F487282

General Info

Members Datasets Scaffolds Average Seq Length
977 295 1954 80

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_1098436|Ga0395900_1098436_204_464
Length 86
Sequence MKRNGSVPTEKRTLDEILDLAAIQFKVPREKLSPDDDFFKTLRIDSLQALSLLTRLEQHFNVELPDYELQGVSDFRTLADRIQARL

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
126 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
127 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
128 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
129 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
130 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
131 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
132 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
193 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
194 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
199 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
200 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
205 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
206 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
207 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
208 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
209 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
210 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
211 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
212 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
213 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
214 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
215 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
216 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
217 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
218 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
219 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
221 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
223 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
224 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
225 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
226 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
227 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
228 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
229 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
232 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
236 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
237 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
238 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
239 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
240 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
241 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
242 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
243 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
244 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
245 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
246 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
247 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
248 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
249 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
250 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
251 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
252 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
253 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
254 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
255 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
256 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
259 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
260 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
261 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
262 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
263 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
264 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
265 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
266 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
267 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
268 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
269 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
270 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
271 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
272 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
276 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
277 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
278 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
279 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
280 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
283 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
284 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
285 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
286 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
287 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
288 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
289 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
290 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
291 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
292 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
293 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
294 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
295 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.73
Rhizosphere 93.14
Stem 0
Stem Tuber 0
Unclassified 34.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_1098436 3300037418 Bacteria 713
2 Ga0065712_10120769 3300005290 Bacteria 1674
3 Ga0065712_10770360 3300005290 Unclassified 522
4 Ga0065715_10717049 3300005293 Unclassified 645
5 Ga0065707_10364680 3300005295 Bacteria 899
6 Ga0070676_10002367 3300005328 Bacteria 9655
7 Ga0070683_100116342 3300005329 Bacteria 2524
8 Ga0070683_100521406 3300005329 Unclassified 1136
9 Ga0070690_100604834 3300005330 Unclassified 833
10 Ga0070670_100011355 3300005331 Bacteria 7613
11 Ga0068869_100083221 3300005334 Bacteria 2393
12 Ga0068869_101451373 3300005334 Unclassified 608
13 Ga0068869_101498839 3300005334 Bacteria 599
14 Ga0070666_10064179 3300005335 Bacteria 2490
15 Ga0070680_100071375 3300005336 Bacteria 2853
16 Ga0070680_100129333 3300005336 Bacteria 2111
17 Ga0070680_100280675 3300005336 Bacteria 1411
18 Ga0070682_100024949 3300005337 Unclassified 3564
19 Ga0068868_100001273 3300005338 Bacteria 17368
20 Ga0068868_100012002 3300005338 Bacteria 6323
21 Ga0068868_100157662 3300005338 Bacteria 1873
22 Ga0068868_100895602 3300005338 Unclassified 806
23 Ga0068868_101584242 3300005338 Unclassified 615
24 Ga0070660_100125313 3300005339 Bacteria 2052
25 Ga0070660_100277780 3300005339 Unclassified 1370
26 Ga0070660_101706163 3300005339 Unclassified 536
27 Ga0070689_100079619 3300005340 Bacteria 2570
28 Ga0070691_10254511 3300005341 Bacteria 943
29 Ga0070661_100167071 3300005344 Bacteria 1669
30 Ga0070661_100584755 3300005344 Bacteria 901
31 Ga0070692_10418498 3300005345 Unclassified 850
32 Ga0070692_10596174 3300005345 Bacteria 730
33 Ga0070668_100021068 3300005347 Unclassified 4926
34 Ga0070669_100114684 3300005353 Bacteria 2049
35 Ga0070675_100591016 3300005354 Unclassified 1006
36 Ga0070671_101212451 3300005355 Bacteria 664
37 Ga0070674_100302941 3300005356 Unclassified 1275
38 Ga0070673_100182094 3300005364 Bacteria 1799
39 Ga0070673_101816789 3300005364 Unclassified 577
40 Ga0070688_100279213 3300005365 Bacteria 1199
41 Ga0070659_100009578 3300005366 Bacteria 7119
42 Ga0070659_100253752 3300005366 Bacteria 1458
43 Ga0070667_100273641 3300005367 Bacteria 1515
44 Ga0070667_100386855 3300005367 Bacteria 1271
45 Ga0070703_10252975 3300005406 Unclassified 715
46 Ga0070709_10000974 3300005434 Bacteria 15878
47 Ga0070709_10016355 3300005434 Unclassified 4232
48 Ga0070709_10081981 3300005434 Bacteria 2107
49 Ga0070709_10094647 3300005434 Unclassified 1977
50 Ga0070709_10142647 3300005434 Bacteria 1647
51 Ga0070709_10339576 3300005434 Unclassified 1107
52 Ga0070709_10382894 3300005434 Bacteria 1046
53 Ga0070709_10460908 3300005434 Unclassified 959
54 Ga0070709_11134546 3300005434 Unclassified 626
55 Ga0070709_11255929 3300005434 Unclassified 596
56 Ga0070714_100026803 3300005435 Bacteria 4765
57 Ga0070714_100048541 3300005435 Bacteria 3611
58 Ga0070714_100051479 3300005435 Unclassified 3511
59 Ga0070714_100163160 3300005435 Bacteria 2017
60 Ga0070714_100164098 3300005435 Bacteria 2012
61 Ga0070714_100380501 3300005435 Unclassified 1331
62 Ga0070714_100670545 3300005435 Bacteria 999
63 Ga0070714_100943388 3300005435 Unclassified 838
64 Ga0070714_100961971 3300005435 Bacteria 830
65 Ga0070714_101078121 3300005435 Bacteria 783
66 Ga0070714_102068822 3300005435 Unclassified 555
67 Ga0070713_100000034 3300005436 Bacteria 86671
68 Ga0070713_100041044 3300005436 Bacteria 3767
69 Ga0070713_100049038 3300005436 Bacteria 3481
70 Ga0070713_100078119 3300005436 Bacteria 2816
71 Ga0070713_100079639 3300005436 Unclassified 2791
72 Ga0070713_100100991 3300005436 Unclassified 2498
73 Ga0070713_100274660 3300005436 Bacteria 1544
74 Ga0070713_100302295 3300005436 Bacteria 1473
75 Ga0070713_100313998 3300005436 Bacteria 1446
76 Ga0070713_100392593 3300005436 Bacteria 1294
77 Ga0070713_100467966 3300005436 Bacteria 1186
78 Ga0070713_100728612 3300005436 Unclassified 948
79 Ga0070713_100939664 3300005436 Bacteria 833
80 Ga0070713_101490312 3300005436 Unclassified 656
81 Ga0070713_101630695 3300005436 Bacteria 626
82 Ga0070713_101805904 3300005436 Unclassified 593
83 Ga0070710_10012360 3300005437 Unclassified 4238
84 Ga0070710_10020111 3300005437 Bacteria 3459
85 Ga0070710_10026854 3300005437 Unclassified 3065
86 Ga0070710_10341970 3300005437 Bacteria 988
87 Ga0070710_10527453 3300005437 Unclassified 812
88 Ga0070710_11057260 3300005437 Unclassified 594
89 Ga0070701_10035602 3300005438 Bacteria 2502
90 Ga0070711_100000146 3300005439 Bacteria 37986
91 Ga0070711_100009798 3300005439 Bacteria 5909
92 Ga0070711_100022658 3300005439 Unclassified 4074
93 Ga0070711_100069134 3300005439 Bacteria 2484
94 Ga0070711_100122145 3300005439 Bacteria 1928
95 Ga0070711_100383483 3300005439 Bacteria 1137
96 Ga0070711_101511281 3300005439 Unclassified 586
97 Ga0070711_101629070 3300005439 Unclassified 565
98 Ga0070711_101912421 3300005439 Unclassified 521
99 Ga0070705_100812432 3300005440 Unclassified 745
100 Ga0070694_100048822 3300005444 Bacteria 2848
101 Ga0070694_100286547 3300005444 Bacteria 1257
102 Ga0070708_100000650 3300005445 Bacteria 26303
103 Ga0070708_100009490 3300005445 Bacteria 7842
104 Ga0070708_100148845 3300005445 Bacteria 2176
105 Ga0070708_100180519 3300005445 Unclassified 1973
106 Ga0070708_100195638 3300005445 Archaea 1892
107 Ga0070708_101020170 3300005445 Unclassified 776
108 Ga0070708_101098894 3300005445 Unclassified 745
109 Ga0070708_101247174 3300005445 Unclassified 695
110 Ga0070708_101786702 3300005445 Bacteria 571
111 Ga0070663_100570099 3300005455 Unclassified 948
112 Ga0070678_100150560 3300005456 Bacteria 1874
113 Ga0070678_100605833 3300005456 Bacteria 978
114 Ga0070662_100898603 3300005457 Unclassified 756
115 Ga0070681_10000377 3300005458 Bacteria 36039
116 Ga0070681_10028330 3300005458 Bacteria 5631
117 Ga0070681_10166543 3300005458 Unclassified 2126
118 Ga0068867_100014152 3300005459 Bacteria 5651
119 Ga0068867_100090433 3300005459 Bacteria 2322
120 Ga0068867_101192018 3300005459 Unclassified 699
121 Ga0070685_10633677 3300005466 Bacteria 773
122 Ga0070706_100075176 3300005467 Bacteria 3126
123 Ga0070706_100327234 3300005467 Bacteria 1429
124 Ga0070706_100401864 3300005467 Unclassified 1275
125 Ga0070706_100482795 3300005467 Bacteria 1153
126 Ga0070707_100006085 3300005468 Bacteria 11257
127 Ga0070707_100018634 3300005468 Bacteria 6532
128 Ga0070707_100307075 3300005468 Unclassified 1542
129 Ga0070707_100312705 3300005468 Unclassified 1527
130 Ga0070707_100462916 3300005468 Bacteria 1229
131 Ga0070707_100973476 3300005468 Unclassified 814
132 Ga0070707_101502183 3300005468 Bacteria 640
133 Ga0070707_101519233 3300005468 Bacteria 636
134 Ga0070707_101531467 3300005468 Bacteria 634
135 Ga0070698_100231122 3300005471 Bacteria 1782
136 Ga0070698_100671062 3300005471 Unclassified 978
137 Ga0070698_101525288 3300005471 Unclassified 620
138 Ga0070699_100388680 3300005518 Bacteria 1260
139 Ga0070699_101440218 3300005518 Unclassified 632
140 Ga0070699_101674528 3300005518 Unclassified 583
141 Ga0070699_101960718 3300005518 Unclassified 535
142 Ga0070679_100009688 3300005530 Bacteria 9113
143 Ga0070679_100120514 3300005530 Bacteria 2608
144 Ga0070679_100320985 3300005530 Bacteria 1498
145 Ga0070679_100601215 3300005530 Unclassified 1043
146 Ga0070684_100187574 3300005535 Bacteria 1881
147 Ga0070684_101565390 3300005535 Unclassified 621
148 Ga0070684_102143536 3300005535 Unclassified 527
149 Ga0070697_100000054 3300005536 Bacteria 88022
150 Ga0070697_100017898 3300005536 Bacteria 5582
151 Ga0070697_100196733 3300005536 Bacteria 1712
152 Ga0070697_100224367 3300005536 Unclassified 1602
153 Ga0070697_100313027 3300005536 Bacteria 1351
154 Ga0070697_100489116 3300005536 Unclassified 1075
155 Ga0070697_100524919 3300005536 Unclassified 1037
156 Ga0070697_101069367 3300005536 Unclassified 718
157 Ga0070697_101563402 3300005536 Unclassified 590
158 Ga0068853_100017902 3300005539 Bacteria 5855
159 Ga0068853_100148874 3300005539 Bacteria 2106
160 Ga0068853_100209068 3300005539 Bacteria 1778
161 Ga0068853_100694156 3300005539 Unclassified 970
162 Ga0070672_100297271 3300005543 Bacteria 1368
163 Ga0070686_100788128 3300005544 Bacteria 765
164 Ga0070695_100079673 3300005545 Unclassified 2163
165 Ga0070695_100438380 3300005545 Bacteria 998
166 Ga0070695_100909232 3300005545 Unclassified 711
167 Ga0070696_100158453 3300005546 Bacteria 1666
168 Ga0070696_100446788 3300005546 Bacteria 1019
169 Ga0070696_101750127 3300005546 Unclassified 536
170 Ga0070693_100240083 3300005547 Unclassified 1196
171 Ga0070693_100300934 3300005547 Bacteria 1081
172 Ga0070693_101277284 3300005547 Unclassified 567
173 Ga0070665_100025769 3300005548 Bacteria 5923
174 Ga0070704_100648819 3300005549 Unclassified 932
175 Ga0070704_101131612 3300005549 Unclassified 712
176 Ga0068855_100001121 3300005563 Bacteria 33253
177 Ga0068855_100003109 3300005563 Bacteria 20315
178 Ga0068855_100070544 3300005563 Bacteria 4065
179 Ga0068855_100260828 3300005563 Bacteria 1930
180 Ga0068855_101287332 3300005563 Unclassified 757
181 Ga0070664_100003491 3300005564 Bacteria 12699
182 Ga0070664_100159389 3300005564 Bacteria 1996
183 Ga0068857_100001087 3300005577 Bacteria 21082
184 Ga0068857_100006322 3300005577 Bacteria 10143
185 Ga0068857_100017859 3300005577 Bacteria 6221
186 Ga0068857_101451029 3300005577 Bacteria 668
187 Ga0068857_101701870 3300005577 Unclassified 617
188 Ga0068854_100001857 3300005578 Bacteria 12871
189 Ga0068854_100018005 3300005578 Bacteria 4736
190 Ga0068854_100932982 3300005578 Bacteria 765
191 Ga0068854_102011753 3300005578 Unclassified 532
192 Ga0068856_100001572 3300005614 Bacteria 23908
193 Ga0068856_100004735 3300005614 Bacteria 13509
194 Ga0068856_100030022 3300005614 Bacteria 5313
195 Ga0068856_100069904 3300005614 Bacteria 3472
196 Ga0068856_100121562 3300005614 Bacteria 2613
197 Ga0068856_100190538 3300005614 Unclassified 2064
198 Ga0068856_100342117 3300005614 Bacteria 1514
199 Ga0068856_100386871 3300005614 Unclassified 1418
200 Ga0068856_100917036 3300005614 Unclassified 895
201 Ga0070702_101650852 3300005615 Unclassified 531
202 Ga0068852_100166359 3300005616 Bacteria 2063
203 Ga0068852_101171454 3300005616 Unclassified 789
204 Ga0068852_101302895 3300005616 Bacteria 748
205 Ga0068859_100000212 3300005617 Bacteria 58021
206 Ga0068859_100012600 3300005617 Bacteria 8504
207 Ga0068859_101358363 3300005617 Unclassified 783
208 Ga0068864_100005484 3300005618 Bacteria 10401
209 Ga0068864_100101200 3300005618 Unclassified 2556
210 Ga0068864_100458419 3300005618 Bacteria 1220
211 Ga0068864_100817087 3300005618 Bacteria 917
212 Ga0068866_10002561 3300005718 Bacteria 7495
213 Ga0068866_10136615 3300005718 Unclassified 1402
214 Ga0068866_10207359 3300005718 Bacteria 1174
215 Ga0068866_10216270 3300005718 Bacteria 1153
216 Ga0068861_100261937 3300005719 Bacteria 1481
217 Ga0068861_100309728 3300005719 Bacteria 1371
218 Ga0068851_10007013 3300005834 Bacteria 5167
219 Ga0068851_10448930 3300005834 Bacteria 766
220 Ga0068870_10181351 3300005840 Bacteria 1264
221 Ga0068863_100022000 3300005841 Bacteria 6086
222 Ga0068863_100052481 3300005841 Bacteria 3864
223 Ga0068863_100158640 3300005841 Bacteria 2166
224 Ga0068863_100177775 3300005841 Bacteria 2043
225 Ga0068863_100191173 3300005841 Bacteria 1967
226 Ga0068863_100501767 3300005841 Bacteria 1195
227 Ga0068858_100004036 3300005842 Bacteria 14485
228 Ga0068858_100041953 3300005842 Bacteria 4242
229 Ga0068858_100384442 3300005842 Unclassified 1347
230 Ga0068858_100631046 3300005842 Unclassified 1040
231 Ga0068858_102418901 3300005842 Bacteria 519
232 Ga0068860_100145523 3300005843 Bacteria 2280
233 Ga0068860_100339588 3300005843 Bacteria 1477
234 Ga0068860_100572145 3300005843 Bacteria 1133
235 Ga0068860_101282780 3300005843 Bacteria 753
236 Ga0068860_101626291 3300005843 Unclassified 668
237 Ga0068862_100140377 3300005844 Bacteria 2144
238 Ga0068862_100268300 3300005844 Bacteria 1560
239 Ga0068862_101424674 3300005844 Unclassified 697
240 Ga0081540_1056259 3300005983 Bacteria 1910
241 Ga0070717_10000783 3300006028 Bacteria 20846
242 Ga0070717_10001830 3300006028 Bacteria 14861
243 Ga0070717_10015827 3300006028 Bacteria 5831
244 Ga0070717_10027647 3300006028 Bacteria 4534
245 Ga0070717_10028400 3300006028 Bacteria 4478
246 Ga0070717_10034022 3300006028 Bacteria 4116
247 Ga0070717_10042990 3300006028 Bacteria 3686
248 Ga0070717_10053292 3300006028 Bacteria 3334
249 Ga0070717_10069754 3300006028 Unclassified 2928
250 Ga0070717_10087653 3300006028 Bacteria 2622
251 Ga0070717_10247820 3300006028 Unclassified 1573
252 Ga0070717_10380763 3300006028 Bacteria 1265
253 Ga0070717_10408917 3300006028 Bacteria 1220
254 Ga0070717_10495216 3300006028 Unclassified 1104
255 Ga0070717_11131185 3300006028 Unclassified 713
256 Ga0070717_11881944 3300006028 Unclassified 540
257 Ga0070715_10020921 3300006163 Bacteria 2530
258 Ga0070715_10022382 3300006163 Bacteria 2464
259 Ga0070715_10090119 3300006163 Bacteria 1409
260 Ga0070715_10110651 3300006163 Bacteria 1295
261 Ga0070715_10237985 3300006163 Unclassified 945
262 Ga0070715_10369812 3300006163 Unclassified 788
263 Ga0070715_10792930 3300006163 Bacteria 574
264 Ga0070716_100000923 3300006173 Bacteria 12724
265 Ga0070716_100007179 3300006173 Bacteria 5478
266 Ga0070716_100007927 3300006173 Bacteria 5258
267 Ga0070716_100008906 3300006173 Unclassified 4990
268 Ga0070716_100046037 3300006173 Bacteria 2453
269 Ga0070716_100127741 3300006173 Bacteria 1602
270 Ga0070716_100213147 3300006173 Bacteria 1292
271 Ga0070716_100242529 3300006173 Unclassified 1223
272 Ga0070716_100426417 3300006173 Unclassified 961
273 Ga0070716_100530219 3300006173 Unclassified 874
274 Ga0070716_101492507 3300006173 Unclassified 552
275 Ga0070712_100000020 3300006175 Bacteria 84120
276 Ga0070712_100001031 3300006175 Bacteria 16810
277 Ga0070712_100002971 3300006175 Bacteria 10496
278 Ga0070712_100072046 3300006175 Bacteria 2474
279 Ga0070712_100086934 3300006175 Bacteria 2279
280 Ga0070712_100103143 3300006175 Bacteria 2114
281 Ga0070712_100116259 3300006175 Bacteria 2006
282 Ga0070712_100481776 3300006175 Unclassified 1037
283 Ga0070712_100581626 3300006175 Bacteria 946
284 Ga0070712_100819713 3300006175 Bacteria 799
285 Ga0097621_100002049 3300006237 Bacteria 13792
286 Ga0097621_100004009 3300006237 Bacteria 10209
287 Ga0097621_100058344 3300006237 Bacteria 3158
288 Ga0097621_100183041 3300006237 Bacteria 1811
289 Ga0097621_100286834 3300006237 Bacteria 1450
290 Ga0097621_100775720 3300006237 Bacteria 887
291 Ga0097621_101129161 3300006237 Unclassified 737
292 Ga0097621_101560671 3300006237 Bacteria 627
293 Ga0068871_100002003 3300006358 Bacteria 13784
294 Ga0068871_100032606 3300006358 Bacteria 4117
295 Ga0068871_100035240 3300006358 Unclassified 3975
296 Ga0068871_100056574 3300006358 Bacteria 3189
297 Ga0068871_100216798 3300006358 Unclassified 1657
298 Ga0068871_100673143 3300006358 Unclassified 946
299 Ga0068871_101041880 3300006358 Unclassified 763
300 Ga0068871_101560866 3300006358 Unclassified 624
301 Ga0075428_100008382 3300006844 Bacteria 11459
302 Ga0075431_100046799 3300006847 Bacteria 4462
303 Ga0075433_11523332 3300006852 Unclassified 577
304 Ga0075434_100028248 3300006871 Bacteria 5510
305 Ga0075434_100236454 3300006871 Bacteria 1847
306 Ga0068865_100199141 3300006881 Bacteria 1554
307 Ga0075436_100000876 3300006914 Bacteria 19978
308 Ga0075436_100002383 3300006914 Bacteria 12963
309 Ga0075436_100085157 3300006914 Unclassified 2194
310 Ga0075436_100090407 3300006914 Archaea 2128
311 Ga0075436_100522543 3300006914 Bacteria 870
312 Ga0097620_100000212 3300006931 Bacteria 58021
313 Ga0097620_100012600 3300006931 Bacteria 8504
314 Ga0097620_101358352 3300006931 Unclassified 783
315 Ga0075435_100000708 3300007076 Bacteria 20652
316 Ga0075435_100011313 3300007076 Bacteria 6558
317 Ga0075435_100483743 3300007076 Unclassified 1069
318 Ga0075435_100742539 3300007076 Unclassified 854
319 Ga0075435_100901228 3300007076 Unclassified 771
320 Ga0099794_10020695 3300007265 Bacteria 2980
321 Ga0099794_10276002 3300007265 Unclassified 869
322 Ga0099795_10071744 3300007788 Unclassified 1308
323 Ga0099795_10279114 3300007788 Bacteria 729
324 Ga0099795_10300733 3300007788 Bacteria 705
325 Ga0099795_10660326 3300007788 Unclassified 501
326 Ga0105251_10142815 3300009011 Unclassified 1083
327 Ga0105250_10098912 3300009092 Unclassified 1190
328 Ga0105250_10132821 3300009092 Bacteria 1028
329 Ga0105250_10162909 3300009092 Unclassified 932
330 Ga0105240_10010302 3300009093 Bacteria 13160
331 Ga0105240_10019089 3300009093 Bacteria 9167
332 Ga0105240_10022087 3300009093 Bacteria 8444
333 Ga0105240_10026956 3300009093 Bacteria 7533
334 Ga0105240_10043487 3300009093 Bacteria 5715
335 Ga0105240_10088373 3300009093 Bacteria 3792
336 Ga0105240_10149523 3300009093 Bacteria 2783
337 Ga0105240_10228754 3300009093 Unclassified 2162
338 Ga0105240_10501666 3300009093 Bacteria 1349
339 Ga0105240_11821688 3300009093 Bacteria 634
340 Ga0105240_12620801 3300009093 Unclassified 521
341 Ga0111539_10275868 3300009094 Bacteria 1956
342 Ga0105245_10089104 3300009098 Bacteria 2836
343 Ga0105245_10145895 3300009098 Bacteria 2233
344 Ga0105245_10364718 3300009098 Unclassified 1435
345 Ga0105245_11326194 3300009098 Bacteria 769
346 Ga0105245_11718262 3300009098 Unclassified 680
347 Ga0105245_13203829 3300009098 Unclassified 507
348 Ga0105247_10004327 3300009101 Bacteria 9073
349 Ga0105247_10205696 3300009101 Bacteria 1325
350 Ga0105247_10595172 3300009101 Bacteria 819
351 Ga0105247_11848767 3300009101 Unclassified 504
352 Ga0114129_10995017 3300009147 Unclassified 1056
353 Ga0105243_10049197 3300009148 Bacteria 3325
354 Ga0105241_10004302 3300009174 Bacteria 10529
355 Ga0105241_10007461 3300009174 Bacteria 8049
356 Ga0105241_10015748 3300009174 Bacteria 5540
357 Ga0105241_10071397 3300009174 Unclassified 2695
358 Ga0105241_10126226 3300009174 Unclassified 2066
359 Ga0105241_10136533 3300009174 Unclassified 1992
360 Ga0105241_10213905 3300009174 Unclassified 1616
361 Ga0105241_10477070 3300009174 Unclassified 1108
362 Ga0105241_10529823 3300009174 Unclassified 1054
363 Ga0105241_11467703 3300009174 Unclassified 655
364 Ga0105242_10063427 3300009176 Bacteria 3043
365 Ga0105242_10760952 3300009176 Bacteria 955
366 Ga0105242_12212778 3300009176 Unclassified 595
367 Ga0105248_10032421 3300009177 Bacteria 5839
368 Ga0105248_10035583 3300009177 Bacteria 5572
369 Ga0105248_10309338 3300009177 Bacteria 1780
370 Ga0105248_10333883 3300009177 Bacteria 1707
371 Ga0105237_10049900 3300009545 Unclassified 4205
372 Ga0105237_10058035 3300009545 Bacteria 3873
373 Ga0105237_10258721 3300009545 Bacteria 1743
374 Ga0105237_10334053 3300009545 Unclassified 1520
375 Ga0105237_10365371 3300009545 Bacteria 1448
376 Ga0105237_10543417 3300009545 Unclassified 1169
377 Ga0105237_10596661 3300009545 Unclassified 1111
378 Ga0105237_11047160 3300009545 Unclassified 823
379 Ga0105237_11135093 3300009545 Unclassified 788
380 Ga0105237_11507023 3300009545 Bacteria 679
381 Ga0105237_11895213 3300009545 Unclassified 604
382 Ga0105237_12599440 3300009545 Unclassified 517
383 Ga0105238_10000064 3300009551 Bacteria 122380
384 Ga0105238_10029631 3300009551 Bacteria 5574
385 Ga0105238_10102411 3300009551 Bacteria 2845
386 Ga0105238_10372482 3300009551 Bacteria 1418
387 Ga0105238_10405307 3300009551 Unclassified 1357
388 Ga0105238_10712117 3300009551 Bacteria 1016
389 Ga0105238_12199816 3300009551 Unclassified 586
390 Ga0105249_10010752 3300009553 Bacteria 8041
391 Ga0105249_10138087 3300009553 Bacteria 2335
392 Ga0105249_10480618 3300009553 Bacteria 1285
393 Ga0105249_12080113 3300009553 Unclassified 641
394 Ga0099796_10426806 3300010159 Bacteria 586
395 Ga0099796_10563963 3300010159 Unclassified 512
396 Ga0105239_10027920 3300010375 Bacteria 6209
397 Ga0105239_10077907 3300010375 Bacteria 3647
398 Ga0105239_10155923 3300010375 Unclassified 2550
399 Ga0105239_10228131 3300010375 Bacteria 2089
400 Ga0105239_10466707 3300010375 Unclassified 1433
401 Ga0105239_11278799 3300010375 Unclassified 846
402 Ga0105239_12437921 3300010375 Unclassified 609
403 Ga0105246_10191097 3300011119 Bacteria 1585
404 Ga0105246_10232936 3300011119 Bacteria 1451
405 Ga0105246_10743852 3300011119 Bacteria 864
406 Ga0157373_10009390 3300013100 Bacteria 7223
407 Ga0157373_10092244 3300013100 Bacteria 2133
408 Ga0157373_10207408 3300013100 Unclassified 1382
409 Ga0157373_10233970 3300013100 Bacteria 1298
410 Ga0157373_10283949 3300013100 Bacteria 1173
411 Ga0157373_10332904 3300013100 Bacteria 1081
412 Ga0157373_10527078 3300013100 Bacteria 855
413 Ga0157373_11582943 3300013100 Unclassified 501
414 Ga0157371_10009629 3300013102 Bacteria 7598
415 Ga0157371_10090948 3300013102 Bacteria 2161
416 Ga0157371_10298053 3300013102 Bacteria 1167
417 Ga0157370_10090313 3300013104 Bacteria 2876
418 Ga0157370_10159142 3300013104 Bacteria 2101
419 Ga0157370_10359581 3300013104 Unclassified 1342
420 Ga0157370_10616772 3300013104 Bacteria 993
421 Ga0157370_10829662 3300013104 Bacteria 841
422 Ga0157370_11070760 3300013104 Unclassified 729
423 Ga0157369_10000506 3300013105 Bacteria 51297
424 Ga0157369_10010162 3300013105 Bacteria 10742
425 Ga0157369_10035511 3300013105 Bacteria 5465
426 Ga0157369_10067761 3300013105 Bacteria 3836
427 Ga0157369_10085630 3300013105 Bacteria 3368
428 Ga0157369_10326618 3300013105 Bacteria 1594
429 Ga0157369_10725761 3300013105 Bacteria 1023
430 Ga0157374_10000140 3300013296 Bacteria 65420
431 Ga0157374_10000142 3300013296 Bacteria 64898
432 Ga0157374_10007649 3300013296 Bacteria 9224
433 Ga0157374_10026203 3300013296 Bacteria 5244
434 Ga0157374_10026373 3300013296 Bacteria 5228
435 Ga0157374_10062360 3300013296 Unclassified 3494
436 Ga0157374_10116750 3300013296 Bacteria 2572
437 Ga0157374_10121018 3300013296 Bacteria 2526
438 Ga0157378_10000135 3300013297 Bacteria 69913
439 Ga0157378_10003940 3300013297 Bacteria 13117
440 Ga0157378_10004347 3300013297 Bacteria 12465
441 Ga0157378_10016335 3300013297 Bacteria 6500
442 Ga0157378_10043483 3300013297 Bacteria 3989
443 Ga0157378_10061121 3300013297 Bacteria 3361
444 Ga0157378_10063087 3300013297 Bacteria 3310
445 Ga0157378_10392030 3300013297 Unclassified 1366
446 Ga0163162_10003913 3300013306 Bacteria 14302
447 Ga0163162_10070206 3300013306 Bacteria 3554
448 Ga0163162_10076256 3300013306 Bacteria 3414
449 Ga0163162_10288068 3300013306 Unclassified 1774
450 Ga0163162_10564314 3300013306 Bacteria 1266
451 Ga0157372_10000516 3300013307 Bacteria 42622
452 Ga0157372_10001178 3300013307 Bacteria 28261
453 Ga0157372_10001443 3300013307 Bacteria 25710
454 Ga0157372_10001921 3300013307 Bacteria 22556
455 Ga0157372_10013898 3300013307 Bacteria 8602
456 Ga0157372_10025104 3300013307 Bacteria 6476
457 Ga0157372_10072284 3300013307 Unclassified 3887
458 Ga0157372_10104094 3300013307 Bacteria 3244
459 Ga0157372_10175689 3300013307 Bacteria 2479
460 Ga0157372_10358100 3300013307 Unclassified 1700
461 Ga0157372_10457759 3300013307 Unclassified 1487
462 Ga0157372_11331521 3300013307 Unclassified 828
463 Ga0157372_12566799 3300013307 Unclassified 585
464 Ga0157372_13411276 3300013307 Unclassified 505
465 Ga0157375_10038435 3300013308 Unclassified 4596
466 Ga0157375_12126062 3300013308 Unclassified 668
467 Ga0163163_10067503 3300014325 Bacteria 3556
468 Ga0163163_10184762 3300014325 Unclassified 2132
469 Ga0163163_10316519 3300014325 Unclassified 1614
470 Ga0163163_10512864 3300014325 Bacteria 1261
471 Ga0163163_10812179 3300014325 Bacteria 999
472 Ga0163163_12838973 3300014325 Bacteria 541
473 Ga0157380_11846809 3300014326 Bacteria 664
474 Ga0182008_10004763 3300014497 Bacteria 7855
475 Ga0157377_11649348 3300014745 Unclassified 515
476 Ga0157379_10003068 3300014968 Bacteria 14130
477 Ga0157379_10012561 3300014968 Bacteria 7398
478 Ga0157379_10225424 3300014968 Unclassified 1699
479 Ga0157379_10636997 3300014968 Bacteria 997
480 Ga0157376_10015466 3300014969 Bacteria 5765
481 Ga0157376_10023577 3300014969 Bacteria 4819
482 Ga0157376_10026825 3300014969 Bacteria 4557
483 Ga0157376_10054603 3300014969 Bacteria 3331
484 Ga0182006_1021602 3300015261 Bacteria 2682
485 Ga0182007_10013047 3300015262 Bacteria 3184
486 Ga0182005_1083525 3300015265 Bacteria 883
487 Ga0213874_10248948 3300021377 Unclassified 654
488 Ga0213875_10070567 3300021388 Unclassified 1631
489 Ga0224572_1002702 3300024225 Bacteria 2908
490 Ga0228598_1095940 3300024227 Bacteria 598
491 Ga0207656_10014893 3300025321 Bacteria 3004
492 Ga0207656_10365023 3300025321 Bacteria 722
493 Ga0207653_10210622 3300025885 Unclassified 735
494 Ga0207692_10026553 3300025898 Bacteria 2717
495 Ga0207692_10081551 3300025898 Bacteria 1731
496 Ga0207692_10126587 3300025898 Unclassified 1438
497 Ga0207692_10234029 3300025898 Bacteria 1094
498 Ga0207642_10040486 3300025899 Unclassified 2033
499 Ga0207642_10063498 3300025899 Bacteria 1728
500 Ga0207710_10107926 3300025900 Bacteria 1319
501 Ga0207710_10136859 3300025900 Bacteria 1180
502 Ga0207710_10653220 3300025900 Unclassified 551
503 Ga0207688_10339579 3300025901 Bacteria 924
504 Ga0207680_10045799 3300025903 Bacteria 2582
505 Ga0207680_11171619 3300025903 Unclassified 548
506 Ga0207647_10043651 3300025904 Bacteria 2804
507 Ga0207647_10162970 3300025904 Unclassified 1300
508 Ga0207685_10014585 3300025905 Unclassified 2464
509 Ga0207685_10018512 3300025905 Bacteria 2275
510 Ga0207685_10677056 3300025905 Unclassified 560
511 Ga0207699_10003179 3300025906 Bacteria 7814
512 Ga0207699_10023765 3300025906 Unclassified 3340
513 Ga0207699_10063009 3300025906 Bacteria 2238
514 Ga0207699_10074645 3300025906 Bacteria 2084
515 Ga0207699_10103159 3300025906 Bacteria 1814
516 Ga0207699_10277692 3300025906 Bacteria 1163
517 Ga0207699_10296370 3300025906 Unclassified 1128
518 Ga0207699_10308697 3300025906 Unclassified 1106
519 Ga0207699_10425226 3300025906 Bacteria 949
520 Ga0207699_10660533 3300025906 Unclassified 764
521 Ga0207699_11376067 3300025906 Unclassified 522
522 Ga0207645_10004401 3300025907 Bacteria 10439
523 Ga0207684_10317627 3300025910 Bacteria 1343
524 Ga0207684_10387670 3300025910 Unclassified 1201
525 Ga0207684_10806829 3300025910 Bacteria 793
526 Ga0207654_10011224 3300025911 Bacteria 4566
527 Ga0207654_10022231 3300025911 Bacteria 3381
528 Ga0207654_10064282 3300025911 Unclassified 2157
529 Ga0207654_10067830 3300025911 Unclassified 2109
530 Ga0207654_10387456 3300025911 Unclassified 969
531 Ga0207654_10663797 3300025911 Unclassified 747
532 Ga0207707_10003767 3300025912 Bacteria 13440
533 Ga0207707_10125676 3300025912 Bacteria 2243
534 Ga0207707_10209066 3300025912 Unclassified 1700
535 Ga0207695_10005740 3300025913 Bacteria 16345
536 Ga0207695_10045944 3300025913 Bacteria 4631
537 Ga0207695_10080073 3300025913 Bacteria 3309
538 Ga0207695_10143376 3300025913 Unclassified 2335
539 Ga0207695_10213209 3300025913 Bacteria 1841
540 Ga0207695_10233404 3300025913 Bacteria 1743
541 Ga0207695_10610852 3300025913 Bacteria 971
542 Ga0207695_11383745 3300025913 Unclassified 584
543 Ga0207695_11446792 3300025913 Unclassified 568
544 Ga0207671_10290971 3300025914 Unclassified 1290
545 Ga0207671_10469577 3300025914 Unclassified 1003
546 Ga0207671_10644725 3300025914 Unclassified 843
547 Ga0207671_10844690 3300025914 Unclassified 725
548 Ga0207671_11067023 3300025914 Unclassified 635
549 Ga0207671_11288485 3300025914 Bacteria 569
550 Ga0207693_10000080 3300025915 Bacteria 86060
551 Ga0207693_10000173 3300025915 Bacteria 58862
552 Ga0207693_10005546 3300025915 Bacteria 10499
553 Ga0207693_10010314 3300025915 Bacteria 7583
554 Ga0207693_10024452 3300025915 Bacteria 4793
555 Ga0207693_10050011 3300025915 Bacteria 3282
556 Ga0207693_10054090 3300025915 Bacteria 3149
557 Ga0207693_10094388 3300025915 Bacteria 2344
558 Ga0207693_10375256 3300025915 Bacteria 1112
559 Ga0207693_11401083 3300025915 Bacteria 519
560 Ga0207663_10006520 3300025916 Bacteria 5981
561 Ga0207663_10015151 3300025916 Unclassified 4246
562 Ga0207663_10058477 3300025916 Bacteria 2433
563 Ga0207663_10107543 3300025916 Bacteria 1887
564 Ga0207663_10171249 3300025916 Unclassified 1542
565 Ga0207663_10171430 3300025916 Bacteria 1542
566 Ga0207663_10850345 3300025916 Bacteria 728
567 Ga0207663_11013072 3300025916 Unclassified 666
568 Ga0207663_11281179 3300025916 Unclassified 590
569 Ga0207660_10051503 3300025917 Bacteria 2927
570 Ga0207660_10059699 3300025917 Bacteria 2739
571 Ga0207660_10118592 3300025917 Bacteria 2002
572 Ga0207660_10287700 3300025917 Bacteria 1306
573 Ga0207657_10000215 3300025919 Bacteria 60239
574 Ga0207657_10212296 3300025919 Unclassified 1553
575 Ga0207649_10228982 3300025920 Bacteria 1328
576 Ga0207652_10022145 3300025921 Bacteria 5253
577 Ga0207652_10214386 3300025921 Unclassified 1734
578 Ga0207652_10351898 3300025921 Bacteria 1329
579 Ga0207652_10629610 3300025921 Unclassified 960
580 Ga0207646_10000165 3300025922 Bacteria 89540
581 Ga0207646_10233637 3300025922 Unclassified 1661
582 Ga0207646_10465268 3300025922 Bacteria 1140
583 Ga0207646_10594871 3300025922 Bacteria 993
584 Ga0207646_11001005 3300025922 Bacteria 739
585 Ga0207646_11080195 3300025922 Bacteria 707
586 Ga0207646_11771721 3300025922 Bacteria 529
587 Ga0207681_10089709 3300025923 Bacteria 2192
588 Ga0207694_10000835 3300025924 Bacteria 27439
589 Ga0207694_10007028 3300025924 Bacteria 8547
590 Ga0207694_10158574 3300025924 Bacteria 1826
591 Ga0207694_10414697 3300025924 Unclassified 1121
592 Ga0207694_10832144 3300025924 Bacteria 780
593 Ga0207650_10001281 3300025925 Bacteria 18234
594 Ga0207650_10053376 3300025925 Bacteria 2996
595 Ga0207659_10085626 3300025926 Bacteria 2342
596 Ga0207659_10697875 3300025926 Unclassified 869
597 Ga0207687_10005132 3300025927 Bacteria 8683
598 Ga0207687_10027572 3300025927 Bacteria 3812
599 Ga0207700_10000364 3300025928 Bacteria 26445
600 Ga0207700_10021287 3300025928 Bacteria 4424
601 Ga0207700_10038051 3300025928 Bacteria 3489
602 Ga0207700_10059887 3300025928 Unclassified 2881
603 Ga0207700_10120883 3300025928 Unclassified 2123
604 Ga0207700_10130716 3300025928 Bacteria 2050
605 Ga0207700_10254186 3300025928 Bacteria 1502
606 Ga0207700_10308298 3300025928 Bacteria 1369
607 Ga0207700_10359334 3300025928 Bacteria 1269
608 Ga0207700_10441610 3300025928 Bacteria 1145
609 Ga0207700_10455204 3300025928 Unclassified 1128
610 Ga0207700_10603111 3300025928 Unclassified 977
611 Ga0207700_10967057 3300025928 Bacteria 762
612 Ga0207700_11465336 3300025928 Unclassified 606
613 Ga0207700_11579496 3300025928 Bacteria 581
614 Ga0207700_11725462 3300025928 Bacteria 552
615 Ga0207664_10004399 3300025929 Bacteria 9544
616 Ga0207664_10021424 3300025929 Bacteria 4806
617 Ga0207664_10030515 3300025929 Bacteria 4117
618 Ga0207664_10052162 3300025929 Bacteria 3234
619 Ga0207664_10087681 3300025929 Unclassified 2544
620 Ga0207664_10141447 3300025929 Bacteria 2036
621 Ga0207664_10269082 3300025929 Unclassified 1492
622 Ga0207664_10316631 3300025929 Bacteria 1376
623 Ga0207664_10602232 3300025929 Bacteria 987
624 Ga0207664_10696057 3300025929 Unclassified 914
625 Ga0207664_10755063 3300025929 Bacteria 875
626 Ga0207664_11684296 3300025929 Unclassified 556
627 Ga0207690_10147586 3300025932 Bacteria 1740
628 Ga0207690_10238690 3300025932 Bacteria 1399
629 Ga0207706_10002361 3300025933 Bacteria 18445
630 Ga0207686_10901209 3300025934 Unclassified 713
631 Ga0207686_11551085 3300025934 Unclassified 546
632 Ga0207686_11558449 3300025934 Unclassified 545
633 Ga0207709_10552504 3300025935 Bacteria 906
634 Ga0207669_11099925 3300025937 Unclassified 671
635 Ga0207704_10003968 3300025938 Bacteria 6732
636 Ga0207704_11944426 3300025938 Unclassified 506
637 Ga0207665_10010667 3300025939 Bacteria 6034
638 Ga0207665_10011380 3300025939 Bacteria 5842
639 Ga0207665_10014315 3300025939 Bacteria 5223
640 Ga0207665_10079496 3300025939 Bacteria 2254
641 Ga0207665_10116510 3300025939 Unclassified 1883
642 Ga0207665_10238114 3300025939 Unclassified 1340
643 Ga0207665_10593395 3300025939 Unclassified 864
644 Ga0207665_10646267 3300025939 Unclassified 829
645 Ga0207665_10871959 3300025939 Bacteria 713
646 Ga0207665_11098887 3300025939 Unclassified 634
647 Ga0207665_11281667 3300025939 Bacteria 584
648 Ga0207691_10270220 3300025940 Bacteria 1464
649 Ga0207711_10002367 3300025941 Bacteria 16881
650 Ga0207711_10264459 3300025941 Bacteria 1582
651 Ga0207711_10568153 3300025941 Bacteria 1058
652 Ga0207689_10574775 3300025942 Unclassified 947
653 Ga0207689_11557082 3300025942 Bacteria 551
654 Ga0207661_10011078 3300025944 Bacteria 6518
655 Ga0207661_10058574 3300025944 Bacteria 3100
656 Ga0207661_10235904 3300025944 Bacteria 1621
657 Ga0207679_10001041 3300025945 Bacteria 17734
658 Ga0207679_10166084 3300025945 Unclassified 1812
659 Ga0207667_10000421 3300025949 Bacteria 57073
660 Ga0207667_10002272 3300025949 Bacteria 24148
661 Ga0207667_10034607 3300025949 Bacteria 5424
662 Ga0207667_10195648 3300025949 Bacteria 2074
663 Ga0207667_11291084 3300025949 Unclassified 707
664 Ga0207651_10065239 3300025960 Bacteria 2553
665 Ga0207712_10036259 3300025961 Bacteria 3357
666 Ga0207640_10003915 3300025981 Bacteria 8035
667 Ga0207640_10012996 3300025981 Bacteria 4758
668 Ga0207640_10047353 3300025981 Bacteria 2773
669 Ga0207640_10693703 3300025981 Unclassified 872
670 Ga0207658_10946705 3300025986 Bacteria 785
671 Ga0207658_11528447 3300025986 Unclassified 610
672 Ga0207658_11587336 3300025986 Unclassified 598
673 Ga0207677_10002537 3300026023 Bacteria 9574
674 Ga0207677_10008028 3300026023 Bacteria 5875
675 Ga0207677_10654452 3300026023 Unclassified 928
676 Ga0207677_12073443 3300026023 Unclassified 529
677 Ga0207703_10002538 3300026035 Bacteria 15775
678 Ga0207703_10160661 3300026035 Bacteria 1968
679 Ga0207703_10314679 3300026035 Unclassified 1432
680 Ga0207703_10915344 3300026035 Bacteria 840
681 Ga0207703_11612221 3300026035 Unclassified 624
682 Ga0207703_11839417 3300026035 Bacteria 582
683 Ga0207639_10095933 3300026041 Bacteria 2385
684 Ga0207639_10178381 3300026041 Bacteria 1805
685 Ga0207639_10285694 3300026041 Bacteria 1453
686 Ga0207639_10728045 3300026041 Unclassified 921
687 Ga0207678_10000874 3300026067 Bacteria 27662
688 Ga0207708_11379634 3300026075 Unclassified 618
689 Ga0207702_10000219 3300026078 Bacteria 66719
690 Ga0207702_10009031 3300026078 Bacteria 8394
691 Ga0207702_10021806 3300026078 Bacteria 5304
692 Ga0207702_10022048 3300026078 Bacteria 5276
693 Ga0207702_10029476 3300026078 Unclassified 4567
694 Ga0207702_10185748 3300026078 Bacteria 1917
695 Ga0207702_10381854 3300026078 Bacteria 1355
696 Ga0207702_10491841 3300026078 Unclassified 1195
697 Ga0207702_12240628 3300026078 Unclassified 535
698 Ga0207641_10033410 3300026088 Bacteria 4274
699 Ga0207641_10184261 3300026088 Bacteria 1914
700 Ga0207641_10214578 3300026088 Bacteria 1781
701 Ga0207641_10451159 3300026088 Unclassified 1243
702 Ga0207648_10004716 3300026089 Bacteria 13940
703 Ga0207648_10013735 3300026089 Bacteria 7517
704 Ga0207648_10458942 3300026089 Unclassified 1161
705 Ga0207676_10003507 3300026095 Bacteria 11099
706 Ga0207676_10078264 3300026095 Bacteria 2678
707 Ga0207676_10706310 3300026095 Bacteria 977
708 Ga0207676_10945023 3300026095 Bacteria 847
709 Ga0207674_10000190 3300026116 Bacteria 75394
710 Ga0207674_10015313 3300026116 Bacteria 8429
711 Ga0207674_10037539 3300026116 Bacteria 5037
712 Ga0207674_10315400 3300026116 Bacteria 1513
713 Ga0207674_10714909 3300026116 Bacteria 967
714 Ga0207674_11506171 3300026116 Unclassified 642
715 Ga0207675_100264085 3300026118 Bacteria 1669
716 Ga0207675_100308583 3300026118 Bacteria 1542
717 Ga0207683_10046033 3300026121 Bacteria 3816
718 Ga0207683_10652873 3300026121 Bacteria 974
719 Ga0207698_10004440 3300026142 Bacteria 8548
720 Ga0207698_11290100 3300026142 Unclassified 745
721 Ga0207698_11553488 3300026142 Unclassified 677
722 Ga0207428_10208608 3300027907 Bacteria 1468
723 Ga0265354_1001563 3300028016 Bacteria 3214
724 Ga0265354_1016478 3300028016 Bacteria 700
725 Ga0265356_1014986 3300028017 Unclassified 843
726 Ga0268266_10008393 3300028379 Bacteria 9185
727 Ga0268265_10056372 3300028380 Bacteria 2989
728 Ga0268265_10501906 3300028380 Bacteria 1143
729 Ga0268264_10009779 3300028381 Bacteria 7937
730 Ga0268264_10497306 3300028381 Bacteria 1189
731 Ga0268264_10764901 3300028381 Bacteria 963
732 Ga0268264_10807567 3300028381 Unclassified 938
733 Ga0268264_11363388 3300028381 Unclassified 720
734 Ga0268264_11656541 3300028381 Unclassified 650
735 Ga0265338_10018837 3300028800 Bacteria 7363
736 Ga0265338_10415312 3300028800 Unclassified 957
737 Ga0265324_10093456 3300029957 Unclassified 1023
738 Ga0265762_1008767 3300030760 Bacteria 1800
739 Ga0265770_1000702 3300030878 Bacteria 4662
740 Ga0265770_1014935 3300030878 Bacteria 1177
741 Ga0265765_1059372 3300030879 Unclassified 538
742 Ga0265760_10023867 3300031090 Bacteria 1778
743 Ga0265760_10026149 3300031090 Bacteria 1707
744 Ga0265330_10016525 3300031235 Bacteria 3404
745 Ga0265328_10177734 3300031239 Unclassified 805
746 Ga0265325_10186341 3300031241 Unclassified 964
747 Ga0265329_10088738 3300031242 Unclassified 981
748 Ga0265340_10087205 3300031247 Unclassified 1463
749 Ga0265340_10171376 3300031247 Bacteria 983
750 Ga0265340_10298804 3300031247 Unclassified 714
751 Ga0265339_10018569 3300031249 Unclassified 4095
752 Ga0265339_10019951 3300031249 Bacteria 3924
753 Ga0265316_10003557 3300031344 Bacteria 15713
754 Ga0265316_10184896 3300031344 Unclassified 1550
755 Ga0265314_10000198 3300031711 Bacteria 89925
756 Ga0265314_10013916 3300031711 Bacteria 6472
757 Ga0265314_10113677 3300031711 Bacteria 1716
758 Ga0373930_0014086 3300034816 Unclassified 1483
759 Ga0373958_0085639 3300034819 Bacteria 720
760 Ga0373926_0000501 3300035083 Bacteria 10438
761 Ga0373928_0137483 3300035084 Bacteria 667
762 Ga0373929_0061106 3300035085 Unclassified 882
763 Ga0373929_0086965 3300035085 Bacteria 770
764 Ga0373940_0140647 3300035088 Unclassified 763
765 Ga0373952_0030277 3300035092 Bacteria 1198
766 Ga0373923_0028307 3300035111 Bacteria 2241
767 Ga0373932_0020641 3300035112 Bacteria 1730
768 Ga0373932_0053553 3300035112 Unclassified 1205
769 Ga0373936_0053789 3300035113 Bacteria 1633
770 Ga0373936_0088441 3300035113 Bacteria 1296
771 Ga0373939_0154780 3300035114 Bacteria 837
772 Ga0373941_0336841 3300035115 Unclassified 610
773 Ga0373945_0032618 3300035116 Bacteria 1846
774 Ga0373945_0589084 3300035116 Bacteria 502
775 Ga0373960_0041318 3300035121 Bacteria 1335
776 Ga0373960_0057269 3300035121 Bacteria 1173
777 Ga0373943_0055135 3300035170 Bacteria 1968
778 Ga0373943_0130504 3300035170 Bacteria 1344
779 Ga0373943_0208818 3300035170 Unclassified 1083
780 Ga0373943_0672014 3300035170 Unclassified 613
781 Ga0373942_0036873 3300035207 Unclassified 1319
782 Ga0373942_0162962 3300035207 Unclassified 722
783 Ga0373931_0033225 3300035691 Unclassified 2673
784 Ga0373931_0081486 3300035691 Unclassified 1787
785 Ga0373931_0114270 3300035691 Unclassified 1535
786 Ga0373931_0115285 3300035691 Bacteria 1529
787 Ga0373931_0142160 3300035691 Unclassified 1391
788 Ga0373931_0169238 3300035691 Bacteria 1286
789 Ga0373931_0211924 3300035691 Unclassified 1162
790 Ga0373935_0005508 3300035692 Bacteria 7458
791 Ga0373935_0200945 3300035692 Unclassified 1377
792 Ga0373935_0207054 3300035692 Bacteria 1358
793 Ga0373935_0806118 3300035692 Bacteria 693
794 Ga0373927_0010674 3300035695 Bacteria 6119
795 Ga0373927_0025477 3300035695 Bacteria 3868
796 Ga0373927_0057773 3300035695 Bacteria 2509
797 Ga0373927_0094843 3300035695 Bacteria 1939
798 Ga0373927_0250252 3300035695 Bacteria 1165
799 Ga0373933_0038561 3300035724 Unclassified 2808
800 Ga0373933_1156514 3300035724 Unclassified 510
801 Ga0373947_0002625 3300035725 Bacteria 10786
802 Ga0373947_0438649 3300035725 Bacteria 884
803 Ga0373947_0459143 3300035725 Bacteria 863
804 Ga0373937_0324632 3300036401 Bacteria 1456
805 Ga0373937_0399278 3300036401 Unclassified 1304
806 Ga0373937_0680256 3300036401 Bacteria 975
807 Ga0373937_0944314 3300036401 Unclassified 811
808 Ga0373937_1030230 3300036401 Bacteria 772
809 Ga0373937_1128343 3300036401 Unclassified 733
810 Ga0373925_0003990 3300037068 Bacteria 11248
811 Ga0373925_0037892 3300037068 Bacteria 3561
812 Ga0373925_0039044 3300037068 Bacteria 3512
813 Ga0373925_0087346 3300037068 Bacteria 2380
814 Ga0373925_0260517 3300037068 Unclassified 1393
815 Ga0373925_0345481 3300037068 Bacteria 1207
816 Ga0373925_1322675 3300037068 Unclassified 591
817 Ga0395900_1139148 3300037418 Bacteria 697
818 Ga0436364_0446884 3300037853 Unclassified 1756
819 Ga0436364_1057791 3300037853 Unclassified 1139
820 Ga0395901_0210588 3300038443 Bacteria 2035
821 Ga0436365_0750651 3300039437 Bacteria 974
822 Ga0436365_1544655 3300039437 Unclassified 1038
823 Ga0436365_1710842 3300039437 Bacteria 882
824 Ga0436361_0604920 3300039447 Unclassified 715
825 Ga0436363_0097650 3300039450 Unclassified 3836
826 Ga0436363_1113891 3300039450 Bacteria 1426
827 Ga0436363_1282358 3300039450 Bacteria 933
828 Ga0436363_1442918 3300039450 Unclassified 654
829 Ga0436362_1215023 3300039453 Bacteria 969
830 Ga0451577_0033862 3300042876 Bacteria 4606
831 Ga0451577_0144566 3300042876 Bacteria 2138
832 Ga0453683_0008301 3300044673 Bacteria 6980
833 Ga0453683_0025320 3300044673 Bacteria 3771
834 Ga0453683_0164664 3300044673 Bacteria 1403
835 Ga0466963_0093803 3300044694 Bacteria 2047
836 Ga0466963_0901932 3300044694 Bacteria 623
837 Ga0466964_0062408 3300044706 Bacteria 1554
838 Ga0466964_0719390 3300044706 Bacteria 558
839 Ga0453684_0008254 3300044712 Bacteria 18771
840 Ga0453684_0118899 3300044712 Bacteria 3195
841 Ga0466971_0031072 3300044719 Bacteria 2391
842 Ga0466968_0318708 3300044735 Bacteria 751
843 Ga0466957_0220959 3300044842 Bacteria 1251
844 Ga0466959_0147994 3300045049 Unclassified 1657
845 Ga0466959_0547691 3300045049 Unclassified 780
846 Ga0451576_0028688 3300045051 Bacteria 5959
847 Ga0451576_0176996 3300045051 Bacteria 2227
848 Ga0451576_0582113 3300045051 Unclassified 1176
849 Ga0451576_0605415 3300045051 Unclassified 1152
850 Ga0466958_0127737 3300045836 Bacteria 1595
851 Ga0466958_0178492 3300045836 Bacteria 1347
852 Ga0466958_0632017 3300045836 Bacteria 697
853 Ga0466967_0010975 3300045976 Bacteria 6830
854 Ga0466967_0409569 3300045976 Bacteria 1320
855 Ga0466967_0505766 3300045976 Bacteria 1186
856 Ga0466967_1415316 3300045976 Unclassified 692
857 Ga0495592_0920997 3300046454 Unclassified 513
858 Ga0495580_0001362 3300046472 Bacteria 21499
859 Ga0495580_0002000 3300046472 Bacteria 17938
860 Ga0495580_0004144 3300046472 Bacteria 12208
861 Ga0495580_0004450 3300046472 Bacteria 11775
862 Ga0495580_0048785 3300046472 Bacteria 2996
863 Ga0495580_0049837 3300046472 Bacteria 2962
864 Ga0495580_0057500 3300046472 Bacteria 2737
865 Ga0495580_0082739 3300046472 Bacteria 2237
866 Ga0495580_0097614 3300046472 Bacteria 2043
867 Ga0495580_0551582 3300046472 Unclassified 765
868 Ga0495580_0661659 3300046472 Unclassified 686
869 Ga0495582_0000442 3300046473 Bacteria 22703
870 Ga0495582_0194132 3300046473 Bacteria 1159
871 Ga0495582_0372507 3300046473 Bacteria 823
872 Ga0495664_0592134 3300046477 Bacteria 659
873 Ga0495630_0074729 3300046517 Bacteria 2553
874 Ga0495630_0352971 3300046517 Unclassified 1125
875 Ga0495630_0508223 3300046517 Bacteria 924
876 Ga0495630_0844955 3300046517 Bacteria 698
877 Ga0495666_0106417 3300046526 Bacteria 1320
878 Ga0495666_0418944 3300046526 Unclassified 601
879 Ga0495665_0001834 3300046531 Bacteria 11472
880 Ga0495665_0021353 3300046531 Unclassified 3478
881 Ga0495587_0073742 3300046536 Bacteria 1983
882 Ga0495622_0417321 3300046557 Unclassified 577
883 Ga0495634_0695181 3300046642 Unclassified 585
884 Ga0495623_0067164 3300046679 Bacteria 2239
885 Ga0495623_0420641 3300046679 Unclassified 716
886 Ga0495623_0499121 3300046679 Bacteria 643
887 Ga0495624_0079273 3300046690 Bacteria 2037
888 Ga0495624_0406138 3300046690 Unclassified 818
889 Ga0495624_0759689 3300046690 Bacteria 574
890 Ga0495581_0010039 3300047315 Bacteria 5477
891 Ga0495604_0582206 3300047317 Bacteria 719
892 Ga0495674_0083043 3300047319 Bacteria 2747
893 Ga0495674_0555651 3300047319 Bacteria 913
894 Ga0495674_1226403 3300047319 Bacteria 566
895 Ga0495676_0376697 3300047321 Bacteria 945
896 Ga0495675_0341546 3300047444 Bacteria 882
897 Ga0495593_0357067 3300047673 Unclassified 730
898 Ga0495602_0283361 3300048088 Bacteria 1220
899 Ga0495602_0302428 3300048088 Unclassified 1170
900 Ga0495602_0315696 3300048088 Unclassified 1139
901 Ga0495602_0324986 3300048088 Unclassified 1118
902 Ga0495602_0792054 3300048088 Unclassified 637
903 Ga0495602_1108045 3300048088 Bacteria 519
904 Ga0496100_0027206 3300048903 Unclassified 3515
905 Ga0496100_0140408 3300048903 Bacteria 1712
906 Ga0496101_0002158 3300048904 Bacteria 12017
907 Ga0496101_0182831 3300048904 Bacteria 1615
908 Ga0496101_0544469 3300048904 Unclassified 918
909 Ga0496101_0737829 3300048904 Unclassified 777
910 Ga0496102_0036185 3300048905 Unclassified 4447
911 Ga0496102_0050905 3300048905 Bacteria 3773
912 Ga0496102_0059439 3300048905 Bacteria 3495
913 Ga0496102_0095153 3300048905 Bacteria 2760
914 Ga0496102_0181158 3300048905 Bacteria 1985
915 Ga0496102_0695720 3300048905 Bacteria 940
916 Ga0496103_0009501 3300048906 Bacteria 5757
917 Ga0496103_0127005 3300048906 Bacteria 1627
918 Ga0496103_0299507 3300048906 Unclassified 1034
919 Ga0496104_0030432 3300048907 Bacteria 5016
920 Ga0496104_0060216 3300048907 Unclassified 3597
921 Ga0496104_0061805 3300048907 Bacteria 3551
922 Ga0496104_0174222 3300048907 Bacteria 2062
923 Ga0496104_1519037 3300048907 Unclassified 572
924 Ga0496105_0071678 3300048908 Unclassified 2863
925 Ga0496105_0160353 3300048908 Bacteria 1846
926 Ga0496105_0246944 3300048908 Bacteria 1447
927 Ga0496105_0685686 3300048908 Unclassified 788
928 Ga0496105_1047836 3300048908 Unclassified 608
929 Ga0496106_0025440 3300048909 Bacteria 4406
930 Ga0496106_0071315 3300048909 Unclassified 2655
931 Ga0496106_0086888 3300048909 Unclassified 2409
932 Ga0496107_0135205 3300048910 Bacteria 1821
933 Ga0496107_0167848 3300048910 Unclassified 1628
934 Ga0496107_0208689 3300048910 Bacteria 1452
935 Ga0496107_1144511 3300048910 Unclassified 561
936 Ga0496108_0227371 3300048911 Bacteria 1622
937 Ga0496108_0655864 3300048911 Unclassified 912
938 Ga0496108_1057295 3300048911 Bacteria 691
939 Ga0496108_1556438 3300048911 Unclassified 548
940 Ga0496109_0107079 3300048912 Bacteria 2597
941 Ga0496109_0219233 3300048912 Bacteria 1789
942 Ga0496109_0505355 3300048912 Bacteria 1141
943 Ga0496109_0662199 3300048912 Bacteria 981
944 Ga0496110_0467021 3300048913 Unclassified 1150
945 Ga0496110_0676463 3300048913 Bacteria 933
946 Ga0496112_0005343 3300048915 Bacteria 11090
947 Ga0496112_0005971 3300048915 Bacteria 10624
948 Ga0496112_0033148 3300048915 Bacteria 5019
949 Ga0496112_0050298 3300048915 Bacteria 4087
950 Ga0496112_0139450 3300048915 Unclassified 2394
951 Ga0496112_0690632 3300048915 Bacteria 949
952 Ga0496112_1048301 3300048915 Unclassified 734
953 Ga0496112_1161867 3300048915 Unclassified 689
954 Ga0496112_1331426 3300048915 Bacteria 633
955 Ga0496113_0224408 3300048916 Bacteria 1498
956 Ga0496113_0358419 3300048916 Bacteria 1170
957 Ga0496113_0655565 3300048916 Unclassified 839
958 Ga0496114_0025952 3300048917 Bacteria 4794
959 Ga0496115_0007193 3300048918 Bacteria 8178
960 Ga0501067_0286487 3300049583 Unclassified 917
961 nmdc:mga05p37_347512_c2 3300050507 Unclassified 1203
962 nmdc:mga06r32_19912_c1 3300050510 Bacteria 6168
963 nmdc:mga08y16_216368_c1 3300050511 Bacteria 1984
964 nmdc:mga0n895_168541_c1 3300050512 Bacteria 2222
965 nmdc:mga0n895_6632_c1 3300050512 Bacteria 9859
966 nmdc:mga0rr50_1064007_c1 3300050513 Unclassified 688
967 nmdc:mga0rr50_1742336_c1 3300050513 Unclassified 525
968 nmdc:mga0rr50_318221_c1 3300050513 Unclassified 1304
969 nmdc:mga0rr50_4024_c1 3300050513 Bacteria 8574
970 nmdc:mga0rr50_772475_c1 3300050513 Unclassified 820
971 nmdc:mga0rr50_7995_c1 3300050513 Bacteria 6559
972 nmdc:mga08x19_122822_c1 3300050514 Unclassified 1742
973 nmdc:mga08x19_1403_c1 3300050514 Bacteria 14894
974 nmdc:mga08x19_3215_c1 3300050514 Bacteria 9795
975 nmdc:mga08x19_402984_c1 3300050514 Unclassified 960
976 nmdc:mga0a205_1274666_c1 3300050515 Unclassified 583
977 Ga0495612_0099695 3300053078 Bacteria 1236
978 Ga0395900_1098436
979 Ga0065712_10120769
980 Ga0065712_10770360
981 Ga0065715_10717049
982 Ga0065707_10364680
983 Ga0070676_10002367
984 Ga0070683_100116342
985 Ga0070683_100521406
986 Ga0070690_100604834
987 Ga0070670_100011355
988 Ga0068869_100083221
989 Ga0068869_101451373
990 Ga0068869_101498839
991 Ga0070666_10064179
992 Ga0070680_100071375
993 Ga0070680_100129333
994 Ga0070680_100280675
995 Ga0070682_100024949
996 Ga0068868_100001273
997 Ga0068868_100012002
998 Ga0068868_100157662
999 Ga0068868_100895602
1000 Ga0068868_101584242
1001 Ga0070660_100125313
1002 Ga0070660_100277780
1003 Ga0070660_101706163
1004 Ga0070689_100079619
1005 Ga0070691_10254511
1006 Ga0070661_100167071
1007 Ga0070661_100584755
1008 Ga0070692_10418498
1009 Ga0070692_10596174
1010 Ga0070668_100021068
1011 Ga0070669_100114684
1012 Ga0070675_100591016
1013 Ga0070671_101212451
1014 Ga0070674_100302941
1015 Ga0070673_100182094
1016 Ga0070673_101816789
1017 Ga0070688_100279213
1018 Ga0070659_100009578
1019 Ga0070659_100253752
1020 Ga0070667_100273641
1021 Ga0070667_100386855
1022 Ga0070703_10252975
1023 Ga0070709_10000974
1024 Ga0070709_10016355
1025 Ga0070709_10081981
1026 Ga0070709_10094647
1027 Ga0070709_10142647
1028 Ga0070709_10339576
1029 Ga0070709_10382894
1030 Ga0070709_10460908
1031 Ga0070709_11134546
1032 Ga0070709_11255929
1033 Ga0070714_100026803
1034 Ga0070714_100048541
1035 Ga0070714_100051479
1036 Ga0070714_100163160
1037 Ga0070714_100164098
1038 Ga0070714_100380501
1039 Ga0070714_100670545
1040 Ga0070714_100943388
1041 Ga0070714_100961971
1042 Ga0070714_101078121
1043 Ga0070714_102068822
1044 Ga0070713_100000034
1045 Ga0070713_100041044
1046 Ga0070713_100049038
1047 Ga0070713_100078119
1048 Ga0070713_100079639
1049 Ga0070713_100100991
1050 Ga0070713_100274660
1051 Ga0070713_100302295
1052 Ga0070713_100313998
1053 Ga0070713_100392593
1054 Ga0070713_100467966
1055 Ga0070713_100728612
1056 Ga0070713_100939664
1057 Ga0070713_101490312
1058 Ga0070713_101630695
1059 Ga0070713_101805904
1060 Ga0070710_10012360
1061 Ga0070710_10020111
1062 Ga0070710_10026854
1063 Ga0070710_10341970
1064 Ga0070710_10527453
1065 Ga0070710_11057260
1066 Ga0070701_10035602
1067 Ga0070711_100000146
1068 Ga0070711_100009798
1069 Ga0070711_100022658
1070 Ga0070711_100069134
1071 Ga0070711_100122145
1072 Ga0070711_100383483
1073 Ga0070711_101511281
1074 Ga0070711_101629070
1075 Ga0070711_101912421
1076 Ga0070705_100812432
1077 Ga0070694_100048822
1078 Ga0070694_100286547
1079 Ga0070708_100000650
1080 Ga0070708_100009490
1081 Ga0070708_100148845
1082 Ga0070708_100180519
1083 Ga0070708_100195638
1084 Ga0070708_101020170
1085 Ga0070708_101098894
1086 Ga0070708_101247174
1087 Ga0070708_101786702
1088 Ga0070663_100570099
1089 Ga0070678_100150560
1090 Ga0070678_100605833
1091 Ga0070662_100898603
1092 Ga0070681_10000377
1093 Ga0070681_10028330
1094 Ga0070681_10166543
1095 Ga0068867_100014152
1096 Ga0068867_100090433
1097 Ga0068867_101192018
1098 Ga0070685_10633677
1099 Ga0070706_100075176
1100 Ga0070706_100327234
1101 Ga0070706_100401864
1102 Ga0070706_100482795
1103 Ga0070707_100006085
1104 Ga0070707_100018634
1105 Ga0070707_100307075
1106 Ga0070707_100312705
1107 Ga0070707_100462916
1108 Ga0070707_100973476
1109 Ga0070707_101502183
1110 Ga0070707_101519233
1111 Ga0070707_101531467
1112 Ga0070698_100231122
1113 Ga0070698_100671062
1114 Ga0070698_101525288
1115 Ga0070699_100388680
1116 Ga0070699_101440218
1117 Ga0070699_101674528
1118 Ga0070699_101960718
1119 Ga0070679_100009688
1120 Ga0070679_100120514
1121 Ga0070679_100320985
1122 Ga0070679_100601215
1123 Ga0070684_100187574
1124 Ga0070684_101565390
1125 Ga0070684_102143536
1126 Ga0070697_100000054
1127 Ga0070697_100017898
1128 Ga0070697_100196733
1129 Ga0070697_100224367
1130 Ga0070697_100313027
1131 Ga0070697_100489116
1132 Ga0070697_100524919
1133 Ga0070697_101069367
1134 Ga0070697_101563402
1135 Ga0068853_100017902
1136 Ga0068853_100148874
1137 Ga0068853_100209068
1138 Ga0068853_100694156
1139 Ga0070672_100297271
1140 Ga0070686_100788128
1141 Ga0070695_100079673
1142 Ga0070695_100438380
1143 Ga0070695_100909232
1144 Ga0070696_100158453
1145 Ga0070696_100446788
1146 Ga0070696_101750127
1147 Ga0070693_100240083
1148 Ga0070693_100300934
1149 Ga0070693_101277284
1150 Ga0070665_100025769
1151 Ga0070704_100648819
1152 Ga0070704_101131612
1153 Ga0068855_100001121
1154 Ga0068855_100003109
1155 Ga0068855_100070544
1156 Ga0068855_100260828
1157 Ga0068855_101287332
1158 Ga0070664_100003491
1159 Ga0070664_100159389
1160 Ga0068857_100001087
1161 Ga0068857_100006322
1162 Ga0068857_100017859
1163 Ga0068857_101451029
1164 Ga0068857_101701870
1165 Ga0068854_100001857
1166 Ga0068854_100018005
1167 Ga0068854_100932982
1168 Ga0068854_102011753
1169 Ga0068856_100001572
1170 Ga0068856_100004735
1171 Ga0068856_100030022
1172 Ga0068856_100069904
1173 Ga0068856_100121562
1174 Ga0068856_100190538
1175 Ga0068856_100342117
1176 Ga0068856_100386871
1177 Ga0068856_100917036
1178 Ga0070702_101650852
1179 Ga0068852_100166359
1180 Ga0068852_101171454
1181 Ga0068852_101302895
1182 Ga0068859_100000212
1183 Ga0068859_100012600
1184 Ga0068859_101358363
1185 Ga0068864_100005484
1186 Ga0068864_100101200
1187 Ga0068864_100458419
1188 Ga0068864_100817087
1189 Ga0068866_10002561
1190 Ga0068866_10136615
1191 Ga0068866_10207359
1192 Ga0068866_10216270
1193 Ga0068861_100261937
1194 Ga0068861_100309728
1195 Ga0068851_10007013
1196 Ga0068851_10448930
1197 Ga0068870_10181351
1198 Ga0068863_100022000
1199 Ga0068863_100052481
1200 Ga0068863_100158640
1201 Ga0068863_100177775
1202 Ga0068863_100191173
1203 Ga0068863_100501767
1204 Ga0068858_100004036
1205 Ga0068858_100041953
1206 Ga0068858_100384442
1207 Ga0068858_100631046
1208 Ga0068858_102418901
1209 Ga0068860_100145523
1210 Ga0068860_100339588
1211 Ga0068860_100572145
1212 Ga0068860_101282780
1213 Ga0068860_101626291
1214 Ga0068862_100140377
1215 Ga0068862_100268300
1216 Ga0068862_101424674
1217 Ga0081540_1056259
1218 Ga0070717_10000783
1219 Ga0070717_10001830
1220 Ga0070717_10015827
1221 Ga0070717_10027647
1222 Ga0070717_10028400
1223 Ga0070717_10034022
1224 Ga0070717_10042990
1225 Ga0070717_10053292
1226 Ga0070717_10069754
1227 Ga0070717_10087653
1228 Ga0070717_10247820
1229 Ga0070717_10380763
1230 Ga0070717_10408917
1231 Ga0070717_10495216
1232 Ga0070717_11131185
1233 Ga0070717_11881944
1234 Ga0070715_10020921
1235 Ga0070715_10022382
1236 Ga0070715_10090119
1237 Ga0070715_10110651
1238 Ga0070715_10237985
1239 Ga0070715_10369812
1240 Ga0070715_10792930
1241 Ga0070716_100000923
1242 Ga0070716_100007179
1243 Ga0070716_100007927
1244 Ga0070716_100008906
1245 Ga0070716_100046037
1246 Ga0070716_100127741
1247 Ga0070716_100213147
1248 Ga0070716_100242529
1249 Ga0070716_100426417
1250 Ga0070716_100530219
1251 Ga0070716_101492507
1252 Ga0070712_100000020
1253 Ga0070712_100001031
1254 Ga0070712_100002971
1255 Ga0070712_100072046
1256 Ga0070712_100086934
1257 Ga0070712_100103143
1258 Ga0070712_100116259
1259 Ga0070712_100481776
1260 Ga0070712_100581626
1261 Ga0070712_100819713
1262 Ga0097621_100002049
1263 Ga0097621_100004009
1264 Ga0097621_100058344
1265 Ga0097621_100183041
1266 Ga0097621_100286834
1267 Ga0097621_100775720
1268 Ga0097621_101129161
1269 Ga0097621_101560671
1270 Ga0068871_100002003
1271 Ga0068871_100032606
1272 Ga0068871_100035240
1273 Ga0068871_100056574
1274 Ga0068871_100216798
1275 Ga0068871_100673143
1276 Ga0068871_101041880
1277 Ga0068871_101560866
1278 Ga0075428_100008382
1279 Ga0075431_100046799
1280 Ga0075433_11523332
1281 Ga0075434_100028248
1282 Ga0075434_100236454
1283 Ga0068865_100199141
1284 Ga0075436_100000876
1285 Ga0075436_100002383
1286 Ga0075436_100085157
1287 Ga0075436_100090407
1288 Ga0075436_100522543
1289 Ga0097620_100000212
1290 Ga0097620_100012600
1291 Ga0097620_101358352
1292 Ga0075435_100000708
1293 Ga0075435_100011313
1294 Ga0075435_100483743
1295 Ga0075435_100742539
1296 Ga0075435_100901228
1297 Ga0099794_10020695
1298 Ga0099794_10276002
1299 Ga0099795_10071744
1300 Ga0099795_10279114
1301 Ga0099795_10300733
1302 Ga0099795_10660326
1303 Ga0105251_10142815
1304 Ga0105250_10098912
1305 Ga0105250_10132821
1306 Ga0105250_10162909
1307 Ga0105240_10010302
1308 Ga0105240_10019089
1309 Ga0105240_10022087
1310 Ga0105240_10026956
1311 Ga0105240_10043487
1312 Ga0105240_10088373
1313 Ga0105240_10149523
1314 Ga0105240_10228754
1315 Ga0105240_10501666
1316 Ga0105240_11821688
1317 Ga0105240_12620801
1318 Ga0111539_10275868
1319 Ga0105245_10089104
1320 Ga0105245_10145895
1321 Ga0105245_10364718
1322 Ga0105245_11326194
1323 Ga0105245_11718262
1324 Ga0105245_13203829
1325 Ga0105247_10004327
1326 Ga0105247_10205696
1327 Ga0105247_10595172
1328 Ga0105247_11848767
1329 Ga0114129_10995017
1330 Ga0105243_10049197
1331 Ga0105241_10004302
1332 Ga0105241_10007461
1333 Ga0105241_10015748
1334 Ga0105241_10071397
1335 Ga0105241_10126226
1336 Ga0105241_10136533
1337 Ga0105241_10213905
1338 Ga0105241_10477070
1339 Ga0105241_10529823
1340 Ga0105241_11467703
1341 Ga0105242_10063427
1342 Ga0105242_10760952
1343 Ga0105242_12212778
1344 Ga0105248_10032421
1345 Ga0105248_10035583
1346 Ga0105248_10309338
1347 Ga0105248_10333883
1348 Ga0105237_10049900
1349 Ga0105237_10058035
1350 Ga0105237_10258721
1351 Ga0105237_10334053
1352 Ga0105237_10365371
1353 Ga0105237_10543417
1354 Ga0105237_10596661
1355 Ga0105237_11047160
1356 Ga0105237_11135093
1357 Ga0105237_11507023
1358 Ga0105237_11895213
1359 Ga0105237_12599440
1360 Ga0105238_10000064
1361 Ga0105238_10029631
1362 Ga0105238_10102411
1363 Ga0105238_10372482
1364 Ga0105238_10405307
1365 Ga0105238_10712117
1366 Ga0105238_12199816
1367 Ga0105249_10010752
1368 Ga0105249_10138087
1369 Ga0105249_10480618
1370 Ga0105249_12080113
1371 Ga0099796_10426806
1372 Ga0099796_10563963
1373 Ga0105239_10027920
1374 Ga0105239_10077907
1375 Ga0105239_10155923
1376 Ga0105239_10228131
1377 Ga0105239_10466707
1378 Ga0105239_11278799
1379 Ga0105239_12437921
1380 Ga0105246_10191097
1381 Ga0105246_10232936
1382 Ga0105246_10743852
1383 Ga0157373_10009390
1384 Ga0157373_10092244
1385 Ga0157373_10207408
1386 Ga0157373_10233970
1387 Ga0157373_10283949
1388 Ga0157373_10332904
1389 Ga0157373_10527078
1390 Ga0157373_11582943
1391 Ga0157371_10009629
1392 Ga0157371_10090948
1393 Ga0157371_10298053
1394 Ga0157370_10090313
1395 Ga0157370_10159142
1396 Ga0157370_10359581
1397 Ga0157370_10616772
1398 Ga0157370_10829662
1399 Ga0157370_11070760
1400 Ga0157369_10000506
1401 Ga0157369_10010162
1402 Ga0157369_10035511
1403 Ga0157369_10067761
1404 Ga0157369_10085630
1405 Ga0157369_10326618
1406 Ga0157369_10725761
1407 Ga0157374_10000140
1408 Ga0157374_10000142
1409 Ga0157374_10007649
1410 Ga0157374_10026203
1411 Ga0157374_10026373
1412 Ga0157374_10062360
1413 Ga0157374_10116750
1414 Ga0157374_10121018
1415 Ga0157378_10000135
1416 Ga0157378_10003940
1417 Ga0157378_10004347
1418 Ga0157378_10016335
1419 Ga0157378_10043483
1420 Ga0157378_10061121
1421 Ga0157378_10063087
1422 Ga0157378_10392030
1423 Ga0163162_10003913
1424 Ga0163162_10070206
1425 Ga0163162_10076256
1426 Ga0163162_10288068
1427 Ga0163162_10564314
1428 Ga0157372_10000516
1429 Ga0157372_10001178
1430 Ga0157372_10001443
1431 Ga0157372_10001921
1432 Ga0157372_10013898
1433 Ga0157372_10025104
1434 Ga0157372_10072284
1435 Ga0157372_10104094
1436 Ga0157372_10175689
1437 Ga0157372_10358100
1438 Ga0157372_10457759
1439 Ga0157372_11331521
1440 Ga0157372_12566799
1441 Ga0157372_13411276
1442 Ga0157375_10038435
1443 Ga0157375_12126062
1444 Ga0163163_10067503
1445 Ga0163163_10184762
1446 Ga0163163_10316519
1447 Ga0163163_10512864
1448 Ga0163163_10812179
1449 Ga0163163_12838973
1450 Ga0157380_11846809
1451 Ga0182008_10004763
1452 Ga0157377_11649348
1453 Ga0157379_10003068
1454 Ga0157379_10012561
1455 Ga0157379_10225424
1456 Ga0157379_10636997
1457 Ga0157376_10015466
1458 Ga0157376_10023577
1459 Ga0157376_10026825
1460 Ga0157376_10054603
1461 Ga0182006_1021602
1462 Ga0182007_10013047
1463 Ga0182005_1083525
1464 Ga0213874_10248948
1465 Ga0213875_10070567
1466 Ga0224572_1002702
1467 Ga0228598_1095940
1468 Ga0207656_10014893
1469 Ga0207656_10365023
1470 Ga0207653_10210622
1471 Ga0207692_10026553
1472 Ga0207692_10081551
1473 Ga0207692_10126587
1474 Ga0207692_10234029
1475 Ga0207642_10040486
1476 Ga0207642_10063498
1477 Ga0207710_10107926
1478 Ga0207710_10136859
1479 Ga0207710_10653220
1480 Ga0207688_10339579
1481 Ga0207680_10045799
1482 Ga0207680_11171619
1483 Ga0207647_10043651
1484 Ga0207647_10162970
1485 Ga0207685_10014585
1486 Ga0207685_10018512
1487 Ga0207685_10677056
1488 Ga0207699_10003179
1489 Ga0207699_10023765
1490 Ga0207699_10063009
1491 Ga0207699_10074645
1492 Ga0207699_10103159
1493 Ga0207699_10277692
1494 Ga0207699_10296370
1495 Ga0207699_10308697
1496 Ga0207699_10425226
1497 Ga0207699_10660533
1498 Ga0207699_11376067
1499 Ga0207645_10004401
1500 Ga0207684_10317627
1501 Ga0207684_10387670
1502 Ga0207684_10806829
1503 Ga0207654_10011224
1504 Ga0207654_10022231
1505 Ga0207654_10064282
1506 Ga0207654_10067830
1507 Ga0207654_10387456
1508 Ga0207654_10663797
1509 Ga0207707_10003767
1510 Ga0207707_10125676
1511 Ga0207707_10209066
1512 Ga0207695_10005740
1513 Ga0207695_10045944
1514 Ga0207695_10080073
1515 Ga0207695_10143376
1516 Ga0207695_10213209
1517 Ga0207695_10233404
1518 Ga0207695_10610852
1519 Ga0207695_11383745
1520 Ga0207695_11446792
1521 Ga0207671_10290971
1522 Ga0207671_10469577
1523 Ga0207671_10644725
1524 Ga0207671_10844690
1525 Ga0207671_11067023
1526 Ga0207671_11288485
1527 Ga0207693_10000080
1528 Ga0207693_10000173
1529 Ga0207693_10005546
1530 Ga0207693_10010314
1531 Ga0207693_10024452
1532 Ga0207693_10050011
1533 Ga0207693_10054090
1534 Ga0207693_10094388
1535 Ga0207693_10375256
1536 Ga0207693_11401083
1537 Ga0207663_10006520
1538 Ga0207663_10015151
1539 Ga0207663_10058477
1540 Ga0207663_10107543
1541 Ga0207663_10171249
1542 Ga0207663_10171430
1543 Ga0207663_10850345
1544 Ga0207663_11013072
1545 Ga0207663_11281179
1546 Ga0207660_10051503
1547 Ga0207660_10059699
1548 Ga0207660_10118592
1549 Ga0207660_10287700
1550 Ga0207657_10000215
1551 Ga0207657_10212296
1552 Ga0207649_10228982
1553 Ga0207652_10022145
1554 Ga0207652_10214386
1555 Ga0207652_10351898
1556 Ga0207652_10629610
1557 Ga0207646_10000165
1558 Ga0207646_10233637
1559 Ga0207646_10465268
1560 Ga0207646_10594871
1561 Ga0207646_11001005
1562 Ga0207646_11080195
1563 Ga0207646_11771721
1564 Ga0207681_10089709
1565 Ga0207694_10000835
1566 Ga0207694_10007028
1567 Ga0207694_10158574
1568 Ga0207694_10414697
1569 Ga0207694_10832144
1570 Ga0207650_10001281
1571 Ga0207650_10053376
1572 Ga0207659_10085626
1573 Ga0207659_10697875
1574 Ga0207687_10005132
1575 Ga0207687_10027572
1576 Ga0207700_10000364
1577 Ga0207700_10021287
1578 Ga0207700_10038051
1579 Ga0207700_10059887
1580 Ga0207700_10120883
1581 Ga0207700_10130716
1582 Ga0207700_10254186
1583 Ga0207700_10308298
1584 Ga0207700_10359334
1585 Ga0207700_10441610
1586 Ga0207700_10455204
1587 Ga0207700_10603111
1588 Ga0207700_10967057
1589 Ga0207700_11465336
1590 Ga0207700_11579496
1591 Ga0207700_11725462
1592 Ga0207664_10004399
1593 Ga0207664_10021424
1594 Ga0207664_10030515
1595 Ga0207664_10052162
1596 Ga0207664_10087681
1597 Ga0207664_10141447
1598 Ga0207664_10269082
1599 Ga0207664_10316631
1600 Ga0207664_10602232
1601 Ga0207664_10696057
1602 Ga0207664_10755063
1603 Ga0207664_11684296
1604 Ga0207690_10147586
1605 Ga0207690_10238690
1606 Ga0207706_10002361
1607 Ga0207686_10901209
1608 Ga0207686_11551085
1609 Ga0207686_11558449
1610 Ga0207709_10552504
1611 Ga0207669_11099925
1612 Ga0207704_10003968
1613 Ga0207704_11944426
1614 Ga0207665_10010667
1615 Ga0207665_10011380
1616 Ga0207665_10014315
1617 Ga0207665_10079496
1618 Ga0207665_10116510
1619 Ga0207665_10238114
1620 Ga0207665_10593395
1621 Ga0207665_10646267
1622 Ga0207665_10871959
1623 Ga0207665_11098887
1624 Ga0207665_11281667
1625 Ga0207691_10270220
1626 Ga0207711_10002367
1627 Ga0207711_10264459
1628 Ga0207711_10568153
1629 Ga0207689_10574775
1630 Ga0207689_11557082
1631 Ga0207661_10011078
1632 Ga0207661_10058574
1633 Ga0207661_10235904
1634 Ga0207679_10001041
1635 Ga0207679_10166084
1636 Ga0207667_10000421
1637 Ga0207667_10002272
1638 Ga0207667_10034607
1639 Ga0207667_10195648
1640 Ga0207667_11291084
1641 Ga0207651_10065239
1642 Ga0207712_10036259
1643 Ga0207640_10003915
1644 Ga0207640_10012996
1645 Ga0207640_10047353
1646 Ga0207640_10693703
1647 Ga0207658_10946705
1648 Ga0207658_11528447
1649 Ga0207658_11587336
1650 Ga0207677_10002537
1651 Ga0207677_10008028
1652 Ga0207677_10654452
1653 Ga0207677_12073443
1654 Ga0207703_10002538
1655 Ga0207703_10160661
1656 Ga0207703_10314679
1657 Ga0207703_10915344
1658 Ga0207703_11612221
1659 Ga0207703_11839417
1660 Ga0207639_10095933
1661 Ga0207639_10178381
1662 Ga0207639_10285694
1663 Ga0207639_10728045
1664 Ga0207678_10000874
1665 Ga0207708_11379634
1666 Ga0207702_10000219
1667 Ga0207702_10009031
1668 Ga0207702_10021806
1669 Ga0207702_10022048
1670 Ga0207702_10029476
1671 Ga0207702_10185748
1672 Ga0207702_10381854
1673 Ga0207702_10491841
1674 Ga0207702_12240628
1675 Ga0207641_10033410
1676 Ga0207641_10184261
1677 Ga0207641_10214578
1678 Ga0207641_10451159
1679 Ga0207648_10004716
1680 Ga0207648_10013735
1681 Ga0207648_10458942
1682 Ga0207676_10003507
1683 Ga0207676_10078264
1684 Ga0207676_10706310
1685 Ga0207676_10945023
1686 Ga0207674_10000190
1687 Ga0207674_10015313
1688 Ga0207674_10037539
1689 Ga0207674_10315400
1690 Ga0207674_10714909
1691 Ga0207674_11506171
1692 Ga0207675_100264085
1693 Ga0207675_100308583
1694 Ga0207683_10046033
1695 Ga0207683_10652873
1696 Ga0207698_10004440
1697 Ga0207698_11290100
1698 Ga0207698_11553488
1699 Ga0207428_10208608
1700 Ga0265354_1001563
1701 Ga0265354_1016478
1702 Ga0265356_1014986
1703 Ga0268266_10008393
1704 Ga0268265_10056372
1705 Ga0268265_10501906
1706 Ga0268264_10009779
1707 Ga0268264_10497306
1708 Ga0268264_10764901
1709 Ga0268264_10807567
1710 Ga0268264_11363388
1711 Ga0268264_11656541
1712 Ga0265338_10018837
1713 Ga0265338_10415312
1714 Ga0265324_10093456
1715 Ga0265762_1008767
1716 Ga0265770_1000702
1717 Ga0265770_1014935
1718 Ga0265765_1059372
1719 Ga0265760_10023867
1720 Ga0265760_10026149
1721 Ga0265330_10016525
1722 Ga0265328_10177734
1723 Ga0265325_10186341
1724 Ga0265329_10088738
1725 Ga0265340_10087205
1726 Ga0265340_10171376
1727 Ga0265340_10298804
1728 Ga0265339_10018569
1729 Ga0265339_10019951
1730 Ga0265316_10003557
1731 Ga0265316_10184896
1732 Ga0265314_10000198
1733 Ga0265314_10013916
1734 Ga0265314_10113677
1735 Ga0373930_0014086
1736 Ga0373958_0085639
1737 Ga0373926_0000501
1738 Ga0373928_0137483
1739 Ga0373929_0061106
1740 Ga0373929_0086965
1741 Ga0373940_0140647
1742 Ga0373952_0030277
1743 Ga0373923_0028307
1744 Ga0373932_0020641
1745 Ga0373932_0053553
1746 Ga0373936_0053789
1747 Ga0373936_0088441
1748 Ga0373939_0154780
1749 Ga0373941_0336841
1750 Ga0373945_0032618
1751 Ga0373945_0589084
1752 Ga0373960_0041318
1753 Ga0373960_0057269
1754 Ga0373943_0055135
1755 Ga0373943_0130504
1756 Ga0373943_0208818
1757 Ga0373943_0672014
1758 Ga0373942_0036873
1759 Ga0373942_0162962
1760 Ga0373931_0033225
1761 Ga0373931_0081486
1762 Ga0373931_0114270
1763 Ga0373931_0115285
1764 Ga0373931_0142160
1765 Ga0373931_0169238
1766 Ga0373931_0211924
1767 Ga0373935_0005508
1768 Ga0373935_0200945
1769 Ga0373935_0207054
1770 Ga0373935_0806118
1771 Ga0373927_0010674
1772 Ga0373927_0025477
1773 Ga0373927_0057773
1774 Ga0373927_0094843
1775 Ga0373927_0250252
1776 Ga0373933_0038561
1777 Ga0373933_1156514
1778 Ga0373947_0002625
1779 Ga0373947_0438649
1780 Ga0373947_0459143
1781 Ga0373937_0324632
1782 Ga0373937_0399278
1783 Ga0373937_0680256
1784 Ga0373937_0944314
1785 Ga0373937_1030230
1786 Ga0373937_1128343
1787 Ga0373925_0003990
1788 Ga0373925_0037892
1789 Ga0373925_0039044
1790 Ga0373925_0087346
1791 Ga0373925_0260517
1792 Ga0373925_0345481
1793 Ga0373925_1322675
1794 Ga0395900_1139148
1795 Ga0436364_0446884
1796 Ga0436364_1057791
1797 Ga0395901_0210588
1798 Ga0436365_0750651
1799 Ga0436365_1544655
1800 Ga0436365_1710842
1801 Ga0436361_0604920
1802 Ga0436363_0097650
1803 Ga0436363_1113891
1804 Ga0436363_1282358
1805 Ga0436363_1442918
1806 Ga0436362_1215023
1807 Ga0451577_0033862
1808 Ga0451577_0144566
1809 Ga0453683_0008301
1810 Ga0453683_0025320
1811 Ga0453683_0164664
1812 Ga0466963_0093803
1813 Ga0466963_0901932
1814 Ga0466964_0062408
1815 Ga0466964_0719390
1816 Ga0453684_0008254
1817 Ga0453684_0118899
1818 Ga0466971_0031072
1819 Ga0466968_0318708
1820 Ga0466957_0220959
1821 Ga0466959_0147994
1822 Ga0466959_0547691
1823 Ga0451576_0028688
1824 Ga0451576_0176996
1825 Ga0451576_0582113
1826 Ga0451576_0605415
1827 Ga0466958_0127737
1828 Ga0466958_0178492
1829 Ga0466958_0632017
1830 Ga0466967_0010975
1831 Ga0466967_0409569
1832 Ga0466967_0505766
1833 Ga0466967_1415316
1834 Ga0495592_0920997
1835 Ga0495580_0001362
1836 Ga0495580_0002000
1837 Ga0495580_0004144
1838 Ga0495580_0004450
1839 Ga0495580_0048785
1840 Ga0495580_0049837
1841 Ga0495580_0057500
1842 Ga0495580_0082739
1843 Ga0495580_0097614
1844 Ga0495580_0551582
1845 Ga0495580_0661659
1846 Ga0495582_0000442
1847 Ga0495582_0194132
1848 Ga0495582_0372507
1849 Ga0495664_0592134
1850 Ga0495630_0074729
1851 Ga0495630_0352971
1852 Ga0495630_0508223
1853 Ga0495630_0844955
1854 Ga0495666_0106417
1855 Ga0495666_0418944
1856 Ga0495665_0001834
1857 Ga0495665_0021353
1858 Ga0495587_0073742
1859 Ga0495622_0417321
1860 Ga0495634_0695181
1861 Ga0495623_0067164
1862 Ga0495623_0420641
1863 Ga0495623_0499121
1864 Ga0495624_0079273
1865 Ga0495624_0406138
1866 Ga0495624_0759689
1867 Ga0495581_0010039
1868 Ga0495604_0582206
1869 Ga0495674_0083043
1870 Ga0495674_0555651
1871 Ga0495674_1226403
1872 Ga0495676_0376697
1873 Ga0495675_0341546
1874 Ga0495593_0357067
1875 Ga0495602_0283361
1876 Ga0495602_0302428
1877 Ga0495602_0315696
1878 Ga0495602_0324986
1879 Ga0495602_0792054
1880 Ga0495602_1108045
1881 Ga0496100_0027206
1882 Ga0496100_0140408
1883 Ga0496101_0002158
1884 Ga0496101_0182831
1885 Ga0496101_0544469
1886 Ga0496101_0737829
1887 Ga0496102_0036185
1888 Ga0496102_0050905
1889 Ga0496102_0059439
1890 Ga0496102_0095153
1891 Ga0496102_0181158
1892 Ga0496102_0695720
1893 Ga0496103_0009501
1894 Ga0496103_0127005
1895 Ga0496103_0299507
1896 Ga0496104_0030432
1897 Ga0496104_0060216
1898 Ga0496104_0061805
1899 Ga0496104_0174222
1900 Ga0496104_1519037
1901 Ga0496105_0071678
1902 Ga0496105_0160353
1903 Ga0496105_0246944
1904 Ga0496105_0685686
1905 Ga0496105_1047836
1906 Ga0496106_0025440
1907 Ga0496106_0071315
1908 Ga0496106_0086888
1909 Ga0496107_0135205
1910 Ga0496107_0167848
1911 Ga0496107_0208689
1912 Ga0496107_1144511
1913 Ga0496108_0227371
1914 Ga0496108_0655864
1915 Ga0496108_1057295
1916 Ga0496108_1556438
1917 Ga0496109_0107079
1918 Ga0496109_0219233
1919 Ga0496109_0505355
1920 Ga0496109_0662199
1921 Ga0496110_0467021
1922 Ga0496110_0676463
1923 Ga0496112_0005343
1924 Ga0496112_0005971
1925 Ga0496112_0033148
1926 Ga0496112_0050298
1927 Ga0496112_0139450
1928 Ga0496112_0690632
1929 Ga0496112_1048301
1930 Ga0496112_1161867
1931 Ga0496112_1331426
1932 Ga0496113_0224408
1933 Ga0496113_0358419
1934 Ga0496113_0655565
1935 Ga0496114_0025952
1936 Ga0496115_0007193
1937 Ga0501067_0286487
1938 nmdc:mga05p37_347512_c2
1939 nmdc:mga06r32_19912_c1
1940 nmdc:mga08y16_216368_c1
1941 nmdc:mga0n895_168541_c1
1942 nmdc:mga0n895_6632_c1
1943 nmdc:mga0rr50_1064007_c1
1944 nmdc:mga0rr50_1742336_c1
1945 nmdc:mga0rr50_318221_c1
1946 nmdc:mga0rr50_4024_c1
1947 nmdc:mga0rr50_772475_c1
1948 nmdc:mga0rr50_7995_c1
1949 nmdc:mga08x19_122822_c1
1950 nmdc:mga08x19_1403_c1
1951 nmdc:mga08x19_3215_c1
1952 nmdc:mga08x19_402984_c1
1953 nmdc:mga0a205_1274666_c1
1954 Ga0495612_0099695

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00550

PP-binding

Phosphopantetheine attachment site

15

82

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h9g-assembly2.cif.gz_B apo-acp from helicobacter pylori 0.9367 4 79
6lvu-assembly2.cif.gz_B crystal structure of apo acyl carrier protein from thermotoga maritima 0.9303 3 80
7e1r-assembly2.cif.gz_D crystal structure of dehydrogenase/isomerase fabx from helicobacter pylori in complex with holo-acp 0.9253 9 79
5h9h-assembly3.cif.gz_C holo acyl carrier protein (holo-acp) from helicobacter pylori 0.9251 7 79
8jfn-assembly1.cif.gz_B crystal structure of enoyl-acp reductase fabi in complex with nad+ and crotonyl-acp from helicobacter pylori 0.9224 7 78
ID Description Score Start End Superfamily
af_Q7KWJ1_42_137_1.10.1200.10 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.9092 4 78 1.10.1200.10
3gzmB00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8958 4 79 1.10.1200.10
2cgqA00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8934 7 78 1.10.1200.10
3gzmA00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8917 3 80 1.10.1200.10
1f80E00 Mainly Alpha;Orthogonal Bundle;Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A;ACP-like 0.8917 6 77 1.10.1200.10
ID Description Score Start End GO Terms
AF-A0A3M1ZS15-F1-model_v4 Acyl carrier protein 0.9886 5 80 GO:0000035
GO:0000036
GO:0005829
GO:0009245
GO:0016020
AF-A0A832E5A4-F1-model_v4 deleted 0.9794 5 80
AF-A0A7Y2CKI1-F1-model_v4 Acyl carrier protein 0.9714 1 80
AF-A0A2V9DGM8-F1-model_v4 Carrier domain-containing protein 0.9693 1 80 GO:0000035
GO:0000036
GO:0005829
GO:0009245
GO:0016020
AF-A0A3M1ZS15-F1-model_v4 Acyl carrier protein 0.9636 5 80 GO:0000035
GO:0000036
GO:0005829
GO:0009245
GO:0016020

Map