416 | Ga0157371_10298053 | 3300013102 | Bacteria | 1167 |
| 417 | Ga0157370_10090313 | 3300013104 | Bacteria | 2876 |
| 418 | Ga0157370_10159142 | 3300013104 | Bacteria | 2101 |
| 419 | Ga0157370_10359581 | 3300013104 | Unclassified | 1342 |
| 420 | Ga0157370_10616772 | 3300013104 | Bacteria | 993 |
| 421 | Ga0157370_10829662 | 3300013104 | Bacteria | 841 |
| 422 | Ga0157370_11070760 | 3300013104 | Unclassified | 729 |
| 423 | Ga0157369_10000506 | 3300013105 | Bacteria | 51297 |
| 424 | Ga0157369_10010162 | 3300013105 | Bacteria | 10742 |
| 425 | Ga0157369_10035511 | 3300013105 | Bacteria | 5465 |
| 426 | Ga0157369_10067761 | 3300013105 | Bacteria | 3836 |
| 427 | Ga0157369_10085630 | 3300013105 | Bacteria | 3368 |
| 428 | Ga0157369_10326618 | 3300013105 | Bacteria | 1594 |
| 429 | Ga0157369_10725761 | 3300013105 | Bacteria | 1023 |
| 430 | Ga0157374_10000140 | 3300013296 | Bacteria | 65420 |
| 431 | Ga0157374_10000142 | 3300013296 | Bacteria | 64898 |
| 432 | Ga0157374_10007649 | 3300013296 | Bacteria | 9224 |
| 433 | Ga0157374_10026203 | 3300013296 | Bacteria | 5244 |
| 434 | Ga0157374_10026373 | 3300013296 | Bacteria | 5228 |
| 435 | Ga0157374_10062360 | 3300013296 | Unclassified | 3494 |
| 436 | Ga0157374_10116750 | 3300013296 | Bacteria | 2572 |
| 437 | Ga0157374_10121018 | 3300013296 | Bacteria | 2526 |
| 438 | Ga0157378_10000135 | 3300013297 | Bacteria | 69913 |
| 439 | Ga0157378_10003940 | 3300013297 | Bacteria | 13117 |
| 440 | Ga0157378_10004347 | 3300013297 | Bacteria | 12465 |
| 441 | Ga0157378_10016335 | 3300013297 | Bacteria | 6500 |
| 442 | Ga0157378_10043483 | 3300013297 | Bacteria | 3989 |
| 443 | Ga0157378_10061121 | 3300013297 | Bacteria | 3361 |
| 444 | Ga0157378_10063087 | 3300013297 | Bacteria | 3310 |
| 445 | Ga0157378_10392030 | 3300013297 | Unclassified | 1366 |
| 446 | Ga0163162_10003913 | 3300013306 | Bacteria | 14302 |
| 447 | Ga0163162_10070206 | 3300013306 | Bacteria | 3554 |
| 448 | Ga0163162_10076256 | 3300013306 | Bacteria | 3414 |
| 449 | Ga0163162_10288068 | 3300013306 | Unclassified | 1774 |
| 450 | Ga0163162_10564314 | 3300013306 | Bacteria | 1266 |
| 451 | Ga0157372_10000516 | 3300013307 | Bacteria | 42622 |
| 452 | Ga0157372_10001178 | 3300013307 | Bacteria | 28261 |
| 453 | Ga0157372_10001443 | 3300013307 | Bacteria | 25710 |
| 454 | Ga0157372_10001921 | 3300013307 | Bacteria | 22556 |
| 455 | Ga0157372_10013898 | 3300013307 | Bacteria | 8602 |
| 456 | Ga0157372_10025104 | 3300013307 | Bacteria | 6476 |
| 457 | Ga0157372_10072284 | 3300013307 | Unclassified | 3887 |
| 458 | Ga0157372_10104094 | 3300013307 | Bacteria | 3244 |
| 459 | Ga0157372_10175689 | 3300013307 | Bacteria | 2479 |
| 460 | Ga0157372_10358100 | 3300013307 | Unclassified | 1700 |
| 461 | Ga0157372_10457759 | 3300013307 | Unclassified | 1487 |
| 462 | Ga0157372_11331521 | 3300013307 | Unclassified | 828 |
| 463 | Ga0157372_12566799 | 3300013307 | Unclassified | 585 |
| 464 | Ga0157372_13411276 | 3300013307 | Unclassified | 505 |
| 465 | Ga0157375_10038435 | 3300013308 | Unclassified | 4596 |
| 466 | Ga0157375_12126062 | 3300013308 | Unclassified | 668 |
| 467 | Ga0163163_10067503 | 3300014325 | Bacteria | 3556 |
| 468 | Ga0163163_10184762 | 3300014325 | Unclassified | 2132 |
| 469 | Ga0163163_10316519 | 3300014325 | Unclassified | 1614 |
| 470 | Ga0163163_10512864 | 3300014325 | Bacteria | 1261 |
| 471 | Ga0163163_10812179 | 3300014325 | Bacteria | 999 |
| 472 | Ga0163163_12838973 | 3300014325 | Bacteria | 541 |
| 473 | Ga0157380_11846809 | 3300014326 | Bacteria | 664 |
| 474 | Ga0182008_10004763 | 3300014497 | Bacteria | 7855 |
| 475 | Ga0157377_11649348 | 3300014745 | Unclassified | 515 |
| 476 | Ga0157379_10003068 | 3300014968 | Bacteria | 14130 |
| 477 | Ga0157379_10012561 | 3300014968 | Bacteria | 7398 |
| 478 | Ga0157379_10225424 | 3300014968 | Unclassified | 1699 |
| 479 | Ga0157379_10636997 | 3300014968 | Bacteria | 997 |
| 480 | Ga0157376_10015466 | 3300014969 | Bacteria | 5765 |
| 481 | Ga0157376_10023577 | 3300014969 | Bacteria | 4819 |
| 482 | Ga0157376_10026825 | 3300014969 | Bacteria | 4557 |
| 483 | Ga0157376_10054603 | 3300014969 | Bacteria | 3331 |
| 484 | Ga0182006_1021602 | 3300015261 | Bacteria | 2682 |
| 485 | Ga0182007_10013047 | 3300015262 | Bacteria | 3184 |
| 486 | Ga0182005_1083525 | 3300015265 | Bacteria | 883 |
| 487 | Ga0213874_10248948 | 3300021377 | Unclassified | 654 |
| 488 | Ga0213875_10070567 | 3300021388 | Unclassified | 1631 |
| 489 | Ga0224572_1002702 | 3300024225 | Bacteria | 2908 |
| 490 | Ga0228598_1095940 | 3300024227 | Bacteria | 598 |
| 491 | Ga0207656_10014893 | 3300025321 | Bacteria | 3004 |
| 492 | Ga0207656_10365023 | 3300025321 | Bacteria | 722 |
| 493 | Ga0207653_10210622 | 3300025885 | Unclassified | 735 |
| 494 | Ga0207692_10026553 | 3300025898 | Bacteria | 2717 |
| 495 | Ga0207692_10081551 | 3300025898 | Bacteria | 1731 |
| 496 | Ga0207692_10126587 | 3300025898 | Unclassified | 1438 |
| 497 | Ga0207692_10234029 | 3300025898 | Bacteria | 1094 |
| 498 | Ga0207642_10040486 | 3300025899 | Unclassified | 2033 |
| 499 | Ga0207642_10063498 | 3300025899 | Bacteria | 1728 |
| 500 | Ga0207710_10107926 | 3300025900 | Bacteria | 1319 |
| 501 | Ga0207710_10136859 | 3300025900 | Bacteria | 1180 |
| 502 | Ga0207710_10653220 | 3300025900 | Unclassified | 551 |
| 503 | Ga0207688_10339579 | 3300025901 | Bacteria | 924 |
| 504 | Ga0207680_10045799 | 3300025903 | Bacteria | 2582 |
| 505 | Ga0207680_11171619 | 3300025903 | Unclassified | 548 |
| 506 | Ga0207647_10043651 | 3300025904 | Bacteria | 2804 |
| 507 | Ga0207647_10162970 | 3300025904 | Unclassified | 1300 |
| 508 | Ga0207685_10014585 | 3300025905 | Unclassified | 2464 |
| 509 | Ga0207685_10018512 | 3300025905 | Bacteria | 2275 |
| 510 | Ga0207685_10677056 | 3300025905 | Unclassified | 560 |
| 511 | Ga0207699_10003179 | 3300025906 | Bacteria | 7814 |
| 512 | Ga0207699_10023765 | 3300025906 | Unclassified | 3340 |
| 513 | Ga0207699_10063009 | 3300025906 | Bacteria | 2238 |
| 514 | Ga0207699_10074645 | 3300025906 | Bacteria | 2084 |
| 515 | Ga0207699_10103159 | 3300025906 | Bacteria | 1814 |
| 516 | Ga0207699_10277692 | 3300025906 | Bacteria | 1163 |
| 517 | Ga0207699_10296370 | 3300025906 | Unclassified | 1128 |
| 518 | Ga0207699_10308697 | 3300025906 | Unclassified | 1106 |
| 519 | Ga0207699_10425226 | 3300025906 | Bacteria | 949 |
| 520 | Ga0207699_10660533 | 3300025906 | Unclassified | 764 |
| 521 | Ga0207699_11376067 | 3300025906 | Unclassified | 522 |
| 522 | Ga0207645_10004401 | 3300025907 | Bacteria | 10439 |
| 523 | Ga0207684_10317627 | 3300025910 | Bacteria | 1343 |
| 524 | Ga0207684_10387670 | 3300025910 | Unclassified | 1201 |
| 525 | Ga0207684_10806829 | 3300025910 | Bacteria | 793 |
| 526 | Ga0207654_10011224 | 3300025911 | Bacteria | 4566 |
| 527 | Ga0207654_10022231 | 3300025911 | Bacteria | 3381 |
| 528 | Ga0207654_10064282 | 3300025911 | Unclassified | 2157 |
| 529 | Ga0207654_10067830 | 3300025911 | Unclassified | 2109 |
| 530 | Ga0207654_10387456 | 3300025911 | Unclassified | 969 |
| 531 | Ga0207654_10663797 | 3300025911 | Unclassified | 747 |
| 532 | Ga0207707_10003767 | 3300025912 | Bacteria | 13440 |
| 533 | Ga0207707_10125676 | 3300025912 | Bacteria | 2243 |
| 534 | Ga0207707_10209066 | 3300025912 | Unclassified | 1700 |
| 535 | Ga0207695_10005740 | 3300025913 | Bacteria | 16345 |
| 536 | Ga0207695_10045944 | 3300025913 | Bacteria | 4631 |
| 537 | Ga0207695_10080073 | 3300025913 | Bacteria | 3309 |
| 538 | Ga0207695_10143376 | 3300025913 | Unclassified | 2335 |
| 539 | Ga0207695_10213209 | 3300025913 | Bacteria | 1841 |
| 540 | Ga0207695_10233404 | 3300025913 | Bacteria | 1743 |
| 541 | Ga0207695_10610852 | 3300025913 | Bacteria | 971 |
| 542 | Ga0207695_11383745 | 3300025913 | Unclassified | 584 |
| 543 | Ga0207695_11446792 | 3300025913 | Unclassified | 568 |
| 544 | Ga0207671_10290971 | 3300025914 | Unclassified | 1290 |
| 545 | Ga0207671_10469577 | 3300025914 | Unclassified | 1003 |
| 546 | Ga0207671_10644725 | 3300025914 | Unclassified | 843 |
| 547 | Ga0207671_10844690 | 3300025914 | Unclassified | 725 |
| 548 | Ga0207671_11067023 | 3300025914 | Unclassified | 635 |
| 549 | Ga0207671_11288485 | 3300025914 | Bacteria | 569 |
| 550 | Ga0207693_10000080 | 3300025915 | Bacteria | 86060 |
| 551 | Ga0207693_10000173 | 3300025915 | Bacteria | 58862 |
| 552 | Ga0207693_10005546 | 3300025915 | Bacteria | 10499 |
| 553 | Ga0207693_10010314 | 3300025915 | Bacteria | 7583 |
| 554 | Ga0207693_10024452 | 3300025915 | Bacteria | 4793 |
| 555 | Ga0207693_10050011 | 3300025915 | Bacteria | 3282 |
| 556 | Ga0207693_10054090 | 3300025915 | Bacteria | 3149 |
| 557 | Ga0207693_10094388 | 3300025915 | Bacteria | 2344 |
| 558 | Ga0207693_10375256 | 3300025915 | Bacteria | 1112 |
| 559 | Ga0207693_11401083 | 3300025915 | Bacteria | 519 |
| 560 | Ga0207663_10006520 | 3300025916 | Bacteria | 5981 |
| 561 | Ga0207663_10015151 | 3300025916 | Unclassified | 4246 |
| 562 | Ga0207663_10058477 | 3300025916 | Bacteria | 2433 |
| 563 | Ga0207663_10107543 | 3300025916 | Bacteria | 1887 |
| 564 | Ga0207663_10171249 | 3300025916 | Unclassified | 1542 |
| 565 | Ga0207663_10171430 | 3300025916 | Bacteria | 1542 |
| 566 | Ga0207663_10850345 | 3300025916 | Bacteria | 728 |
| 567 | Ga0207663_11013072 | 3300025916 | Unclassified | 666 |
| 568 | Ga0207663_11281179 | 3300025916 | Unclassified | 590 |
| 569 | Ga0207660_10051503 | 3300025917 | Bacteria | 2927 |
| 570 | Ga0207660_10059699 | 3300025917 | Bacteria | 2739 |
| 571 | Ga0207660_10118592 | 3300025917 | Bacteria | 2002 |
| 572 | Ga0207660_10287700 | 3300025917 | Bacteria | 1306 |
| 573 | Ga0207657_10000215 | 3300025919 | Bacteria | 60239 |
| 574 | Ga0207657_10212296 | 3300025919 | Unclassified | 1553 |
| 575 | Ga0207649_10228982 | 3300025920 | Bacteria | 1328 |
| 576 | Ga0207652_10022145 | 3300025921 | Bacteria | 5253 |
| 577 | Ga0207652_10214386 | 3300025921 | Unclassified | 1734 |
| 578 | Ga0207652_10351898 | 3300025921 | Bacteria | 1329 |
| 579 | Ga0207652_10629610 | 3300025921 | Unclassified | 960 |
| 580 | Ga0207646_10000165 | 3300025922 | Bacteria | 89540 |
| 581 | Ga0207646_10233637 | 3300025922 | Unclassified | 1661 |
| 582 | Ga0207646_10465268 | 3300025922 | Bacteria | 1140 |
| 583 | Ga0207646_10594871 | 3300025922 | Bacteria | 993 |
| 584 | Ga0207646_11001005 | 3300025922 | Bacteria | 739 |
| 585 | Ga0207646_11080195 | 3300025922 | Bacteria | 707 |
| 586 | Ga0207646_11771721 | 3300025922 | Bacteria | 529 |
| 587 | Ga0207681_10089709 | 3300025923 | Bacteria | 2192 |
| 588 | Ga0207694_10000835 | 3300025924 | Bacteria | 27439 |
| 589 | Ga0207694_10007028 | 3300025924 | Bacteria | 8547 |
| 590 | Ga0207694_10158574 | 3300025924 | Bacteria | 1826 |
| 591 | Ga0207694_10414697 | 3300025924 | Unclassified | 1121 |
| 592 | Ga0207694_10832144 | 3300025924 | Bacteria | 780 |
| 593 | Ga0207650_10001281 | 3300025925 | Bacteria | 18234 |
| 594 | Ga0207650_10053376 | 3300025925 | Bacteria | 2996 |
| 595 | Ga0207659_10085626 | 3300025926 | Bacteria | 2342 |
| 596 | Ga0207659_10697875 | 3300025926 | Unclassified | 869 |
| 597 | Ga0207687_10005132 | 3300025927 | Bacteria | 8683 |
| 598 | Ga0207687_10027572 | 3300025927 | Bacteria | 3812 |
| 599 | Ga0207700_10000364 | 3300025928 | Bacteria | 26445 |
| 600 | Ga0207700_10021287 | 3300025928 | Bacteria | 4424 |
| 601 | Ga0207700_10038051 | 3300025928 | Bacteria | 3489 |
| 602 | Ga0207700_10059887 | 3300025928 | Unclassified | 2881 |
| 603 | Ga0207700_10120883 | 3300025928 | Unclassified | 2123 |
| 604 | Ga0207700_10130716 | 3300025928 | Bacteria | 2050 |
| 605 | Ga0207700_10254186 | 3300025928 | Bacteria | 1502 |
| 606 | Ga0207700_10308298 | 3300025928 | Bacteria | 1369 |
| 607 | Ga0207700_10359334 | 3300025928 | Bacteria | 1269 |
| 608 | Ga0207700_10441610 | 3300025928 | Bacteria | 1145 |
| 609 | Ga0207700_10455204 | 3300025928 | Unclassified | 1128 |
| 610 | Ga0207700_10603111 | 3300025928 | Unclassified | 977 |
| 611 | Ga0207700_10967057 | 3300025928 | Bacteria | 762 |
| 612 | Ga0207700_11465336 | 3300025928 | Unclassified | 606 |
| 613 | Ga0207700_11579496 | 3300025928 | Bacteria | 581 |
| 614 | Ga0207700_11725462 | 3300025928 | Bacteria | 552 |
| 615 | Ga0207664_10004399 | 3300025929 | Bacteria | 9544 |
| 616 | Ga0207664_10021424 | 3300025929 | Bacteria | 4806 |
| 617 | Ga0207664_10030515 | 3300025929 | Bacteria | 4117 |
| 618 | Ga0207664_10052162 | 3300025929 | Bacteria | 3234 |
| 619 | Ga0207664_10087681 | 3300025929 | Unclassified | 2544 |
| 620 | Ga0207664_10141447 | 3300025929 | Bacteria | 2036 |
| 621 | Ga0207664_10269082 | 3300025929 | Unclassified | 1492 |
| 622 | Ga0207664_10316631 | 3300025929 | Bacteria | 1376 |
| 623 | Ga0207664_10602232 | 3300025929 | Bacteria | 987 |
| 624 | Ga0207664_10696057 | 3300025929 | Unclassified | 914 |
| 625 | Ga0207664_10755063 | 3300025929 | Bacteria | 875 |
| 626 | Ga0207664_11684296 | 3300025929 | Unclassified | 556 |
| 627 | Ga0207690_10147586 | 3300025932 | Bacteria | 1740 |
| 628 | Ga0207690_10238690 | 3300025932 | Bacteria | 1399 |
| 629 | Ga0207706_10002361 | 3300025933 | Bacteria | 18445 |
| 630 | Ga0207686_10901209 | 3300025934 | Unclassified | 713 |
| 631 | Ga0207686_11551085 | 3300025934 | Unclassified | 546 |
| 632 | Ga0207686_11558449 | 3300025934 | Unclassified | 545 |
| 633 | Ga0207709_10552504 | 3300025935 | Bacteria | 906 |
| 634 | Ga0207669_11099925 | 3300025937 | Unclassified | 671 |
| 635 | Ga0207704_10003968 | 3300025938 | Bacteria | 6732 |
| 636 | Ga0207704_11944426 | 3300025938 | Unclassified | 506 |
| 637 | Ga0207665_10010667 | 3300025939 | Bacteria | 6034 |
| 638 | Ga0207665_10011380 | 3300025939 | Bacteria | 5842 |
| 639 | Ga0207665_10014315 | 3300025939 | Bacteria | 5223 |
| 640 | Ga0207665_10079496 | 3300025939 | Bacteria | 2254 |
| 641 | Ga0207665_10116510 | 3300025939 | Unclassified | 1883 |
| 642 | Ga0207665_10238114 | 3300025939 | Unclassified | 1340 |
| 643 | Ga0207665_10593395 | 3300025939 | Unclassified | 864 |
| 644 | Ga0207665_10646267 | 3300025939 | Unclassified | 829 |
| 645 | Ga0207665_10871959 | 3300025939 | Bacteria | 713 |
| 646 | Ga0207665_11098887 | 3300025939 | Unclassified | 634 |
| 647 | Ga0207665_11281667 | 3300025939 | Bacteria | 584 |
| 648 | Ga0207691_10270220 | 3300025940 | Bacteria | 1464 |
| 649 | Ga0207711_10002367 | 3300025941 | Bacteria | 16881 |
| 650 | Ga0207711_10264459 | 3300025941 | Bacteria | 1582 |
| 651 | Ga0207711_10568153 | 3300025941 | Bacteria | 1058 |
| 652 | Ga0207689_10574775 | 3300025942 | Unclassified | 947 |
| 653 | Ga0207689_11557082 | 3300025942 | Bacteria | 551 |
| 654 | Ga0207661_10011078 | 3300025944 | Bacteria | 6518 |
| 655 | Ga0207661_10058574 | 3300025944 | Bacteria | 3100 |
| 656 | Ga0207661_10235904 | 3300025944 | Bacteria | 1621 |
| 657 | Ga0207679_10001041 | 3300025945 | Bacteria | 17734 |
| 658 | Ga0207679_10166084 | 3300025945 | Unclassified | 1812 |
| 659 | Ga0207667_10000421 | 3300025949 | Bacteria | 57073 |
| 660 | Ga0207667_10002272 | 3300025949 | Bacteria | 24148 |
| 661 | Ga0207667_10034607 | 3300025949 | Bacteria | 5424 |
| 662 | Ga0207667_10195648 | 3300025949 | Bacteria | 2074 |
| 663 | Ga0207667_11291084 | 3300025949 | Unclassified | 707 |
| 664 | Ga0207651_10065239 | 3300025960 | Bacteria | 2553 |
| 665 | Ga0207712_10036259 | 3300025961 | Bacteria | 3357 |
| 666 | Ga0207640_10003915 | 3300025981 | Bacteria | 8035 |
| 667 | Ga0207640_10012996 | 3300025981 | Bacteria | 4758 |
| 668 | Ga0207640_10047353 | 3300025981 | Bacteria | 2773 |
| 669 | Ga0207640_10693703 | 3300025981 | Unclassified | 872 |
| 670 | Ga0207658_10946705 | 3300025986 | Bacteria | 785 |
| 671 | Ga0207658_11528447 | 3300025986 | Unclassified | 610 |
| 672 | Ga0207658_11587336 | 3300025986 | Unclassified | 598 |
| 673 | Ga0207677_10002537 | 3300026023 | Bacteria | 9574 |
| 674 | Ga0207677_10008028 | 3300026023 | Bacteria | 5875 |
| 675 | Ga0207677_10654452 | 3300026023 | Unclassified | 928 |
| 676 | Ga0207677_12073443 | 3300026023 | Unclassified | 529 |
| 677 | Ga0207703_10002538 | 3300026035 | Bacteria | 15775 |
| 678 | Ga0207703_10160661 | 3300026035 | Bacteria | 1968 |
| 679 | Ga0207703_10314679 | 3300026035 | Unclassified | 1432 |
| 680 | Ga0207703_10915344 | 3300026035 | Bacteria | 840 |
| 681 | Ga0207703_11612221 | 3300026035 | Unclassified | 624 |
| 682 | Ga0207703_11839417 | 3300026035 | Bacteria | 582 |
| 683 | Ga0207639_10095933 | 3300026041 | Bacteria | 2385 |
| 684 | Ga0207639_10178381 | 3300026041 | Bacteria | 1805 |
| 685 | Ga0207639_10285694 | 3300026041 | Bacteria | 1453 |
| 686 | Ga0207639_10728045 | 3300026041 | Unclassified | 921 |
| 687 | Ga0207678_10000874 | 3300026067 | Bacteria | 27662 |
| 688 | Ga0207708_11379634 | 3300026075 | Unclassified | 618 |
| 689 | Ga0207702_10000219 | 3300026078 | Bacteria | 66719 |
| 690 | Ga0207702_10009031 | 3300026078 | Bacteria | 8394 |
| 691 | Ga0207702_10021806 | 3300026078 | Bacteria | 5304 |
| 692 | Ga0207702_10022048 | 3300026078 | Bacteria | 5276 |
| 693 | Ga0207702_10029476 | 3300026078 | Unclassified | 4567 |
| 694 | Ga0207702_10185748 | 3300026078 | Bacteria | 1917 |
| 695 | Ga0207702_10381854 | 3300026078 | Bacteria | 1355 |
| 696 | Ga0207702_10491841 | 3300026078 | Unclassified | 1195 |
| 697 | Ga0207702_12240628 | 3300026078 | Unclassified | 535 |
| 698 | Ga0207641_10033410 | 3300026088 | Bacteria | 4274 |
| 699 | Ga0207641_10184261 | 3300026088 | Bacteria | 1914 |
| 700 | Ga0207641_10214578 | 3300026088 | Bacteria | 1781 |
| 701 | Ga0207641_10451159 | 3300026088 | Unclassified | 1243 |
| 702 | Ga0207648_10004716 | 3300026089 | Bacteria | 13940 |
| 703 | Ga0207648_10013735 | 3300026089 | Bacteria | 7517 |
| 704 | Ga0207648_10458942 | 3300026089 | Unclassified | 1161 |
| 705 | Ga0207676_10003507 | 3300026095 | Bacteria | 11099 |
| 706 | Ga0207676_10078264 | 3300026095 | Bacteria | 2678 |
| 707 | Ga0207676_10706310 | 3300026095 | Bacteria | 977 |
| 708 | Ga0207676_10945023 | 3300026095 | Bacteria | 847 |
| 709 | Ga0207674_10000190 | 3300026116 | Bacteria | 75394 |
| 710 | Ga0207674_10015313 | 3300026116 | Bacteria | 8429 |
| 711 | Ga0207674_10037539 | 3300026116 | Bacteria | 5037 |
| 712 | Ga0207674_10315400 | 3300026116 | Bacteria | 1513 |
| 713 | Ga0207674_10714909 | 3300026116 | Bacteria | 967 |
| 714 | Ga0207674_11506171 | 3300026116 | Unclassified | 642 |
| 715 | Ga0207675_100264085 | 3300026118 | Bacteria | 1669 |
| 716 | Ga0207675_100308583 | 3300026118 | Bacteria | 1542 |
| 717 | Ga0207683_10046033 | 3300026121 | Bacteria | 3816 |
| 718 | Ga0207683_10652873 | 3300026121 | Bacteria | 974 |
| 719 | Ga0207698_10004440 | 3300026142 | Bacteria | 8548 |
| 720 | Ga0207698_11290100 | 3300026142 | Unclassified | 745 |
| 721 | Ga0207698_11553488 | 3300026142 | Unclassified | 677 |
| 722 | Ga0207428_10208608 | 3300027907 | Bacteria | 1468 |
| 723 | Ga0265354_1001563 | 3300028016 | Bacteria | 3214 |
| 724 | Ga0265354_1016478 | 3300028016 | Bacteria | 700 |
| 725 | Ga0265356_1014986 | 3300028017 | Unclassified | 843 |
| 726 | Ga0268266_10008393 | 3300028379 | Bacteria | 9185 |
| 727 | Ga0268265_10056372 | 3300028380 | Bacteria | 2989 |
| 728 | Ga0268265_10501906 | 3300028380 | Bacteria | 1143 |
| 729 | Ga0268264_10009779 | 3300028381 | Bacteria | 7937 |
| 730 | Ga0268264_10497306 | 3300028381 | Bacteria | 1189 |
| 731 | Ga0268264_10764901 | 3300028381 | Bacteria | 963 |
| 732 | Ga0268264_10807567 | 3300028381 | Unclassified | 938 |
| 733 | Ga0268264_11363388 | 3300028381 | Unclassified | 720 |
| 734 | Ga0268264_11656541 | 3300028381 | Unclassified | 650 |
| 735 | Ga0265338_10018837 | 3300028800 | Bacteria | 7363 |
| 736 | Ga0265338_10415312 | 3300028800 | Unclassified | 957 |
| 737 | Ga0265324_10093456 | 3300029957 | Unclassified | 1023 |
| 738 | Ga0265762_1008767 | 3300030760 | Bacteria | 1800 |
| 739 | Ga0265770_1000702 | 3300030878 | Bacteria | 4662 |
| 740 | Ga0265770_1014935 | 3300030878 | Bacteria | 1177 |
| 741 | Ga0265765_1059372 | 3300030879 | Unclassified | 538 |
| 742 | Ga0265760_10023867 | 3300031090 | Bacteria | 1778 |
| 743 | Ga0265760_10026149 | 3300031090 | Bacteria | 1707 |
| 744 | Ga0265330_10016525 | 3300031235 | Bacteria | 3404 |
| 745 | Ga0265328_10177734 | 3300031239 | Unclassified | 805 |
| 746 | Ga0265325_10186341 | 3300031241 | Unclassified | 964 |
| 747 | Ga0265329_10088738 | 3300031242 | Unclassified | 981 |
| 748 | Ga0265340_10087205 | 3300031247 | Unclassified | 1463 |
| 749 | Ga0265340_10171376 | 3300031247 | Bacteria | 983 |
| 750 | Ga0265340_10298804 | 3300031247 | Unclassified | 714 |
| 751 | Ga0265339_10018569 | 3300031249 | Unclassified | 4095 |
| 752 | Ga0265339_10019951 | 3300031249 | Bacteria | 3924 |
| 753 | Ga0265316_10003557 | 3300031344 | Bacteria | 15713 |
| 754 | Ga0265316_10184896 | 3300031344 | Unclassified | 1550 |
| 755 | Ga0265314_10000198 | 3300031711 | Bacteria | 89925 |
| 756 | Ga0265314_10013916 | 3300031711 | Bacteria | 6472 |
| 757 | Ga0265314_10113677 | 3300031711 | Bacteria | 1716 |
| 758 | Ga0373930_0014086 | 3300034816 | Unclassified | 1483 |
| 759 | Ga0373958_0085639 | 3300034819 | Bacteria | 720 |
| 760 | Ga0373926_0000501 | 3300035083 | Bacteria | 10438 |
| 761 | Ga0373928_0137483 | 3300035084 | Bacteria | 667 |
| 762 | Ga0373929_0061106 | 3300035085 | Unclassified | 882 |
| 763 | Ga0373929_0086965 | 3300035085 | Bacteria | 770 |
| 764 | Ga0373940_0140647 | 3300035088 | Unclassified | 763 |
| 765 | Ga0373952_0030277 | 3300035092 | Bacteria | 1198 |
| 766 | Ga0373923_0028307 | 3300035111 | Bacteria | 2241 |
| 767 | Ga0373932_0020641 | 3300035112 | Bacteria | 1730 |
| 768 | Ga0373932_0053553 | 3300035112 | Unclassified | 1205 |
| 769 | Ga0373936_0053789 | 3300035113 | Bacteria | 1633 |
| 770 | Ga0373936_0088441 | 3300035113 | Bacteria | 1296 |
| 771 | Ga0373939_0154780 | 3300035114 | Bacteria | 837 |
| 772 | Ga0373941_0336841 | 3300035115 | Unclassified | 610 |
| 773 | Ga0373945_0032618 | 3300035116 | Bacteria | 1846 |
| 774 | Ga0373945_0589084 | 3300035116 | Bacteria | 502 |
| 775 | Ga0373960_0041318 | 3300035121 | Bacteria | 1335 |
| 776 | Ga0373960_0057269 | 3300035121 | Bacteria | 1173 |
| 777 | Ga0373943_0055135 | 3300035170 | Bacteria | 1968 |
| 778 | Ga0373943_0130504 | 3300035170 | Bacteria | 1344 |
| 779 | Ga0373943_0208818 | 3300035170 | Unclassified | 1083 |
| 780 | Ga0373943_0672014 | 3300035170 | Unclassified | 613 |
| 781 | Ga0373942_0036873 | 3300035207 | Unclassified | 1319 |
| 782 | Ga0373942_0162962 | 3300035207 | Unclassified | 722 |
| 783 | Ga0373931_0033225 | 3300035691 | Unclassified | 2673 |
| 784 | Ga0373931_0081486 | 3300035691 | Unclassified | 1787 |
| 785 | Ga0373931_0114270 | 3300035691 | Unclassified | 1535 |
| 786 | Ga0373931_0115285 | 3300035691 | Bacteria | 1529 |
| 787 | Ga0373931_0142160 | 3300035691 | Unclassified | 1391 |
| 788 | Ga0373931_0169238 | 3300035691 | Bacteria | 1286 |
| 789 | Ga0373931_0211924 | 3300035691 | Unclassified | 1162 |
| 790 | Ga0373935_0005508 | 3300035692 | Bacteria | 7458 |
| 791 | Ga0373935_0200945 | 3300035692 | Unclassified | 1377 |
| 792 | Ga0373935_0207054 | 3300035692 | Bacteria | 1358 |
| 793 | Ga0373935_0806118 | 3300035692 | Bacteria | 693 |
| 794 | Ga0373927_0010674 | 3300035695 | Bacteria | 6119 |
| 795 | Ga0373927_0025477 | 3300035695 | Bacteria | 3868 |
| 796 | Ga0373927_0057773 | 3300035695 | Bacteria | 2509 |
| 797 | Ga0373927_0094843 | 3300035695 | Bacteria | 1939 |
| 798 | Ga0373927_0250252 | 3300035695 | Bacteria | 1165 |
| 799 | Ga0373933_0038561 | 3300035724 | Unclassified | 2808 |
| 800 | Ga0373933_1156514 | 3300035724 | Unclassified | 510 |
| 801 | Ga0373947_0002625 | 3300035725 | Bacteria | 10786 |
| 802 | Ga0373947_0438649 | 3300035725 | Bacteria | 884 |
| 803 | Ga0373947_0459143 | 3300035725 | Bacteria | 863 |
| 804 | Ga0373937_0324632 | 3300036401 | Bacteria | 1456 |
| 805 | Ga0373937_0399278 | 3300036401 | Unclassified | 1304 |
| 806 | Ga0373937_0680256 | 3300036401 | Bacteria | 975 |
| 807 | Ga0373937_0944314 | 3300036401 | Unclassified | 811 |
| 808 | Ga0373937_1030230 | 3300036401 | Bacteria | 772 |
| 809 | Ga0373937_1128343 | 3300036401 | Unclassified | 733 |
| 810 | Ga0373925_0003990 | 3300037068 | Bacteria | 11248 |
| 811 | Ga0373925_0037892 | 3300037068 | Bacteria | 3561 |
| 812 | Ga0373925_0039044 | 3300037068 | Bacteria | 3512 |
| 813 | Ga0373925_0087346 | 3300037068 | Bacteria | 2380 |
| 814 | Ga0373925_0260517 | 3300037068 | Unclassified | 1393 |
| 815 | Ga0373925_0345481 | 3300037068 | Bacteria | 1207 |
| 816 | Ga0373925_1322675 | 3300037068 | Unclassified | 591 |
| 817 | Ga0395900_1139148 | 3300037418 | Bacteria | 697 |
| 818 | Ga0436364_0446884 | 3300037853 | Unclassified | 1756 |
| 819 | Ga0436364_1057791 | 3300037853 | Unclassified | 1139 |
| 820 | Ga0395901_0210588 | 3300038443 | Bacteria | 2035 |
| 821 | Ga0436365_0750651 | 3300039437 | Bacteria | 974 |
| 822 | Ga0436365_1544655 | 3300039437 | Unclassified | 1038 |
| 823 | Ga0436365_1710842 | 3300039437 | Bacteria | 882 |
| 824 | Ga0436361_0604920 | 3300039447 | Unclassified | 715 |
| 825 | Ga0436363_0097650 | 3300039450 | Unclassified | 3836 |
| 826 | Ga0436363_1113891 | 3300039450 | Bacteria | 1426 |
| 827 | Ga0436363_1282358 | 3300039450 | Bacteria | 933 |
| 828 | Ga0436363_1442918 | 3300039450 | Unclassified | 654 |
| 829 | Ga0436362_1215023 | 3300039453 | Bacteria | 969 |
| 830 | Ga0451577_0033862 | 3300042876 | Bacteria | 4606 |
| 831 | Ga0451577_0144566 | 3300042876 | Bacteria | 2138 |
| 832 | Ga0453683_0008301 | 3300044673 | Bacteria | 6980 |
| 833 | Ga0453683_0025320 | 3300044673 | Bacteria | 3771 |
| 834 | Ga0453683_0164664 | 3300044673 | Bacteria | 1403 |
| 835 | Ga0466963_0093803 | 3300044694 | Bacteria | 2047 |
| 836 | Ga0466963_0901932 | 3300044694 | Bacteria | 623 |
| 837 | Ga0466964_0062408 | 3300044706 | Bacteria | 1554 |
| 838 | Ga0466964_0719390 | 3300044706 | Bacteria | 558 |
| 839 | Ga0453684_0008254 | 3300044712 | Bacteria | 18771 |
| 840 | Ga0453684_0118899 | 3300044712 | Bacteria | 3195 |
| 841 | Ga0466971_0031072 | 3300044719 | Bacteria | 2391 |
| 842 | Ga0466968_0318708 | 3300044735 | Bacteria | 751 |
| 843 | Ga0466957_0220959 | 3300044842 | Bacteria | 1251 |
| 844 | Ga0466959_0147994 | 3300045049 | Unclassified | 1657 |
| 845 | Ga0466959_0547691 | 3300045049 | Unclassified | 780 |
| 846 | Ga0451576_0028688 | 3300045051 | Bacteria | 5959 |
| 847 | Ga0451576_0176996 | 3300045051 | Bacteria | 2227 |
| 848 | Ga0451576_0582113 | 3300045051 | Unclassified | 1176 |
| 849 | Ga0451576_0605415 | 3300045051 | Unclassified | 1152 |
| 850 | Ga0466958_0127737 | 3300045836 | Bacteria | 1595 |
| 851 | Ga0466958_0178492 | 3300045836 | Bacteria | 1347 |
| 852 | Ga0466958_0632017 | 3300045836 | Bacteria | 697 |
| 853 | Ga0466967_0010975 | 3300045976 | Bacteria | 6830 |
| 854 | Ga0466967_0409569 | 3300045976 | Bacteria | 1320 |
| 855 | Ga0466967_0505766 | 3300045976 | Bacteria | 1186 |
| 856 | Ga0466967_1415316 | 3300045976 | Unclassified | 692 |
| 857 | Ga0495592_0920997 | 3300046454 | Unclassified | 513 |
| 858 | Ga0495580_0001362 | 3300046472 | Bacteria | 21499 |
| 859 | Ga0495580_0002000 | 3300046472 | Bacteria | 17938 |
| 860 | Ga0495580_0004144 | 3300046472 | Bacteria | 12208 |
| 861 | Ga0495580_0004450 | 3300046472 | Bacteria | 11775 |
| 862 | Ga0495580_0048785 | 3300046472 | Bacteria | 2996 |
| 863 | Ga0495580_0049837 | 3300046472 | Bacteria | 2962 |
| 864 | Ga0495580_0057500 | 3300046472 | Bacteria | 2737 |
| 865 | Ga0495580_0082739 | 3300046472 | Bacteria | 2237 |
| 866 | Ga0495580_0097614 | 3300046472 | Bacteria | 2043 |
| 867 | Ga0495580_0551582 | 3300046472 | Unclassified | 765 |
| 868 | Ga0495580_0661659 | 3300046472 | Unclassified | 686 |
| 869 | Ga0495582_0000442 | 3300046473 | Bacteria | 22703 |
| 870 | Ga0495582_0194132 | 3300046473 | Bacteria | 1159 |
| 871 | Ga0495582_0372507 | 3300046473 | Bacteria | 823 |
| 872 | Ga0495664_0592134 | 3300046477 | Bacteria | 659 |
| 873 | Ga0495630_0074729 | 3300046517 | Bacteria | 2553 |
| 874 | Ga0495630_0352971 | 3300046517 | Unclassified | 1125 |
| 875 | Ga0495630_0508223 | 3300046517 | Bacteria | 924 |
| 876 | Ga0495630_0844955 | 3300046517 | Bacteria | 698 |
| 877 | Ga0495666_0106417 | 3300046526 | Bacteria | 1320 |
| 878 | Ga0495666_0418944 | 3300046526 | Unclassified | 601 |
| 879 | Ga0495665_0001834 | 3300046531 | Bacteria | 11472 |
| 880 | Ga0495665_0021353 | 3300046531 | Unclassified | 3478 |
| 881 | Ga0495587_0073742 | 3300046536 | Bacteria | 1983 |
| 882 | Ga0495622_0417321 | 3300046557 | Unclassified | 577 |
| 883 | Ga0495634_0695181 | 3300046642 | Unclassified | 585 |
| 884 | Ga0495623_0067164 | 3300046679 | Bacteria | 2239 |
| 885 | Ga0495623_0420641 | 3300046679 | Unclassified | 716 |
| 886 | Ga0495623_0499121 | 3300046679 | Bacteria | 643 |
| 887 | Ga0495624_0079273 | 3300046690 | Bacteria | 2037 |
| 888 | Ga0495624_0406138 | 3300046690 | Unclassified | 818 |
| 889 | Ga0495624_0759689 | 3300046690 | Bacteria | 574 |
| 890 | Ga0495581_0010039 | 3300047315 | Bacteria | 5477 |
| 891 | Ga0495604_0582206 | 3300047317 | Bacteria | 719 |
| 892 | Ga0495674_0083043 | 3300047319 | Bacteria | 2747 |
| 893 | Ga0495674_0555651 | 3300047319 | Bacteria | 913 |
| 894 | Ga0495674_1226403 | 3300047319 | Bacteria | 566 |
| 895 | Ga0495676_0376697 | 3300047321 | Bacteria | 945 |
| 896 | Ga0495675_0341546 | 3300047444 | Bacteria | 882 |
| 897 | Ga0495593_0357067 | 3300047673 | Unclassified | 730 |
| 898 | Ga0495602_0283361 | 3300048088 | Bacteria | 1220 |
| 899 | Ga0495602_0302428 | 3300048088 | Unclassified | 1170 |
| 900 | Ga0495602_0315696 | 3300048088 | Unclassified | 1139 |
| 901 | Ga0495602_0324986 | 3300048088 | Unclassified | 1118 |
| 902 | Ga0495602_0792054 | 3300048088 | Unclassified | 637 |
| 903 | Ga0495602_1108045 | 3300048088 | Bacteria | 519 |
| 904 | Ga0496100_0027206 | 3300048903 | Unclassified | 3515 |
| 905 | Ga0496100_0140408 | 3300048903 | Bacteria | 1712 |
| 906 | Ga0496101_0002158 | 3300048904 | Bacteria | 12017 |
| 907 | Ga0496101_0182831 | 3300048904 | Bacteria | 1615 |
| 908 | Ga0496101_0544469 | 3300048904 | Unclassified | 918 |
| 909 | Ga0496101_0737829 | 3300048904 | Unclassified | 777 |
| 910 | Ga0496102_0036185 | 3300048905 | Unclassified | 4447 |
| 911 | Ga0496102_0050905 | 3300048905 | Bacteria | 3773 |
| 912 | Ga0496102_0059439 | 3300048905 | Bacteria | 3495 |
| 913 | Ga0496102_0095153 | 3300048905 | Bacteria | 2760 |
| 914 | Ga0496102_0181158 | 3300048905 | Bacteria | 1985 |
| 915 | Ga0496102_0695720 | 3300048905 | Bacteria | 940 |
| 916 | Ga0496103_0009501 | 3300048906 | Bacteria | 5757 |
| 917 | Ga0496103_0127005 | 3300048906 | Bacteria | 1627 |
| 918 | Ga0496103_0299507 | 3300048906 | Unclassified | 1034 |
| 919 | Ga0496104_0030432 | 3300048907 | Bacteria | 5016 |
| 920 | Ga0496104_0060216 | 3300048907 | Unclassified | 3597 |
| 921 | Ga0496104_0061805 | 3300048907 | Bacteria | 3551 |
| 922 | Ga0496104_0174222 | 3300048907 | Bacteria | 2062 |
| 923 | Ga0496104_1519037 | 3300048907 | Unclassified | 572 |
| 924 | Ga0496105_0071678 | 3300048908 | Unclassified | 2863 |
| 925 | Ga0496105_0160353 | 3300048908 | Bacteria | 1846 |
| 926 | Ga0496105_0246944 | 3300048908 | Bacteria | 1447 |
| 927 | Ga0496105_0685686 | 3300048908 | Unclassified | 788 |
| 928 | Ga0496105_1047836 | 3300048908 | Unclassified | 608 |
| 929 | Ga0496106_0025440 | 3300048909 | Bacteria | 4406 |
| 930 | Ga0496106_0071315 | 3300048909 | Unclassified | 2655 |
| 931 | Ga0496106_0086888 | 3300048909 | Unclassified | 2409 |
| 932 | Ga0496107_0135205 | 3300048910 | Bacteria | 1821 |
| 933 | Ga0496107_0167848 | 3300048910 | Unclassified | 1628 |
| 934 | Ga0496107_0208689 | 3300048910 | Bacteria | 1452 |
| 935 | Ga0496107_1144511 | 3300048910 | Unclassified | 561 |
| 936 | Ga0496108_0227371 | 3300048911 | Bacteria | 1622 |
| 937 | Ga0496108_0655864 | 3300048911 | Unclassified | 912 |
| 938 | Ga0496108_1057295 | 3300048911 | Bacteria | 691 |
| 939 | Ga0496108_1556438 | 3300048911 | Unclassified | 548 |
| 940 | Ga0496109_0107079 | 3300048912 | Bacteria | 2597 |
| 941 | Ga0496109_0219233 | 3300048912 | Bacteria | 1789 |
| 942 | Ga0496109_0505355 | 3300048912 | Bacteria | 1141 |
| 943 | Ga0496109_0662199 | 3300048912 | Bacteria | 981 |
| 944 | Ga0496110_0467021 | 3300048913 | Unclassified | 1150 |
| 945 | Ga0496110_0676463 | 3300048913 | Bacteria | 933 |
| 946 | Ga0496112_0005343 | 3300048915 | Bacteria | 11090 |
| 947 | Ga0496112_0005971 | 3300048915 | Bacteria | 10624 |
| 948 | Ga0496112_0033148 | 3300048915 | Bacteria | 5019 |
| 949 | Ga0496112_0050298 | 3300048915 | Bacteria | 4087 |
| 950 | Ga0496112_0139450 | 3300048915 | Unclassified | 2394 |
| 951 | Ga0496112_0690632 | 3300048915 | Bacteria | 949 |
| 952 | Ga0496112_1048301 | 3300048915 | Unclassified | 734 |
| 953 | Ga0496112_1161867 | 3300048915 | Unclassified | 689 |
| 954 | Ga0496112_1331426 | 3300048915 | Bacteria | 633 |
| 955 | Ga0496113_0224408 | 3300048916 | Bacteria | 1498 |
| 956 | Ga0496113_0358419 | 3300048916 | Bacteria | 1170 |
| 957 | Ga0496113_0655565 | 3300048916 | Unclassified | 839 |
| 958 | Ga0496114_0025952 | 3300048917 | Bacteria | 4794 |
| 959 | Ga0496115_0007193 | 3300048918 | Bacteria | 8178 |
| 960 | Ga0501067_0286487 | 3300049583 | Unclassified | 917 |
| 961 | nmdc:mga05p37_347512_c2 | 3300050507 | Unclassified | 1203 |
| 962 | nmdc:mga06r32_19912_c1 | 3300050510 | Bacteria | 6168 |
| 963 | nmdc:mga08y16_216368_c1 | 3300050511 | Bacteria | 1984 |
| 964 | nmdc:mga0n895_168541_c1 | 3300050512 | Bacteria | 2222 |
| 965 | nmdc:mga0n895_6632_c1 | 3300050512 | Bacteria | 9859 |
| 966 | nmdc:mga0rr50_1064007_c1 | 3300050513 | Unclassified | 688 |
| 967 | nmdc:mga0rr50_1742336_c1 | 3300050513 | Unclassified | 525 |
| 968 | nmdc:mga0rr50_318221_c1 | 3300050513 | Unclassified | 1304 |
| 969 | nmdc:mga0rr50_4024_c1 | 3300050513 | Bacteria | 8574 |
| 970 | nmdc:mga0rr50_772475_c1 | 3300050513 | Unclassified | 820 |
| 971 | nmdc:mga0rr50_7995_c1 | 3300050513 | Bacteria | 6559 |
| 972 | nmdc:mga08x19_122822_c1 | 3300050514 | Unclassified | 1742 |
| 973 | nmdc:mga08x19_1403_c1 | 3300050514 | Bacteria | 14894 |
| 974 | nmdc:mga08x19_3215_c1 | 3300050514 | Bacteria | 9795 |
| 975 | nmdc:mga08x19_402984_c1 | 3300050514 | Unclassified | 960 |
| 976 | nmdc:mga0a205_1274666_c1 | 3300050515 | Unclassified | 583 |
| 977 | Ga0495612_0099695 | 3300053078 | Bacteria | 1236 |
| 978 | Ga0395900_1098436 | |||
| 979 | Ga0065712_10120769 | |||
| 980 | Ga0065712_10770360 | |||
| 981 | Ga0065715_10717049 | |||
| 982 | Ga0065707_10364680 | |||
| 983 | Ga0070676_10002367 | |||
| 984 | Ga0070683_100116342 | |||
| 985 | Ga0070683_100521406 | |||
| 986 | Ga0070690_100604834 | |||
| 987 | Ga0070670_100011355 | |||
| 988 | Ga0068869_100083221 | |||
| 989 | Ga0068869_101451373 | |||
| 990 | Ga0068869_101498839 | |||
| 991 | Ga0070666_10064179 | |||
| 992 | Ga0070680_100071375 | |||
| 993 | Ga0070680_100129333 | |||
| 994 | Ga0070680_100280675 | |||
| 995 | Ga0070682_100024949 | |||
| 996 | Ga0068868_100001273 | |||
| 997 | Ga0068868_100012002 | |||
| 998 | Ga0068868_100157662 | |||
| 999 | Ga0068868_100895602 | |||
| 1000 | Ga0068868_101584242 | |||
| 1001 | Ga0070660_100125313 | |||
| 1002 | Ga0070660_100277780 | |||
| 1003 | Ga0070660_101706163 | |||
| 1004 | Ga0070689_100079619 | |||
| 1005 | Ga0070691_10254511 | |||
| 1006 | Ga0070661_100167071 | |||
| 1007 | Ga0070661_100584755 | |||
| 1008 | Ga0070692_10418498 | |||
| 1009 | Ga0070692_10596174 | |||
| 1010 | Ga0070668_100021068 | |||
| 1011 | Ga0070669_100114684 | |||
| 1012 | Ga0070675_100591016 | |||
| 1013 | Ga0070671_101212451 | |||
| 1014 | Ga0070674_100302941 | |||
| 1015 | Ga0070673_100182094 | |||
| 1016 | Ga0070673_101816789 | |||
| 1017 | Ga0070688_100279213 | |||
| 1018 | Ga0070659_100009578 | |||
| 1019 | Ga0070659_100253752 | |||
| 1020 | Ga0070667_100273641 | |||
| 1021 | Ga0070667_100386855 | |||
| 1022 | Ga0070703_10252975 | |||
| 1023 | Ga0070709_10000974 | |||
| 1024 | Ga0070709_10016355 | |||
| 1025 | Ga0070709_10081981 | |||
| 1026 | Ga0070709_10094647 | |||
| 1027 | Ga0070709_10142647 | |||
| 1028 | Ga0070709_10339576 | |||
| 1029 | Ga0070709_10382894 | |||
| 1030 | Ga0070709_10460908 | |||
| 1031 | Ga0070709_11134546 | |||
| 1032 | Ga0070709_11255929 | |||
| 1033 | Ga0070714_100026803 | |||
| 1034 | Ga0070714_100048541 | |||
| 1035 | Ga0070714_100051479 | |||
| 1036 | Ga0070714_100163160 | |||
| 1037 | Ga0070714_100164098 | |||
| 1038 | Ga0070714_100380501 | |||
| 1039 | Ga0070714_100670545 | |||
| 1040 | Ga0070714_100943388 | |||
| 1041 | Ga0070714_100961971 | |||
| 1042 | Ga0070714_101078121 | |||
| 1043 | Ga0070714_102068822 | |||
| 1044 | Ga0070713_100000034 | |||
| 1045 | Ga0070713_100041044 | |||
| 1046 | Ga0070713_100049038 | |||
| 1047 | Ga0070713_100078119 | |||
| 1048 | Ga0070713_100079639 | |||
| 1049 | Ga0070713_100100991 | |||
| 1050 | Ga0070713_100274660 | |||
| 1051 | Ga0070713_100302295 | |||
| 1052 | Ga0070713_100313998 | |||
| 1053 | Ga0070713_100392593 | |||
| 1054 | Ga0070713_100467966 | |||
| 1055 | Ga0070713_100728612 | |||
| 1056 | Ga0070713_100939664 | |||
| 1057 | Ga0070713_101490312 | |||
| 1058 | Ga0070713_101630695 | |||
| 1059 | Ga0070713_101805904 | |||
| 1060 | Ga0070710_10012360 | |||
| 1061 | Ga0070710_10020111 | |||
| 1062 | Ga0070710_10026854 | |||
| 1063 | Ga0070710_10341970 | |||
| 1064 | Ga0070710_10527453 | |||
| 1065 | Ga0070710_11057260 | |||
| 1066 | Ga0070701_10035602 | |||
| 1067 | Ga0070711_100000146 | |||
| 1068 | Ga0070711_100009798 | |||
| 1069 | Ga0070711_100022658 | |||
| 1070 | Ga0070711_100069134 | |||
| 1071 | Ga0070711_100122145 | |||
| 1072 | Ga0070711_100383483 | |||
| 1073 | Ga0070711_101511281 | |||
| 1074 | Ga0070711_101629070 | |||
| 1075 | Ga0070711_101912421 | |||
| 1076 | Ga0070705_100812432 | |||
| 1077 | Ga0070694_100048822 | |||
| 1078 | Ga0070694_100286547 | |||
| 1079 | Ga0070708_100000650 | |||
| 1080 | Ga0070708_100009490 | |||
| 1081 | Ga0070708_100148845 | |||
| 1082 | Ga0070708_100180519 | |||
| 1083 | Ga0070708_100195638 | |||
| 1084 | Ga0070708_101020170 | |||
| 1085 | Ga0070708_101098894 | |||
| 1086 | Ga0070708_101247174 | |||
| 1087 | Ga0070708_101786702 | |||
| 1088 | Ga0070663_100570099 | |||
| 1089 | Ga0070678_100150560 | |||
| 1090 | Ga0070678_100605833 | |||
| 1091 | Ga0070662_100898603 | |||
| 1092 | Ga0070681_10000377 | |||
| 1093 | Ga0070681_10028330 | |||
| 1094 | Ga0070681_10166543 | |||
| 1095 | Ga0068867_100014152 | |||
| 1096 | Ga0068867_100090433 | |||
| 1097 | Ga0068867_101192018 | |||
| 1098 | Ga0070685_10633677 | |||
| 1099 | Ga0070706_100075176 | |||
| 1100 | Ga0070706_100327234 | |||
| 1101 | Ga0070706_100401864 | |||
| 1102 | Ga0070706_100482795 | |||
| 1103 | Ga0070707_100006085 | |||
| 1104 | Ga0070707_100018634 | |||
| 1105 | Ga0070707_100307075 | |||
| 1106 | Ga0070707_100312705 | |||
| 1107 | Ga0070707_100462916 | |||
| 1108 | Ga0070707_100973476 | |||
| 1109 | Ga0070707_101502183 | |||
| 1110 | Ga0070707_101519233 | |||
| 1111 | Ga0070707_101531467 | |||
| 1112 | Ga0070698_100231122 | |||
| 1113 | Ga0070698_100671062 | |||
| 1114 | Ga0070698_101525288 | |||
| 1115 | Ga0070699_100388680 | |||
| 1116 | Ga0070699_101440218 | |||
| 1117 | Ga0070699_101674528 | |||
| 1118 | Ga0070699_101960718 | |||
| 1119 | Ga0070679_100009688 | |||
| 1120 | Ga0070679_100120514 | |||
| 1121 | Ga0070679_100320985 | |||
| 1122 | Ga0070679_100601215 | |||
| 1123 | Ga0070684_100187574 | |||
| 1124 | Ga0070684_101565390 | |||
| 1125 | Ga0070684_102143536 | |||
| 1126 | Ga0070697_100000054 | |||
| 1127 | Ga0070697_100017898 | |||
| 1128 | Ga0070697_100196733 | |||
| 1129 | Ga0070697_100224367 | |||
| 1130 | Ga0070697_100313027 | |||
| 1131 | Ga0070697_100489116 | |||
| 1132 | Ga0070697_100524919 | |||
| 1133 | Ga0070697_101069367 | |||
| 1134 | Ga0070697_101563402 | |||
| 1135 | Ga0068853_100017902 | |||
| 1136 | Ga0068853_100148874 | |||
| 1137 | Ga0068853_100209068 | |||
| 1138 | Ga0068853_100694156 | |||
| 1139 | Ga0070672_100297271 | |||
| 1140 | Ga0070686_100788128 | |||
| 1141 | Ga0070695_100079673 | |||
| 1142 | Ga0070695_100438380 | |||
| 1143 | Ga0070695_100909232 | |||
| 1144 | Ga0070696_100158453 | |||
| 1145 | Ga0070696_100446788 | |||
| 1146 | Ga0070696_101750127 | |||
| 1147 | Ga0070693_100240083 | |||
| 1148 | Ga0070693_100300934 | |||
| 1149 | Ga0070693_101277284 | |||
| 1150 | Ga0070665_100025769 | |||
| 1151 | Ga0070704_100648819 | |||
| 1152 | Ga0070704_101131612 | |||
| 1153 | Ga0068855_100001121 | |||
| 1154 | Ga0068855_100003109 | |||
| 1155 | Ga0068855_100070544 | |||
| 1156 | Ga0068855_100260828 | |||
| 1157 | Ga0068855_101287332 | |||
| 1158 | Ga0070664_100003491 | |||
| 1159 | Ga0070664_100159389 | |||
| 1160 | Ga0068857_100001087 | |||
| 1161 | Ga0068857_100006322 | |||
| 1162 | Ga0068857_100017859 | |||
| 1163 | Ga0068857_101451029 | |||
| 1164 | Ga0068857_101701870 | |||
| 1165 | Ga0068854_100001857 | |||
| 1166 | Ga0068854_100018005 | |||
| 1167 | Ga0068854_100932982 | |||
| 1168 | Ga0068854_102011753 | |||
| 1169 | Ga0068856_100001572 | |||
| 1170 | Ga0068856_100004735 | |||
| 1171 | Ga0068856_100030022 | |||
| 1172 | Ga0068856_100069904 | |||
| 1173 | Ga0068856_100121562 | |||
| 1174 | Ga0068856_100190538 | |||
| 1175 | Ga0068856_100342117 | |||
| 1176 | Ga0068856_100386871 | |||
| 1177 | Ga0068856_100917036 | |||
| 1178 | Ga0070702_101650852 | |||
| 1179 | Ga0068852_100166359 | |||
| 1180 | Ga0068852_101171454 | |||
| 1181 | Ga0068852_101302895 | |||
| 1182 | Ga0068859_100000212 | |||
| 1183 | Ga0068859_100012600 | |||
| 1184 | Ga0068859_101358363 | |||
| 1185 | Ga0068864_100005484 | |||
| 1186 | Ga0068864_100101200 | |||
| 1187 | Ga0068864_100458419 | |||
| 1188 | Ga0068864_100817087 | |||
| 1189 | Ga0068866_10002561 | |||
| 1190 | Ga0068866_10136615 | |||
| 1191 | Ga0068866_10207359 | |||
| 1192 | Ga0068866_10216270 | |||
| 1193 | Ga0068861_100261937 | |||
| 1194 | Ga0068861_100309728 | |||
| 1195 | Ga0068851_10007013 | |||
| 1196 | Ga0068851_10448930 | |||
| 1197 | Ga0068870_10181351 | |||
| 1198 | Ga0068863_100022000 | |||
| 1199 | Ga0068863_100052481 | |||
| 1200 | Ga0068863_100158640 | |||
| 1201 | Ga0068863_100177775 | |||
| 1202 | Ga0068863_100191173 | |||
| 1203 | Ga0068863_100501767 | |||
| 1204 | Ga0068858_100004036 | |||
| 1205 | Ga0068858_100041953 | |||
| 1206 | Ga0068858_100384442 | |||
| 1207 | Ga0068858_100631046 | |||
| 1208 | Ga0068858_102418901 | |||
| 1209 | Ga0068860_100145523 | |||
| 1210 | Ga0068860_100339588 | |||
| 1211 | Ga0068860_100572145 | |||
| 1212 | Ga0068860_101282780 | |||
| 1213 | Ga0068860_101626291 | |||
| 1214 | Ga0068862_100140377 | |||
| 1215 | Ga0068862_100268300 | |||
| 1216 | Ga0068862_101424674 | |||
| 1217 | Ga0081540_1056259 | |||
| 1218 | Ga0070717_10000783 | |||
| 1219 | Ga0070717_10001830 | |||
| 1220 | Ga0070717_10015827 | |||
| 1221 | Ga0070717_10027647 | |||
| 1222 | Ga0070717_10028400 | |||
| 1223 | Ga0070717_10034022 | |||
| 1224 | Ga0070717_10042990 | |||
| 1225 | Ga0070717_10053292 | |||
| 1226 | Ga0070717_10069754 | |||
| 1227 | Ga0070717_10087653 | |||
| 1228 | Ga0070717_10247820 | |||
| 1229 | Ga0070717_10380763 | |||
| 1230 | Ga0070717_10408917 | |||
| 1231 | Ga0070717_10495216 | |||
| 1232 | Ga0070717_11131185 | |||
| 1233 | Ga0070717_11881944 | |||
| 1234 | Ga0070715_10020921 | |||
| 1235 | Ga0070715_10022382 | |||
| 1236 | Ga0070715_10090119 | |||
| 1237 | Ga0070715_10110651 | |||
| 1238 | Ga0070715_10237985 | |||
| 1239 | Ga0070715_10369812 | |||
| 1240 | Ga0070715_10792930 | |||
| 1241 | Ga0070716_100000923 | |||
| 1242 | Ga0070716_100007179 | |||
| 1243 | Ga0070716_100007927 | |||
| 1244 | Ga0070716_100008906 | |||
| 1245 | Ga0070716_100046037 | |||
| 1246 | Ga0070716_100127741 | |||
| 1247 | Ga0070716_100213147 | |||
| 1248 | Ga0070716_100242529 | |||
| 1249 | Ga0070716_100426417 | |||
| 1250 | Ga0070716_100530219 | |||
| 1251 | Ga0070716_101492507 | |||
| 1252 | Ga0070712_100000020 | |||
| 1253 | Ga0070712_100001031 | |||
| 1254 | Ga0070712_100002971 | |||
| 1255 | Ga0070712_100072046 | |||
| 1256 | Ga0070712_100086934 | |||
| 1257 | Ga0070712_100103143 | |||
| 1258 | Ga0070712_100116259 | |||
| 1259 | Ga0070712_100481776 | |||
| 1260 | Ga0070712_100581626 | |||
| 1261 | Ga0070712_100819713 | |||
| 1262 | Ga0097621_100002049 | |||
| 1263 | Ga0097621_100004009 | |||
| 1264 | Ga0097621_100058344 | |||
| 1265 | Ga0097621_100183041 | |||
| 1266 | Ga0097621_100286834 | |||
| 1267 | Ga0097621_100775720 | |||
| 1268 | Ga0097621_101129161 | |||
| 1269 | Ga0097621_101560671 | |||
| 1270 | Ga0068871_100002003 | |||
| 1271 | Ga0068871_100032606 | |||
| 1272 | Ga0068871_100035240 | |||
| 1273 | Ga0068871_100056574 | |||
| 1274 | Ga0068871_100216798 | |||
| 1275 | Ga0068871_100673143 | |||
| 1276 | Ga0068871_101041880 | |||
| 1277 | Ga0068871_101560866 | |||
| 1278 | Ga0075428_100008382 | |||
| 1279 | Ga0075431_100046799 | |||
| 1280 | Ga0075433_11523332 | |||
| 1281 | Ga0075434_100028248 | |||
| 1282 | Ga0075434_100236454 | |||
| 1283 | Ga0068865_100199141 | |||
| 1284 | Ga0075436_100000876 | |||
| 1285 | Ga0075436_100002383 | |||
| 1286 | Ga0075436_100085157 | |||
| 1287 | Ga0075436_100090407 | |||
| 1288 | Ga0075436_100522543 | |||
| 1289 | Ga0097620_100000212 | |||
| 1290 | Ga0097620_100012600 | |||
| 1291 | Ga0097620_101358352 | |||
| 1292 | Ga0075435_100000708 | |||
| 1293 | Ga0075435_100011313 | |||
| 1294 | Ga0075435_100483743 | |||
| 1295 | Ga0075435_100742539 | |||
| 1296 | Ga0075435_100901228 | |||
| 1297 | Ga0099794_10020695 | |||
| 1298 | Ga0099794_10276002 | |||
| 1299 | Ga0099795_10071744 | |||
| 1300 | Ga0099795_10279114 | |||
| 1301 | Ga0099795_10300733 | |||
| 1302 | Ga0099795_10660326 | |||
| 1303 | Ga0105251_10142815 | |||
| 1304 | Ga0105250_10098912 | |||
| 1305 | Ga0105250_10132821 | |||
| 1306 | Ga0105250_10162909 | |||
| 1307 | Ga0105240_10010302 | |||
| 1308 | Ga0105240_10019089 | |||
| 1309 | Ga0105240_10022087 | |||
| 1310 | Ga0105240_10026956 | |||
| 1311 | Ga0105240_10043487 | |||
| 1312 | Ga0105240_10088373 | |||
| 1313 | Ga0105240_10149523 | |||
| 1314 | Ga0105240_10228754 | |||
| 1315 | Ga0105240_10501666 | |||
| 1316 | Ga0105240_11821688 | |||
| 1317 | Ga0105240_12620801 | |||
| 1318 | Ga0111539_10275868 | |||
| 1319 | Ga0105245_10089104 | |||
| 1320 | Ga0105245_10145895 | |||
| 1321 | Ga0105245_10364718 | |||
| 1322 | Ga0105245_11326194 | |||
| 1323 | Ga0105245_11718262 | |||
| 1324 | Ga0105245_13203829 | |||
| 1325 | Ga0105247_10004327 | |||
| 1326 | Ga0105247_10205696 | |||
| 1327 | Ga0105247_10595172 | |||
| 1328 | Ga0105247_11848767 | |||
| 1329 | Ga0114129_10995017 | |||
| 1330 | Ga0105243_10049197 | |||
| 1331 | Ga0105241_10004302 | |||
| 1332 | Ga0105241_10007461 | |||
| 1333 | Ga0105241_10015748 | |||
| 1334 | Ga0105241_10071397 | |||
| 1335 | Ga0105241_10126226 | |||
| 1336 | Ga0105241_10136533 | |||
| 1337 | Ga0105241_10213905 | |||
| 1338 | Ga0105241_10477070 | |||
| 1339 | Ga0105241_10529823 | |||
| 1340 | Ga0105241_11467703 | |||
| 1341 | Ga0105242_10063427 | |||
| 1342 | Ga0105242_10760952 | |||
| 1343 | Ga0105242_12212778 | |||
| 1344 | Ga0105248_10032421 | |||
| 1345 | Ga0105248_10035583 | |||
| 1346 | Ga0105248_10309338 | |||
| 1347 | Ga0105248_10333883 | |||
| 1348 | Ga0105237_10049900 | |||
| 1349 | Ga0105237_10058035 | |||
| 1350 | Ga0105237_10258721 | |||
| 1351 | Ga0105237_10334053 | |||
| 1352 | Ga0105237_10365371 | |||
| 1353 | Ga0105237_10543417 | |||
| 1354 | Ga0105237_10596661 | |||
| 1355 | Ga0105237_11047160 | |||
| 1356 | Ga0105237_11135093 | |||
| 1357 | Ga0105237_11507023 | |||
| 1358 | Ga0105237_11895213 | |||
| 1359 | Ga0105237_12599440 | |||
| 1360 | Ga0105238_10000064 | |||
| 1361 | Ga0105238_10029631 | |||
| 1362 | Ga0105238_10102411 | |||
| 1363 | Ga0105238_10372482 | |||
| 1364 | Ga0105238_10405307 | |||
| 1365 | Ga0105238_10712117 | |||
| 1366 | Ga0105238_12199816 | |||
| 1367 | Ga0105249_10010752 | |||
| 1368 | Ga0105249_10138087 | |||
| 1369 | Ga0105249_10480618 | |||
| 1370 | Ga0105249_12080113 | |||
| 1371 | Ga0099796_10426806 | |||
| 1372 | Ga0099796_10563963 | |||
| 1373 | Ga0105239_10027920 | |||
| 1374 | Ga0105239_10077907 | |||
| 1375 | Ga0105239_10155923 | |||
| 1376 | Ga0105239_10228131 | |||
| 1377 | Ga0105239_10466707 | |||
| 1378 | Ga0105239_11278799 | |||
| 1379 | Ga0105239_12437921 | |||
| 1380 | Ga0105246_10191097 | |||
| 1381 | Ga0105246_10232936 | |||
| 1382 | Ga0105246_10743852 | |||
| 1383 | Ga0157373_10009390 | |||
| 1384 | Ga0157373_10092244 | |||
| 1385 | Ga0157373_10207408 | |||
| 1386 | Ga0157373_10233970 | |||
| 1387 | Ga0157373_10283949 | |||
| 1388 | Ga0157373_10332904 | |||
| 1389 | Ga0157373_10527078 | |||
| 1390 | Ga0157373_11582943 | |||
| 1391 | Ga0157371_10009629 | |||
| 1392 | Ga0157371_10090948 | |||
| 1393 | Ga0157371_10298053 | |||
| 1394 | Ga0157370_10090313 | |||
| 1395 | Ga0157370_10159142 | |||
| 1396 | Ga0157370_10359581 | |||
| 1397 | Ga0157370_10616772 | |||
| 1398 | Ga0157370_10829662 | |||
| 1399 | Ga0157370_11070760 | |||
| 1400 | Ga0157369_10000506 | |||
| 1401 | Ga0157369_10010162 | |||
| 1402 | Ga0157369_10035511 | |||
| 1403 | Ga0157369_10067761 | |||
| 1404 | Ga0157369_10085630 | |||
| 1405 | Ga0157369_10326618 | |||
| 1406 | Ga0157369_10725761 | |||
| 1407 | Ga0157374_10000140 | |||
| 1408 | Ga0157374_10000142 | |||
| 1409 | Ga0157374_10007649 | |||
| 1410 | Ga0157374_10026203 | |||
| 1411 | Ga0157374_10026373 | |||
| 1412 | Ga0157374_10062360 | |||
| 1413 | Ga0157374_10116750 | |||
| 1414 | Ga0157374_10121018 | |||
| 1415 | Ga0157378_10000135 | |||
| 1416 | Ga0157378_10003940 | |||
| 1417 | Ga0157378_10004347 | |||
| 1418 | Ga0157378_10016335 | |||
| 1419 | Ga0157378_10043483 | |||
| 1420 | Ga0157378_10061121 | |||
| 1421 | Ga0157378_10063087 | |||
| 1422 | Ga0157378_10392030 | |||
| 1423 | Ga0163162_10003913 | |||
| 1424 | Ga0163162_10070206 | |||
| 1425 | Ga0163162_10076256 | |||
| 1426 | Ga0163162_10288068 | |||
| 1427 | Ga0163162_10564314 | |||
| 1428 | Ga0157372_10000516 | |||
| 1429 | Ga0157372_10001178 | |||
| 1430 | Ga0157372_10001443 | |||
| 1431 | Ga0157372_10001921 | |||
| 1432 | Ga0157372_10013898 | |||
| 1433 | Ga0157372_10025104 | |||
| 1434 | Ga0157372_10072284 | |||
| 1435 | Ga0157372_10104094 | |||
| 1436 | Ga0157372_10175689 | |||
| 1437 | Ga0157372_10358100 | |||
| 1438 | Ga0157372_10457759 | |||
| 1439 | Ga0157372_11331521 | |||
| 1440 | Ga0157372_12566799 | |||
| 1441 | Ga0157372_13411276 | |||
| 1442 | Ga0157375_10038435 | |||
| 1443 | Ga0157375_12126062 | |||
| 1444 | Ga0163163_10067503 | |||
| 1445 | Ga0163163_10184762 | |||
| 1446 | Ga0163163_10316519 | |||
| 1447 | Ga0163163_10512864 | |||
| 1448 | Ga0163163_10812179 | |||
| 1449 | Ga0163163_12838973 | |||
| 1450 | Ga0157380_11846809 | |||
| 1451 | Ga0182008_10004763 | |||
| 1452 | Ga0157377_11649348 | |||
| 1453 | Ga0157379_10003068 | |||
| 1454 | Ga0157379_10012561 | |||
| 1455 | Ga0157379_10225424 | |||
| 1456 | Ga0157379_10636997 | |||
| 1457 | Ga0157376_10015466 | |||
| 1458 | Ga0157376_10023577 | |||
| 1459 | Ga0157376_10026825 | |||
| 1460 | Ga0157376_10054603 | |||
| 1461 | Ga0182006_1021602 | |||
| 1462 | Ga0182007_10013047 | |||
| 1463 | Ga0182005_1083525 | |||
| 1464 | Ga0213874_10248948 | |||
| 1465 | Ga0213875_10070567 | |||
| 1466 | Ga0224572_1002702 | |||
| 1467 | Ga0228598_1095940 | |||
| 1468 | Ga0207656_10014893 | |||
| 1469 | Ga0207656_10365023 | |||
| 1470 | Ga0207653_10210622 | |||
| 1471 | Ga0207692_10026553 | |||
| 1472 | Ga0207692_10081551 | |||
| 1473 | Ga0207692_10126587 | |||
| 1474 | Ga0207692_10234029 | |||
| 1475 | Ga0207642_10040486 | |||
| 1476 | Ga0207642_10063498 | |||
| 1477 | Ga0207710_10107926 | |||
| 1478 | Ga0207710_10136859 | |||
| 1479 | Ga0207710_10653220 | |||
| 1480 | Ga0207688_10339579 | |||
| 1481 | Ga0207680_10045799 | |||
| 1482 | Ga0207680_11171619 | |||
| 1483 | Ga0207647_10043651 | |||
| 1484 | Ga0207647_10162970 | |||
| 1485 | Ga0207685_10014585 | |||
| 1486 | Ga0207685_10018512 | |||
| 1487 | Ga0207685_10677056 | |||
| 1488 | Ga0207699_10003179 | |||
| 1489 | Ga0207699_10023765 | |||
| 1490 | Ga0207699_10063009 | |||
| 1491 | Ga0207699_10074645 | |||
| 1492 | Ga0207699_10103159 | |||
| 1493 | Ga0207699_10277692 | |||
| 1494 | Ga0207699_10296370 | |||
| 1495 | Ga0207699_10308697 | |||
| 1496 | Ga0207699_10425226 | |||
| 1497 | Ga0207699_10660533 | |||
| 1498 | Ga0207699_11376067 | |||
| 1499 | Ga0207645_10004401 | |||
| 1500 | Ga0207684_10317627 | |||
| 1501 | Ga0207684_10387670 | |||
| 1502 | Ga0207684_10806829 | |||
| 1503 | Ga0207654_10011224 | |||
| 1504 | Ga0207654_10022231 | |||
| 1505 | Ga0207654_10064282 | |||
| 1506 | Ga0207654_10067830 | |||
| 1507 | Ga0207654_10387456 | |||
| 1508 | Ga0207654_10663797 | |||
| 1509 | Ga0207707_10003767 | |||
| 1510 | Ga0207707_10125676 | |||
| 1511 | Ga0207707_10209066 | |||
| 1512 | Ga0207695_10005740 | |||
| 1513 | Ga0207695_10045944 | |||
| 1514 | Ga0207695_10080073 | |||
| 1515 | Ga0207695_10143376 | |||
| 1516 | Ga0207695_10213209 | |||
| 1517 | Ga0207695_10233404 | |||
| 1518 | Ga0207695_10610852 | |||
| 1519 | Ga0207695_11383745 | |||
| 1520 | Ga0207695_11446792 | |||
| 1521 | Ga0207671_10290971 | |||
| 1522 | Ga0207671_10469577 | |||
| 1523 | Ga0207671_10644725 | |||
| 1524 | Ga0207671_10844690 | |||
| 1525 | Ga0207671_11067023 | |||
| 1526 | Ga0207671_11288485 | |||
| 1527 | Ga0207693_10000080 | |||
| 1528 | Ga0207693_10000173 | |||
| 1529 | Ga0207693_10005546 | |||
| 1530 | Ga0207693_10010314 | |||
| 1531 | Ga0207693_10024452 | |||
| 1532 | Ga0207693_10050011 | |||
| 1533 | Ga0207693_10054090 | |||
| 1534 | Ga0207693_10094388 | |||
| 1535 | Ga0207693_10375256 | |||
| 1536 | Ga0207693_11401083 | |||
| 1537 | Ga0207663_10006520 | |||
| 1538 | Ga0207663_10015151 | |||
| 1539 | Ga0207663_10058477 | |||
| 1540 | Ga0207663_10107543 | |||
| 1541 | Ga0207663_10171249 | |||
| 1542 | Ga0207663_10171430 | |||
| 1543 | Ga0207663_10850345 | |||
| 1544 | Ga0207663_11013072 | |||
| 1545 | Ga0207663_11281179 | |||
| 1546 | Ga0207660_10051503 | |||
| 1547 | Ga0207660_10059699 | |||
| 1548 | Ga0207660_10118592 | |||
| 1549 | Ga0207660_10287700 | |||
| 1550 | Ga0207657_10000215 | |||
| 1551 | Ga0207657_10212296 | |||
| 1552 | Ga0207649_10228982 | |||
| 1553 | Ga0207652_10022145 | |||
| 1554 | Ga0207652_10214386 | |||
| 1555 | Ga0207652_10351898 | |||
| 1556 | Ga0207652_10629610 | |||
| 1557 | Ga0207646_10000165 | |||
| 1558 | Ga0207646_10233637 | |||
| 1559 | Ga0207646_10465268 | |||
| 1560 | Ga0207646_10594871 | |||
| 1561 | Ga0207646_11001005 | |||
| 1562 | Ga0207646_11080195 | |||
| 1563 | Ga0207646_11771721 | |||
| 1564 | Ga0207681_10089709 | |||
| 1565 | Ga0207694_10000835 | |||
| 1566 | Ga0207694_10007028 | |||
| 1567 | Ga0207694_10158574 | |||
| 1568 | Ga0207694_10414697 | |||
| 1569 | Ga0207694_10832144 | |||
| 1570 | Ga0207650_10001281 | |||
| 1571 | Ga0207650_10053376 | |||
| 1572 | Ga0207659_10085626 | |||
| 1573 | Ga0207659_10697875 | |||
| 1574 | Ga0207687_10005132 | |||
| 1575 | Ga0207687_10027572 | |||
| 1576 | Ga0207700_10000364 | |||
| 1577 | Ga0207700_10021287 | |||
| 1578 | Ga0207700_10038051 | |||
| 1579 | Ga0207700_10059887 | |||
| 1580 | Ga0207700_10120883 | |||
| 1581 | Ga0207700_10130716 | |||
| 1582 | Ga0207700_10254186 | |||
| 1583 | Ga0207700_10308298 | |||
| 1584 | Ga0207700_10359334 | |||
| 1585 | Ga0207700_10441610 | |||
| 1586 | Ga0207700_10455204 | |||
| 1587 | Ga0207700_10603111 | |||
| 1588 | Ga0207700_10967057 | |||
| 1589 | Ga0207700_11465336 | |||
| 1590 | Ga0207700_11579496 | |||
| 1591 | Ga0207700_11725462 | |||
| 1592 | Ga0207664_10004399 | |||
| 1593 | Ga0207664_10021424 | |||
| 1594 | Ga0207664_10030515 | |||
| 1595 | Ga0207664_10052162 | |||
| 1596 | Ga0207664_10087681 | |||
| 1597 | Ga0207664_10141447 | |||
| 1598 | Ga0207664_10269082 | |||
| 1599 | Ga0207664_10316631 | |||
| 1600 | Ga0207664_10602232 | |||
| 1601 | Ga0207664_10696057 | |||
| 1602 | Ga0207664_10755063 | |||
| 1603 | Ga0207664_11684296 | |||
| 1604 | Ga0207690_10147586 | |||
| 1605 | Ga0207690_10238690 | |||
| 1606 | Ga0207706_10002361 | |||
| 1607 | Ga0207686_10901209 | |||
| 1608 | Ga0207686_11551085 | |||
| 1609 | Ga0207686_11558449 | |||
| 1610 | Ga0207709_10552504 | |||
| 1611 | Ga0207669_11099925 | |||
| 1612 | Ga0207704_10003968 | |||
| 1613 | Ga0207704_11944426 | |||
| 1614 | Ga0207665_10010667 | |||
| 1615 | Ga0207665_10011380 | |||
| 1616 | Ga0207665_10014315 | |||
| 1617 | Ga0207665_10079496 | |||
| 1618 | Ga0207665_10116510 | |||
| 1619 | Ga0207665_10238114 | |||
| 1620 | Ga0207665_10593395 | |||
| 1621 | Ga0207665_10646267 | |||
| 1622 | Ga0207665_10871959 | |||
| 1623 | Ga0207665_11098887 | |||
| 1624 | Ga0207665_11281667 | |||
| 1625 | Ga0207691_10270220 | |||
| 1626 | Ga0207711_10002367 | |||
| 1627 | Ga0207711_10264459 | |||
| 1628 | Ga0207711_10568153 | |||
| 1629 | Ga0207689_10574775 | |||
| 1630 | Ga0207689_11557082 | |||
| 1631 | Ga0207661_10011078 | |||
| 1632 | Ga0207661_10058574 | |||
| 1633 | Ga0207661_10235904 | |||
| 1634 | Ga0207679_10001041 | |||
| 1635 | Ga0207679_10166084 | |||
| 1636 | Ga0207667_10000421 | |||
| 1637 | Ga0207667_10002272 | |||
| 1638 | Ga0207667_10034607 | |||
| 1639 | Ga0207667_10195648 | |||
| 1640 | Ga0207667_11291084 | |||
| 1641 | Ga0207651_10065239 | |||
| 1642 | Ga0207712_10036259 | |||
| 1643 | Ga0207640_10003915 | |||
| 1644 | Ga0207640_10012996 | |||
| 1645 | Ga0207640_10047353 | |||
| 1646 | Ga0207640_10693703 | |||
| 1647 | Ga0207658_10946705 | |||
| 1648 | Ga0207658_11528447 | |||
| 1649 | Ga0207658_11587336 | |||
| 1650 | Ga0207677_10002537 | |||
| 1651 | Ga0207677_10008028 | |||
| 1652 | Ga0207677_10654452 | |||
| 1653 | Ga0207677_12073443 | |||
| 1654 | Ga0207703_10002538 | |||
| 1655 | Ga0207703_10160661 | |||
| 1656 | Ga0207703_10314679 | |||
| 1657 | Ga0207703_10915344 | |||
| 1658 | Ga0207703_11612221 | |||
| 1659 | Ga0207703_11839417 | |||
| 1660 | Ga0207639_10095933 | |||
| 1661 | Ga0207639_10178381 | |||
| 1662 | Ga0207639_10285694 | |||
| 1663 | Ga0207639_10728045 | |||
| 1664 | Ga0207678_10000874 | |||
| 1665 | Ga0207708_11379634 | |||
| 1666 | Ga0207702_10000219 | |||
| 1667 | Ga0207702_10009031 | |||
| 1668 | Ga0207702_10021806 | |||
| 1669 | Ga0207702_10022048 | |||
| 1670 | Ga0207702_10029476 | |||
| 1671 | Ga0207702_10185748 | |||
| 1672 | Ga0207702_10381854 | |||
| 1673 | Ga0207702_10491841 | |||
| 1674 | Ga0207702_12240628 | |||
| 1675 | Ga0207641_10033410 | |||
| 1676 | Ga0207641_10184261 | |||
| 1677 | Ga0207641_10214578 | |||
| 1678 | Ga0207641_10451159 | |||
| 1679 | Ga0207648_10004716 | |||
| 1680 | Ga0207648_10013735 | |||
| 1681 | Ga0207648_10458942 | |||
| 1682 | Ga0207676_10003507 | |||
| 1683 | Ga0207676_10078264 | |||
| 1684 | Ga0207676_10706310 | |||
| 1685 | Ga0207676_10945023 | |||
| 1686 | Ga0207674_10000190 | |||
| 1687 | Ga0207674_10015313 | |||
| 1688 | Ga0207674_10037539 | |||
| 1689 | Ga0207674_10315400 | |||
| 1690 | Ga0207674_10714909 | |||
| 1691 | Ga0207674_11506171 | |||
| 1692 | Ga0207675_100264085 | |||
| 1693 | Ga0207675_100308583 | |||
| 1694 | Ga0207683_10046033 | |||
| 1695 | Ga0207683_10652873 | |||
| 1696 | Ga0207698_10004440 | |||
| 1697 | Ga0207698_11290100 | |||
| 1698 | Ga0207698_11553488 | |||
| 1699 | Ga0207428_10208608 | |||
| 1700 | Ga0265354_1001563 | |||
| 1701 | Ga0265354_1016478 | |||
| 1702 | Ga0265356_1014986 | |||
| 1703 | Ga0268266_10008393 | |||
| 1704 | Ga0268265_10056372 | |||
| 1705 | Ga0268265_10501906 | |||
| 1706 | Ga0268264_10009779 | |||
| 1707 | Ga0268264_10497306 | |||
| 1708 | Ga0268264_10764901 | |||
| 1709 | Ga0268264_10807567 | |||
| 1710 | Ga0268264_11363388 | |||
| 1711 | Ga0268264_11656541 | |||
| 1712 | Ga0265338_10018837 | |||
| 1713 | Ga0265338_10415312 | |||
| 1714 | Ga0265324_10093456 | |||
| 1715 | Ga0265762_1008767 | |||
| 1716 | Ga0265770_1000702 | |||
| 1717 | Ga0265770_1014935 | |||
| 1718 | Ga0265765_1059372 | |||
| 1719 | Ga0265760_10023867 | |||
| 1720 | Ga0265760_10026149 | |||
| 1721 | Ga0265330_10016525 | |||
| 1722 | Ga0265328_10177734 | |||
| 1723 | Ga0265325_10186341 | |||
| 1724 | Ga0265329_10088738 | |||
| 1725 | Ga0265340_10087205 | |||
| 1726 | Ga0265340_10171376 | |||
| 1727 | Ga0265340_10298804 | |||
| 1728 | Ga0265339_10018569 | |||
| 1729 | Ga0265339_10019951 | |||
| 1730 | Ga0265316_10003557 | |||
| 1731 | Ga0265316_10184896 | |||
| 1732 | Ga0265314_10000198 | |||
| 1733 | Ga0265314_10013916 | |||
| 1734 | Ga0265314_10113677 | |||
| 1735 | Ga0373930_0014086 | |||
| 1736 | Ga0373958_0085639 | |||
| 1737 | Ga0373926_0000501 | |||
| 1738 | Ga0373928_0137483 | |||
| 1739 | Ga0373929_0061106 | |||
| 1740 | Ga0373929_0086965 | |||
| 1741 | Ga0373940_0140647 | |||
| 1742 | Ga0373952_0030277 | |||
| 1743 | Ga0373923_0028307 | |||
| 1744 | Ga0373932_0020641 | |||
| 1745 | Ga0373932_0053553 | |||
| 1746 | Ga0373936_0053789 | |||
| 1747 | Ga0373936_0088441 | |||
| 1748 | Ga0373939_0154780 | |||
| 1749 | Ga0373941_0336841 | |||
| 1750 | Ga0373945_0032618 | |||
| 1751 | Ga0373945_0589084 | |||
| 1752 | Ga0373960_0041318 | |||
| 1753 | Ga0373960_0057269 | |||
| 1754 | Ga0373943_0055135 | |||
| 1755 | Ga0373943_0130504 | |||
| 1756 | Ga0373943_0208818 | |||
| 1757 | Ga0373943_0672014 | |||
| 1758 | Ga0373942_0036873 | |||
| 1759 | Ga0373942_0162962 | |||
| 1760 | Ga0373931_0033225 | |||
| 1761 | Ga0373931_0081486 | |||
| 1762 | Ga0373931_0114270 | |||
| 1763 | Ga0373931_0115285 | |||
| 1764 | Ga0373931_0142160 | |||
| 1765 | Ga0373931_0169238 | |||
| 1766 | Ga0373931_0211924 | |||
| 1767 | Ga0373935_0005508 | |||
| 1768 | Ga0373935_0200945 | |||
| 1769 | Ga0373935_0207054 | |||
| 1770 | Ga0373935_0806118 | |||
| 1771 | Ga0373927_0010674 | |||
| 1772 | Ga0373927_0025477 | |||
| 1773 | Ga0373927_0057773 | |||
| 1774 | Ga0373927_0094843 | |||
| 1775 | Ga0373927_0250252 | |||
| 1776 | Ga0373933_0038561 | |||
| 1777 | Ga0373933_1156514 | |||
| 1778 | Ga0373947_0002625 | |||
| 1779 | Ga0373947_0438649 | |||
| 1780 | Ga0373947_0459143 | |||
| 1781 | Ga0373937_0324632 | |||
| 1782 | Ga0373937_0399278 | |||
| 1783 | Ga0373937_0680256 | |||
| 1784 | Ga0373937_0944314 | |||
| 1785 | Ga0373937_1030230 | |||
| 1786 | Ga0373937_1128343 | |||
| 1787 | Ga0373925_0003990 | |||
| 1788 | Ga0373925_0037892 | |||
| 1789 | Ga0373925_0039044 | |||
| 1790 | Ga0373925_0087346 | |||
| 1791 | Ga0373925_0260517 | |||
| 1792 | Ga0373925_0345481 | |||
| 1793 | Ga0373925_1322675 | |||
| 1794 | Ga0395900_1139148 | |||
| 1795 | Ga0436364_0446884 | |||
| 1796 | Ga0436364_1057791 | |||
| 1797 | Ga0395901_0210588 | |||
| 1798 | Ga0436365_0750651 | |||
| 1799 | Ga0436365_1544655 | |||
| 1800 | Ga0436365_1710842 | |||
| 1801 | Ga0436361_0604920 | |||
| 1802 | Ga0436363_0097650 | |||
| 1803 | Ga0436363_1113891 | |||
| 1804 | Ga0436363_1282358 | |||
| 1805 | Ga0436363_1442918 | |||
| 1806 | Ga0436362_1215023 | |||
| 1807 | Ga0451577_0033862 | |||
| 1808 | Ga0451577_0144566 | |||
| 1809 | Ga0453683_0008301 | |||
| 1810 | Ga0453683_0025320 | |||
| 1811 | Ga0453683_0164664 | |||
| 1812 | Ga0466963_0093803 | |||
| 1813 | Ga0466963_0901932 | |||
| 1814 | Ga0466964_0062408 | |||
| 1815 | Ga0466964_0719390 | |||
| 1816 | Ga0453684_0008254 | |||
| 1817 | Ga0453684_0118899 | |||
| 1818 | Ga0466971_0031072 | |||
| 1819 | Ga0466968_0318708 | |||
| 1820 | Ga0466957_0220959 | |||
| 1821 | Ga0466959_0147994 | |||
| 1822 | Ga0466959_0547691 | |||
| 1823 | Ga0451576_0028688 | |||
| 1824 | Ga0451576_0176996 | |||
| 1825 | Ga0451576_0582113 | |||
| 1826 | Ga0451576_0605415 | |||
| 1827 | Ga0466958_0127737 | |||
| 1828 | Ga0466958_0178492 | |||
| 1829 | Ga0466958_0632017 | |||
| 1830 | Ga0466967_0010975 | |||
| 1831 | Ga0466967_0409569 | |||
| 1832 | Ga0466967_0505766 | |||
| 1833 | Ga0466967_1415316 | |||
| 1834 | Ga0495592_0920997 | |||
| 1835 | Ga0495580_0001362 | |||
| 1836 | Ga0495580_0002000 | |||
| 1837 | Ga0495580_0004144 | |||
| 1838 | Ga0495580_0004450 | |||
| 1839 | Ga0495580_0048785 | |||
| 1840 | Ga0495580_0049837 | |||
| 1841 | Ga0495580_0057500 | |||
| 1842 | Ga0495580_0082739 | |||
| 1843 | Ga0495580_0097614 | |||
| 1844 | Ga0495580_0551582 | |||
| 1845 | Ga0495580_0661659 | |||
| 1846 | Ga0495582_0000442 | |||
| 1847 | Ga0495582_0194132 | |||
| 1848 | Ga0495582_0372507 | |||
| 1849 | Ga0495664_0592134 | |||
| 1850 | Ga0495630_0074729 | |||
| 1851 | Ga0495630_0352971 | |||
| 1852 | Ga0495630_0508223 | |||
| 1853 | Ga0495630_0844955 | |||
| 1854 | Ga0495666_0106417 | |||
| 1855 | Ga0495666_0418944 | |||
| 1856 | Ga0495665_0001834 | |||
| 1857 | Ga0495665_0021353 | |||
| 1858 | Ga0495587_0073742 | |||
| 1859 | Ga0495622_0417321 | |||
| 1860 | Ga0495634_0695181 | |||
| 1861 | Ga0495623_0067164 | |||
| 1862 | Ga0495623_0420641 | |||
| 1863 | Ga0495623_0499121 | |||
| 1864 | Ga0495624_0079273 | |||
| 1865 | Ga0495624_0406138 | |||
| 1866 | Ga0495624_0759689 | |||
| 1867 | Ga0495581_0010039 | |||
| 1868 | Ga0495604_0582206 | |||
| 1869 | Ga0495674_0083043 | |||
| 1870 | Ga0495674_0555651 | |||
| 1871 | Ga0495674_1226403 | |||
| 1872 | Ga0495676_0376697 | |||
| 1873 | Ga0495675_0341546 | |||
| 1874 | Ga0495593_0357067 | |||
| 1875 | Ga0495602_0283361 | |||
| 1876 | Ga0495602_0302428 | |||
| 1877 | Ga0495602_0315696 | |||
| 1878 | Ga0495602_0324986 | |||
| 1879 | Ga0495602_0792054 | |||
| 1880 | Ga0495602_1108045 | |||
| 1881 | Ga0496100_0027206 | |||
| 1882 | Ga0496100_0140408 | |||
| 1883 | Ga0496101_0002158 | |||
| 1884 | Ga0496101_0182831 | |||
| 1885 | Ga0496101_0544469 | |||
| 1886 | Ga0496101_0737829 | |||
| 1887 | Ga0496102_0036185 | |||
| 1888 | Ga0496102_0050905 | |||
| 1889 | Ga0496102_0059439 | |||
| 1890 | Ga0496102_0095153 | |||
| 1891 | Ga0496102_0181158 | |||
| 1892 | Ga0496102_0695720 | |||
| 1893 | Ga0496103_0009501 | |||
| 1894 | Ga0496103_0127005 | |||
| 1895 | Ga0496103_0299507 | |||
| 1896 | Ga0496104_0030432 | |||
| 1897 | Ga0496104_0060216 | |||
| 1898 | Ga0496104_0061805 | |||
| 1899 | Ga0496104_0174222 | |||
| 1900 | Ga0496104_1519037 | |||
| 1901 | Ga0496105_0071678 | |||
| 1902 | Ga0496105_0160353 | |||
| 1903 | Ga0496105_0246944 | |||
| 1904 | Ga0496105_0685686 | |||
| 1905 | Ga0496105_1047836 | |||
| 1906 | Ga0496106_0025440 | |||
| 1907 | Ga0496106_0071315 | |||
| 1908 | Ga0496106_0086888 | |||
| 1909 | Ga0496107_0135205 | |||
| 1910 | Ga0496107_0167848 | |||
| 1911 | Ga0496107_0208689 | |||
| 1912 | Ga0496107_1144511 | |||
| 1913 | Ga0496108_0227371 | |||
| 1914 | Ga0496108_0655864 | |||
| 1915 | Ga0496108_1057295 | |||
| 1916 | Ga0496108_1556438 | |||
| 1917 | Ga0496109_0107079 | |||
| 1918 | Ga0496109_0219233 | |||
| 1919 | Ga0496109_0505355 | |||
| 1920 | Ga0496109_0662199 | |||
| 1921 | Ga0496110_0467021 | |||
| 1922 | Ga0496110_0676463 | |||
| 1923 | Ga0496112_0005343 | |||
| 1924 | Ga0496112_0005971 | |||
| 1925 | Ga0496112_0033148 | |||
| 1926 | Ga0496112_0050298 | |||
| 1927 | Ga0496112_0139450 | |||
| 1928 | Ga0496112_0690632 | |||
| 1929 | Ga0496112_1048301 | |||
| 1930 | Ga0496112_1161867 | |||
| 1931 | Ga0496112_1331426 | |||
| 1932 | Ga0496113_0224408 | |||
| 1933 | Ga0496113_0358419 | |||
| 1934 | Ga0496113_0655565 | |||
| 1935 | Ga0496114_0025952 | |||
| 1936 | Ga0496115_0007193 | |||
| 1937 | Ga0501067_0286487 | |||
| 1938 | nmdc:mga05p37_347512_c2 | |||
| 1939 | nmdc:mga06r32_19912_c1 | |||
| 1940 | nmdc:mga08y16_216368_c1 | |||
| 1941 | nmdc:mga0n895_168541_c1 | |||
| 1942 | nmdc:mga0n895_6632_c1 | |||
| 1943 | nmdc:mga0rr50_1064007_c1 | |||
| 1944 | nmdc:mga0rr50_1742336_c1 | |||
| 1945 | nmdc:mga0rr50_318221_c1 | |||
| 1946 | nmdc:mga0rr50_4024_c1 | |||
| 1947 | nmdc:mga0rr50_772475_c1 | |||
| 1948 | nmdc:mga0rr50_7995_c1 | |||
| 1949 | nmdc:mga08x19_122822_c1 | |||
| 1950 | nmdc:mga08x19_1403_c1 | |||
| 1951 | nmdc:mga08x19_3215_c1 | |||
| 1952 | nmdc:mga08x19_402984_c1 | |||
| 1953 | nmdc:mga0a205_1274666_c1 | |||
| 1954 | Ga0495612_0099695 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5h9g-assembly2.cif.gz_B | apo-acp from helicobacter pylori | 0.9367 | 4 | 79 |
| 6lvu-assembly2.cif.gz_B | crystal structure of apo acyl carrier protein from thermotoga maritima | 0.9303 | 3 | 80 |
| 7e1r-assembly2.cif.gz_D | crystal structure of dehydrogenase/isomerase fabx from helicobacter pylori in complex with holo-acp | 0.9253 | 9 | 79 |
| 5h9h-assembly3.cif.gz_C | holo acyl carrier protein (holo-acp) from helicobacter pylori | 0.9251 | 7 | 79 |
| 8jfn-assembly1.cif.gz_B | crystal structure of enoyl-acp reductase fabi in complex with nad+ and crotonyl-acp from helicobacter pylori | 0.9224 | 7 | 78 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q7KWJ1_42_137_1.10.1200.10 | Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like | 0.9092 | 4 | 78 | 1.10.1200.10 |
| 3gzmB00 | Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like | 0.8958 | 4 | 79 | 1.10.1200.10 |
| 2cgqA00 | Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like | 0.8934 | 7 | 78 | 1.10.1200.10 |
| 3gzmA00 | Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like | 0.8917 | 3 | 80 | 1.10.1200.10 |
| 1f80E00 | Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like | 0.8917 | 6 | 77 | 1.10.1200.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M1ZS15-F1-model_v4 | Acyl carrier protein | 0.9886 | 5 | 80 |
GO:0000035
GO:0000036 GO:0005829 GO:0009245 GO:0016020 |
| AF-A0A832E5A4-F1-model_v4 | deleted | 0.9794 | 5 | 80 |
|
| AF-A0A7Y2CKI1-F1-model_v4 | Acyl carrier protein | 0.9714 | 1 | 80 |
|
| AF-A0A2V9DGM8-F1-model_v4 | Carrier domain-containing protein | 0.9693 | 1 | 80 |
GO:0000035
GO:0000036 GO:0005829 GO:0009245 GO:0016020 |
| AF-A0A3M1ZS15-F1-model_v4 | Acyl carrier protein | 0.9636 | 5 | 80 |
GO:0000035
GO:0000036 GO:0005829 GO:0009245 GO:0016020 |