F487110

General Info

Members Datasets Scaffolds Average Seq Length
970 731 486 270

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|639633055|639649651
Length 313
Sequence SRSGTVLSRYSFLFLGWNNNIFFVQNASGRRCLLAADAKETGSMTVEWKDMMLDKVAIGPVSARIYQGADYGKGPPIVLYLHGGAFLDSDKNVDRPVAMSLAKAGAIVVAADYSSLSGNLFPQALEVSFSVFTYLANKRAGLGDRKSLLFVAGEEAGGNVAAGVALKARDQMPDALDGQVLISPLLDPFMGTSSIRKAEAIGMRQRWTEGWSHYLSGGGCHPYAAPCLCSRISGVAPALIFTAEDDPLHDETIGYGARLKQAGVGVRQHVLPAGTGWPSIYGGKSDGAPDWQENVSRHFGSFLRDVSVQPQLH

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
8 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
9 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
10 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
11 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
12 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
13 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
14 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
15 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
16 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
17 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
18 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
19 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
20 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
21 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
22 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
23 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
24 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
25 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
26 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
27 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
28 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
29 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
30 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
31 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
32 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
33 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
34 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
35 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
36 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
37 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
38 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
39 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
40 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
41 2519899620 Rhizobium sp. Pop5 Isolate Nodule
42 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
43 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
44 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
45 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
46 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
47 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
48 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
49 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
50 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
51 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
52 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
53 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
54 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
55 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
56 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
57 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
58 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
59 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
60 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
61 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
62 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
63 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
64 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
65 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
66 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
67 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
68 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
69 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
70 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
71 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
72 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
73 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
74 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
75 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
76 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
77 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
78 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
79 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
80 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
81 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
82 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
83 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
84 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
85 2643221568 Rhizobium sp. Root564 Isolate Unclassified
86 2643221582 Rhizobium sp. Root651 Isolate Unclassified
87 2643221599 Rhizobium sp. Root708 Isolate Unclassified
88 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
89 2643221693 Rhizobium sp. Root491 Isolate Unclassified
90 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
91 2718217882 Rhizobium sp. N741 Isolate Nodule
92 2718217927 Rhizobium sp. N324 Isolate Nodule
93 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
94 2718218009 Rhizobium sp. N561 Isolate Nodule
95 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
96 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
97 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
98 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
99 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
100 2718218363 Rhizobium sp. N113 Isolate Nodule
101 2718218365 Rhizobium sp. N731 Isolate Nodule
102 2718218366 Rhizobium sp. N621 Isolate Nodule
103 2718218423 Rhizobium sp. N941 Isolate Nodule
104 2721755514 Rhizobium sp. N6212 Isolate Nodule
105 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
106 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
107 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
108 2721755809 Rhizobium sp. N541 Isolate Nodule
109 2721755810 Rhizobium sp. N871 Isolate Nodule
110 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
111 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
112 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
113 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
114 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
115 2728369365 Rhizobium sp. N1341 Isolate Nodule
116 2728369397 Rhizobium sp. N1314 Isolate Nodule
117 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
118 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
119 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
120 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
121 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
122 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
123 2791355256 Rhizobium sp. M10 Isolate Nodule
124 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
125 2791355260 Rhizobium sp. L9 Isolate Nodule
126 2791355261 Rhizobium sp. J15 Isolate Nodule
127 2791355262 Rhizobium sp. M1 Isolate Nodule
128 2791355263 Rhizobium chutanense C5 Isolate Nodule
129 2791355264 Rhizobium sp. S9 Isolate Nodule
130 2791355265 Rhizobium sp. H4 Isolate Nodule
131 2791355266 Rhizobium sp. L43 Isolate Nodule
132 2791355267 Rhizobium sp. L18 Isolate Nodule
133 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
134 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
135 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
136 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
137 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
138 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
139 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
140 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
141 2802429633 Rhizobium anhuiense J3 Isolate Nodule
142 2802429634 Rhizobium anhuiense S10 Isolate Nodule
143 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
144 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
145 2802429637 Rhizobium anhuiense C15 Isolate Nodule
146 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
147 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
148 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
149 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
150 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
151 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
152 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
153 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
154 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
155 2838048938 Rhizobium pisi 27/80 Isolate Nodule
156 2838061910 Rhizobium phaseoli L15 Isolate Nodule
157 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
158 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
159 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
160 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
161 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
162 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
163 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
164 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
165 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
166 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
167 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
168 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
169 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
170 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
171 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
172 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
173 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
174 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
175 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
176 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
177 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
178 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
179 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
180 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
181 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
182 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
183 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
184 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
185 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
186 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
187 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
188 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
189 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
190 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
191 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
192 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
193 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
194 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
195 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
196 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
197 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
198 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
199 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
200 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
201 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
202 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
203 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
204 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
205 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
206 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
207 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
208 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
209 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
210 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
211 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
212 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
213 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
214 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
215 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
216 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
217 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
218 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
219 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
220 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
221 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
222 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
223 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
224 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
225 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
226 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
227 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
228 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
229 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
230 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
231 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
232 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
233 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
234 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
235 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
236 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
237 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
238 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
239 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
240 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
241 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
242 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
243 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
244 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
245 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
246 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
247 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
248 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
249 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
250 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
251 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
252 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
253 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
254 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
255 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
256 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
257 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
258 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
259 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
260 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
261 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
262 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
263 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
264 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
265 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
266 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
267 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
268 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
269 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
270 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
271 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
272 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
273 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
274 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
275 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
276 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
277 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
278 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
279 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
280 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
281 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
282 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
283 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
284 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
285 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
286 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
287 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
288 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
289 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
290 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
291 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
292 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
293 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
294 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
295 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
296 2933599457 Rhizobium phaseoli M3 Isolate Nodule
297 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
298 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
299 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
300 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
301 2936381700 Rhizobium chutanense C16 Isolate Unclassified
302 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
303 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
304 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
305 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
306 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
307 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
308 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
309 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
310 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
311 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
312 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
313 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
314 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
315 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
316 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
317 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
318 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
319 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
320 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
321 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
322 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
323 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
324 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
325 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
326 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
327 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
328 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
329 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
330 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
331 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
332 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
333 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
334 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
335 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
336 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
337 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
338 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
339 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
340 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
341 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
342 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
343 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
344 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
345 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
346 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
347 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
348 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
349 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
350 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
351 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
352 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
353 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
354 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
355 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
356 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
357 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
358 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
359 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
360 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
361 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
362 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
363 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
364 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
365 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
366 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
367 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
368 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
369 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
370 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
371 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
372 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
373 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
374 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
375 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
376 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
377 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
378 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
379 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
380 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
381 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
382 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
383 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
384 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
385 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
386 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
387 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
388 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
389 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
390 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
391 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
392 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
393 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
394 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
395 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
396 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
397 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
398 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
399 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
400 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
401 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
402 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
403 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
404 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
405 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
406 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
407 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
408 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
409 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
410 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
411 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
412 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
413 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
414 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
415 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
416 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
417 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
418 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
419 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
420 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
421 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
422 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
423 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
424 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
425 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
426 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
427 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
428 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
429 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
430 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
431 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
432 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
433 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
434 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
435 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
436 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
437 2996893221 Rhizobium sp. R635 Isolate Nodule
438 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
439 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
440 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
441 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
442 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
443 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
444 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
445 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
446 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
447 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
448 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
449 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
450 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
451 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
452 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
453 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
454 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
455 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
456 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
457 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
458 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
459 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
460 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
461 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
462 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
463 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
464 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
465 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
466 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
467 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
468 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
469 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
470 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
471 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
472 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
473 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
474 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
475 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
476 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
477 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
478 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
479 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
480 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
481 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
482 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
483 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
484 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
485 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
486 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
487 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
488 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
489 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
490 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
491 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
492 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
493 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
494 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
495 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
496 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
497 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
498 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
499 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
500 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
501 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
502 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
503 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
504 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
505 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
506 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
507 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
508 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
509 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
510 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
511 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
512 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
513 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
514 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
515 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
516 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
517 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
518 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
519 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
520 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
521 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
522 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
523 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
524 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
525 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
526 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
527 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
528 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
529 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
530 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
531 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
532 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
533 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
534 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
535 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
536 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
537 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
538 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
539 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
540 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
541 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
542 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
543 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
544 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
545 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
546 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
547 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
548 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
549 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
550 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
551 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
552 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
553 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
554 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
555 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
556 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
557 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
558 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
559 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
560 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
561 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
562 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
563 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
564 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
565 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
566 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
567 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
568 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
569 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
570 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
571 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
572 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
573 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
574 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
575 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
576 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
577 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
578 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
579 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
580 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
581 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
582 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
583 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
584 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
585 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
586 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
587 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
588 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
589 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
590 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
591 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
592 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
593 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
594 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
595 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
596 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
597 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
598 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
599 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
600 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
601 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
602 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
603 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
604 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
605 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
606 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
607 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
608 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
609 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
610 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
611 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
612 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
613 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
614 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
615 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
616 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
617 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
618 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
619 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
620 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
621 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
622 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
623 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
624 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
625 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
626 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
627 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
628 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
629 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
630 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
631 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
632 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
633 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
634 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
635 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
636 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
637 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
638 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
639 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
640 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
641 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
642 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
643 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
644 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
645 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
646 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
647 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
648 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
649 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
650 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
651 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
652 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
653 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
654 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
655 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
656 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
657 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
658 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
659 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
660 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
661 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
662 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
663 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
664 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
665 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
666 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
667 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
668 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
669 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
670 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
671 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
672 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
673 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
674 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
675 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
676 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
677 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
678 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
679 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
680 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
681 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
682 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
683 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
684 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
685 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
686 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
687 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
688 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
689 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
690 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
691 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
692 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
693 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
694 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
695 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
696 8005275841 Rhizobium sp. N4311 Isolate Nodule
697 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
698 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
699 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
700 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
701 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
702 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
703 8005382845 Rhizobium sp. R634 Isolate Nodule
704 8005395548 Rhizobium sp. R339 Isolate Nodule
705 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
706 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
707 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
708 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
709 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
710 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
711 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
712 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
713 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
714 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
715 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
716 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
717 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
718 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
719 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
720 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
721 8018176218 Rhizobium sp. N122 Isolate Nodule
722 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
723 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
724 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
725 8024501048 Rhizobium sp. H4 Isolate Nodule
726 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
727 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
728 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
729 8056382006 Rhizobium croatiense 13T Isolate Nodule
730 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
731 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 49.69
Metatranscriptomes 0.41
Isolates 49.9

Biome Distribution

Category Percentage (%)
Aerial Root 0.41
Bulb 0
Endosphere 22.89
Nodule 42.78
Rhizoplane 1.03
Rhizosphere 18.76
Stem 0
Stem Tuber 0
Unclassified 14.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000564 3300001979 Bacteria 15949
2 JGI25155J39150_1000065 3300002704 Bacteria 69464
3 JGI25155J39150_1000098 3300002704 Bacteria 48725
4 JGI25156J39149_1000144 3300002705 Bacteria 52681
5 JGI25156J39149_1000163 3300002705 Bacteria 48762
6 JGI25154J39366_1000035 3300002738 Bacteria 172224
7 JGI25154J39366_1000183 3300002738 Bacteria 48762
8 JGI25158J39367_1000927 3300002739 Bacteria 5464
9 JGI25157J39369_1000209 3300002741 Bacteria 48762
10 JGI25157J39369_1001004 3300002741 Bacteria 13118
11 JGI25152J39213_1003227 3300002773 Bacteria 5673
12 JGI25152J39213_1010470 3300002773 Bacteria 2117
13 JGI25159J45721_1001556 3300002987 Bacteria 9403
14 JGI25159J45721_1004685 3300002987 Bacteria 4465
15 JGI25151J46595_10002096 3300003187 Bacteria 12432
16 JGI25151J46595_10005186 3300003187 Bacteria 6758
17 JGI25151J46595_10007415 3300003187 Bacteria 5378
18 JGI25151J46595_10009835 3300003187 Bacteria 4495
19 JGI25151J46595_10026849 3300003187 Bacteria 2316
20 JGI25153J46596_10006886 3300003215 Bacteria 5676
21 JGI25153J46596_10007510 3300003215 Bacteria 5343
22 JGI25153J46596_10011704 3300003215 Bacteria 3854
23 rootH1_10057687 3300003316 Bacteria 1444
24 rootH1_10074966 3300003316 Bacteria 1695
25 rootH2_10008438 3300003320 Bacteria 4030
26 rootH2_10008440 3300003320 Bacteria 1808
27 rootH2_10045333 3300003320 Bacteria 1620
28 rootL2_10016820 3300003322 Bacteria 9950
29 rootL2_10320304 3300003322 Bacteria 1491
30 rootH1_10063714 3300003323 Bacteria 2561
31 rootH1_10117136 3300003323 Bacteria 1559
32 rootH1_10170367 3300003323 Bacteria 3776
33 JGI25160J50197_1000001 3300003354 Bacteria 782301
34 JGI25160J50197_1000212 3300003354 Bacteria 47984
35 JGI25160J50197_1000917 3300003354 Bacteria 15487
36 JGI25160J50197_1009247 3300003354 Bacteria 3674
37 JGI25161J50226_1000047 3300003374 Bacteria 113472
38 JGI25161J50226_1000151 3300003374 Bacteria 47984
39 JGI25161J50226_1000238 3300003374 Bacteria 33305
40 JGI25161J50226_1000331 3300003374 Bacteria 25691
41 JGI25161J50226_1001587 3300003374 Bacteria 6643
42 Ga0055526_1002806 3300003771 Bacteria 11539
43 Ga0055526_1004625 3300003771 Bacteria 8198
44 Ga0055526_1012519 3300003771 Bacteria 3691
45 Ga0055526_1017186 3300003771 Bacteria 2780
46 Ga0055537_1000709 3300003773 Bacteria 17283
47 Ga0055524_1000082 3300003775 Bacteria 119749
48 Ga0055524_1001237 3300003775 Bacteria 15052
49 Ga0055524_1004997 3300003775 Bacteria 6005
50 Ga0055524_1006292 3300003775 Bacteria 5166
51 Ga0055524_1021578 3300003775 Bacteria 2130
52 Ga0055536_1001960 3300003781 Bacteria 11848
53 Ga0055534_1003222 3300003784 Bacteria 5238
54 Ga0055534_1005336 3300003784 Bacteria 3465
55 Ga0055534_1013334 3300003784 Bacteria 1583
56 Ga0055528_1000525 3300003790 Bacteria 29704
57 Ga0055528_1001182 3300003790 Bacteria 16852
58 Ga0055528_1002394 3300003790 Bacteria 10090
59 Ga0055528_1003139 3300003790 Bacteria 8476
60 Ga0055528_1009964 3300003790 Bacteria 3915
61 Ga0055528_1019332 3300003790 Bacteria 2263
62 Ga0055528_1019744 3300003790 Bacteria 2216
63 Ga0055530_10000688 3300003791 Bacteria 28617
64 Ga0055530_10046368 3300003791 Bacteria 1032
65 Ga0055540_1000010 3300003792 Bacteria 290865
66 Ga0055540_1001376 3300003792 Bacteria 14517
67 Ga0055540_1003377 3300003792 Bacteria 7740
68 Ga0055531_10019143 3300003794 Bacteria 2786
69 Ga0058692_1001275 3300003856 Bacteria 9566
70 Ga0055543_1000007 3300004625 Bacteria 204042
71 Ga0055543_1000419 3300004625 Bacteria 26802
72 Ga0055543_1000526 3300004625 Bacteria 21681
73 Ga0055543_1000646 3300004625 Bacteria 18584
74 Ga0065165_1000357 3300005262 Bacteria 75030
75 Ga0065165_1015536 3300005262 Bacteria 2896
76 Ga0065165_1032167 3300005262 Bacteria 1647
77 Ga0065165_1042739 3300005262 Bacteria 1335
78 Ga0070670_100000560 3300005331 Bacteria 29495
79 Ga0070669_100286700 3300005353 Bacteria 1321
80 Ga0070664_100468505 3300005564 Bacteria 1158
81 Ga0068854_100017336 3300005578 Bacteria 4819
82 Ga0068856_100185206 3300005614 Bacteria 2096
83 Ga0068852_100127814 3300005616 Bacteria 2336
84 Ga0075365_10004644 3300006038 Bacteria 7313
85 Ga0075365_10006669 3300006038 Bacteria 6378
86 Ga0075368_10027051 3300006042 Bacteria 2210
87 Ga0075363_100026618 3300006048 Bacteria 2960
88 Ga0075364_10007185 3300006051 Bacteria 6593
89 Ga0075364_10012908 3300006051 Bacteria 5127
90 Ga0075362_10000300 3300006177 Bacteria 14031
91 Ga0075362_10001572 3300006177 Bacteria 7379
92 Ga0075362_10092379 3300006177 Bacteria 1406
93 Ga0075367_10004384 3300006178 Bacteria 6885
94 Ga0075367_10005561 3300006178 Bacteria 6278
95 Ga0075367_10021211 3300006178 Bacteria 3628
96 Ga0075369_10001899 3300006186 Bacteria 7324
97 Ga0075369_10001967 3300006186 Bacteria 7222
98 Ga0075369_10027942 3300006186 Bacteria 2361
99 Ga0075369_10031219 3300006186 Bacteria 2247
100 Ga0075369_10055396 3300006186 Bacteria 1723
101 Ga0075366_10009357 3300006195 Bacteria 5468
102 Ga0075366_10022758 3300006195 Bacteria 3648
103 Ga0075366_10048190 3300006195 Bacteria 2526
104 Ga0075370_10020155 3300006353 Bacteria 3641
105 Ga0075370_10027128 3300006353 Bacteria 3177
106 Ga0075370_10045619 3300006353 Bacteria 2479
107 Ga0075370_10062684 3300006353 Bacteria 2119
108 Ga0075370_10078416 3300006353 Bacteria 1897
109 Ga0079104_1004704 3300006946 Bacteria 5718
110 Ga0079104_1005831 3300006946 Bacteria 4814
111 Ga0099826_10002615 3300006948 Bacteria 11731
112 Ga0105240_10000014 3300009093 Bacteria 482033
113 Ga0105243_10131709 3300009148 Bacteria 2122
114 Ga0105237_10000770 3300009545 Bacteria 43805
115 Ga0105238_10659264 3300009551 Bacteria 1057
116 Ga0123341_1000011 3300009765 Bacteria 108023
117 Ga0123342_1008752 3300009766 Bacteria 12535
118 Ga0123342_1018063 3300009766 Bacteria 5714
119 Ga0105239_10004243 3300010375 Bacteria 17211
120 Ga0105239_10316635 3300010375 Bacteria 1759
121 Ga0105246_10050655 3300011119 Bacteria 2849
122 Ga0157373_10049545 3300013100 Bacteria 2993
123 Ga0157373_10081630 3300013100 Bacteria 2279
124 Ga0157373_10106668 3300013100 Bacteria 1969
125 Ga0157371_10000966 3300013102 Bacteria 31904
126 Ga0157371_10002118 3300013102 Bacteria 19329
127 Ga0157370_10000015 3300013104 Bacteria 185771
128 Ga0157370_10000338 3300013104 Bacteria 59035
129 Ga0157369_10020309 3300013105 Bacteria 7424
130 Ga0157372_10239097 3300013307 Unclassified 2107
131 Ga0182008_10033845 3300014497 Bacteria 2563
132 Ga0182007_10002096 3300015262 Bacteria 10220
133 Ga0182005_1010891 3300015265 Bacteria 2606
134 Ga0206355_1174415 3300020076 Bacteria 1071
135 Ga0214544_1000105 3300021320 Bacteria 114109
136 Ga0214542_1000029 3300021321 Bacteria 174097
137 Ga0214543_1000027 3300021327 Bacteria 215065
138 Ga0214543_1000040 3300021327 Bacteria 174142
139 Ga0228711_1000013 3300022739 Bacteria 132585
140 Ga0228710_1000008 3300022740 Bacteria 174306
141 Ga0209435_100005 3300025206 Bacteria 573745
142 Ga0209435_100010 3300025206 Bacteria 475373
143 Ga0209436_100110 3300025208 Bacteria 41189
144 Ga0209436_107364 3300025208 Bacteria 2305
145 Ga0209672_103287 3300025228 Bacteria 3414
146 Ga0209437_100058 3300025233 Bacteria 357279
147 Ga0209437_100060 3300025233 Bacteria 355034
148 Ga0207425_1001956 3300025245 Bacteria 7737
149 Ga0207425_1001995 3300025245 Bacteria 7624
150 Ga0207425_1013334 3300025245 Bacteria 1902
151 Ga0209646_1000001 3300025246 Bacteria 3092932
152 Ga0209646_1000011 3300025246 Bacteria 573745
153 Ga0209026_1000001 3300025250 Bacteria 1228671
154 Ga0209026_1000008 3300025250 Bacteria 573745
155 Ga0209677_100781 3300025253 Bacteria 16045
156 Ga0209148_1004917 3300025254 Bacteria 3157
157 Ga0209759_1000001 3300025256 Bacteria 2799452
158 Ga0209759_1000004 3300025256 Bacteria 573745
159 Ga0209129_1000226 3300025258 Bacteria 63537
160 Ga0209129_1001492 3300025258 Bacteria 13007
161 Ga0209129_1002108 3300025258 Bacteria 10140
162 Ga0209129_1005143 3300025258 Bacteria 4773
163 Ga0209129_1005786 3300025258 Bacteria 4230
164 Ga0209129_1010068 3300025258 Bacteria 2405
165 Ga0209129_1013977 3300025258 Bacteria 1733
166 Ga0209233_1000137 3300025261 Bacteria 200314
167 Ga0209565_1000036 3300025263 Bacteria 293334
168 Ga0209565_1000226 3300025263 Bacteria 63161
169 Ga0209455_1012080 3300025272 Bacteria 2087
170 Ga0209673_1000239 3300025273 Bacteria 105502
171 Ga0209673_1000282 3300025273 Bacteria 95013
172 Ga0209673_1000478 3300025273 Bacteria 66832
173 Ga0209673_1001495 3300025273 Bacteria 21722
174 Ga0209673_1001737 3300025273 Bacteria 18320
175 Ga0209673_1002506 3300025273 Bacteria 12623
176 Ga0209673_1018821 3300025273 Bacteria 2497
177 Ga0209130_1000023 3300025284 Bacteria 359355
178 Ga0209130_1000042 3300025284 Bacteria 257581
179 Ga0209130_1000145 3300025284 Bacteria 113201
180 Ga0209130_1008226 3300025284 Bacteria 3102
181 Ga0209130_1014063 3300025284 Bacteria 2024
182 Ga0209130_1017324 3300025284 Bacteria 1719
183 Ga0209675_1000289 3300025291 Bacteria 47643
184 Ga0209675_1003625 3300025291 Bacteria 7246
185 Ga0209676_1000007 3300025292 Bacteria 1029371
186 Ga0209676_1018097 3300025292 Bacteria 2467
187 Ga0209025_1000288 3300025294 Bacteria 113626
188 Ga0209025_1000411 3300025294 Bacteria 86058
189 Ga0209025_1002347 3300025294 Bacteria 20391
190 Ga0209025_1006388 3300025294 Bacteria 9173
191 Ga0209025_1013965 3300025294 Bacteria 4996
192 Ga0209025_1037708 3300025294 Bacteria 2139
193 Ga0209025_1051255 3300025294 Bacteria 1642
194 Ga0209025_1081354 3300025294 Bacteria 1098
195 Ga0209564_1000259 3300025295 Bacteria 112570
196 Ga0209564_1000393 3300025295 Bacteria 78338
197 Ga0209564_1001326 3300025295 Bacteria 26471
198 Ga0209564_1007458 3300025295 Bacteria 5644
199 Ga0209564_1024341 3300025295 Bacteria 2072
200 Ga0209564_1025207 3300025295 Bacteria 2009
201 Ga0209564_1026301 3300025295 Bacteria 1927
202 Ga0209758_1000390 3300025297 Bacteria 75869
203 Ga0209758_1001594 3300025297 Bacteria 25947
204 Ga0209758_1004703 3300025297 Bacteria 11144
205 Ga0209758_1008994 3300025297 Bacteria 6315
206 Ga0209758_1078594 3300025297 Bacteria 1007
207 Ga0209050_1000003 3300025298 Bacteria 1609245
208 Ga0209050_1004120 3300025298 Bacteria 10120
209 Ga0209050_1007028 3300025298 Bacteria 6467
210 Ga0209050_1013661 3300025298 Bacteria 3582
211 Ga0209256_1000001 3300025299 Bacteria 2166974
212 Ga0209256_1000155 3300025299 Bacteria 144379
213 Ga0209256_1000619 3300025299 Bacteria 49078
214 Ga0209256_1001902 3300025299 Bacteria 19096
215 Ga0209256_1004144 3300025299 Bacteria 9364
216 Ga0209256_1007631 3300025299 Bacteria 5271
217 Ga0207426_1000011 3300025302 Bacteria 791203
218 Ga0207426_1000087 3300025302 Bacteria 288870
219 Ga0207426_1000097 3300025302 Bacteria 265930
220 Ga0207426_1000386 3300025302 Bacteria 75890
221 Ga0207426_1001878 3300025302 Bacteria 15369
222 Ga0209051_1000003 3300025303 Bacteria 1609245
223 Ga0209051_1000321 3300025303 Bacteria 72390
224 Ga0209051_1003739 3300025303 Bacteria 9784
225 Ga0209051_1004393 3300025303 Bacteria 8718
226 Ga0209051_1018086 3300025303 Bacteria 3130
227 Ga0209257_1000020 3300025304 Bacteria 773356
228 Ga0209257_1005878 3300025304 Bacteria 8282
229 Ga0209257_1010077 3300025304 Bacteria 4886
230 Ga0207695_10000037 3300025913 Bacteria 476303
231 Ga0207671_10000080 3300025914 Bacteria 148567
232 Ga0207681_10101055 3300025923 Bacteria 2080
233 Ga0207650_10007237 3300025925 Bacteria 7559
234 Ga0207709_10086633 3300025935 Bacteria 2034
235 Ga0207640_10018330 3300025981 Bacteria 4113
236 Ga0207702_10041321 3300026078 Bacteria 3867
237 Ga0209281_1000134 3300027111 Bacteria 185406
238 Ga0209281_1000783 3300027111 Bacteria 30223
239 Ga0209371_1000022 3300027312 Bacteria 536342
240 Ga0209371_1000370 3300027312 Bacteria 48496
241 Ga0209371_1001191 3300027312 Bacteria 18849
242 Ga0209282_1000029 3300027666 Bacteria 157883
243 Ga0209282_1001507 3300027666 Bacteria 12863
244 Ga0209813_10003505 3300027866 Bacteria 3679
245 Ga0268266_10112087 3300028379 Bacteria 2418
246 Ga0307515_10007465 3300028794 Bacteria 21615
247 Ga0307515_10209541 3300028794 Bacteria 1797
248 Ga0268256_1000019 3300030500 Bacteria 587949
249 Ga0268256_1002822 3300030500 Bacteria 8390
250 Ga0268256_1005648 3300030500 Bacteria 4853
251 Ga0316181_1086484 3300030744 Bacteria 2161
252 Ga0307513_10000011 3300031456 Bacteria 354929
253 Ga0307513_10015921 3300031456 Bacteria 9094
254 Ga0307513_10129858 3300031456 Bacteria 2468
255 Ga0307408_100004501 3300031548 Bacteria 9450
256 Ga0307408_100068413 3300031548 Bacteria 2615
257 Ga0307408_100344065 3300031548 Bacteria 1263
258 Ga0307405_10157461 3300031731 Bacteria 1605
259 Ga0307406_10027924 3300031901 Bacteria 3405
260 Ga0307412_10025014 3300031911 Bacteria 3693
261 Ga0307412_10218606 3300031911 Bacteria 1459
262 Ga0307412_10436561 3300031911 Bacteria 1075
263 Ga0315914_1000021 3300031967 Bacteria 119592
264 Ga0307409_100331407 3300031995 Bacteria 1428
265 Ga0307409_100381438 3300031995 Bacteria 1340
266 Ga0307414_10073553 3300032004 Bacteria 2473
267 Ga0315913_1000014 3300033430 Bacteria 120114
268 Ga0315915_1000003 3300033464 Bacteria 407996
269 Ga0395905_0012601 3300037471 Bacteria 8134
270 Ga0439465_0007062 3300041413 Bacteria 3568
271 Ga0439465_0018167 3300041413 Bacteria 2197
272 Ga0451787_279068 3300041441 Bacteria 3997
273 Ga0451798_0814015 3300041458 Bacteria 2521
274 Ga0451833_0644275 3300041491 Bacteria 4161
275 Ga0451840_11731 3300041497 Bacteria 1565
276 Ga0451841_0397021 3300041498 Bacteria 1357
277 Ga0451841_1005621 3300041498 Bacteria 923
278 Ga0451845_0927883 3300041501 Bacteria 1270
279 Ga0451845_0929104 3300041501 Bacteria 1300
280 Ga0451846_05577 3300041502 Bacteria 2773
281 Ga0451847_0008387 3300041503 Bacteria 3817
282 Ga0451847_0691945 3300041503 Bacteria 1303
283 Ga0451851_0548143 3300041507 Bacteria 1880
284 Ga0451855_0189021 3300041511 Bacteria 947
285 Ga0451853_1500900 3300041512 Bacteria 5314
286 Ga0451853_3538132 3300041512 Bacteria 2636
287 Ga0452268_38528 3300041907 Bacteria 1511
288 Ga0439432_013219 3300042006 Bacteria 2810
289 Ga0439449_0022025 3300042007 Bacteria 2385
290 Ga0439449_0086854 3300042007 Bacteria 1154
291 Ga0453684_0009469 3300044712 Bacteria 17035
292 Ga0495617_054991 3300046452 Bacteria 1321
293 Ga0495629_0019024 3300046459 Bacteria 4911
294 Ga0495638_0000300 3300046460 Bacteria 63643
295 Ga0495638_0014856 3300046460 Bacteria 5248
296 Ga0495638_0025826 3300046460 Bacteria 3814
297 Ga0495651_0066767 3300046462 Bacteria 2745
298 Ga0495605_0000998 3300046474 Bacteria 19122
299 Ga0495605_0036369 3300046474 Bacteria 2483
300 Ga0495662_0017093 3300046476 Bacteria 3511
301 Ga0495664_0058057 3300046477 Bacteria 2302
302 Ga0495585_0037288 3300046492 Bacteria 2738
303 Ga0495607_0073056 3300046501 Bacteria 1907
304 Ga0495583_0032155 3300046506 Bacteria 2535
305 Ga0495583_0044005 3300046506 Bacteria 2075
306 Ga0495606_0001142 3300046507 Bacteria 37680
307 Ga0495606_0048548 3300046507 Bacteria 2790
308 Ga0495608_0116000 3300046511 Bacteria 1719
309 Ga0495610_0022471 3300046512 Bacteria 3449
310 Ga0495616_0036507 3300046513 Bacteria 2535
311 Ga0495616_0080039 3300046513 Bacteria 1565
312 Ga0495620_0006745 3300046515 Bacteria 6279
313 Ga0495620_0022657 3300046515 Bacteria 3020
314 Ga0495631_0002311 3300046518 Bacteria 10861
315 Ga0495632_0008599 3300046519 Bacteria 6238
316 Ga0495632_0029795 3300046519 Bacteria 2838
317 Ga0495643_0018843 3300046522 Bacteria 3998
318 Ga0495643_0022292 3300046522 Bacteria 3616
319 Ga0495644_0047387 3300046523 Bacteria 1615
320 Ga0495652_0140687 3300046529 Bacteria 1898
321 Ga0495654_0005924 3300046530 Bacteria 7027
322 Ga0495587_0155622 3300046536 Bacteria 1302
323 Ga0495609_0014796 3300046538 Bacteria 3662
324 Ga0495609_0060177 3300046538 Bacteria 1679
325 Ga0495597_0025376 3300046542 Bacteria 2728
326 Ga0495633_0032451 3300046558 Bacteria 2523
327 Ga0495656_0053175 3300046615 Bacteria 1739
328 Ga0495668_0004998 3300046616 Bacteria 9163
329 Ga0495668_0028712 3300046616 Bacteria 3145
330 Ga0495611_0011812 3300046648 Bacteria 3706
331 Ga0495625_0008370 3300046660 Bacteria 8830
332 Ga0495625_0021355 3300046660 Bacteria 4986
333 Ga0495625_0023158 3300046660 Bacteria 4746
334 Ga0495635_0048244 3300046663 Bacteria 2936
335 Ga0495588_0019961 3300046674 Bacteria 3288
336 Ga0495657_0051262 3300046675 Bacteria 2771
337 Ga0495613_0131417 3300046689 Bacteria 1793
338 Ga0495624_0228488 3300046690 Bacteria 1127
339 Ga0495671_0041582 3300046692 Bacteria 2314
340 Ga0495649_0010942 3300046694 Bacteria 5344
341 Ga0495649_0030253 3300046694 Bacteria 2991
342 Ga0495600_0034660 3300046809 Bacteria 3277
343 Ga0495660_0015968 3300046810 Bacteria 4332
344 Ga0495604_0003714 3300047317 Bacteria 12160
345 Ga0495636_0006453 3300047318 Bacteria 4609
346 Ga0495672_0011865 3300047320 Bacteria 6118
347 Ga0495683_0069995 3300047323 Bacteria 1723
348 Ga0495687_116962 3300047443 Bacteria 969
349 Ga0495681_0000688 3300047470 Bacteria 25777
350 Ga0495681_0136781 3300047470 Bacteria 1038
351 Ga0495686_0000422 3300047472 Bacteria 66571
352 Ga0495686_0002120 3300047472 Bacteria 19433
353 Ga0495686_0027768 3300047472 Bacteria 3692
354 Ga0495686_0064325 3300047472 Bacteria 2271
355 Ga0495686_0143729 3300047472 Bacteria 1406
356 Ga0495602_0359792 3300048088 Bacteria 1048
357 Ga0495615_0008384 3300048090 Bacteria 1995
358 Ga0495626_0057492 3300048091 Bacteria 1779
359 Ga0496100_0358463 3300048903 Bacteria 1103
360 Ga0496104_0114639 3300048907 Bacteria 2585
361 Ga0496106_0000028 3300048909 Bacteria 143296
362 Ga0496113_0061214 3300048916 Bacteria 2840
363 Ga0496116_0000049 3300048919 Bacteria 314452
364 Ga0496116_0020205 3300048919 Bacteria 5065
365 Ga0496116_0041823 3300048919 Bacteria 3140
366 Ga0496116_0101314 3300048919 Bacteria 1720
367 Ga0496117_0000002 3300048920 Bacteria 2483758
368 Ga0496117_0001124 3300048920 Bacteria 40302
369 Ga0496117_0036587 3300048920 Bacteria 3671
370 Ga0496117_0097498 3300048920 Bacteria 1872
371 Ga0496118_0000759 3300048921 Bacteria 52080
372 Ga0496118_0003513 3300048921 Bacteria 19652
373 Ga0496118_0011225 3300048921 Bacteria 8770
374 Ga0496118_0015019 3300048921 Bacteria 7199
375 Ga0496118_0046582 3300048921 Bacteria 3371
376 Ga0496118_0083291 3300048921 Bacteria 2237
377 Ga0496119_0003324 3300048922 Bacteria 16773
378 Ga0496119_0011799 3300048922 Bacteria 7179
379 Ga0496119_0026727 3300048922 Bacteria 3991
380 Ga0496120_0000093 3300048923 Bacteria 146905
381 Ga0496120_0004706 3300048923 Bacteria 11250
382 Ga0496120_0048286 3300048923 Bacteria 2450
383 Ga0496120_0077123 3300048923 Bacteria 1814
384 Ga0496121_0000005 3300048924 Bacteria 1034486
385 Ga0496121_0000570 3300048924 Bacteria 69574
386 Ga0496121_0033662 3300048924 Bacteria 4632
387 Ga0496121_0186523 3300048924 Bacteria 1491
388 Ga0496121_0196021 3300048924 Bacteria 1444
389 Ga0496122_0000004 3300048925 Bacteria 645283
390 Ga0496122_0016047 3300048925 Bacteria 7117
391 Ga0496122_0027961 3300048925 Bacteria 4802
392 Ga0496122_0030501 3300048925 Bacteria 4517
393 Ga0496122_0066691 3300048925 Bacteria 2597
394 Ga0496123_0000007 3300048926 Bacteria 645283
395 Ga0496123_0031684 3300048926 Bacteria 3842
396 Ga0496124_0000091 3300048927 Bacteria 189706
397 Ga0496124_0006058 3300048927 Bacteria 13308
398 Ga0496124_0028541 3300048927 Bacteria 4990
399 Ga0496124_0049468 3300048927 Bacteria 3586
400 Ga0496124_0118925 3300048927 Bacteria 2114
401 Ga0496124_0268973 3300048927 Bacteria 1249
402 Ga0496124_0371616 3300048927 Bacteria 1003
403 Ga0496125_0000159 3300048928 Bacteria 151205
404 Ga0496125_0004359 3300048928 Bacteria 16404
405 Ga0496125_0030598 3300048928 Bacteria 4812
406 Ga0496125_0128119 3300048928 Bacteria 1793
407 Ga0496126_0000081 3300048929 Bacteria 218818
408 Ga0496126_0012281 3300048929 Bacteria 8789
409 Ga0496126_0045555 3300048929 Bacteria 4030
410 Ga0496126_0283502 3300048929 Bacteria 1371
411 Ga0495682_0080327 3300049460 Bacteria 1173
412 Ga0501032_0146820 3300049569 Bacteria 1552
413 Ga0501033_0051370 3300049570 Bacteria 3056
414 Ga0501034_0161912 3300049571 Bacteria 2208
415 Ga0501036_0015259 3300049572 Bacteria 6414
416 Ga0501037_0085812 3300049573 Bacteria 2279
417 Ga0501038_0185118 3300049574 Bacteria 1678
418 Ga0501043_0044713 3300049579 Bacteria 3482
419 Ga0501043_0129810 3300049579 Bacteria 1975
420 Ga0501047_0059512 3300049581 Bacteria 3688
421 Ga0501047_0061221 3300049581 Bacteria 3632
422 Ga0501073_0461324 3300049589 Bacteria 878
423 Ga0501080_0047331 3300049742 Bacteria 4003
424 Ga0501083_0040392 3300049744 Bacteria 3167
425 Ga0501083_0086468 3300049744 Bacteria 2073
426 Ga0501044_0031639 3300049823 Bacteria 5568
427 nmdc:mga03683_34324_c1 3300050489 Bacteria 2053
428 nmdc:mga03683_51438_c1 3300050489 Bacteria 1720
429 nmdc:mga03n38_68598_c1 3300050490 Bacteria 1635
430 nmdc:mga03n38_84311_c1 3300050490 Bacteria 1500
431 nmdc:mga00v17_19670_c1 3300050491 Bacteria 3860
432 nmdc:mga0yw44_154925_c1 3300050492 Bacteria 1497
433 nmdc:mga0yw44_213678_c1 3300050492 Bacteria 1276
434 nmdc:mga0yw44_3224_c1 3300050492 Bacteria 7187
435 nmdc:mga0yw44_431_c1 3300050492 Bacteria 14728
436 nmdc:mga0k408_127220_c1 3300050493 Bacteria 1512
437 nmdc:mga0k408_3813_c1 3300050493 Bacteria 7991
438 nmdc:mga06z11_102447_c1 3300050494 Bacteria 1573
439 nmdc:mga06z11_10978_c1 3300050494 Bacteria 3884
440 nmdc:mga04h51_39557_c1 3300050495 Bacteria 1532
441 nmdc:mga07m45_134482_c1 3300050496 Bacteria 1431
442 nmdc:mga07m45_38680_c1 3300050496 Bacteria 2663
443 nmdc:mga0sz30_25294_c1 3300050516 Bacteria 1803
444 nmdc:mga0sz30_2699_c1 3300050516 Bacteria 3389
445 nmdc:mga0sz30_26_c1 3300050516 Bacteria 59011
446 Ga0495655_0003456 3300053083 Bacteria 2609
447 Ga0500578_0063248 3300053086 Bacteria 2360
448 Ga0500650_0025695 3300053098 Bacteria 2635
449 Ga0500557_000894 3300053105 Bacteria 4400
450 Ga0500562_031322 3300053108 Bacteria 1403
451 Ga0500569_000971 3300053109 Bacteria 5165
452 Ga0500569_011125 3300053109 Bacteria 2140
453 Ga0500572_001165 3300053111 Bacteria 7574
454 Ga0500593_003321 3300053117 Bacteria 6055
455 Ga0500594_0001842 3300053118 Bacteria 4594
456 Ga0500594_0010520 3300053118 Bacteria 2149
457 Ga0500608_012503 3300053122 Bacteria 3725
458 Ga0500628_006682 3300053129 Bacteria 1956
459 Ga0500658_0001192 3300053134 Bacteria 10585
460 Ga0500658_0037330 3300053134 Bacteria 1932
461 Ga0500559_0009290 3300053136 Bacteria 4264
462 Ga0500561_0005831 3300053137 Bacteria 2315
463 Ga0500568_0001664 3300053139 Bacteria 13928
464 Ga0500568_0002341 3300053139 Bacteria 11225
465 Ga0500577_0010406 3300053142 Bacteria 2737
466 Ga0500590_005672 3300053148 Bacteria 6023
467 Ga0500604_0011839 3300053151 Bacteria 2349
468 Ga0500616_0000400 3300053153 Bacteria 59475
469 Ga0500616_0001502 3300053153 Bacteria 22017
470 Ga0500616_0040719 3300053153 Bacteria 2497
471 Ga0500622_0000593 3300053156 Bacteria 32900
472 Ga0500622_0003374 3300053156 Bacteria 10748
473 Ga0500622_0138141 3300053156 Bacteria 1165
474 Ga0500624_000600 3300053157 Bacteria 9838
475 Ga0500627_0043016 3300053158 Bacteria 1946
476 Ga0500627_0079345 3300053158 Bacteria 1462
477 Ga0500627_0133104 3300053158 Bacteria 1123
478 Ga0500633_0000975 3300053160 Bacteria 5042
479 Ga0500636_0000001 3300053177 Bacteria 324086
480 Ga0500636_0021680 3300053177 Bacteria 3803
481 Ga0500611_029383 3300053727 Bacteria 1125
482 Ga0500645_001087 3300053730 Bacteria 14925
483 Ga0500645_010175 3300053730 Bacteria 3125
484 Ga0500645_041416 3300053730 Bacteria 1360
485 Ga0500645_044187 3300053730 Bacteria 1311
486 Ga0501082_0149894 3300060353 Bacteria 2025

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031548 Ga0307408_100004501 Ga0307408_1000045019 249
2 3300031901 Ga0307406_10027924 Ga0307406_100279244 249
3 3300031911 Ga0307412_10218606 Ga0307412_102186062 250
4 iso_pu_bacteria 2718218423 2721400637 252
5 iso_pu_bacteria 2721755809 2724039450 252
6 iso_pu_bacteria 8018176218 8018179031 252
7 iso_pu_bacteria 2838016132 2838019858 253
8 iso_pu_bacteria 2838022645 2838023364 253
9 iso_pu_bacteria 2838048938 2838052666 253
10 iso_pu_bacteria 2838061910 2838064924 253
11 iso_pu_bacteria 2838068647 2838069652 253
12 iso_pu_bacteria 2838668709 2838671846 253
13 iso_pu_bacteria 2838686498 2838686558 253
14 iso_pu_bacteria 2838694306 2838698107 253
15 iso_pu_bacteria 2838701080 2838704525 253
16 iso_pu_bacteria 2838707686 2838711221 253
17 iso_pu_bacteria 2838729681 2838734800 253
18 iso_pu_bacteria 2838742623 2838747415 253
19 iso_pu_bacteria 2841851746 2841854387 253
20 iso_pu_bacteria 2842077413 2842079398 253
21 iso_pu_bacteria 2842110456 2842115496 253
22 iso_pu_bacteria 2842118031 2842118093 253
23 iso_pu_bacteria 2842146304 2842149743 253
24 iso_pu_bacteria 2842156927 2842158594 253
25 iso_pu_bacteria 2842163707 2842168960 253
26 iso_pu_bacteria 2842180545 2842182208 253
27 iso_pu_bacteria 2842198810 2842198878 253
28 iso_pu_bacteria 2842217011 2842218439 253
29 iso_pu_bacteria 2842229732 2842229792 253
30 iso_pu_bacteria 2842237096 2842240006 253
31 iso_pu_bacteria 2842257432 2842258234 253
32 iso_pu_bacteria 2842264693 2842268985 253
33 iso_pu_bacteria 2842271015 2842271904 253
34 iso_pu_bacteria 2842278818 2842284328 253
35 iso_pu_bacteria 2842285085 2842285114 253
36 iso_pu_bacteria 2842291075 2842293059 253
37 iso_pu_bacteria 2842304105 2842305516 253
38 iso_pu_bacteria 2842311132 2842314238 253
39 iso_pu_bacteria 2842317721 2842320040 253
40 iso_pu_bacteria 2842363717 2842368787 253
41 iso_pu_bacteria 2842370503 2842373579 253
42 iso_pu_bacteria 2842384541 2842384603 253
43 iso_pu_bacteria 2842402390 2842402472 253
44 iso_pu_bacteria 2842415677 2842416805 253
45 iso_pu_bacteria 2842422224 2842423266 253
46 iso_pu_bacteria 2842428310 2842433093 253
47 iso_pu_bacteria 2842434925 2842439398 253
48 iso_pu_bacteria 2842441272 2842446027 253
49 iso_pu_bacteria 2842447887 2842449055 253
50 iso_pu_bacteria 2842462802 2842467368 253
51 iso_pu_bacteria 2842469257 2842474163 253
52 iso_pu_bacteria 2842489311 2842493418 253
53 iso_pu_bacteria 2842495871 2842497570 253
54 iso_pu_bacteria 2844454524 2844457856 253
55 iso_pu_bacteria 2857516855 2857516929 253
56 iso_pu_bacteria 2551306091 2551730292 254
57 iso_pu_bacteria 2615840624 2616296576 254
58 iso_pu_bacteria 2996893221 2996898131 254
59 iso_pu_bacteria 8018127388 8018130653 254
60 iso_pu_bacteria 2551306090 2551718114 255
61 iso_pu_bacteria 2923556063 2923562018 256
62 3300002987 JGI25159J45721_1001556 JGI25159J45721_10015564 258
63 3300003320 rootH2_10008440 rootH2_100084402 258
64 3300003354 JGI25160J50197_1000001 JGI25160J50197_100000177 258
65 3300003374 JGI25161J50226_1000047 JGI25161J50226_100004727 258
66 3300004625 Ga0055543_1000007 Ga0055543_1000007118 258
67 3300005262 Ga0065165_1000357 Ga0065165_100035720 258
68 3300005578 Ga0068854_100017336 Ga0068854_1000173363 258
69 3300005614 Ga0068856_100185206 Ga0068856_1001852062 258
70 3300005616 Ga0068852_100127814 Ga0068852_1001278142 258
71 3300009093 Ga0105240_10000014 Ga0105240_1000001433 258
72 3300009545 Ga0105237_10000770 Ga0105237_1000077035 258
73 3300010375 Ga0105239_10004243 Ga0105239_100042439 258
74 3300013104 Ga0157370_10000015 Ga0157370_1000001533 258
75 3300014497 Ga0182008_10033845 Ga0182008_100338452 258
76 3300015262 Ga0182007_10002096 Ga0182007_100020965 258
77 3300015265 Ga0182005_1010891 Ga0182005_10108912 258
78 3300020076 Ga0206355_1174415 Ga0206355_11744151 258
79 3300025253 Ga0209677_100781 Ga0209677_1007814 258
80 3300025261 Ga0209233_1000137 Ga0209233_100013734 258
81 3300025284 Ga0209130_1000145 Ga0209130_100014577 258
82 3300025302 Ga0207426_1000011 Ga0207426_100001177 258
83 3300025913 Ga0207695_10000037 Ga0207695_1000003734 258
84 3300025914 Ga0207671_10000080 Ga0207671_1000008034 258
85 3300025981 Ga0207640_10018330 Ga0207640_100183306 258
86 3300026078 Ga0207702_10041321 Ga0207702_100413213 258
87 3300037471 Ga0395905_0012601 Ga0395905_0012601_5385_6206 258
88 3300048919 Ga0496116_0020205 Ga0496116_0020205_1229_2041 258
89 3300048920 Ga0496117_0001124 Ga0496117_0001124_35201_36013 258
90 3300048921 Ga0496118_0000759 Ga0496118_0000759_16268_17080 258
91 3300048922 Ga0496119_0003324 Ga0496119_0003324_1869_2681 258
92 3300048923 Ga0496120_0004706 Ga0496120_0004706_2837_3649 258
93 3300048924 Ga0496121_0000570 Ga0496121_0000570_4043_4855 258
94 3300048925 Ga0496122_0027961 Ga0496122_0027961_2782_3594 258
95 3300048927 Ga0496124_0028541 Ga0496124_0028541_4032_4844 258
96 3300048929 Ga0496126_0045555 Ga0496126_0045555_1542_2354 258
97 3300049589 Ga0501073_0461324 Ga0501073_0461324_14_808 258
98 3300053158 Ga0500627_0079345 Ga0500627_0079345_280_1092 258
99 iso_pu_bacteria 3005409236 3005409314 258
100 3300006042 Ga0075368_10027051 Ga0075368_100270512 259
101 3300006177 Ga0075362_10092379 Ga0075362_100923792 259
102 3300006353 Ga0075370_10078416 Ga0075370_100784161 259
103 3300041512 Ga0451853_3538132 Ga0451853_3538132_1374_2180 259
104 3300046530 Ga0495654_0005924 Ga0495654_0005924_4159_4980 259
105 3300046536 Ga0495587_0155622 Ga0495587_0155622_479_1282 259
106 3300050492 nmdc:mga0yw44_154925_c1 nmdc:mga0yw44_154925_c1_528_1352 259
107 3300050494 nmdc:mga06z11_10978_c1 nmdc:mga06z11_10978_c1_2122_2946 259
108 3300050496 nmdc:mga07m45_134482_c1 nmdc:mga07m45_134482_c1_571_1395 259
109 3300053158 Ga0500627_0133104 Ga0500627_0133104_290_1108 259
110 iso_pu_bacteria 2537561587 2537875859 259
111 iso_pu_bacteria 2599185210 2599602036 259
112 iso_pu_bacteria 2838042994 2838045692 259
113 iso_pu_bacteria 2838680041 2838682950 259
114 iso_pu_bacteria 2841859092 2841862572 259
115 iso_pu_bacteria 2841864319 2841867466 259
116 iso_pu_bacteria 2842192696 2842195553 259
117 iso_pu_bacteria 2842205361 2842210874 259
118 iso_pu_bacteria 2842243621 2842243681 259
119 iso_pu_bacteria 2842250916 2842254090 259
120 iso_pu_bacteria 2842341865 2842347563 259
121 iso_pu_bacteria 2842377471 2842379456 259
122 iso_pu_bacteria 2842515876 2842519356 259
123 iso_pu_bacteria 2899792073 2899795745 259
124 iso_pu_bacteria 2933011516 2933014473 259
125 iso_pu_bacteria 8005301065 8005303635 259
126 iso_pu_bacteria 8005688590 8005691585 259
127 3300003316 rootH1_10057687 rootH1_100576872 260
128 3300006195 Ga0075366_10048190 Ga0075366_100481903 260
129 3300050493 nmdc:mga0k408_127220_c1 nmdc:mga0k408_127220_c1_486_1337 260
130 iso_pu_bacteria 2510917028 2511182803 260
131 iso_pu_bacteria 2512875026 2512973007 260
132 iso_pu_bacteria 2513237089 2513604411 260
133 iso_pu_bacteria 2513237138 2513869758 260
134 iso_pu_bacteria 2513237144 2513910557 260
135 iso_pu_bacteria 2513237160 2514007111 260
136 iso_pu_bacteria 2517487022 2517568375 260
137 iso_pu_bacteria 2554235003 2554248624 260
138 iso_pu_bacteria 2558860242 2559295712 260
139 iso_pu_bacteria 2582581299 2585230762 260
140 iso_pu_bacteria 2582581304 2585259280 260
141 iso_pu_bacteria 2582581867 2585402853 260
142 iso_pu_bacteria 2585427590 2585823485 260
143 iso_pu_bacteria 2600255279 2601609713 260
144 iso_pu_bacteria 2600255308 2601746488 260
145 iso_pu_bacteria 2643221568 2643854596 260
146 iso_pu_bacteria 2643221582 2643919969 260
147 iso_pu_bacteria 2643221599 2644003010 260
148 iso_pu_bacteria 2643221634 2644196748 260
149 iso_pu_bacteria 2643221693 2644523321 260
150 iso_pu_bacteria 2775507049 2776910490 260
151 iso_pu_bacteria 2802428858 2802718574 260
152 iso_pu_bacteria 2802428859 2802724255 260
153 iso_pu_bacteria 2802428860 2802730083 260
154 iso_pu_bacteria 2802428861 2802737426 260
155 iso_pu_bacteria 2802428862 2802742342 260
156 iso_pu_bacteria 2802428863 2802749025 260
157 iso_pu_bacteria 2808606387 2808987553 260
158 iso_pu_bacteria 2818991439 2819559430 260
159 iso_pu_bacteria 2838675328 2838675394 260
160 iso_pu_bacteria 2838714209 2838714275 260
161 iso_pu_bacteria 2838719591 2838721923 260
162 iso_pu_bacteria 2838724970 2838725036 260
163 iso_pu_bacteria 2841846520 2841848903 260
164 iso_pu_bacteria 2842124991 2842125066 260
165 iso_pu_bacteria 2842130223 2842130289 260
166 iso_pu_bacteria 2842152218 2842154541 260
167 iso_pu_bacteria 2842170452 2842170518 260
168 iso_pu_bacteria 2842175837 2842178161 260
169 iso_pu_bacteria 2842187318 2842187384 260
170 iso_pu_bacteria 2842211629 2842211695 260
171 iso_pu_bacteria 2842224351 2842226685 260
172 iso_pu_bacteria 2899845264 2899848942 260
173 iso_pu_bacteria 2913295892 2913298224 260
174 iso_pu_bacteria 2915980308 2915986499 260
175 iso_pu_bacteria 2916061851 2916068297 260
176 iso_pu_bacteria 2919114240 2919114306 260
177 iso_pu_bacteria 2919166419 2919168933 260
178 iso_pu_bacteria 2921250672 2921252653 260
179 iso_pu_bacteria 2926754445 2926755326 260
180 iso_pu_bacteria 2926760298 2926762436 260
181 iso_pu_bacteria 2929138655 2929142905 260
182 iso_pu_bacteria 2933006813 2933009186 260
183 iso_pu_bacteria 2933594066 2933596223 260
184 iso_pu_bacteria 2937029754 2937031592 260
185 iso_pu_bacteria 2937036028 2937037724 260
186 iso_pu_bacteria 2937078374 2937081719 260
187 iso_pu_bacteria 2937084907 2937089411 260
188 iso_pu_bacteria 2957375807 2957377805 260
189 iso_pu_bacteria 2957437181 2957443279 260
190 iso_pu_bacteria 2960591022 2960593362 260
191 iso_pu_bacteria 2960631154 2960637148 260
192 iso_pu_bacteria 2960680706 2960684607 260
193 iso_pu_bacteria 2960693952 2960697473 260
194 iso_pu_bacteria 2967686174 2967688123 260
195 iso_pu_bacteria 2967728569 2967731133 260
196 iso_pu_bacteria 2970026789 2970027325 260
197 iso_pu_bacteria 2970122695 2970126138 260
198 iso_pu_bacteria 2970143518 2970146322 260
199 iso_pu_bacteria 2977530762 2977531094 260
200 iso_pu_bacteria 2977544691 2977545836 260
201 iso_pu_bacteria 2978969890 2978971630 260
202 iso_pu_bacteria 2979089926 2979092293 260
203 iso_pu_bacteria 2979095461 2979100318 260
204 iso_pu_bacteria 2979100975 2979104281 260
205 iso_pu_bacteria 2984509177 2984511139 260
206 iso_pu_bacteria 2984518228 2984522499 260
207 iso_pu_bacteria 2984587000 2984588772 260
208 iso_pu_bacteria 2984601300 2984604158 260
209 iso_pu_bacteria 3005452660 3005455146 260
210 iso_pu_bacteria 650716007 650740924 260
211 iso_pu_bacteria 8003570095 8003571997 260
212 iso_pu_bacteria 8003999396 8003999457 260
213 iso_pu_bacteria 2508501122 2509108994 261
214 iso_pu_bacteria 2509276019 2509375284 261
215 iso_pu_bacteria 2509276021 2509390098 261
216 iso_pu_bacteria 2509276033 2509447615 261
217 iso_pu_bacteria 2510065019 2510134447 261
218 iso_pu_bacteria 2510065057 2510307169 261
219 iso_pu_bacteria 2510461076 2510895872 261
220 iso_pu_bacteria 2510917030 2511194864 261
221 iso_pu_bacteria 2511231052 2511499038 261
222 iso_pu_bacteria 2512047086 2512531637 261
223 iso_pu_bacteria 2513237084 2513567440 261
224 iso_pu_bacteria 2513237085 2513577776 261
225 iso_pu_bacteria 2513237086 2513582400 261
226 iso_pu_bacteria 2513237091 2513616104 261
227 iso_pu_bacteria 2513237093 2513632077 261
228 iso_pu_bacteria 2513237103 2513712453 261
229 iso_pu_bacteria 2513237140 2513884694 261
230 iso_pu_bacteria 2513237143 2513905089 261
231 iso_pu_bacteria 2513237146 2513927999 261
232 iso_pu_bacteria 2513237162 2514017823 261
233 iso_pu_bacteria 2515075009 2515113609 261
234 iso_pu_bacteria 2515154107 2515607458 261
235 iso_pu_bacteria 2515154113 2515635322 261
236 iso_pu_bacteria 2515154114 2515646066 261
237 iso_pu_bacteria 2515154116 2515654860 261
238 iso_pu_bacteria 2515154134 2515739966 261
239 iso_pu_bacteria 2516653046 2516891587 261
240 iso_pu_bacteria 2516653077 2517037224 261
241 iso_pu_bacteria 2516653085 2517077563 261
242 iso_pu_bacteria 2517093000 2517096333 261
243 iso_pu_bacteria 2517287029 2517408191 261
244 iso_pu_bacteria 2519899620 2520378474 261
245 iso_pu_bacteria 2524023207 2524450804 261
246 iso_pu_bacteria 2529292951 2530646311 261
247 iso_pu_bacteria 2551306084 2551679987 261
248 iso_pu_bacteria 2551306085 2551683658 261
249 iso_pu_bacteria 2551306086 2551691638 261
250 iso_pu_bacteria 2551306087 2551702798 261
251 iso_pu_bacteria 2551306089 2551708725 261
252 iso_pu_bacteria 2551306092 2551733866 261
253 iso_pu_bacteria 2551306093 2551741150 261
254 iso_pu_bacteria 2558860100 2558866372 261
255 iso_pu_bacteria 2582581298 2585225171 261
256 iso_pu_bacteria 2585427526 2585524991 261
257 iso_pu_bacteria 2585427528 2585542707 261
258 iso_pu_bacteria 2585427529 2585547727 261
259 iso_pu_bacteria 2585427593 2585841349 261
260 iso_pu_bacteria 2599185170 2599421010 261
261 iso_pu_bacteria 2718217882 2719182323 261
262 iso_pu_bacteria 2718217927 2719386914 261
263 iso_pu_bacteria 2718217997 2719666650 261
264 iso_pu_bacteria 2718218009 2719733039 261
265 iso_pu_bacteria 2718218199 2720493070 261
266 iso_pu_bacteria 2718218232 2720614548 261
267 iso_pu_bacteria 2718218233 2720621322 261
268 iso_pu_bacteria 2718218235 2720632648 261
269 iso_pu_bacteria 2718218269 2720776372 261
270 iso_pu_bacteria 2718218363 2721148436 261
271 iso_pu_bacteria 2718218365 2721159822 261
272 iso_pu_bacteria 2718218366 2721165250 261
273 iso_pu_bacteria 2721755514 2722841420 261
274 iso_pu_bacteria 2721755556 2723027961 261
275 iso_pu_bacteria 2721755684 2723561591 261
276 iso_pu_bacteria 2721755685 2723568220 261
277 iso_pu_bacteria 2721755810 2724045795 261
278 iso_pu_bacteria 2721755819 2724090979 261
279 iso_pu_bacteria 2721755822 2724105485 261
280 iso_pu_bacteria 2721755823 2724111310 261
281 iso_pu_bacteria 2724679232 2725949289 261
282 iso_pu_bacteria 2728369352 2730108897 261
283 iso_pu_bacteria 2728369365 2730165558 261
284 iso_pu_bacteria 2728369397 2730299454 261
285 iso_pu_bacteria 2738541333 2739033313 261
286 iso_pu_bacteria 2751185821 2753462706 261
287 iso_pu_bacteria 2765235942 2766066361 261
288 iso_pu_bacteria 2791355094 2792637812 261
289 iso_pu_bacteria 2791355256 2793293940 261
290 iso_pu_bacteria 2791355259 2793314386 261
291 iso_pu_bacteria 2791355260 2793323872 261
292 iso_pu_bacteria 2791355262 2793335035 261
293 iso_pu_bacteria 2791355263 2793342378 261
294 iso_pu_bacteria 2791355264 2793349746 261
295 iso_pu_bacteria 2791355265 2793355397 261
296 iso_pu_bacteria 2791355266 2793362103 261
297 iso_pu_bacteria 2791355267 2793369957 261
298 iso_pu_bacteria 2802429605 2805929612 261
299 iso_pu_bacteria 2802429606 2805937304 261
300 iso_pu_bacteria 2802429633 2806047445 261
301 iso_pu_bacteria 2802429634 2806055204 261
302 iso_pu_bacteria 2802429635 2806062652 261
303 iso_pu_bacteria 2802429636 2806069720 261
304 iso_pu_bacteria 2802429637 2806075649 261
305 iso_pu_bacteria 2838035591 2838041370 261
306 iso_pu_bacteria 2838661181 2838665762 261
307 iso_pu_bacteria 2842395702 2842400505 261
308 iso_pu_bacteria 2842409023 2842410157 261
309 iso_pu_bacteria 2850079185 2850079651 261
310 iso_pu_bacteria 2855825444 2855827950 261
311 iso_pu_bacteria 2855839649 2855839707 261
312 iso_pu_bacteria 2858800743 2858803599 261
313 iso_pu_bacteria 2915986958 2915987646 261
314 iso_pu_bacteria 2915993759 2915997269 261
315 iso_pu_bacteria 2916000859 2916004675 261
316 iso_pu_bacteria 2916007675 2916012071 261
317 iso_pu_bacteria 2916014648 2916019062 261
318 iso_pu_bacteria 2916021584 2916027949 261
319 iso_pu_bacteria 2916028427 2916031518 261
320 iso_pu_bacteria 2916035215 2916039418 261
321 iso_pu_bacteria 2916041962 2916048280 261
322 iso_pu_bacteria 2916048683 2916051976 261
323 iso_pu_bacteria 2916055098 2916057069 261
324 iso_pu_bacteria 2916068649 2916076386 261
325 iso_pu_bacteria 2916076590 2916077872 261
326 iso_pu_bacteria 2919100787 2919105677 261
327 iso_pu_bacteria 2921201388 2921203736 261
328 iso_pu_bacteria 2921208531 2921212355 261
329 iso_pu_bacteria 2921237296 2921242759 261
330 iso_pu_bacteria 2921244191 2921248993 261
331 iso_pu_bacteria 2921257292 2921262732 261
332 iso_pu_bacteria 2921263974 2921268815 261
333 iso_pu_bacteria 2921282425 2921287005 261
334 iso_pu_bacteria 2921289301 2921289799 261
335 iso_pu_bacteria 2921296804 2921298629 261
336 iso_pu_bacteria 2924144063 2924148879 261
337 iso_pu_bacteria 2924150972 2924154326 261
338 iso_pu_bacteria 2924158325 2924164644 261
339 iso_pu_bacteria 2924165586 2924170794 261
340 iso_pu_bacteria 2924172951 2924179248 261
341 iso_pu_bacteria 2924179722 2924181134 261
342 iso_pu_bacteria 2924186466 2924189436 261
343 iso_pu_bacteria 2924193448 2924200187 261
344 iso_pu_bacteria 2924200457 2924204656 261
345 iso_pu_bacteria 2924207177 2924211733 261
346 iso_pu_bacteria 2924214083 2924214650 261
347 iso_pu_bacteria 2924221636 2924226405 261
348 iso_pu_bacteria 2924228884 2924230038 261
349 iso_pu_bacteria 2933570622 2933571323 261
350 iso_pu_bacteria 2933586486 2933591911 261
351 iso_pu_bacteria 2933599457 2933600458 261
352 iso_pu_bacteria 2935894831 2935896510 261
353 iso_pu_bacteria 2935901341 2935901402 261
354 iso_pu_bacteria 2936367885 2936371548 261
355 iso_pu_bacteria 2936375103 2936376919 261
356 iso_pu_bacteria 2936381700 2936383491 261
357 iso_pu_bacteria 2936996657 2936998556 261
358 iso_pu_bacteria 2937002841 2937007462 261
359 iso_pu_bacteria 2937009748 2937015578 261
360 iso_pu_bacteria 2937016420 2937021365 261
361 iso_pu_bacteria 2937023124 2937023473 261
362 iso_pu_bacteria 2937042894 2937047393 261
363 iso_pu_bacteria 2937049772 2937053248 261
364 iso_pu_bacteria 2937056579 2937060786 261
365 iso_pu_bacteria 2937063883 2937066776 261
366 iso_pu_bacteria 2937071275 2937072807 261
367 iso_pu_bacteria 2937091812 2937097062 261
368 iso_pu_bacteria 2937098957 2937102801 261
369 iso_pu_bacteria 2937106411 2937106515 261
370 iso_pu_bacteria 2937113482 2937119374 261
371 iso_pu_bacteria 2937119839 2937124296 261
372 iso_pu_bacteria 2937126314 2937130876 261
373 iso_pu_bacteria 2957382221 2957386461 261
374 iso_pu_bacteria 2957388812 2957393280 261
375 iso_pu_bacteria 2957395598 2957397590 261
376 iso_pu_bacteria 2957402308 2957403400 261
377 iso_pu_bacteria 2957408893 2957413421 261
378 iso_pu_bacteria 2957415311 2957420851 261
379 iso_pu_bacteria 2957422303 2957423585 261
380 iso_pu_bacteria 2957430029 2957435918 261
381 iso_pu_bacteria 2957443900 2957449250 261
382 iso_pu_bacteria 2957450854 2957455647 261
383 iso_pu_bacteria 2957457609 2957461867 261
384 iso_pu_bacteria 2957464669 2957469420 261
385 iso_pu_bacteria 2957471148 2957473226 261
386 iso_pu_bacteria 2957478035 2957481880 261
387 iso_pu_bacteria 2957484790 2957490984 261
388 iso_pu_bacteria 2957491536 2957494030 261
389 iso_pu_bacteria 2957498199 2957500767 261
390 iso_pu_bacteria 2957505466 2957505907 261
391 iso_pu_bacteria 2960584000 2960590436 261
392 iso_pu_bacteria 2960597568 2960601247 261
393 iso_pu_bacteria 2960603979 2960604350 261
394 iso_pu_bacteria 2960610863 2960613303 261
395 iso_pu_bacteria 2960617483 2960620127 261
396 iso_pu_bacteria 2960624210 2960626230 261
397 iso_pu_bacteria 2960637947 2960644144 261
398 iso_pu_bacteria 2960645483 2960650390 261
399 iso_pu_bacteria 2960652885 2960658890 261
400 iso_pu_bacteria 2960660292 2960660681 261
401 iso_pu_bacteria 2960667422 2960673047 261
402 iso_pu_bacteria 2960674078 2960677720 261
403 iso_pu_bacteria 2960687367 2960687401 261
404 iso_pu_bacteria 2964607997 2964614786 261
405 iso_pu_bacteria 2964615318 2964618328 261
406 iso_pu_bacteria 2964621998 2964626601 261
407 iso_pu_bacteria 2964628898 2964633376 261
408 iso_pu_bacteria 2964636051 2964642263 261
409 iso_pu_bacteria 2964643177 2964649811 261
410 iso_pu_bacteria 2964649959 2964650046 261
411 iso_pu_bacteria 2964656573 2964661674 261
412 iso_pu_bacteria 2964663802 2964670247 261
413 iso_pu_bacteria 2964670856 2964675752 261
414 iso_pu_bacteria 2964678106 2964683601 261
415 iso_pu_bacteria 2964685014 2964689840 261
416 iso_pu_bacteria 2964691889 2964696179 261
417 iso_pu_bacteria 2964698721 2964702854 261
418 iso_pu_bacteria 2964705432 2964710731 261
419 iso_pu_bacteria 2964712639 2964712988 261
420 iso_pu_bacteria 2964719344 2964724399 261
421 iso_pu_bacteria 2967664464 2967667512 261
422 iso_pu_bacteria 2967671571 2967676838 261
423 iso_pu_bacteria 2967678726 2967682593 261
424 iso_pu_bacteria 2967693043 2967694801 261
425 iso_pu_bacteria 2967699805 2967706914 261
426 iso_pu_bacteria 2967706974 2967711502 261
427 iso_pu_bacteria 2967714385 2967714395 261
428 iso_pu_bacteria 2967721400 2967723719 261
429 iso_pu_bacteria 2967735183 2967739145 261
430 iso_pu_bacteria 2967742019 2967745732 261
431 iso_pu_bacteria 2967748971 2967754559 261
432 iso_pu_bacteria 2967755722 2967757246 261
433 iso_pu_bacteria 2967762386 2967768775 261
434 iso_pu_bacteria 2967769361 2967773767 261
435 iso_pu_bacteria 2967775926 2967780048 261
436 iso_pu_bacteria 2970019648 2970021234 261
437 iso_pu_bacteria 2970033650 2970037480 261
438 iso_pu_bacteria 2970040964 2970040995 261
439 iso_pu_bacteria 2970047711 2970048159 261
440 iso_pu_bacteria 2970054988 2970056952 261
441 iso_pu_bacteria 2970061556 2970068339 261
442 iso_pu_bacteria 2970068827 2970069186 261
443 iso_pu_bacteria 2970076120 2970080466 261
444 iso_pu_bacteria 2970082768 2970088086 261
445 iso_pu_bacteria 2970088815 2970093737 261
446 iso_pu_bacteria 2970095765 2970100803 261
447 iso_pu_bacteria 2970102677 2970106085 261
448 iso_pu_bacteria 2970109326 2970111543 261
449 iso_pu_bacteria 2970116247 2970121378 261
450 iso_pu_bacteria 2970129317 2970131299 261
451 iso_pu_bacteria 2970136068 2970140811 261
452 iso_pu_bacteria 2970149975 2970151880 261
453 iso_pu_bacteria 2970156795 2970162607 261
454 iso_pu_bacteria 2970164137 2970169574 261
455 iso_pu_bacteria 2970170962 2970175699 261
456 iso_pu_bacteria 2970177841 2970179388 261
457 iso_pu_bacteria 2970184632 2970185657 261
458 iso_pu_bacteria 2970191845 2970196576 261
459 iso_pu_bacteria 2977516862 2977518296 261
460 iso_pu_bacteria 2977523885 2977528444 261
461 iso_pu_bacteria 2977537788 2977538514 261
462 iso_pu_bacteria 2977551784 2977554718 261
463 iso_pu_bacteria 2977558990 2977563350 261
464 iso_pu_bacteria 2977565890 2977570072 261
465 iso_pu_bacteria 2977572785 2977575584 261
466 iso_pu_bacteria 2977579622 2977584319 261
467 iso_pu_bacteria 3005445848 3005448916 261
468 iso_pu_bacteria 643692032 643824273 261
469 iso_pu_bacteria 648276728 648736775 261
470 iso_pu_bacteria 8003992118 8003992178 261
471 iso_pu_bacteria 8005275841 8005281728 261
472 iso_pu_bacteria 8005282627 8005284316 261
473 iso_pu_bacteria 8005289223 8005289568 261
474 iso_pu_bacteria 8005307578 8005314152 261
475 iso_pu_bacteria 8005376324 8005382608 261
476 iso_pu_bacteria 8005382845 8005384570 261
477 iso_pu_bacteria 8005395548 8005395598 261
478 iso_pu_bacteria 8005430974 8005434446 261
479 iso_pu_bacteria 8005460587 8005464295 261
480 iso_pu_bacteria 8005497431 8005501398 261
481 iso_pu_bacteria 8005556819 8005561709 261
482 iso_pu_bacteria 8005563573 8005568488 261
483 iso_pu_bacteria 8005570704 8005572976 261
484 iso_pu_bacteria 8005619151 8005622761 261
485 iso_pu_bacteria 8005626139 8005630275 261
486 iso_pu_bacteria 8005668836 8005672818 261
487 iso_pu_bacteria 8005695170 8005696719 261
488 iso_pu_bacteria 8018163183 8018163270 261
489 iso_pu_bacteria 8023680758 8023682678 261
490 iso_pu_bacteria 8024479707 8024486035 261
491 iso_pu_bacteria 8024501048 8024501114 261
492 iso_pu_bacteria 8056375014 8056377093 261
493 iso_pu_bacteria 8056382006 8056387415 261
494 iso_pu_bacteria 8057874678 8057881848 261
495 3300044712 Ga0453684_0009469 Ga0453684_0009469_3814_4671 262
496 3300002704 JGI25155J39150_1000098 JGI25155J39150_100009844 263
497 3300002705 JGI25156J39149_1000163 JGI25156J39149_100016344 263
498 3300002738 JGI25154J39366_1000183 JGI25154J39366_100018344 263
499 3300002741 JGI25157J39369_1000209 JGI25157J39369_10002096 263
500 3300003187 JGI25151J46595_10005186 JGI25151J46595_100051866 263
501 3300003187 JGI25151J46595_10007415 JGI25151J46595_100074156 263
502 3300003187 JGI25151J46595_10009835 JGI25151J46595_100098352 263
503 3300003354 JGI25160J50197_1000212 JGI25160J50197_10002126 263
504 3300003374 JGI25161J50226_1000151 JGI25161J50226_10001516 263
505 3300003773 Ga0055537_1000709 Ga0055537_10007099 263
506 3300003775 Ga0055524_1000082 Ga0055524_1000082110 263
507 3300003775 Ga0055524_1001237 Ga0055524_10012379 263
508 3300003781 Ga0055536_1001960 Ga0055536_10019603 263
509 3300003784 Ga0055534_1003222 Ga0055534_10032226 263
510 3300003784 Ga0055534_1005336 Ga0055534_10053362 263
511 3300003784 Ga0055534_1013334 Ga0055534_10133342 263
512 3300003790 Ga0055528_1002394 Ga0055528_10023944 263
513 3300003791 Ga0055530_10000688 Ga0055530_1000068810 263
514 3300003791 Ga0055530_10046368 Ga0055530_100463681 263
515 3300003792 Ga0055540_1000010 Ga0055540_1000010246 263
516 3300003794 Ga0055531_10019143 Ga0055531_100191431 263
517 3300003856 Ga0058692_1001275 Ga0058692_10012757 263
518 3300004625 Ga0055543_1000526 Ga0055543_100052624 263
519 3300005262 Ga0065165_1015536 Ga0065165_10155362 263
520 3300005262 Ga0065165_1032167 Ga0065165_10321672 263
521 3300005262 Ga0065165_1042739 Ga0065165_10427391 263
522 3300025206 Ga0209435_100010 Ga0209435_100010387 263
523 3300025208 Ga0209436_107364 Ga0209436_1073641 263
524 3300025245 Ga0207425_1001995 Ga0207425_10019955 263
525 3300025246 Ga0209646_1000001 Ga0209646_10000011755 263
526 3300025250 Ga0209026_1000001 Ga0209026_1000001409 263
527 3300025256 Ga0209759_1000001 Ga0209759_10000011386 263
528 3300025258 Ga0209129_1013977 Ga0209129_10139771 263
529 3300025263 Ga0209565_1000036 Ga0209565_1000036112 263
530 3300025263 Ga0209565_1000226 Ga0209565_10002268 263
531 3300025273 Ga0209673_1000282 Ga0209673_100028222 263
532 3300025284 Ga0209130_1000042 Ga0209130_1000042125 263
533 3300025291 Ga0209675_1000289 Ga0209675_100028947 263
534 3300025291 Ga0209675_1003625 Ga0209675_10036252 263
535 3300025292 Ga0209676_1000007 Ga0209676_1000007272 263
536 3300025294 Ga0209025_1002347 Ga0209025_100234714 263
537 3300025294 Ga0209025_1006388 Ga0209025_10063883 263
538 3300025295 Ga0209564_1024341 Ga0209564_10243412 263
539 3300025295 Ga0209564_1025207 Ga0209564_10252072 263
540 3300025297 Ga0209758_1004703 Ga0209758_10047037 263
541 3300025298 Ga0209050_1000003 Ga0209050_10000031236 263
542 3300025298 Ga0209050_1004120 Ga0209050_10041204 263
543 3300025298 Ga0209050_1013661 Ga0209050_10136613 263
544 3300025299 Ga0209256_1000001 Ga0209256_10000011239 263
545 3300025302 Ga0207426_1000097 Ga0207426_1000097131 263
546 3300025302 Ga0207426_1001878 Ga0207426_100187810 263
547 3300025303 Ga0209051_1000003 Ga0209051_10000031236 263
548 3300025304 Ga0209257_1000020 Ga0209257_1000020272 263
549 3300025304 Ga0209257_1005878 Ga0209257_100587810 263
550 3300027312 Ga0209371_1001191 Ga0209371_10011916 263
551 3300030500 Ga0268256_1005648 Ga0268256_10056485 263
552 3300031456 Ga0307513_10000011 Ga0307513_10000011163 263
553 3300031548 Ga0307408_100344065 Ga0307408_1003440652 263
554 3300031731 Ga0307405_10157461 Ga0307405_101574612 263
555 3300031911 Ga0307412_10436561 Ga0307412_104365611 263
556 3300048919 Ga0496116_0041823 Ga0496116_0041823_728_1534 263
557 3300048921 Ga0496118_0046582 Ga0496118_0046582_17_823 263
558 3300053098 Ga0500650_0025695 Ga0500650_0025695_902_1774 263
559 3300053117 Ga0500593_003321 Ga0500593_003321_1990_2862 263
560 3300053730 Ga0500645_010175 Ga0500645_010175_868_1740 263
561 3300053730 Ga0500645_041416 Ga0500645_041416_74_955 263
562 iso_pu_bacteria 8024486573 8024488527 263
563 3300003322 rootL2_10320304 rootL2_103203042 264
564 3300003323 rootH1_10117136 rootH1_101171362 264
565 3300003323 rootH1_10170367 rootH1_101703673 264
566 3300003771 Ga0055526_1017186 Ga0055526_10171863 264
567 3300003775 Ga0055524_1004997 Ga0055524_10049972 264
568 3300003790 Ga0055528_1001182 Ga0055528_10011828 264
569 3300005564 Ga0070664_100468505 Ga0070664_1004685052 264
570 3300006038 Ga0075365_10006669 Ga0075365_100066694 264
571 3300006048 Ga0075363_100026618 Ga0075363_1000266183 264
572 3300006051 Ga0075364_10007185 Ga0075364_100071853 264
573 3300006051 Ga0075364_10012908 Ga0075364_100129082 264
574 3300006177 Ga0075362_10001572 Ga0075362_100015723 264
575 3300006178 Ga0075367_10005561 Ga0075367_100055611 264
576 3300006178 Ga0075367_10021211 Ga0075367_100212113 264
577 3300006186 Ga0075369_10001899 Ga0075369_100018993 264
578 3300006186 Ga0075369_10027942 Ga0075369_100279422 264
579 3300006195 Ga0075366_10022758 Ga0075366_100227583 264
580 3300006353 Ga0075370_10020155 Ga0075370_100201552 264
581 3300006946 Ga0079104_1004704 Ga0079104_10047043 264
582 3300006948 Ga0099826_10002615 Ga0099826_100026152 264
583 3300009148 Ga0105243_10131709 Ga0105243_101317092 264
584 3300009551 Ga0105238_10659264 Ga0105238_106592641 264
585 3300009766 Ga0123342_1018063 Ga0123342_10180633 264
586 3300010375 Ga0105239_10316635 Ga0105239_103166352 264
587 3300011119 Ga0105246_10050655 Ga0105246_100506553 264
588 3300013100 Ga0157373_10049545 Ga0157373_100495453 264
589 3300013100 Ga0157373_10106668 Ga0157373_101066682 264
590 3300013102 Ga0157371_10000966 Ga0157371_100009669 264
591 3300013102 Ga0157371_10002118 Ga0157371_100021183 264
592 3300013104 Ga0157370_10000338 Ga0157370_100003388 264
593 3300013105 Ga0157369_10020309 Ga0157369_100203093 264
594 3300013307 Ga0157372_10239097 Ga0157372_102390973 264
595 3300021320 Ga0214544_1000105 Ga0214544_100010541 264
596 3300021321 Ga0214542_1000029 Ga0214542_1000029128 264
597 3300021327 Ga0214543_1000040 Ga0214543_1000040128 264
598 3300022739 Ga0228711_1000013 Ga0228711_100001336 264
599 3300022740 Ga0228710_1000008 Ga0228710_100000893 264
600 3300025258 Ga0209129_1000226 Ga0209129_100022620 264
601 3300025273 Ga0209673_1000239 Ga0209673_100023982 264
602 3300025284 Ga0209130_1008226 Ga0209130_10082262 264
603 3300025284 Ga0209130_1014063 Ga0209130_10140633 264
604 3300025292 Ga0209676_1018097 Ga0209676_10180972 264
605 3300025294 Ga0209025_1000288 Ga0209025_1000288111 264
606 3300025294 Ga0209025_1037708 Ga0209025_10377081 264
607 3300025294 Ga0209025_1051255 Ga0209025_10512551 264
608 3300025294 Ga0209025_1081354 Ga0209025_10813542 264
609 3300025295 Ga0209564_1007458 Ga0209564_10074583 264
610 3300025299 Ga0209256_1000619 Ga0209256_100061932 264
611 3300025935 Ga0207709_10086633 Ga0207709_100866332 264
612 3300027111 Ga0209281_1000134 Ga0209281_1000134155 264
613 3300027312 Ga0209371_1000022 Ga0209371_1000022453 264
614 3300027312 Ga0209371_1000370 Ga0209371_100037023 264
615 3300027666 Ga0209282_1000029 Ga0209282_1000029123 264
616 3300027666 Ga0209282_1001507 Ga0209282_10015079 264
617 3300027866 Ga0209813_10003505 Ga0209813_100035052 264
618 3300028794 Ga0307515_10209541 Ga0307515_102095412 264
619 3300030500 Ga0268256_1000019 Ga0268256_100001967 264
620 3300030744 Ga0316181_1086484 Ga0316181_10864842 264
621 3300031967 Ga0315914_1000021 Ga0315914_100002122 264
622 3300031995 Ga0307409_100381438 Ga0307409_1003814382 264
623 3300032004 Ga0307414_10073553 Ga0307414_100735532 264
624 3300033430 Ga0315913_1000014 Ga0315913_100001488 264
625 3300033464 Ga0315915_1000003 Ga0315915_100000322 264
626 3300046460 Ga0495638_0014856 Ga0495638_0014856_2832_3644 264
627 3300046460 Ga0495638_0025826 Ga0495638_0025826_1684_2496 264
628 3300046506 Ga0495583_0032155 Ga0495583_0032155_132_953 264
629 3300046558 Ga0495633_0032451 Ga0495633_0032451_1486_2283 264
630 3300047470 Ga0495681_0000688 Ga0495681_0000688_2343_3140 264
631 3300047470 Ga0495681_0136781 Ga0495681_0136781_170_991 264
632 3300048907 Ga0496104_0114639 Ga0496104_0114639_1565_2362 264
633 3300048916 Ga0496113_0061214 Ga0496113_0061214_698_1495 264
634 3300048919 Ga0496116_0000049 Ga0496116_0000049_126057_126860 264
635 3300048920 Ga0496117_0000002 Ga0496117_0000002_96785_97582 264
636 3300048920 Ga0496117_0097498 Ga0496117_0097498_858_1655 264
637 3300048921 Ga0496118_0003513 Ga0496118_0003513_10739_11536 264
638 3300048921 Ga0496118_0083291 Ga0496118_0083291_61_939 264
639 3300048922 Ga0496119_0011799 Ga0496119_0011799_2906_3703 264
640 3300048922 Ga0496119_0026727 Ga0496119_0026727_1329_2126 264
641 3300048923 Ga0496120_0000093 Ga0496120_0000093_49636_50433 264
642 3300048923 Ga0496120_0048286 Ga0496120_0048286_133_930 264
643 3300048923 Ga0496120_0077123 Ga0496120_0077123_549_1346 264
644 3300048924 Ga0496121_0000005 Ga0496121_0000005_979666_980463 264
645 3300048925 Ga0496122_0000004 Ga0496122_0000004_548094_548891 264
646 3300048925 Ga0496122_0016047 Ga0496122_0016047_4572_5411 264
647 3300048925 Ga0496122_0066691 Ga0496122_0066691_239_1081 264
648 3300048926 Ga0496123_0000007 Ga0496123_0000007_548094_548891 264
649 3300048927 Ga0496124_0000091 Ga0496124_0000091_138182_138979 264
650 3300048927 Ga0496124_0006058 Ga0496124_0006058_7737_8534 264
651 3300048927 Ga0496124_0118925 Ga0496124_0118925_1135_1956 264
652 3300048927 Ga0496124_0268973 Ga0496124_0268973_394_1197 264
653 3300048928 Ga0496125_0000159 Ga0496125_0000159_103744_104586 264
654 3300048928 Ga0496125_0030598 Ga0496125_0030598_131_928 264
655 3300048928 Ga0496125_0128119 Ga0496125_0128119_636_1433 264
656 3300048929 Ga0496126_0000081 Ga0496126_0000081_117981_118784 264
657 3300048929 Ga0496126_0012281 Ga0496126_0012281_3331_4149 264
658 3300048929 Ga0496126_0283502 Ga0496126_0283502_411_1208 264
659 3300050489 nmdc:mga03683_34324_c1 nmdc:mga03683_34324_c1_805_1602 264
660 3300050491 nmdc:mga00v17_19670_c1 nmdc:mga00v17_19670_c1_575_1372 264
661 3300050492 nmdc:mga0yw44_213678_c1 nmdc:mga0yw44_213678_c1_344_1162 264
662 3300050492 nmdc:mga0yw44_431_c1 nmdc:mga0yw44_431_c1_9949_10746 264
663 3300050495 nmdc:mga04h51_39557_c1 nmdc:mga04h51_39557_c1_377_1186 264
664 3300050516 nmdc:mga0sz30_26_c1 nmdc:mga0sz30_26_c1_11443_12240 264
665 3300053111 Ga0500572_001165 Ga0500572_001165_1843_2673 264
666 3300053122 Ga0500608_012503 Ga0500608_012503_1945_2742 264
667 3300053136 Ga0500559_0009290 Ga0500559_0009290_1693_2505 264
668 3300053137 Ga0500561_0005831 Ga0500561_0005831_818_1615 264
669 3300053153 Ga0500616_0000400 Ga0500616_0000400_36116_36937 264
670 3300053156 Ga0500622_0003374 Ga0500622_0003374_8840_9637 264
671 3300053157 Ga0500624_000600 Ga0500624_000600_2476_3273 264
672 3300053177 Ga0500636_0000001 Ga0500636_0000001_31148_31945 264
673 3300053177 Ga0500636_0021680 Ga0500636_0021680_1374_2171 264
674 3300053730 Ga0500645_001087 Ga0500645_001087_1594_2466 264
675 3300053730 Ga0500645_044187 Ga0500645_044187_223_1044 264
676 iso_pu_bacteria 2510461069 2510838947 264
677 iso_pu_bacteria 8054460903 8054464715 264
678 3300002739 JGI25158J39367_1000927 JGI25158J39367_10009273 265
679 3300002773 JGI25152J39213_1003227 JGI25152J39213_10032273 265
680 3300002773 JGI25152J39213_1010470 JGI25152J39213_10104702 265
681 3300002987 JGI25159J45721_1004685 JGI25159J45721_10046852 265
682 3300003187 JGI25151J46595_10002096 JGI25151J46595_1000209611 265
683 3300003187 JGI25151J46595_10026849 JGI25151J46595_100268492 265
684 3300003215 JGI25153J46596_10006886 JGI25153J46596_100068862 265
685 3300003215 JGI25153J46596_10007510 JGI25153J46596_100075105 265
686 3300003215 JGI25153J46596_10011704 JGI25153J46596_100117042 265
687 3300003320 rootH2_10045333 rootH2_100453332 265
688 3300003354 JGI25160J50197_1000917 JGI25160J50197_100091710 265
689 3300003354 JGI25160J50197_1009247 JGI25160J50197_10092472 265
690 3300003374 JGI25161J50226_1000238 JGI25161J50226_10002383 265
691 3300003374 JGI25161J50226_1000331 JGI25161J50226_100033120 265
692 3300003374 JGI25161J50226_1001587 JGI25161J50226_10015877 265
693 3300003771 Ga0055526_1002806 Ga0055526_10028066 265
694 3300003771 Ga0055526_1004625 Ga0055526_10046253 265
695 3300003771 Ga0055526_1012519 Ga0055526_10125193 265
696 3300003775 Ga0055524_1006292 Ga0055524_10062923 265
697 3300003775 Ga0055524_1021578 Ga0055524_10215782 265
698 3300003790 Ga0055528_1000525 Ga0055528_10005253 265
699 3300003790 Ga0055528_1003139 Ga0055528_10031395 265
700 3300003790 Ga0055528_1009964 Ga0055528_10099643 265
701 3300003790 Ga0055528_1019332 Ga0055528_10193322 265
702 3300003790 Ga0055528_1019744 Ga0055528_10197442 265
703 3300003792 Ga0055540_1001376 Ga0055540_10013762 265
704 3300003792 Ga0055540_1003377 Ga0055540_10033771 265
705 3300004625 Ga0055543_1000419 Ga0055543_100041922 265
706 3300004625 Ga0055543_1000646 Ga0055543_10006463 265
707 3300005353 Ga0070669_100286700 Ga0070669_1002867002 265
708 3300006038 Ga0075365_10004644 Ga0075365_100046442 265
709 3300006177 Ga0075362_10000300 Ga0075362_1000030012 265
710 3300006178 Ga0075367_10004384 Ga0075367_100043842 265
711 3300006186 Ga0075369_10001967 Ga0075369_100019672 265
712 3300006186 Ga0075369_10031219 Ga0075369_100312192 265
713 3300006186 Ga0075369_10055396 Ga0075369_100553962 265
714 3300006195 Ga0075366_10009357 Ga0075366_100093573 265
715 3300006353 Ga0075370_10045619 Ga0075370_100456192 265
716 3300006353 Ga0075370_10062684 Ga0075370_100626841 265
717 3300006946 Ga0079104_1005831 Ga0079104_10058313 265
718 3300009765 Ga0123341_1000011 Ga0123341_100001184 265
719 3300009766 Ga0123342_1008752 Ga0123342_10087526 265
720 3300021327 Ga0214543_1000027 Ga0214543_100002752 265
721 3300025208 Ga0209436_100110 Ga0209436_10011032 265
722 3300025245 Ga0207425_1001956 Ga0207425_10019562 265
723 3300025245 Ga0207425_1013334 Ga0207425_10133342 265
724 3300025258 Ga0209129_1001492 Ga0209129_10014929 265
725 3300025258 Ga0209129_1002108 Ga0209129_10021085 265
726 3300025258 Ga0209129_1005143 Ga0209129_10051431 265
727 3300025258 Ga0209129_1005786 Ga0209129_10057864 265
728 3300025258 Ga0209129_1010068 Ga0209129_10100682 265
729 3300025273 Ga0209673_1000478 Ga0209673_100047837 265
730 3300025273 Ga0209673_1001495 Ga0209673_100149514 265
731 3300025273 Ga0209673_1001737 Ga0209673_100173716 265
732 3300025273 Ga0209673_1002506 Ga0209673_10025062 265
733 3300025273 Ga0209673_1018821 Ga0209673_10188212 265
734 3300025284 Ga0209130_1000023 Ga0209130_1000023217 265
735 3300025284 Ga0209130_1017324 Ga0209130_10173242 265
736 3300025294 Ga0209025_1000411 Ga0209025_100041160 265
737 3300025294 Ga0209025_1013965 Ga0209025_10139651 265
738 3300025295 Ga0209564_1000259 Ga0209564_10002592 265
739 3300025295 Ga0209564_1000393 Ga0209564_100039328 265
740 3300025295 Ga0209564_1001326 Ga0209564_10013268 265
741 3300025295 Ga0209564_1026301 Ga0209564_10263012 265
742 3300025297 Ga0209758_1000390 Ga0209758_100039050 265
743 3300025297 Ga0209758_1001594 Ga0209758_10015943 265
744 3300025297 Ga0209758_1008994 Ga0209758_10089942 265
745 3300025297 Ga0209758_1078594 Ga0209758_10785941 265
746 3300025298 Ga0209050_1007028 Ga0209050_10070284 265
747 3300025299 Ga0209256_1000155 Ga0209256_1000155117 265
748 3300025299 Ga0209256_1001902 Ga0209256_10019022 265
749 3300025299 Ga0209256_1004144 Ga0209256_10041444 265
750 3300025299 Ga0209256_1007631 Ga0209256_10076316 265
751 3300025302 Ga0207426_1000087 Ga0207426_1000087145 265
752 3300025302 Ga0207426_1000386 Ga0207426_100038650 265
753 3300025303 Ga0209051_1000321 Ga0209051_100032111 265
754 3300025303 Ga0209051_1003739 Ga0209051_10037398 265
755 3300025303 Ga0209051_1004393 Ga0209051_10043932 265
756 3300025303 Ga0209051_1018086 Ga0209051_10180862 265
757 3300025304 Ga0209257_1010077 Ga0209257_10100774 265
758 3300025923 Ga0207681_10101055 Ga0207681_101010551 265
759 3300027111 Ga0209281_1000783 Ga0209281_10007835 265
760 3300028379 Ga0268266_10112087 Ga0268266_101120872 265
761 3300028794 Ga0307515_10007465 Ga0307515_1000746519 265
762 3300031456 Ga0307513_10015921 Ga0307513_100159215 265
763 3300031548 Ga0307408_100068413 Ga0307408_1000684132 265
764 3300031911 Ga0307412_10025014 Ga0307412_100250142 265
765 3300031995 Ga0307409_100331407 Ga0307409_1003314072 265
766 3300041413 Ga0439465_0007062 Ga0439465_0007062_255_1079 265
767 3300041413 Ga0439465_0018167 Ga0439465_0018167_1250_2125 265
768 3300041441 Ga0451787_279068 Ga0451787_279068_1935_2774 265
769 3300041458 Ga0451798_0814015 Ga0451798_0814015_128_967 265
770 3300041491 Ga0451833_0644275 Ga0451833_0644275_1547_2386 265
771 3300041497 Ga0451840_11731 Ga0451840_11731_332_1144 265
772 3300041498 Ga0451841_0397021 Ga0451841_0397021_322_1134 265
773 3300041498 Ga0451841_1005621 Ga0451841_1005621_15_827 265
774 3300041501 Ga0451845_0927883 Ga0451845_0927883_292_1131 265
775 3300041501 Ga0451845_0929104 Ga0451845_0929104_166_978 265
776 3300041502 Ga0451846_05577 Ga0451846_05577_902_1741 265
777 3300041503 Ga0451847_0008387 Ga0451847_0008387_2987_3799 265
778 3300041503 Ga0451847_0691945 Ga0451847_0691945_224_1036 265
779 3300041507 Ga0451851_0548143 Ga0451851_0548143_845_1684 265
780 3300041511 Ga0451855_0189021 Ga0451855_0189021_33_872 265
781 3300041512 Ga0451853_1500900 Ga0451853_1500900_2708_3547 265
782 3300041907 Ga0452268_38528 Ga0452268_38528_523_1335 265
783 3300042006 Ga0439432_013219 Ga0439432_013219_862_1686 265
784 3300042007 Ga0439449_0022025 Ga0439449_0022025_1066_1881 265
785 3300042007 Ga0439449_0086854 Ga0439449_0086854_152_976 265
786 3300046452 Ga0495617_054991 Ga0495617_054991_143_955 265
787 3300046460 Ga0495638_0000300 Ga0495638_0000300_60398_61222 265
788 3300046474 Ga0495605_0000998 Ga0495605_0000998_6920_7744 265
789 3300046474 Ga0495605_0036369 Ga0495605_0036369_711_1550 265
790 3300046492 Ga0495585_0037288 Ga0495585_0037288_1783_2607 265
791 3300046501 Ga0495607_0073056 Ga0495607_0073056_32_871 265
792 3300046506 Ga0495583_0044005 Ga0495583_0044005_871_1695 265
793 3300046507 Ga0495606_0048548 Ga0495606_0048548_1399_2238 265
794 3300046512 Ga0495610_0022471 Ga0495610_0022471_497_1336 265
795 3300046513 Ga0495616_0036507 Ga0495616_0036507_237_1061 265
796 3300046513 Ga0495616_0080039 Ga0495616_0080039_26_838 265
797 3300046515 Ga0495620_0006745 Ga0495620_0006745_1413_2252 265
798 3300046515 Ga0495620_0022657 Ga0495620_0022657_899_1723 265
799 3300046518 Ga0495631_0002311 Ga0495631_0002311_1506_2330 265
800 3300046519 Ga0495632_0008599 Ga0495632_0008599_4166_4990 265
801 3300046519 Ga0495632_0029795 Ga0495632_0029795_1631_2470 265
802 3300046522 Ga0495643_0018843 Ga0495643_0018843_2817_3743 265
803 3300046522 Ga0495643_0022292 Ga0495643_0022292_1221_2033 265
804 3300046523 Ga0495644_0047387 Ga0495644_0047387_505_1344 265
805 3300046538 Ga0495609_0014796 Ga0495609_0014796_1239_2063 265
806 3300046538 Ga0495609_0060177 Ga0495609_0060177_504_1343 265
807 3300046542 Ga0495597_0025376 Ga0495597_0025376_1025_1864 265
808 3300046615 Ga0495656_0053175 Ga0495656_0053175_83_922 265
809 3300046616 Ga0495668_0004998 Ga0495668_0004998_7796_8620 265
810 3300046616 Ga0495668_0028712 Ga0495668_0028712_2150_2989 265
811 3300046648 Ga0495611_0011812 Ga0495611_0011812_1482_2306 265
812 3300046660 Ga0495625_0008370 Ga0495625_0008370_2477_3301 265
813 3300046660 Ga0495625_0021355 Ga0495625_0021355_288_1127 265
814 3300046660 Ga0495625_0023158 Ga0495625_0023158_3832_4671 265
815 3300046692 Ga0495671_0041582 Ga0495671_0041582_1443_2282 265
816 3300046694 Ga0495649_0010942 Ga0495649_0010942_2107_3033 265
817 3300046694 Ga0495649_0030253 Ga0495649_0030253_1738_2589 265
818 3300046810 Ga0495660_0015968 Ga0495660_0015968_359_1198 265
819 3300047318 Ga0495636_0006453 Ga0495636_0006453_740_1579 265
820 3300047320 Ga0495672_0011865 Ga0495672_0011865_1811_2635 265
821 3300047323 Ga0495683_0069995 Ga0495683_0069995_728_1567 265
822 3300047443 Ga0495687_116962 Ga0495687_116962_75_899 265
823 3300047472 Ga0495686_0002120 Ga0495686_0002120_11509_12348 265
824 3300047472 Ga0495686_0064325 Ga0495686_0064325_801_1652 265
825 3300048090 Ga0495615_0008384 Ga0495615_0008384_810_1649 265
826 3300048091 Ga0495626_0057492 Ga0495626_0057492_233_1159 265
827 3300048909 Ga0496106_0000028 Ga0496106_0000028_138300_139166 265
828 3300048919 Ga0496116_0101314 Ga0496116_0101314_604_1419 265
829 3300048920 Ga0496117_0036587 Ga0496117_0036587_326_1138 265
830 3300048921 Ga0496118_0011225 Ga0496118_0011225_2648_3460 265
831 3300048921 Ga0496118_0015019 Ga0496118_0015019_4664_5479 265
832 3300048924 Ga0496121_0033662 Ga0496121_0033662_1427_2239 265
833 3300048924 Ga0496121_0186523 Ga0496121_0186523_352_1170 265
834 3300048924 Ga0496121_0196021 Ga0496121_0196021_538_1377 265
835 3300048925 Ga0496122_0030501 Ga0496122_0030501_219_1085 265
836 3300048926 Ga0496123_0031684 Ga0496123_0031684_327_1139 265
837 3300048927 Ga0496124_0049468 Ga0496124_0049468_2518_3330 265
838 3300048927 Ga0496124_0371616 Ga0496124_0371616_168_980 265
839 3300048928 Ga0496125_0004359 Ga0496125_0004359_11770_12636 265
840 3300049460 Ga0495682_0080327 Ga0495682_0080327_31_855 265
841 3300049569 Ga0501032_0146820 Ga0501032_0146820_80_922 265
842 3300049570 Ga0501033_0051370 Ga0501033_0051370_1074_1916 265
843 3300049571 Ga0501034_0161912 Ga0501034_0161912_1301_2140 265
844 3300049572 Ga0501036_0015259 Ga0501036_0015259_2951_3793 265
845 3300049573 Ga0501037_0085812 Ga0501037_0085812_530_1372 265
846 3300049574 Ga0501038_0185118 Ga0501038_0185118_251_1093 265
847 3300049579 Ga0501043_0044713 Ga0501043_0044713_1892_2731 265
848 3300049579 Ga0501043_0129810 Ga0501043_0129810_442_1284 265
849 3300049581 Ga0501047_0059512 Ga0501047_0059512_2117_2959 265
850 3300049581 Ga0501047_0061221 Ga0501047_0061221_1214_2053 265
851 3300049742 Ga0501080_0047331 Ga0501080_0047331_1798_2640 265
852 3300049744 Ga0501083_0040392 Ga0501083_0040392_1362_2204 265
853 3300049744 Ga0501083_0086468 Ga0501083_0086468_735_1574 265
854 3300049823 Ga0501044_0031639 Ga0501044_0031639_811_1653 265
855 3300050489 nmdc:mga03683_51438_c1 nmdc:mga03683_51438_c1_765_1577 265
856 3300050490 nmdc:mga03n38_68598_c1 nmdc:mga03n38_68598_c1_35_850 265
857 3300050490 nmdc:mga03n38_84311_c1 nmdc:mga03n38_84311_c1_363_1175 265
858 3300050492 nmdc:mga0yw44_3224_c1 nmdc:mga0yw44_3224_c1_5311_6123 265
859 3300050493 nmdc:mga0k408_3813_c1 nmdc:mga0k408_3813_c1_6400_7212 265
860 3300050494 nmdc:mga06z11_102447_c1 nmdc:mga06z11_102447_c1_448_1260 265
861 3300050496 nmdc:mga07m45_38680_c1 nmdc:mga07m45_38680_c1_699_1511 265
862 3300050516 nmdc:mga0sz30_25294_c1 nmdc:mga0sz30_25294_c1_529_1341 265
863 3300050516 nmdc:mga0sz30_2699_c1 nmdc:mga0sz30_2699_c1_1511_2323 265
864 3300053083 Ga0495655_0003456 Ga0495655_0003456_894_1733 265
865 3300053086 Ga0500578_0063248 Ga0500578_0063248_1025_1864 265
866 3300053105 Ga0500557_000894 Ga0500557_000894_64_888 265
867 3300053108 Ga0500562_031322 Ga0500562_031322_405_1229 265
868 3300053109 Ga0500569_000971 Ga0500569_000971_2900_3739 265
869 3300053109 Ga0500569_011125 Ga0500569_011125_972_1796 265
870 3300053118 Ga0500594_0001842 Ga0500594_0001842_277_1098 265
871 3300053118 Ga0500594_0010520 Ga0500594_0010520_751_1590 265
872 3300053129 Ga0500628_006682 Ga0500628_006682_708_1547 265
873 3300053134 Ga0500658_0001192 Ga0500658_0001192_1909_2748 265
874 3300053134 Ga0500658_0037330 Ga0500658_0037330_308_1174 265
875 3300053139 Ga0500568_0001664 Ga0500568_0001664_9807_10673 265
876 3300053139 Ga0500568_0002341 Ga0500568_0002341_7983_8807 265
877 3300053142 Ga0500577_0010406 Ga0500577_0010406_662_1486 265
878 3300053151 Ga0500604_0011839 Ga0500604_0011839_625_1491 265
879 3300053153 Ga0500616_0001502 Ga0500616_0001502_12706_13530 265
880 3300053153 Ga0500616_0040719 Ga0500616_0040719_535_1374 265
881 3300053156 Ga0500622_0000593 Ga0500622_0000593_3303_4154 265
882 3300053156 Ga0500622_0138141 Ga0500622_0138141_52_864 265
883 3300053158 Ga0500627_0043016 Ga0500627_0043016_588_1427 265
884 3300053160 Ga0500633_0000975 Ga0500633_0000975_918_1784 265
885 3300053727 Ga0500611_029383 Ga0500611_029383_268_1092 265
886 3300060353 Ga0501082_0149894 Ga0501082_0149894_914_1753 265
887 iso_pu_bacteria 2791355261 2793330156 265
888 iso_pu_bacteria 2838074704 2838075082 265
889 iso_pu_bacteria 2896384573 2896384792 265
890 iso_pu_bacteria 2920760137 2920763660 265
891 iso_pu_bacteria 639633055 639649651 265
892 3300005331 Ga0070670_100000560 Ga0070670_10000056010 266
893 3300025925 Ga0207650_10007237 Ga0207650_100072375 266
894 3300046507 Ga0495606_0001142 Ga0495606_0001142_1719_2531 266
895 3300047472 Ga0495686_0000422 Ga0495686_0000422_39157_39969 266
896 3300047472 Ga0495686_0027768 Ga0495686_0027768_813_1625 266
897 3300047472 Ga0495686_0143729 Ga0495686_0143729_214_1023 266
898 iso_pu_bacteria 2510917022 2511137331 266
899 iso_pu_bacteria 2524023209 2524459103 266
900 iso_pu_bacteria 2582581307 2585274070 266
901 iso_pu_bacteria 2582581308 2585279528 266
902 iso_pu_bacteria 2582581315 2585322812 266
903 iso_pu_bacteria 2582581316 2585330982 266
904 iso_pu_bacteria 2585427527 2585530988 266
905 iso_pu_bacteria 2585427530 2585553091 266
906 iso_pu_bacteria 2585427531 2585560520 266
907 iso_pu_bacteria 2585427608 2585898713 266
908 iso_pu_bacteria 2585427609 2585903698 266
909 iso_pu_bacteria 2585428125 2587981183 266
910 iso_pu_bacteria 2615840626 2616307102 266
911 iso_pu_bacteria 2615840698 2616554706 266
912 iso_pu_bacteria 2617270742 2617383058 266
913 iso_pu_bacteria 2667528174 2671111942 266
914 iso_pu_bacteria 2775507266 2778175777 266
915 iso_pu_bacteria 2818991448 2819609834 266
916 iso_pu_bacteria 2818991453 2819639939 266
917 iso_pu_bacteria 2838029111 2838034058 266
918 iso_pu_bacteria 2842298080 2842298456 266
919 iso_pu_bacteria 2842357229 2842360468 266
920 iso_pu_bacteria 2842475841 2842480774 266
921 iso_pu_bacteria 2842482326 2842483623 266
922 iso_pu_bacteria 2842502639 2842507415 266
923 iso_pu_bacteria 2842509118 2842510485 266
924 iso_pu_bacteria 2852387548 2852390909 266
925 iso_pu_bacteria 2919408235 2919410445 266
926 iso_pu_bacteria 8005484373 8005488730 266
927 iso_pu_bacteria 8005645114 8005645888 266
928 iso_pu_bacteria 8005682033 8005682433 266
929 iso_pu_bacteria 8046767195 8046772544 266
930 iso_pu_bacteria 8057575449 8057576998 266
931 3300031456 Ga0307513_10129858 Ga0307513_101298582 267
932 3300046459 Ga0495629_0019024 Ga0495629_0019024_4032_4859 267
933 3300046462 Ga0495651_0066767 Ga0495651_0066767_1454_2281 267
934 3300046476 Ga0495662_0017093 Ga0495662_0017093_2569_3396 267
935 3300046477 Ga0495664_0058057 Ga0495664_0058057_755_1582 267
936 3300046511 Ga0495608_0116000 Ga0495608_0116000_159_986 267
937 3300046529 Ga0495652_0140687 Ga0495652_0140687_118_945 267
938 3300046663 Ga0495635_0048244 Ga0495635_0048244_1368_2195 267
939 3300046674 Ga0495588_0019961 Ga0495588_0019961_295_1122 267
940 3300046675 Ga0495657_0051262 Ga0495657_0051262_274_1101 267
941 3300046689 Ga0495613_0131417 Ga0495613_0131417_38_865 267
942 3300046690 Ga0495624_0228488 Ga0495624_0228488_138_965 267
943 3300046809 Ga0495600_0034660 Ga0495600_0034660_897_1724 267
944 3300047317 Ga0495604_0003714 Ga0495604_0003714_9076_9903 267
945 3300048088 Ga0495602_0359792 Ga0495602_0359792_11_838 267
946 3300048903 Ga0496100_0358463 Ga0496100_0358463_165_977 267
947 3300053148 Ga0500590_005672 Ga0500590_005672_1012_1839 267
948 3300001979 JGI24740J21852_10000564 JGI24740J21852_100005644 270
949 3300002704 JGI25155J39150_1000065 JGI25155J39150_100006559 270
950 3300002705 JGI25156J39149_1000144 JGI25156J39149_100014447 270
951 3300002738 JGI25154J39366_1000035 JGI25154J39366_1000035153 270
952 3300002741 JGI25157J39369_1001004 JGI25157J39369_10010046 270
953 3300003316 rootH1_10074966 rootH1_100749662 270
954 3300003320 rootH2_10008438 rootH2_100084383 270
955 3300003322 rootL2_10016820 rootL2_100168203 270
956 3300003323 rootH1_10063714 rootH1_100637141 270
957 3300006353 Ga0075370_10027128 Ga0075370_100271283 270
958 3300013100 Ga0157373_10081630 Ga0157373_100816303 270
959 3300025206 Ga0209435_100005 Ga0209435_100005389 270
960 3300025228 Ga0209672_103287 Ga0209672_1032872 270
961 3300025233 Ga0209437_100058 Ga0209437_100058189 270
962 3300025233 Ga0209437_100060 Ga0209437_10006074 270
963 3300025246 Ga0209646_1000011 Ga0209646_1000011389 270
964 3300025250 Ga0209026_1000008 Ga0209026_1000008389 270
965 3300025254 Ga0209148_1004917 Ga0209148_10049174 270
966 3300025256 Ga0209759_1000004 Ga0209759_1000004389 270
967 3300025272 Ga0209455_1012080 Ga0209455_10120802 270
968 3300030500 Ga0268256_1002822 Ga0268256_10028228 270
969 iso_pu_bacteria 3005416602 3005418722 270
970 iso_pu_bacteria 8005314921 8005318386 270

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07859

Abhydrolase_3

alpha/beta hydrolase fold

78

275

0.91

PF20434

BD-FAE

BD-FAE

64

186

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3aim-assembly1.cif.gz_A r267e mutant of a hsl-like carboxylesterase from sulfolobus tokodaii 0.8674 4 268
3aik-assembly1.cif.gz_A crystal structure of a hsl-like carboxylesterase from sulfolobus tokodaii 0.8458 4 268
4ob7-assembly1.cif.gz_A-2 crystal structure of esterase rppe mutant w187h 0.8444 2 270
4ob8-assembly1.cif.gz_A-2 crystal structure of a novel thermostable esterase from pseudomonas putida ecu1011 0.8444 2 270
4ou5-assembly1.cif.gz_A crystal structure of esterase rppe mutant s159a/w187h 0.8433 2 270
ID Description Score Start End Superfamily
3aikA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8458 4 268 3.40.50.1820
4ob8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8444 2 270 3.40.50.1820
4ob8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8386 2 270 3.40.50.1820
5jd4D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8371 1 266 3.40.50.1820
3wj2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8332 1 268 3.40.50.1820
ID Description Score Start End GO Terms
AF-F7U5Z8-F1-model_v4 deleted 0.9518 35 270
AF-F7U5Z8-F1-model_v4 deleted 0.9438 35 270
AF-A0A4Q3YDS7-F1-model_v4 Alpha/beta hydrolase 0.9334 180 269 GO:0016787
AF-A0A7G6RUS5-F1-model_v4 deleted 0.9311 51 270
AF-A0A1M3ANF6-F1-model_v4 deleted 0.9262 1 269

Feature Viewer

pLDDT pTM Quality
89.72 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map