F487110
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 970 | 731 | 486 | 270 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|639633055|639649651 |
| Length | 313 |
| Sequence | SRSGTVLSRYSFLFLGWNNNIFFVQNASGRRCLLAADAKETGSMTVEWKDMMLDKVAIGPVSARIYQGADYGKGPPIVLYLHGGAFLDSDKNVDRPVAMSLAKAGAIVVAADYSSLSGNLFPQALEVSFSVFTYLANKRAGLGDRKSLLFVAGEEAGGNVAAGVALKARDQMPDALDGQVLISPLLDPFMGTSSIRKAEAIGMRQRWTEGWSHYLSGGGCHPYAAPCLCSRISGVAPALIFTAEDDPLHDETIGYGARLKQAGVGVRQHVLPAGTGWPSIYGGKSDGAPDWQENVSRHFGSFLRDVSVQPQLH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 2 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 3 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 4 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 5 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 6 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 7 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 8 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 9 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 10 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 11 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 12 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 13 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 14 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 15 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 16 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 17 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 18 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 19 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 20 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 21 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 22 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 23 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 24 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 25 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 26 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 27 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 28 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 29 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 30 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 31 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 32 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 33 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 34 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 35 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 36 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 37 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 38 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 39 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 40 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 41 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 42 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 43 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 44 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 45 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 46 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 47 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 48 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 49 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 50 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 51 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 52 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 53 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 54 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 55 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 56 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 57 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 58 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 59 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 60 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 61 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 62 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 63 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 64 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 65 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 66 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 67 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 68 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 69 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 70 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 71 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 72 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 73 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 74 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 75 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 76 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 77 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 78 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 79 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 80 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 81 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 82 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 83 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 84 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 85 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 86 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 87 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 88 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 89 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 90 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 91 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 92 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 93 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 94 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 95 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 96 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 97 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 98 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 99 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 100 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 101 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 102 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 103 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 104 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 105 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 106 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 107 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 108 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 109 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 110 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 111 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 112 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 113 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 114 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 115 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 116 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 117 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 118 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 119 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 120 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 121 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 122 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 123 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 124 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 125 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 126 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 127 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 128 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 129 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 130 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 131 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 132 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 133 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 134 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 135 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 136 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 137 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 138 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 139 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 140 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 141 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 142 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 143 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 144 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 145 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 146 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 147 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 148 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 149 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 150 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 151 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 152 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 153 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 154 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 155 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 156 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 157 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 158 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 159 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 160 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 161 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 162 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 163 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 164 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 165 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 166 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 167 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 168 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 169 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 170 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 171 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 172 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 173 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 174 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 175 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 176 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 177 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 178 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 179 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 180 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 181 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 182 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 183 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 184 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 185 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 186 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 187 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 188 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 189 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 190 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 191 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 192 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 193 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 194 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 195 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 196 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 197 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 198 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 199 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 200 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 201 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 202 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 203 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 204 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 205 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 206 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 207 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 208 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 209 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 210 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 211 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 212 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 213 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 214 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 215 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 216 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 217 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 218 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 219 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 220 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 221 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 222 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 223 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 224 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 225 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 226 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 227 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 228 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 229 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 230 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 231 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 232 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 233 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 234 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 235 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 236 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 237 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 238 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 239 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 240 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 241 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 242 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 243 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 244 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 245 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 246 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 247 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 248 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 249 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 250 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 251 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 252 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 253 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 254 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 255 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 256 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 257 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 258 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 259 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 260 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 261 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 262 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 263 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 264 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 265 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 266 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 267 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 268 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 269 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 270 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 271 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 272 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 273 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 274 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 275 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 276 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 277 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 278 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 279 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 280 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 281 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 282 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 283 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 284 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 285 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 286 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 287 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 288 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 289 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 290 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 291 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 292 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 293 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 294 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 295 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 296 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 297 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 298 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 299 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 300 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 301 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 302 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 303 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 304 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 305 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 306 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 307 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 308 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 309 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 310 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 311 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 312 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 313 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 314 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 315 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 316 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 317 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 318 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 319 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 320 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 321 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 322 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 323 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 324 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 325 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 326 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 327 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 328 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 329 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 330 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 331 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 332 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 333 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 334 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 335 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 336 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 337 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 338 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 339 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 340 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 341 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 342 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 343 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 344 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 345 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 346 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 347 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 348 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 349 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 350 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 351 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 352 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 353 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 354 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 355 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 356 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 357 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 358 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 359 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 360 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 361 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 362 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 363 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 364 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 365 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 366 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 367 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 368 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 369 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 370 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 371 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 372 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 373 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 374 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 375 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 376 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 377 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 378 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 379 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 380 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 381 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 382 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 383 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 384 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 385 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 386 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 387 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 388 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 389 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 390 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 391 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 392 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 393 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 394 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 395 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 396 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 397 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 398 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 399 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 400 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 401 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 402 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 403 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 404 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 405 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 406 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 407 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 408 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 409 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 410 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 411 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 412 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 413 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 414 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 415 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 416 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 417 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 418 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 419 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 420 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 421 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 422 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 423 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 424 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 425 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 426 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 427 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 428 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 429 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 430 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 431 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 432 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 433 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 434 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 435 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 436 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 437 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 438 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 439 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 440 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 441 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 442 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 443 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 444 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 445 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 446 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 447 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 448 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 449 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 450 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 451 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 452 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 453 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 454 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 455 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 456 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 457 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 458 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 459 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 460 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 461 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 462 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 463 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 464 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 465 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 466 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 467 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 468 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 469 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 470 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 471 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 472 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 473 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 474 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 475 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 476 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 477 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 478 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 479 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 480 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 481 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 482 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 483 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 484 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 485 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 486 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 487 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 488 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 489 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 490 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 491 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 492 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 493 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 494 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 495 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 496 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 497 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 498 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 499 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 500 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 501 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 502 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 503 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 504 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 505 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 506 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 507 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 508 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 509 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 510 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 511 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 512 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 513 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 514 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 515 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 516 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 517 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 518 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 519 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 520 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 521 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 522 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 523 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 524 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 525 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 526 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 527 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 528 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 529 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 530 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 531 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 532 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 533 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 534 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 535 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 536 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 537 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 538 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 539 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 540 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 541 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 542 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 543 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 544 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 545 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 546 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 547 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 548 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 549 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 550 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 551 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 552 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 553 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 554 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 555 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 556 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 557 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 558 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 559 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 560 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 561 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 562 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 563 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 564 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 565 | 3300041497 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT | Metatranscriptome | Unclassified |
| 566 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 567 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 568 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 569 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 570 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 571 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 572 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 573 | 3300041907 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run | Metatranscriptome | Unclassified |
| 574 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 575 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 576 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 577 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 607 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 620 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 626 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 627 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 628 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 629 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 630 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 631 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 632 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 633 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 634 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 635 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 636 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 637 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 638 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 639 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 640 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 641 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 642 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 643 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 644 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 645 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 646 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 647 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 648 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 649 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 650 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 651 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 652 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 653 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 654 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 655 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 656 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 657 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 658 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 659 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 660 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 661 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 662 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 663 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 664 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 665 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 666 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 667 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 668 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 669 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 670 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 671 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 672 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 673 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 674 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 675 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 676 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 677 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 678 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 679 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 680 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 681 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 682 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 683 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 684 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 685 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 686 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 687 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 688 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 689 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 690 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 691 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 692 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 693 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 694 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 695 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 696 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 697 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 698 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 699 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 700 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 701 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 702 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 703 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 704 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 705 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 706 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 707 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 708 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 709 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 710 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 711 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 712 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 713 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 714 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 715 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 716 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 717 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 718 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 719 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 720 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 721 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 722 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 723 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 724 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 725 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 726 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 727 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 728 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 729 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 730 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 731 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 49.69 |
| Metatranscriptomes | 0.41 |
| Isolates | 49.9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.41 |
| Bulb | 0 |
| Endosphere | 22.89 |
| Nodule | 42.78 |
| Rhizoplane | 1.03 |
| Rhizosphere | 18.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000564 | 3300001979 | Bacteria | 15949 |
| 2 | JGI25155J39150_1000065 | 3300002704 | Bacteria | 69464 |
| 3 | JGI25155J39150_1000098 | 3300002704 | Bacteria | 48725 |
| 4 | JGI25156J39149_1000144 | 3300002705 | Bacteria | 52681 |
| 5 | JGI25156J39149_1000163 | 3300002705 | Bacteria | 48762 |
| 6 | JGI25154J39366_1000035 | 3300002738 | Bacteria | 172224 |
| 7 | JGI25154J39366_1000183 | 3300002738 | Bacteria | 48762 |
| 8 | JGI25158J39367_1000927 | 3300002739 | Bacteria | 5464 |
| 9 | JGI25157J39369_1000209 | 3300002741 | Bacteria | 48762 |
| 10 | JGI25157J39369_1001004 | 3300002741 | Bacteria | 13118 |
| 11 | JGI25152J39213_1003227 | 3300002773 | Bacteria | 5673 |
| 12 | JGI25152J39213_1010470 | 3300002773 | Bacteria | 2117 |
| 13 | JGI25159J45721_1001556 | 3300002987 | Bacteria | 9403 |
| 14 | JGI25159J45721_1004685 | 3300002987 | Bacteria | 4465 |
| 15 | JGI25151J46595_10002096 | 3300003187 | Bacteria | 12432 |
| 16 | JGI25151J46595_10005186 | 3300003187 | Bacteria | 6758 |
| 17 | JGI25151J46595_10007415 | 3300003187 | Bacteria | 5378 |
| 18 | JGI25151J46595_10009835 | 3300003187 | Bacteria | 4495 |
| 19 | JGI25151J46595_10026849 | 3300003187 | Bacteria | 2316 |
| 20 | JGI25153J46596_10006886 | 3300003215 | Bacteria | 5676 |
| 21 | JGI25153J46596_10007510 | 3300003215 | Bacteria | 5343 |
| 22 | JGI25153J46596_10011704 | 3300003215 | Bacteria | 3854 |
| 23 | rootH1_10057687 | 3300003316 | Bacteria | 1444 |
| 24 | rootH1_10074966 | 3300003316 | Bacteria | 1695 |
| 25 | rootH2_10008438 | 3300003320 | Bacteria | 4030 |
| 26 | rootH2_10008440 | 3300003320 | Bacteria | 1808 |
| 27 | rootH2_10045333 | 3300003320 | Bacteria | 1620 |
| 28 | rootL2_10016820 | 3300003322 | Bacteria | 9950 |
| 29 | rootL2_10320304 | 3300003322 | Bacteria | 1491 |
| 30 | rootH1_10063714 | 3300003323 | Bacteria | 2561 |
| 31 | rootH1_10117136 | 3300003323 | Bacteria | 1559 |
| 32 | rootH1_10170367 | 3300003323 | Bacteria | 3776 |
| 33 | JGI25160J50197_1000001 | 3300003354 | Bacteria | 782301 |
| 34 | JGI25160J50197_1000212 | 3300003354 | Bacteria | 47984 |
| 35 | JGI25160J50197_1000917 | 3300003354 | Bacteria | 15487 |
| 36 | JGI25160J50197_1009247 | 3300003354 | Bacteria | 3674 |
| 37 | JGI25161J50226_1000047 | 3300003374 | Bacteria | 113472 |
| 38 | JGI25161J50226_1000151 | 3300003374 | Bacteria | 47984 |
| 39 | JGI25161J50226_1000238 | 3300003374 | Bacteria | 33305 |
| 40 | JGI25161J50226_1000331 | 3300003374 | Bacteria | 25691 |
| 41 | JGI25161J50226_1001587 | 3300003374 | Bacteria | 6643 |
| 42 | Ga0055526_1002806 | 3300003771 | Bacteria | 11539 |
| 43 | Ga0055526_1004625 | 3300003771 | Bacteria | 8198 |
| 44 | Ga0055526_1012519 | 3300003771 | Bacteria | 3691 |
| 45 | Ga0055526_1017186 | 3300003771 | Bacteria | 2780 |
| 46 | Ga0055537_1000709 | 3300003773 | Bacteria | 17283 |
| 47 | Ga0055524_1000082 | 3300003775 | Bacteria | 119749 |
| 48 | Ga0055524_1001237 | 3300003775 | Bacteria | 15052 |
| 49 | Ga0055524_1004997 | 3300003775 | Bacteria | 6005 |
| 50 | Ga0055524_1006292 | 3300003775 | Bacteria | 5166 |
| 51 | Ga0055524_1021578 | 3300003775 | Bacteria | 2130 |
| 52 | Ga0055536_1001960 | 3300003781 | Bacteria | 11848 |
| 53 | Ga0055534_1003222 | 3300003784 | Bacteria | 5238 |
| 54 | Ga0055534_1005336 | 3300003784 | Bacteria | 3465 |
| 55 | Ga0055534_1013334 | 3300003784 | Bacteria | 1583 |
| 56 | Ga0055528_1000525 | 3300003790 | Bacteria | 29704 |
| 57 | Ga0055528_1001182 | 3300003790 | Bacteria | 16852 |
| 58 | Ga0055528_1002394 | 3300003790 | Bacteria | 10090 |
| 59 | Ga0055528_1003139 | 3300003790 | Bacteria | 8476 |
| 60 | Ga0055528_1009964 | 3300003790 | Bacteria | 3915 |
| 61 | Ga0055528_1019332 | 3300003790 | Bacteria | 2263 |
| 62 | Ga0055528_1019744 | 3300003790 | Bacteria | 2216 |
| 63 | Ga0055530_10000688 | 3300003791 | Bacteria | 28617 |
| 64 | Ga0055530_10046368 | 3300003791 | Bacteria | 1032 |
| 65 | Ga0055540_1000010 | 3300003792 | Bacteria | 290865 |
| 66 | Ga0055540_1001376 | 3300003792 | Bacteria | 14517 |
| 67 | Ga0055540_1003377 | 3300003792 | Bacteria | 7740 |
| 68 | Ga0055531_10019143 | 3300003794 | Bacteria | 2786 |
| 69 | Ga0058692_1001275 | 3300003856 | Bacteria | 9566 |
| 70 | Ga0055543_1000007 | 3300004625 | Bacteria | 204042 |
| 71 | Ga0055543_1000419 | 3300004625 | Bacteria | 26802 |
| 72 | Ga0055543_1000526 | 3300004625 | Bacteria | 21681 |
| 73 | Ga0055543_1000646 | 3300004625 | Bacteria | 18584 |
| 74 | Ga0065165_1000357 | 3300005262 | Bacteria | 75030 |
| 75 | Ga0065165_1015536 | 3300005262 | Bacteria | 2896 |
| 76 | Ga0065165_1032167 | 3300005262 | Bacteria | 1647 |
| 77 | Ga0065165_1042739 | 3300005262 | Bacteria | 1335 |
| 78 | Ga0070670_100000560 | 3300005331 | Bacteria | 29495 |
| 79 | Ga0070669_100286700 | 3300005353 | Bacteria | 1321 |
| 80 | Ga0070664_100468505 | 3300005564 | Bacteria | 1158 |
| 81 | Ga0068854_100017336 | 3300005578 | Bacteria | 4819 |
| 82 | Ga0068856_100185206 | 3300005614 | Bacteria | 2096 |
| 83 | Ga0068852_100127814 | 3300005616 | Bacteria | 2336 |
| 84 | Ga0075365_10004644 | 3300006038 | Bacteria | 7313 |
| 85 | Ga0075365_10006669 | 3300006038 | Bacteria | 6378 |
| 86 | Ga0075368_10027051 | 3300006042 | Bacteria | 2210 |
| 87 | Ga0075363_100026618 | 3300006048 | Bacteria | 2960 |
| 88 | Ga0075364_10007185 | 3300006051 | Bacteria | 6593 |
| 89 | Ga0075364_10012908 | 3300006051 | Bacteria | 5127 |
| 90 | Ga0075362_10000300 | 3300006177 | Bacteria | 14031 |
| 91 | Ga0075362_10001572 | 3300006177 | Bacteria | 7379 |
| 92 | Ga0075362_10092379 | 3300006177 | Bacteria | 1406 |
| 93 | Ga0075367_10004384 | 3300006178 | Bacteria | 6885 |
| 94 | Ga0075367_10005561 | 3300006178 | Bacteria | 6278 |
| 95 | Ga0075367_10021211 | 3300006178 | Bacteria | 3628 |
| 96 | Ga0075369_10001899 | 3300006186 | Bacteria | 7324 |
| 97 | Ga0075369_10001967 | 3300006186 | Bacteria | 7222 |
| 98 | Ga0075369_10027942 | 3300006186 | Bacteria | 2361 |
| 99 | Ga0075369_10031219 | 3300006186 | Bacteria | 2247 |
| 100 | Ga0075369_10055396 | 3300006186 | Bacteria | 1723 |
| 101 | Ga0075366_10009357 | 3300006195 | Bacteria | 5468 |
| 102 | Ga0075366_10022758 | 3300006195 | Bacteria | 3648 |
| 103 | Ga0075366_10048190 | 3300006195 | Bacteria | 2526 |
| 104 | Ga0075370_10020155 | 3300006353 | Bacteria | 3641 |
| 105 | Ga0075370_10027128 | 3300006353 | Bacteria | 3177 |
| 106 | Ga0075370_10045619 | 3300006353 | Bacteria | 2479 |
| 107 | Ga0075370_10062684 | 3300006353 | Bacteria | 2119 |
| 108 | Ga0075370_10078416 | 3300006353 | Bacteria | 1897 |
| 109 | Ga0079104_1004704 | 3300006946 | Bacteria | 5718 |
| 110 | Ga0079104_1005831 | 3300006946 | Bacteria | 4814 |
| 111 | Ga0099826_10002615 | 3300006948 | Bacteria | 11731 |
| 112 | Ga0105240_10000014 | 3300009093 | Bacteria | 482033 |
| 113 | Ga0105243_10131709 | 3300009148 | Bacteria | 2122 |
| 114 | Ga0105237_10000770 | 3300009545 | Bacteria | 43805 |
| 115 | Ga0105238_10659264 | 3300009551 | Bacteria | 1057 |
| 116 | Ga0123341_1000011 | 3300009765 | Bacteria | 108023 |
| 117 | Ga0123342_1008752 | 3300009766 | Bacteria | 12535 |
| 118 | Ga0123342_1018063 | 3300009766 | Bacteria | 5714 |
| 119 | Ga0105239_10004243 | 3300010375 | Bacteria | 17211 |
| 120 | Ga0105239_10316635 | 3300010375 | Bacteria | 1759 |
| 121 | Ga0105246_10050655 | 3300011119 | Bacteria | 2849 |
| 122 | Ga0157373_10049545 | 3300013100 | Bacteria | 2993 |
| 123 | Ga0157373_10081630 | 3300013100 | Bacteria | 2279 |
| 124 | Ga0157373_10106668 | 3300013100 | Bacteria | 1969 |
| 125 | Ga0157371_10000966 | 3300013102 | Bacteria | 31904 |
| 126 | Ga0157371_10002118 | 3300013102 | Bacteria | 19329 |
| 127 | Ga0157370_10000015 | 3300013104 | Bacteria | 185771 |
| 128 | Ga0157370_10000338 | 3300013104 | Bacteria | 59035 |
| 129 | Ga0157369_10020309 | 3300013105 | Bacteria | 7424 |
| 130 | Ga0157372_10239097 | 3300013307 | Unclassified | 2107 |
| 131 | Ga0182008_10033845 | 3300014497 | Bacteria | 2563 |
| 132 | Ga0182007_10002096 | 3300015262 | Bacteria | 10220 |
| 133 | Ga0182005_1010891 | 3300015265 | Bacteria | 2606 |
| 134 | Ga0206355_1174415 | 3300020076 | Bacteria | 1071 |
| 135 | Ga0214544_1000105 | 3300021320 | Bacteria | 114109 |
| 136 | Ga0214542_1000029 | 3300021321 | Bacteria | 174097 |
| 137 | Ga0214543_1000027 | 3300021327 | Bacteria | 215065 |
| 138 | Ga0214543_1000040 | 3300021327 | Bacteria | 174142 |
| 139 | Ga0228711_1000013 | 3300022739 | Bacteria | 132585 |
| 140 | Ga0228710_1000008 | 3300022740 | Bacteria | 174306 |
| 141 | Ga0209435_100005 | 3300025206 | Bacteria | 573745 |
| 142 | Ga0209435_100010 | 3300025206 | Bacteria | 475373 |
| 143 | Ga0209436_100110 | 3300025208 | Bacteria | 41189 |
| 144 | Ga0209436_107364 | 3300025208 | Bacteria | 2305 |
| 145 | Ga0209672_103287 | 3300025228 | Bacteria | 3414 |
| 146 | Ga0209437_100058 | 3300025233 | Bacteria | 357279 |
| 147 | Ga0209437_100060 | 3300025233 | Bacteria | 355034 |
| 148 | Ga0207425_1001956 | 3300025245 | Bacteria | 7737 |
| 149 | Ga0207425_1001995 | 3300025245 | Bacteria | 7624 |
| 150 | Ga0207425_1013334 | 3300025245 | Bacteria | 1902 |
| 151 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 152 | Ga0209646_1000011 | 3300025246 | Bacteria | 573745 |
| 153 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 154 | Ga0209026_1000008 | 3300025250 | Bacteria | 573745 |
| 155 | Ga0209677_100781 | 3300025253 | Bacteria | 16045 |
| 156 | Ga0209148_1004917 | 3300025254 | Bacteria | 3157 |
| 157 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 158 | Ga0209759_1000004 | 3300025256 | Bacteria | 573745 |
| 159 | Ga0209129_1000226 | 3300025258 | Bacteria | 63537 |
| 160 | Ga0209129_1001492 | 3300025258 | Bacteria | 13007 |
| 161 | Ga0209129_1002108 | 3300025258 | Bacteria | 10140 |
| 162 | Ga0209129_1005143 | 3300025258 | Bacteria | 4773 |
| 163 | Ga0209129_1005786 | 3300025258 | Bacteria | 4230 |
| 164 | Ga0209129_1010068 | 3300025258 | Bacteria | 2405 |
| 165 | Ga0209129_1013977 | 3300025258 | Bacteria | 1733 |
| 166 | Ga0209233_1000137 | 3300025261 | Bacteria | 200314 |
| 167 | Ga0209565_1000036 | 3300025263 | Bacteria | 293334 |
| 168 | Ga0209565_1000226 | 3300025263 | Bacteria | 63161 |
| 169 | Ga0209455_1012080 | 3300025272 | Bacteria | 2087 |
| 170 | Ga0209673_1000239 | 3300025273 | Bacteria | 105502 |
| 171 | Ga0209673_1000282 | 3300025273 | Bacteria | 95013 |
| 172 | Ga0209673_1000478 | 3300025273 | Bacteria | 66832 |
| 173 | Ga0209673_1001495 | 3300025273 | Bacteria | 21722 |
| 174 | Ga0209673_1001737 | 3300025273 | Bacteria | 18320 |
| 175 | Ga0209673_1002506 | 3300025273 | Bacteria | 12623 |
| 176 | Ga0209673_1018821 | 3300025273 | Bacteria | 2497 |
| 177 | Ga0209130_1000023 | 3300025284 | Bacteria | 359355 |
| 178 | Ga0209130_1000042 | 3300025284 | Bacteria | 257581 |
| 179 | Ga0209130_1000145 | 3300025284 | Bacteria | 113201 |
| 180 | Ga0209130_1008226 | 3300025284 | Bacteria | 3102 |
| 181 | Ga0209130_1014063 | 3300025284 | Bacteria | 2024 |
| 182 | Ga0209130_1017324 | 3300025284 | Bacteria | 1719 |
| 183 | Ga0209675_1000289 | 3300025291 | Bacteria | 47643 |
| 184 | Ga0209675_1003625 | 3300025291 | Bacteria | 7246 |
| 185 | Ga0209676_1000007 | 3300025292 | Bacteria | 1029371 |
| 186 | Ga0209676_1018097 | 3300025292 | Bacteria | 2467 |
| 187 | Ga0209025_1000288 | 3300025294 | Bacteria | 113626 |
| 188 | Ga0209025_1000411 | 3300025294 | Bacteria | 86058 |
| 189 | Ga0209025_1002347 | 3300025294 | Bacteria | 20391 |
| 190 | Ga0209025_1006388 | 3300025294 | Bacteria | 9173 |
| 191 | Ga0209025_1013965 | 3300025294 | Bacteria | 4996 |
| 192 | Ga0209025_1037708 | 3300025294 | Bacteria | 2139 |
| 193 | Ga0209025_1051255 | 3300025294 | Bacteria | 1642 |
| 194 | Ga0209025_1081354 | 3300025294 | Bacteria | 1098 |
| 195 | Ga0209564_1000259 | 3300025295 | Bacteria | 112570 |
| 196 | Ga0209564_1000393 | 3300025295 | Bacteria | 78338 |
| 197 | Ga0209564_1001326 | 3300025295 | Bacteria | 26471 |
| 198 | Ga0209564_1007458 | 3300025295 | Bacteria | 5644 |
| 199 | Ga0209564_1024341 | 3300025295 | Bacteria | 2072 |
| 200 | Ga0209564_1025207 | 3300025295 | Bacteria | 2009 |
| 201 | Ga0209564_1026301 | 3300025295 | Bacteria | 1927 |
| 202 | Ga0209758_1000390 | 3300025297 | Bacteria | 75869 |
| 203 | Ga0209758_1001594 | 3300025297 | Bacteria | 25947 |
| 204 | Ga0209758_1004703 | 3300025297 | Bacteria | 11144 |
| 205 | Ga0209758_1008994 | 3300025297 | Bacteria | 6315 |
| 206 | Ga0209758_1078594 | 3300025297 | Bacteria | 1007 |
| 207 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 208 | Ga0209050_1004120 | 3300025298 | Bacteria | 10120 |
| 209 | Ga0209050_1007028 | 3300025298 | Bacteria | 6467 |
| 210 | Ga0209050_1013661 | 3300025298 | Bacteria | 3582 |
| 211 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 212 | Ga0209256_1000155 | 3300025299 | Bacteria | 144379 |
| 213 | Ga0209256_1000619 | 3300025299 | Bacteria | 49078 |
| 214 | Ga0209256_1001902 | 3300025299 | Bacteria | 19096 |
| 215 | Ga0209256_1004144 | 3300025299 | Bacteria | 9364 |
| 216 | Ga0209256_1007631 | 3300025299 | Bacteria | 5271 |
| 217 | Ga0207426_1000011 | 3300025302 | Bacteria | 791203 |
| 218 | Ga0207426_1000087 | 3300025302 | Bacteria | 288870 |
| 219 | Ga0207426_1000097 | 3300025302 | Bacteria | 265930 |
| 220 | Ga0207426_1000386 | 3300025302 | Bacteria | 75890 |
| 221 | Ga0207426_1001878 | 3300025302 | Bacteria | 15369 |
| 222 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 223 | Ga0209051_1000321 | 3300025303 | Bacteria | 72390 |
| 224 | Ga0209051_1003739 | 3300025303 | Bacteria | 9784 |
| 225 | Ga0209051_1004393 | 3300025303 | Bacteria | 8718 |
| 226 | Ga0209051_1018086 | 3300025303 | Bacteria | 3130 |
| 227 | Ga0209257_1000020 | 3300025304 | Bacteria | 773356 |
| 228 | Ga0209257_1005878 | 3300025304 | Bacteria | 8282 |
| 229 | Ga0209257_1010077 | 3300025304 | Bacteria | 4886 |
| 230 | Ga0207695_10000037 | 3300025913 | Bacteria | 476303 |
| 231 | Ga0207671_10000080 | 3300025914 | Bacteria | 148567 |
| 232 | Ga0207681_10101055 | 3300025923 | Bacteria | 2080 |
| 233 | Ga0207650_10007237 | 3300025925 | Bacteria | 7559 |
| 234 | Ga0207709_10086633 | 3300025935 | Bacteria | 2034 |
| 235 | Ga0207640_10018330 | 3300025981 | Bacteria | 4113 |
| 236 | Ga0207702_10041321 | 3300026078 | Bacteria | 3867 |
| 237 | Ga0209281_1000134 | 3300027111 | Bacteria | 185406 |
| 238 | Ga0209281_1000783 | 3300027111 | Bacteria | 30223 |
| 239 | Ga0209371_1000022 | 3300027312 | Bacteria | 536342 |
| 240 | Ga0209371_1000370 | 3300027312 | Bacteria | 48496 |
| 241 | Ga0209371_1001191 | 3300027312 | Bacteria | 18849 |
| 242 | Ga0209282_1000029 | 3300027666 | Bacteria | 157883 |
| 243 | Ga0209282_1001507 | 3300027666 | Bacteria | 12863 |
| 244 | Ga0209813_10003505 | 3300027866 | Bacteria | 3679 |
| 245 | Ga0268266_10112087 | 3300028379 | Bacteria | 2418 |
| 246 | Ga0307515_10007465 | 3300028794 | Bacteria | 21615 |
| 247 | Ga0307515_10209541 | 3300028794 | Bacteria | 1797 |
| 248 | Ga0268256_1000019 | 3300030500 | Bacteria | 587949 |
| 249 | Ga0268256_1002822 | 3300030500 | Bacteria | 8390 |
| 250 | Ga0268256_1005648 | 3300030500 | Bacteria | 4853 |
| 251 | Ga0316181_1086484 | 3300030744 | Bacteria | 2161 |
| 252 | Ga0307513_10000011 | 3300031456 | Bacteria | 354929 |
| 253 | Ga0307513_10015921 | 3300031456 | Bacteria | 9094 |
| 254 | Ga0307513_10129858 | 3300031456 | Bacteria | 2468 |
| 255 | Ga0307408_100004501 | 3300031548 | Bacteria | 9450 |
| 256 | Ga0307408_100068413 | 3300031548 | Bacteria | 2615 |
| 257 | Ga0307408_100344065 | 3300031548 | Bacteria | 1263 |
| 258 | Ga0307405_10157461 | 3300031731 | Bacteria | 1605 |
| 259 | Ga0307406_10027924 | 3300031901 | Bacteria | 3405 |
| 260 | Ga0307412_10025014 | 3300031911 | Bacteria | 3693 |
| 261 | Ga0307412_10218606 | 3300031911 | Bacteria | 1459 |
| 262 | Ga0307412_10436561 | 3300031911 | Bacteria | 1075 |
| 263 | Ga0315914_1000021 | 3300031967 | Bacteria | 119592 |
| 264 | Ga0307409_100331407 | 3300031995 | Bacteria | 1428 |
| 265 | Ga0307409_100381438 | 3300031995 | Bacteria | 1340 |
| 266 | Ga0307414_10073553 | 3300032004 | Bacteria | 2473 |
| 267 | Ga0315913_1000014 | 3300033430 | Bacteria | 120114 |
| 268 | Ga0315915_1000003 | 3300033464 | Bacteria | 407996 |
| 269 | Ga0395905_0012601 | 3300037471 | Bacteria | 8134 |
| 270 | Ga0439465_0007062 | 3300041413 | Bacteria | 3568 |
| 271 | Ga0439465_0018167 | 3300041413 | Bacteria | 2197 |
| 272 | Ga0451787_279068 | 3300041441 | Bacteria | 3997 |
| 273 | Ga0451798_0814015 | 3300041458 | Bacteria | 2521 |
| 274 | Ga0451833_0644275 | 3300041491 | Bacteria | 4161 |
| 275 | Ga0451840_11731 | 3300041497 | Bacteria | 1565 |
| 276 | Ga0451841_0397021 | 3300041498 | Bacteria | 1357 |
| 277 | Ga0451841_1005621 | 3300041498 | Bacteria | 923 |
| 278 | Ga0451845_0927883 | 3300041501 | Bacteria | 1270 |
| 279 | Ga0451845_0929104 | 3300041501 | Bacteria | 1300 |
| 280 | Ga0451846_05577 | 3300041502 | Bacteria | 2773 |
| 281 | Ga0451847_0008387 | 3300041503 | Bacteria | 3817 |
| 282 | Ga0451847_0691945 | 3300041503 | Bacteria | 1303 |
| 283 | Ga0451851_0548143 | 3300041507 | Bacteria | 1880 |
| 284 | Ga0451855_0189021 | 3300041511 | Bacteria | 947 |
| 285 | Ga0451853_1500900 | 3300041512 | Bacteria | 5314 |
| 286 | Ga0451853_3538132 | 3300041512 | Bacteria | 2636 |
| 287 | Ga0452268_38528 | 3300041907 | Bacteria | 1511 |
| 288 | Ga0439432_013219 | 3300042006 | Bacteria | 2810 |
| 289 | Ga0439449_0022025 | 3300042007 | Bacteria | 2385 |
| 290 | Ga0439449_0086854 | 3300042007 | Bacteria | 1154 |
| 291 | Ga0453684_0009469 | 3300044712 | Bacteria | 17035 |
| 292 | Ga0495617_054991 | 3300046452 | Bacteria | 1321 |
| 293 | Ga0495629_0019024 | 3300046459 | Bacteria | 4911 |
| 294 | Ga0495638_0000300 | 3300046460 | Bacteria | 63643 |
| 295 | Ga0495638_0014856 | 3300046460 | Bacteria | 5248 |
| 296 | Ga0495638_0025826 | 3300046460 | Bacteria | 3814 |
| 297 | Ga0495651_0066767 | 3300046462 | Bacteria | 2745 |
| 298 | Ga0495605_0000998 | 3300046474 | Bacteria | 19122 |
| 299 | Ga0495605_0036369 | 3300046474 | Bacteria | 2483 |
| 300 | Ga0495662_0017093 | 3300046476 | Bacteria | 3511 |
| 301 | Ga0495664_0058057 | 3300046477 | Bacteria | 2302 |
| 302 | Ga0495585_0037288 | 3300046492 | Bacteria | 2738 |
| 303 | Ga0495607_0073056 | 3300046501 | Bacteria | 1907 |
| 304 | Ga0495583_0032155 | 3300046506 | Bacteria | 2535 |
| 305 | Ga0495583_0044005 | 3300046506 | Bacteria | 2075 |
| 306 | Ga0495606_0001142 | 3300046507 | Bacteria | 37680 |
| 307 | Ga0495606_0048548 | 3300046507 | Bacteria | 2790 |
| 308 | Ga0495608_0116000 | 3300046511 | Bacteria | 1719 |
| 309 | Ga0495610_0022471 | 3300046512 | Bacteria | 3449 |
| 310 | Ga0495616_0036507 | 3300046513 | Bacteria | 2535 |
| 311 | Ga0495616_0080039 | 3300046513 | Bacteria | 1565 |
| 312 | Ga0495620_0006745 | 3300046515 | Bacteria | 6279 |
| 313 | Ga0495620_0022657 | 3300046515 | Bacteria | 3020 |
| 314 | Ga0495631_0002311 | 3300046518 | Bacteria | 10861 |
| 315 | Ga0495632_0008599 | 3300046519 | Bacteria | 6238 |
| 316 | Ga0495632_0029795 | 3300046519 | Bacteria | 2838 |
| 317 | Ga0495643_0018843 | 3300046522 | Bacteria | 3998 |
| 318 | Ga0495643_0022292 | 3300046522 | Bacteria | 3616 |
| 319 | Ga0495644_0047387 | 3300046523 | Bacteria | 1615 |
| 320 | Ga0495652_0140687 | 3300046529 | Bacteria | 1898 |
| 321 | Ga0495654_0005924 | 3300046530 | Bacteria | 7027 |
| 322 | Ga0495587_0155622 | 3300046536 | Bacteria | 1302 |
| 323 | Ga0495609_0014796 | 3300046538 | Bacteria | 3662 |
| 324 | Ga0495609_0060177 | 3300046538 | Bacteria | 1679 |
| 325 | Ga0495597_0025376 | 3300046542 | Bacteria | 2728 |
| 326 | Ga0495633_0032451 | 3300046558 | Bacteria | 2523 |
| 327 | Ga0495656_0053175 | 3300046615 | Bacteria | 1739 |
| 328 | Ga0495668_0004998 | 3300046616 | Bacteria | 9163 |
| 329 | Ga0495668_0028712 | 3300046616 | Bacteria | 3145 |
| 330 | Ga0495611_0011812 | 3300046648 | Bacteria | 3706 |
| 331 | Ga0495625_0008370 | 3300046660 | Bacteria | 8830 |
| 332 | Ga0495625_0021355 | 3300046660 | Bacteria | 4986 |
| 333 | Ga0495625_0023158 | 3300046660 | Bacteria | 4746 |
| 334 | Ga0495635_0048244 | 3300046663 | Bacteria | 2936 |
| 335 | Ga0495588_0019961 | 3300046674 | Bacteria | 3288 |
| 336 | Ga0495657_0051262 | 3300046675 | Bacteria | 2771 |
| 337 | Ga0495613_0131417 | 3300046689 | Bacteria | 1793 |
| 338 | Ga0495624_0228488 | 3300046690 | Bacteria | 1127 |
| 339 | Ga0495671_0041582 | 3300046692 | Bacteria | 2314 |
| 340 | Ga0495649_0010942 | 3300046694 | Bacteria | 5344 |
| 341 | Ga0495649_0030253 | 3300046694 | Bacteria | 2991 |
| 342 | Ga0495600_0034660 | 3300046809 | Bacteria | 3277 |
| 343 | Ga0495660_0015968 | 3300046810 | Bacteria | 4332 |
| 344 | Ga0495604_0003714 | 3300047317 | Bacteria | 12160 |
| 345 | Ga0495636_0006453 | 3300047318 | Bacteria | 4609 |
| 346 | Ga0495672_0011865 | 3300047320 | Bacteria | 6118 |
| 347 | Ga0495683_0069995 | 3300047323 | Bacteria | 1723 |
| 348 | Ga0495687_116962 | 3300047443 | Bacteria | 969 |
| 349 | Ga0495681_0000688 | 3300047470 | Bacteria | 25777 |
| 350 | Ga0495681_0136781 | 3300047470 | Bacteria | 1038 |
| 351 | Ga0495686_0000422 | 3300047472 | Bacteria | 66571 |
| 352 | Ga0495686_0002120 | 3300047472 | Bacteria | 19433 |
| 353 | Ga0495686_0027768 | 3300047472 | Bacteria | 3692 |
| 354 | Ga0495686_0064325 | 3300047472 | Bacteria | 2271 |
| 355 | Ga0495686_0143729 | 3300047472 | Bacteria | 1406 |
| 356 | Ga0495602_0359792 | 3300048088 | Bacteria | 1048 |
| 357 | Ga0495615_0008384 | 3300048090 | Bacteria | 1995 |
| 358 | Ga0495626_0057492 | 3300048091 | Bacteria | 1779 |
| 359 | Ga0496100_0358463 | 3300048903 | Bacteria | 1103 |
| 360 | Ga0496104_0114639 | 3300048907 | Bacteria | 2585 |
| 361 | Ga0496106_0000028 | 3300048909 | Bacteria | 143296 |
| 362 | Ga0496113_0061214 | 3300048916 | Bacteria | 2840 |
| 363 | Ga0496116_0000049 | 3300048919 | Bacteria | 314452 |
| 364 | Ga0496116_0020205 | 3300048919 | Bacteria | 5065 |
| 365 | Ga0496116_0041823 | 3300048919 | Bacteria | 3140 |
| 366 | Ga0496116_0101314 | 3300048919 | Bacteria | 1720 |
| 367 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 368 | Ga0496117_0001124 | 3300048920 | Bacteria | 40302 |
| 369 | Ga0496117_0036587 | 3300048920 | Bacteria | 3671 |
| 370 | Ga0496117_0097498 | 3300048920 | Bacteria | 1872 |
| 371 | Ga0496118_0000759 | 3300048921 | Bacteria | 52080 |
| 372 | Ga0496118_0003513 | 3300048921 | Bacteria | 19652 |
| 373 | Ga0496118_0011225 | 3300048921 | Bacteria | 8770 |
| 374 | Ga0496118_0015019 | 3300048921 | Bacteria | 7199 |
| 375 | Ga0496118_0046582 | 3300048921 | Bacteria | 3371 |
| 376 | Ga0496118_0083291 | 3300048921 | Bacteria | 2237 |
| 377 | Ga0496119_0003324 | 3300048922 | Bacteria | 16773 |
| 378 | Ga0496119_0011799 | 3300048922 | Bacteria | 7179 |
| 379 | Ga0496119_0026727 | 3300048922 | Bacteria | 3991 |
| 380 | Ga0496120_0000093 | 3300048923 | Bacteria | 146905 |
| 381 | Ga0496120_0004706 | 3300048923 | Bacteria | 11250 |
| 382 | Ga0496120_0048286 | 3300048923 | Bacteria | 2450 |
| 383 | Ga0496120_0077123 | 3300048923 | Bacteria | 1814 |
| 384 | Ga0496121_0000005 | 3300048924 | Bacteria | 1034486 |
| 385 | Ga0496121_0000570 | 3300048924 | Bacteria | 69574 |
| 386 | Ga0496121_0033662 | 3300048924 | Bacteria | 4632 |
| 387 | Ga0496121_0186523 | 3300048924 | Bacteria | 1491 |
| 388 | Ga0496121_0196021 | 3300048924 | Bacteria | 1444 |
| 389 | Ga0496122_0000004 | 3300048925 | Bacteria | 645283 |
| 390 | Ga0496122_0016047 | 3300048925 | Bacteria | 7117 |
| 391 | Ga0496122_0027961 | 3300048925 | Bacteria | 4802 |
| 392 | Ga0496122_0030501 | 3300048925 | Bacteria | 4517 |
| 393 | Ga0496122_0066691 | 3300048925 | Bacteria | 2597 |
| 394 | Ga0496123_0000007 | 3300048926 | Bacteria | 645283 |
| 395 | Ga0496123_0031684 | 3300048926 | Bacteria | 3842 |
| 396 | Ga0496124_0000091 | 3300048927 | Bacteria | 189706 |
| 397 | Ga0496124_0006058 | 3300048927 | Bacteria | 13308 |
| 398 | Ga0496124_0028541 | 3300048927 | Bacteria | 4990 |
| 399 | Ga0496124_0049468 | 3300048927 | Bacteria | 3586 |
| 400 | Ga0496124_0118925 | 3300048927 | Bacteria | 2114 |
| 401 | Ga0496124_0268973 | 3300048927 | Bacteria | 1249 |
| 402 | Ga0496124_0371616 | 3300048927 | Bacteria | 1003 |
| 403 | Ga0496125_0000159 | 3300048928 | Bacteria | 151205 |
| 404 | Ga0496125_0004359 | 3300048928 | Bacteria | 16404 |
| 405 | Ga0496125_0030598 | 3300048928 | Bacteria | 4812 |
| 406 | Ga0496125_0128119 | 3300048928 | Bacteria | 1793 |
| 407 | Ga0496126_0000081 | 3300048929 | Bacteria | 218818 |
| 408 | Ga0496126_0012281 | 3300048929 | Bacteria | 8789 |
| 409 | Ga0496126_0045555 | 3300048929 | Bacteria | 4030 |
| 410 | Ga0496126_0283502 | 3300048929 | Bacteria | 1371 |
| 411 | Ga0495682_0080327 | 3300049460 | Bacteria | 1173 |
| 412 | Ga0501032_0146820 | 3300049569 | Bacteria | 1552 |
| 413 | Ga0501033_0051370 | 3300049570 | Bacteria | 3056 |
| 414 | Ga0501034_0161912 | 3300049571 | Bacteria | 2208 |
| 415 | Ga0501036_0015259 | 3300049572 | Bacteria | 6414 |
| 416 | Ga0501037_0085812 | 3300049573 | Bacteria | 2279 |
| 417 | Ga0501038_0185118 | 3300049574 | Bacteria | 1678 |
| 418 | Ga0501043_0044713 | 3300049579 | Bacteria | 3482 |
| 419 | Ga0501043_0129810 | 3300049579 | Bacteria | 1975 |
| 420 | Ga0501047_0059512 | 3300049581 | Bacteria | 3688 |
| 421 | Ga0501047_0061221 | 3300049581 | Bacteria | 3632 |
| 422 | Ga0501073_0461324 | 3300049589 | Bacteria | 878 |
| 423 | Ga0501080_0047331 | 3300049742 | Bacteria | 4003 |
| 424 | Ga0501083_0040392 | 3300049744 | Bacteria | 3167 |
| 425 | Ga0501083_0086468 | 3300049744 | Bacteria | 2073 |
| 426 | Ga0501044_0031639 | 3300049823 | Bacteria | 5568 |
| 427 | nmdc:mga03683_34324_c1 | 3300050489 | Bacteria | 2053 |
| 428 | nmdc:mga03683_51438_c1 | 3300050489 | Bacteria | 1720 |
| 429 | nmdc:mga03n38_68598_c1 | 3300050490 | Bacteria | 1635 |
| 430 | nmdc:mga03n38_84311_c1 | 3300050490 | Bacteria | 1500 |
| 431 | nmdc:mga00v17_19670_c1 | 3300050491 | Bacteria | 3860 |
| 432 | nmdc:mga0yw44_154925_c1 | 3300050492 | Bacteria | 1497 |
| 433 | nmdc:mga0yw44_213678_c1 | 3300050492 | Bacteria | 1276 |
| 434 | nmdc:mga0yw44_3224_c1 | 3300050492 | Bacteria | 7187 |
| 435 | nmdc:mga0yw44_431_c1 | 3300050492 | Bacteria | 14728 |
| 436 | nmdc:mga0k408_127220_c1 | 3300050493 | Bacteria | 1512 |
| 437 | nmdc:mga0k408_3813_c1 | 3300050493 | Bacteria | 7991 |
| 438 | nmdc:mga06z11_102447_c1 | 3300050494 | Bacteria | 1573 |
| 439 | nmdc:mga06z11_10978_c1 | 3300050494 | Bacteria | 3884 |
| 440 | nmdc:mga04h51_39557_c1 | 3300050495 | Bacteria | 1532 |
| 441 | nmdc:mga07m45_134482_c1 | 3300050496 | Bacteria | 1431 |
| 442 | nmdc:mga07m45_38680_c1 | 3300050496 | Bacteria | 2663 |
| 443 | nmdc:mga0sz30_25294_c1 | 3300050516 | Bacteria | 1803 |
| 444 | nmdc:mga0sz30_2699_c1 | 3300050516 | Bacteria | 3389 |
| 445 | nmdc:mga0sz30_26_c1 | 3300050516 | Bacteria | 59011 |
| 446 | Ga0495655_0003456 | 3300053083 | Bacteria | 2609 |
| 447 | Ga0500578_0063248 | 3300053086 | Bacteria | 2360 |
| 448 | Ga0500650_0025695 | 3300053098 | Bacteria | 2635 |
| 449 | Ga0500557_000894 | 3300053105 | Bacteria | 4400 |
| 450 | Ga0500562_031322 | 3300053108 | Bacteria | 1403 |
| 451 | Ga0500569_000971 | 3300053109 | Bacteria | 5165 |
| 452 | Ga0500569_011125 | 3300053109 | Bacteria | 2140 |
| 453 | Ga0500572_001165 | 3300053111 | Bacteria | 7574 |
| 454 | Ga0500593_003321 | 3300053117 | Bacteria | 6055 |
| 455 | Ga0500594_0001842 | 3300053118 | Bacteria | 4594 |
| 456 | Ga0500594_0010520 | 3300053118 | Bacteria | 2149 |
| 457 | Ga0500608_012503 | 3300053122 | Bacteria | 3725 |
| 458 | Ga0500628_006682 | 3300053129 | Bacteria | 1956 |
| 459 | Ga0500658_0001192 | 3300053134 | Bacteria | 10585 |
| 460 | Ga0500658_0037330 | 3300053134 | Bacteria | 1932 |
| 461 | Ga0500559_0009290 | 3300053136 | Bacteria | 4264 |
| 462 | Ga0500561_0005831 | 3300053137 | Bacteria | 2315 |
| 463 | Ga0500568_0001664 | 3300053139 | Bacteria | 13928 |
| 464 | Ga0500568_0002341 | 3300053139 | Bacteria | 11225 |
| 465 | Ga0500577_0010406 | 3300053142 | Bacteria | 2737 |
| 466 | Ga0500590_005672 | 3300053148 | Bacteria | 6023 |
| 467 | Ga0500604_0011839 | 3300053151 | Bacteria | 2349 |
| 468 | Ga0500616_0000400 | 3300053153 | Bacteria | 59475 |
| 469 | Ga0500616_0001502 | 3300053153 | Bacteria | 22017 |
| 470 | Ga0500616_0040719 | 3300053153 | Bacteria | 2497 |
| 471 | Ga0500622_0000593 | 3300053156 | Bacteria | 32900 |
| 472 | Ga0500622_0003374 | 3300053156 | Bacteria | 10748 |
| 473 | Ga0500622_0138141 | 3300053156 | Bacteria | 1165 |
| 474 | Ga0500624_000600 | 3300053157 | Bacteria | 9838 |
| 475 | Ga0500627_0043016 | 3300053158 | Bacteria | 1946 |
| 476 | Ga0500627_0079345 | 3300053158 | Bacteria | 1462 |
| 477 | Ga0500627_0133104 | 3300053158 | Bacteria | 1123 |
| 478 | Ga0500633_0000975 | 3300053160 | Bacteria | 5042 |
| 479 | Ga0500636_0000001 | 3300053177 | Bacteria | 324086 |
| 480 | Ga0500636_0021680 | 3300053177 | Bacteria | 3803 |
| 481 | Ga0500611_029383 | 3300053727 | Bacteria | 1125 |
| 482 | Ga0500645_001087 | 3300053730 | Bacteria | 14925 |
| 483 | Ga0500645_010175 | 3300053730 | Bacteria | 3125 |
| 484 | Ga0500645_041416 | 3300053730 | Bacteria | 1360 |
| 485 | Ga0500645_044187 | 3300053730 | Bacteria | 1311 |
| 486 | Ga0501082_0149894 | 3300060353 | Bacteria | 2025 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031548 | Ga0307408_100004501 | Ga0307408_1000045019 | 249 |
| 2 | 3300031901 | Ga0307406_10027924 | Ga0307406_100279244 | 249 |
| 3 | 3300031911 | Ga0307412_10218606 | Ga0307412_102186062 | 250 |
| 4 | iso_pu_bacteria | 2718218423 | 2721400637 | 252 |
| 5 | iso_pu_bacteria | 2721755809 | 2724039450 | 252 |
| 6 | iso_pu_bacteria | 8018176218 | 8018179031 | 252 |
| 7 | iso_pu_bacteria | 2838016132 | 2838019858 | 253 |
| 8 | iso_pu_bacteria | 2838022645 | 2838023364 | 253 |
| 9 | iso_pu_bacteria | 2838048938 | 2838052666 | 253 |
| 10 | iso_pu_bacteria | 2838061910 | 2838064924 | 253 |
| 11 | iso_pu_bacteria | 2838068647 | 2838069652 | 253 |
| 12 | iso_pu_bacteria | 2838668709 | 2838671846 | 253 |
| 13 | iso_pu_bacteria | 2838686498 | 2838686558 | 253 |
| 14 | iso_pu_bacteria | 2838694306 | 2838698107 | 253 |
| 15 | iso_pu_bacteria | 2838701080 | 2838704525 | 253 |
| 16 | iso_pu_bacteria | 2838707686 | 2838711221 | 253 |
| 17 | iso_pu_bacteria | 2838729681 | 2838734800 | 253 |
| 18 | iso_pu_bacteria | 2838742623 | 2838747415 | 253 |
| 19 | iso_pu_bacteria | 2841851746 | 2841854387 | 253 |
| 20 | iso_pu_bacteria | 2842077413 | 2842079398 | 253 |
| 21 | iso_pu_bacteria | 2842110456 | 2842115496 | 253 |
| 22 | iso_pu_bacteria | 2842118031 | 2842118093 | 253 |
| 23 | iso_pu_bacteria | 2842146304 | 2842149743 | 253 |
| 24 | iso_pu_bacteria | 2842156927 | 2842158594 | 253 |
| 25 | iso_pu_bacteria | 2842163707 | 2842168960 | 253 |
| 26 | iso_pu_bacteria | 2842180545 | 2842182208 | 253 |
| 27 | iso_pu_bacteria | 2842198810 | 2842198878 | 253 |
| 28 | iso_pu_bacteria | 2842217011 | 2842218439 | 253 |
| 29 | iso_pu_bacteria | 2842229732 | 2842229792 | 253 |
| 30 | iso_pu_bacteria | 2842237096 | 2842240006 | 253 |
| 31 | iso_pu_bacteria | 2842257432 | 2842258234 | 253 |
| 32 | iso_pu_bacteria | 2842264693 | 2842268985 | 253 |
| 33 | iso_pu_bacteria | 2842271015 | 2842271904 | 253 |
| 34 | iso_pu_bacteria | 2842278818 | 2842284328 | 253 |
| 35 | iso_pu_bacteria | 2842285085 | 2842285114 | 253 |
| 36 | iso_pu_bacteria | 2842291075 | 2842293059 | 253 |
| 37 | iso_pu_bacteria | 2842304105 | 2842305516 | 253 |
| 38 | iso_pu_bacteria | 2842311132 | 2842314238 | 253 |
| 39 | iso_pu_bacteria | 2842317721 | 2842320040 | 253 |
| 40 | iso_pu_bacteria | 2842363717 | 2842368787 | 253 |
| 41 | iso_pu_bacteria | 2842370503 | 2842373579 | 253 |
| 42 | iso_pu_bacteria | 2842384541 | 2842384603 | 253 |
| 43 | iso_pu_bacteria | 2842402390 | 2842402472 | 253 |
| 44 | iso_pu_bacteria | 2842415677 | 2842416805 | 253 |
| 45 | iso_pu_bacteria | 2842422224 | 2842423266 | 253 |
| 46 | iso_pu_bacteria | 2842428310 | 2842433093 | 253 |
| 47 | iso_pu_bacteria | 2842434925 | 2842439398 | 253 |
| 48 | iso_pu_bacteria | 2842441272 | 2842446027 | 253 |
| 49 | iso_pu_bacteria | 2842447887 | 2842449055 | 253 |
| 50 | iso_pu_bacteria | 2842462802 | 2842467368 | 253 |
| 51 | iso_pu_bacteria | 2842469257 | 2842474163 | 253 |
| 52 | iso_pu_bacteria | 2842489311 | 2842493418 | 253 |
| 53 | iso_pu_bacteria | 2842495871 | 2842497570 | 253 |
| 54 | iso_pu_bacteria | 2844454524 | 2844457856 | 253 |
| 55 | iso_pu_bacteria | 2857516855 | 2857516929 | 253 |
| 56 | iso_pu_bacteria | 2551306091 | 2551730292 | 254 |
| 57 | iso_pu_bacteria | 2615840624 | 2616296576 | 254 |
| 58 | iso_pu_bacteria | 2996893221 | 2996898131 | 254 |
| 59 | iso_pu_bacteria | 8018127388 | 8018130653 | 254 |
| 60 | iso_pu_bacteria | 2551306090 | 2551718114 | 255 |
| 61 | iso_pu_bacteria | 2923556063 | 2923562018 | 256 |
| 62 | 3300002987 | JGI25159J45721_1001556 | JGI25159J45721_10015564 | 258 |
| 63 | 3300003320 | rootH2_10008440 | rootH2_100084402 | 258 |
| 64 | 3300003354 | JGI25160J50197_1000001 | JGI25160J50197_100000177 | 258 |
| 65 | 3300003374 | JGI25161J50226_1000047 | JGI25161J50226_100004727 | 258 |
| 66 | 3300004625 | Ga0055543_1000007 | Ga0055543_1000007118 | 258 |
| 67 | 3300005262 | Ga0065165_1000357 | Ga0065165_100035720 | 258 |
| 68 | 3300005578 | Ga0068854_100017336 | Ga0068854_1000173363 | 258 |
| 69 | 3300005614 | Ga0068856_100185206 | Ga0068856_1001852062 | 258 |
| 70 | 3300005616 | Ga0068852_100127814 | Ga0068852_1001278142 | 258 |
| 71 | 3300009093 | Ga0105240_10000014 | Ga0105240_1000001433 | 258 |
| 72 | 3300009545 | Ga0105237_10000770 | Ga0105237_1000077035 | 258 |
| 73 | 3300010375 | Ga0105239_10004243 | Ga0105239_100042439 | 258 |
| 74 | 3300013104 | Ga0157370_10000015 | Ga0157370_1000001533 | 258 |
| 75 | 3300014497 | Ga0182008_10033845 | Ga0182008_100338452 | 258 |
| 76 | 3300015262 | Ga0182007_10002096 | Ga0182007_100020965 | 258 |
| 77 | 3300015265 | Ga0182005_1010891 | Ga0182005_10108912 | 258 |
| 78 | 3300020076 | Ga0206355_1174415 | Ga0206355_11744151 | 258 |
| 79 | 3300025253 | Ga0209677_100781 | Ga0209677_1007814 | 258 |
| 80 | 3300025261 | Ga0209233_1000137 | Ga0209233_100013734 | 258 |
| 81 | 3300025284 | Ga0209130_1000145 | Ga0209130_100014577 | 258 |
| 82 | 3300025302 | Ga0207426_1000011 | Ga0207426_100001177 | 258 |
| 83 | 3300025913 | Ga0207695_10000037 | Ga0207695_1000003734 | 258 |
| 84 | 3300025914 | Ga0207671_10000080 | Ga0207671_1000008034 | 258 |
| 85 | 3300025981 | Ga0207640_10018330 | Ga0207640_100183306 | 258 |
| 86 | 3300026078 | Ga0207702_10041321 | Ga0207702_100413213 | 258 |
| 87 | 3300037471 | Ga0395905_0012601 | Ga0395905_0012601_5385_6206 | 258 |
| 88 | 3300048919 | Ga0496116_0020205 | Ga0496116_0020205_1229_2041 | 258 |
| 89 | 3300048920 | Ga0496117_0001124 | Ga0496117_0001124_35201_36013 | 258 |
| 90 | 3300048921 | Ga0496118_0000759 | Ga0496118_0000759_16268_17080 | 258 |
| 91 | 3300048922 | Ga0496119_0003324 | Ga0496119_0003324_1869_2681 | 258 |
| 92 | 3300048923 | Ga0496120_0004706 | Ga0496120_0004706_2837_3649 | 258 |
| 93 | 3300048924 | Ga0496121_0000570 | Ga0496121_0000570_4043_4855 | 258 |
| 94 | 3300048925 | Ga0496122_0027961 | Ga0496122_0027961_2782_3594 | 258 |
| 95 | 3300048927 | Ga0496124_0028541 | Ga0496124_0028541_4032_4844 | 258 |
| 96 | 3300048929 | Ga0496126_0045555 | Ga0496126_0045555_1542_2354 | 258 |
| 97 | 3300049589 | Ga0501073_0461324 | Ga0501073_0461324_14_808 | 258 |
| 98 | 3300053158 | Ga0500627_0079345 | Ga0500627_0079345_280_1092 | 258 |
| 99 | iso_pu_bacteria | 3005409236 | 3005409314 | 258 |
| 100 | 3300006042 | Ga0075368_10027051 | Ga0075368_100270512 | 259 |
| 101 | 3300006177 | Ga0075362_10092379 | Ga0075362_100923792 | 259 |
| 102 | 3300006353 | Ga0075370_10078416 | Ga0075370_100784161 | 259 |
| 103 | 3300041512 | Ga0451853_3538132 | Ga0451853_3538132_1374_2180 | 259 |
| 104 | 3300046530 | Ga0495654_0005924 | Ga0495654_0005924_4159_4980 | 259 |
| 105 | 3300046536 | Ga0495587_0155622 | Ga0495587_0155622_479_1282 | 259 |
| 106 | 3300050492 | nmdc:mga0yw44_154925_c1 | nmdc:mga0yw44_154925_c1_528_1352 | 259 |
| 107 | 3300050494 | nmdc:mga06z11_10978_c1 | nmdc:mga06z11_10978_c1_2122_2946 | 259 |
| 108 | 3300050496 | nmdc:mga07m45_134482_c1 | nmdc:mga07m45_134482_c1_571_1395 | 259 |
| 109 | 3300053158 | Ga0500627_0133104 | Ga0500627_0133104_290_1108 | 259 |
| 110 | iso_pu_bacteria | 2537561587 | 2537875859 | 259 |
| 111 | iso_pu_bacteria | 2599185210 | 2599602036 | 259 |
| 112 | iso_pu_bacteria | 2838042994 | 2838045692 | 259 |
| 113 | iso_pu_bacteria | 2838680041 | 2838682950 | 259 |
| 114 | iso_pu_bacteria | 2841859092 | 2841862572 | 259 |
| 115 | iso_pu_bacteria | 2841864319 | 2841867466 | 259 |
| 116 | iso_pu_bacteria | 2842192696 | 2842195553 | 259 |
| 117 | iso_pu_bacteria | 2842205361 | 2842210874 | 259 |
| 118 | iso_pu_bacteria | 2842243621 | 2842243681 | 259 |
| 119 | iso_pu_bacteria | 2842250916 | 2842254090 | 259 |
| 120 | iso_pu_bacteria | 2842341865 | 2842347563 | 259 |
| 121 | iso_pu_bacteria | 2842377471 | 2842379456 | 259 |
| 122 | iso_pu_bacteria | 2842515876 | 2842519356 | 259 |
| 123 | iso_pu_bacteria | 2899792073 | 2899795745 | 259 |
| 124 | iso_pu_bacteria | 2933011516 | 2933014473 | 259 |
| 125 | iso_pu_bacteria | 8005301065 | 8005303635 | 259 |
| 126 | iso_pu_bacteria | 8005688590 | 8005691585 | 259 |
| 127 | 3300003316 | rootH1_10057687 | rootH1_100576872 | 260 |
| 128 | 3300006195 | Ga0075366_10048190 | Ga0075366_100481903 | 260 |
| 129 | 3300050493 | nmdc:mga0k408_127220_c1 | nmdc:mga0k408_127220_c1_486_1337 | 260 |
| 130 | iso_pu_bacteria | 2510917028 | 2511182803 | 260 |
| 131 | iso_pu_bacteria | 2512875026 | 2512973007 | 260 |
| 132 | iso_pu_bacteria | 2513237089 | 2513604411 | 260 |
| 133 | iso_pu_bacteria | 2513237138 | 2513869758 | 260 |
| 134 | iso_pu_bacteria | 2513237144 | 2513910557 | 260 |
| 135 | iso_pu_bacteria | 2513237160 | 2514007111 | 260 |
| 136 | iso_pu_bacteria | 2517487022 | 2517568375 | 260 |
| 137 | iso_pu_bacteria | 2554235003 | 2554248624 | 260 |
| 138 | iso_pu_bacteria | 2558860242 | 2559295712 | 260 |
| 139 | iso_pu_bacteria | 2582581299 | 2585230762 | 260 |
| 140 | iso_pu_bacteria | 2582581304 | 2585259280 | 260 |
| 141 | iso_pu_bacteria | 2582581867 | 2585402853 | 260 |
| 142 | iso_pu_bacteria | 2585427590 | 2585823485 | 260 |
| 143 | iso_pu_bacteria | 2600255279 | 2601609713 | 260 |
| 144 | iso_pu_bacteria | 2600255308 | 2601746488 | 260 |
| 145 | iso_pu_bacteria | 2643221568 | 2643854596 | 260 |
| 146 | iso_pu_bacteria | 2643221582 | 2643919969 | 260 |
| 147 | iso_pu_bacteria | 2643221599 | 2644003010 | 260 |
| 148 | iso_pu_bacteria | 2643221634 | 2644196748 | 260 |
| 149 | iso_pu_bacteria | 2643221693 | 2644523321 | 260 |
| 150 | iso_pu_bacteria | 2775507049 | 2776910490 | 260 |
| 151 | iso_pu_bacteria | 2802428858 | 2802718574 | 260 |
| 152 | iso_pu_bacteria | 2802428859 | 2802724255 | 260 |
| 153 | iso_pu_bacteria | 2802428860 | 2802730083 | 260 |
| 154 | iso_pu_bacteria | 2802428861 | 2802737426 | 260 |
| 155 | iso_pu_bacteria | 2802428862 | 2802742342 | 260 |
| 156 | iso_pu_bacteria | 2802428863 | 2802749025 | 260 |
| 157 | iso_pu_bacteria | 2808606387 | 2808987553 | 260 |
| 158 | iso_pu_bacteria | 2818991439 | 2819559430 | 260 |
| 159 | iso_pu_bacteria | 2838675328 | 2838675394 | 260 |
| 160 | iso_pu_bacteria | 2838714209 | 2838714275 | 260 |
| 161 | iso_pu_bacteria | 2838719591 | 2838721923 | 260 |
| 162 | iso_pu_bacteria | 2838724970 | 2838725036 | 260 |
| 163 | iso_pu_bacteria | 2841846520 | 2841848903 | 260 |
| 164 | iso_pu_bacteria | 2842124991 | 2842125066 | 260 |
| 165 | iso_pu_bacteria | 2842130223 | 2842130289 | 260 |
| 166 | iso_pu_bacteria | 2842152218 | 2842154541 | 260 |
| 167 | iso_pu_bacteria | 2842170452 | 2842170518 | 260 |
| 168 | iso_pu_bacteria | 2842175837 | 2842178161 | 260 |
| 169 | iso_pu_bacteria | 2842187318 | 2842187384 | 260 |
| 170 | iso_pu_bacteria | 2842211629 | 2842211695 | 260 |
| 171 | iso_pu_bacteria | 2842224351 | 2842226685 | 260 |
| 172 | iso_pu_bacteria | 2899845264 | 2899848942 | 260 |
| 173 | iso_pu_bacteria | 2913295892 | 2913298224 | 260 |
| 174 | iso_pu_bacteria | 2915980308 | 2915986499 | 260 |
| 175 | iso_pu_bacteria | 2916061851 | 2916068297 | 260 |
| 176 | iso_pu_bacteria | 2919114240 | 2919114306 | 260 |
| 177 | iso_pu_bacteria | 2919166419 | 2919168933 | 260 |
| 178 | iso_pu_bacteria | 2921250672 | 2921252653 | 260 |
| 179 | iso_pu_bacteria | 2926754445 | 2926755326 | 260 |
| 180 | iso_pu_bacteria | 2926760298 | 2926762436 | 260 |
| 181 | iso_pu_bacteria | 2929138655 | 2929142905 | 260 |
| 182 | iso_pu_bacteria | 2933006813 | 2933009186 | 260 |
| 183 | iso_pu_bacteria | 2933594066 | 2933596223 | 260 |
| 184 | iso_pu_bacteria | 2937029754 | 2937031592 | 260 |
| 185 | iso_pu_bacteria | 2937036028 | 2937037724 | 260 |
| 186 | iso_pu_bacteria | 2937078374 | 2937081719 | 260 |
| 187 | iso_pu_bacteria | 2937084907 | 2937089411 | 260 |
| 188 | iso_pu_bacteria | 2957375807 | 2957377805 | 260 |
| 189 | iso_pu_bacteria | 2957437181 | 2957443279 | 260 |
| 190 | iso_pu_bacteria | 2960591022 | 2960593362 | 260 |
| 191 | iso_pu_bacteria | 2960631154 | 2960637148 | 260 |
| 192 | iso_pu_bacteria | 2960680706 | 2960684607 | 260 |
| 193 | iso_pu_bacteria | 2960693952 | 2960697473 | 260 |
| 194 | iso_pu_bacteria | 2967686174 | 2967688123 | 260 |
| 195 | iso_pu_bacteria | 2967728569 | 2967731133 | 260 |
| 196 | iso_pu_bacteria | 2970026789 | 2970027325 | 260 |
| 197 | iso_pu_bacteria | 2970122695 | 2970126138 | 260 |
| 198 | iso_pu_bacteria | 2970143518 | 2970146322 | 260 |
| 199 | iso_pu_bacteria | 2977530762 | 2977531094 | 260 |
| 200 | iso_pu_bacteria | 2977544691 | 2977545836 | 260 |
| 201 | iso_pu_bacteria | 2978969890 | 2978971630 | 260 |
| 202 | iso_pu_bacteria | 2979089926 | 2979092293 | 260 |
| 203 | iso_pu_bacteria | 2979095461 | 2979100318 | 260 |
| 204 | iso_pu_bacteria | 2979100975 | 2979104281 | 260 |
| 205 | iso_pu_bacteria | 2984509177 | 2984511139 | 260 |
| 206 | iso_pu_bacteria | 2984518228 | 2984522499 | 260 |
| 207 | iso_pu_bacteria | 2984587000 | 2984588772 | 260 |
| 208 | iso_pu_bacteria | 2984601300 | 2984604158 | 260 |
| 209 | iso_pu_bacteria | 3005452660 | 3005455146 | 260 |
| 210 | iso_pu_bacteria | 650716007 | 650740924 | 260 |
| 211 | iso_pu_bacteria | 8003570095 | 8003571997 | 260 |
| 212 | iso_pu_bacteria | 8003999396 | 8003999457 | 260 |
| 213 | iso_pu_bacteria | 2508501122 | 2509108994 | 261 |
| 214 | iso_pu_bacteria | 2509276019 | 2509375284 | 261 |
| 215 | iso_pu_bacteria | 2509276021 | 2509390098 | 261 |
| 216 | iso_pu_bacteria | 2509276033 | 2509447615 | 261 |
| 217 | iso_pu_bacteria | 2510065019 | 2510134447 | 261 |
| 218 | iso_pu_bacteria | 2510065057 | 2510307169 | 261 |
| 219 | iso_pu_bacteria | 2510461076 | 2510895872 | 261 |
| 220 | iso_pu_bacteria | 2510917030 | 2511194864 | 261 |
| 221 | iso_pu_bacteria | 2511231052 | 2511499038 | 261 |
| 222 | iso_pu_bacteria | 2512047086 | 2512531637 | 261 |
| 223 | iso_pu_bacteria | 2513237084 | 2513567440 | 261 |
| 224 | iso_pu_bacteria | 2513237085 | 2513577776 | 261 |
| 225 | iso_pu_bacteria | 2513237086 | 2513582400 | 261 |
| 226 | iso_pu_bacteria | 2513237091 | 2513616104 | 261 |
| 227 | iso_pu_bacteria | 2513237093 | 2513632077 | 261 |
| 228 | iso_pu_bacteria | 2513237103 | 2513712453 | 261 |
| 229 | iso_pu_bacteria | 2513237140 | 2513884694 | 261 |
| 230 | iso_pu_bacteria | 2513237143 | 2513905089 | 261 |
| 231 | iso_pu_bacteria | 2513237146 | 2513927999 | 261 |
| 232 | iso_pu_bacteria | 2513237162 | 2514017823 | 261 |
| 233 | iso_pu_bacteria | 2515075009 | 2515113609 | 261 |
| 234 | iso_pu_bacteria | 2515154107 | 2515607458 | 261 |
| 235 | iso_pu_bacteria | 2515154113 | 2515635322 | 261 |
| 236 | iso_pu_bacteria | 2515154114 | 2515646066 | 261 |
| 237 | iso_pu_bacteria | 2515154116 | 2515654860 | 261 |
| 238 | iso_pu_bacteria | 2515154134 | 2515739966 | 261 |
| 239 | iso_pu_bacteria | 2516653046 | 2516891587 | 261 |
| 240 | iso_pu_bacteria | 2516653077 | 2517037224 | 261 |
| 241 | iso_pu_bacteria | 2516653085 | 2517077563 | 261 |
| 242 | iso_pu_bacteria | 2517093000 | 2517096333 | 261 |
| 243 | iso_pu_bacteria | 2517287029 | 2517408191 | 261 |
| 244 | iso_pu_bacteria | 2519899620 | 2520378474 | 261 |
| 245 | iso_pu_bacteria | 2524023207 | 2524450804 | 261 |
| 246 | iso_pu_bacteria | 2529292951 | 2530646311 | 261 |
| 247 | iso_pu_bacteria | 2551306084 | 2551679987 | 261 |
| 248 | iso_pu_bacteria | 2551306085 | 2551683658 | 261 |
| 249 | iso_pu_bacteria | 2551306086 | 2551691638 | 261 |
| 250 | iso_pu_bacteria | 2551306087 | 2551702798 | 261 |
| 251 | iso_pu_bacteria | 2551306089 | 2551708725 | 261 |
| 252 | iso_pu_bacteria | 2551306092 | 2551733866 | 261 |
| 253 | iso_pu_bacteria | 2551306093 | 2551741150 | 261 |
| 254 | iso_pu_bacteria | 2558860100 | 2558866372 | 261 |
| 255 | iso_pu_bacteria | 2582581298 | 2585225171 | 261 |
| 256 | iso_pu_bacteria | 2585427526 | 2585524991 | 261 |
| 257 | iso_pu_bacteria | 2585427528 | 2585542707 | 261 |
| 258 | iso_pu_bacteria | 2585427529 | 2585547727 | 261 |
| 259 | iso_pu_bacteria | 2585427593 | 2585841349 | 261 |
| 260 | iso_pu_bacteria | 2599185170 | 2599421010 | 261 |
| 261 | iso_pu_bacteria | 2718217882 | 2719182323 | 261 |
| 262 | iso_pu_bacteria | 2718217927 | 2719386914 | 261 |
| 263 | iso_pu_bacteria | 2718217997 | 2719666650 | 261 |
| 264 | iso_pu_bacteria | 2718218009 | 2719733039 | 261 |
| 265 | iso_pu_bacteria | 2718218199 | 2720493070 | 261 |
| 266 | iso_pu_bacteria | 2718218232 | 2720614548 | 261 |
| 267 | iso_pu_bacteria | 2718218233 | 2720621322 | 261 |
| 268 | iso_pu_bacteria | 2718218235 | 2720632648 | 261 |
| 269 | iso_pu_bacteria | 2718218269 | 2720776372 | 261 |
| 270 | iso_pu_bacteria | 2718218363 | 2721148436 | 261 |
| 271 | iso_pu_bacteria | 2718218365 | 2721159822 | 261 |
| 272 | iso_pu_bacteria | 2718218366 | 2721165250 | 261 |
| 273 | iso_pu_bacteria | 2721755514 | 2722841420 | 261 |
| 274 | iso_pu_bacteria | 2721755556 | 2723027961 | 261 |
| 275 | iso_pu_bacteria | 2721755684 | 2723561591 | 261 |
| 276 | iso_pu_bacteria | 2721755685 | 2723568220 | 261 |
| 277 | iso_pu_bacteria | 2721755810 | 2724045795 | 261 |
| 278 | iso_pu_bacteria | 2721755819 | 2724090979 | 261 |
| 279 | iso_pu_bacteria | 2721755822 | 2724105485 | 261 |
| 280 | iso_pu_bacteria | 2721755823 | 2724111310 | 261 |
| 281 | iso_pu_bacteria | 2724679232 | 2725949289 | 261 |
| 282 | iso_pu_bacteria | 2728369352 | 2730108897 | 261 |
| 283 | iso_pu_bacteria | 2728369365 | 2730165558 | 261 |
| 284 | iso_pu_bacteria | 2728369397 | 2730299454 | 261 |
| 285 | iso_pu_bacteria | 2738541333 | 2739033313 | 261 |
| 286 | iso_pu_bacteria | 2751185821 | 2753462706 | 261 |
| 287 | iso_pu_bacteria | 2765235942 | 2766066361 | 261 |
| 288 | iso_pu_bacteria | 2791355094 | 2792637812 | 261 |
| 289 | iso_pu_bacteria | 2791355256 | 2793293940 | 261 |
| 290 | iso_pu_bacteria | 2791355259 | 2793314386 | 261 |
| 291 | iso_pu_bacteria | 2791355260 | 2793323872 | 261 |
| 292 | iso_pu_bacteria | 2791355262 | 2793335035 | 261 |
| 293 | iso_pu_bacteria | 2791355263 | 2793342378 | 261 |
| 294 | iso_pu_bacteria | 2791355264 | 2793349746 | 261 |
| 295 | iso_pu_bacteria | 2791355265 | 2793355397 | 261 |
| 296 | iso_pu_bacteria | 2791355266 | 2793362103 | 261 |
| 297 | iso_pu_bacteria | 2791355267 | 2793369957 | 261 |
| 298 | iso_pu_bacteria | 2802429605 | 2805929612 | 261 |
| 299 | iso_pu_bacteria | 2802429606 | 2805937304 | 261 |
| 300 | iso_pu_bacteria | 2802429633 | 2806047445 | 261 |
| 301 | iso_pu_bacteria | 2802429634 | 2806055204 | 261 |
| 302 | iso_pu_bacteria | 2802429635 | 2806062652 | 261 |
| 303 | iso_pu_bacteria | 2802429636 | 2806069720 | 261 |
| 304 | iso_pu_bacteria | 2802429637 | 2806075649 | 261 |
| 305 | iso_pu_bacteria | 2838035591 | 2838041370 | 261 |
| 306 | iso_pu_bacteria | 2838661181 | 2838665762 | 261 |
| 307 | iso_pu_bacteria | 2842395702 | 2842400505 | 261 |
| 308 | iso_pu_bacteria | 2842409023 | 2842410157 | 261 |
| 309 | iso_pu_bacteria | 2850079185 | 2850079651 | 261 |
| 310 | iso_pu_bacteria | 2855825444 | 2855827950 | 261 |
| 311 | iso_pu_bacteria | 2855839649 | 2855839707 | 261 |
| 312 | iso_pu_bacteria | 2858800743 | 2858803599 | 261 |
| 313 | iso_pu_bacteria | 2915986958 | 2915987646 | 261 |
| 314 | iso_pu_bacteria | 2915993759 | 2915997269 | 261 |
| 315 | iso_pu_bacteria | 2916000859 | 2916004675 | 261 |
| 316 | iso_pu_bacteria | 2916007675 | 2916012071 | 261 |
| 317 | iso_pu_bacteria | 2916014648 | 2916019062 | 261 |
| 318 | iso_pu_bacteria | 2916021584 | 2916027949 | 261 |
| 319 | iso_pu_bacteria | 2916028427 | 2916031518 | 261 |
| 320 | iso_pu_bacteria | 2916035215 | 2916039418 | 261 |
| 321 | iso_pu_bacteria | 2916041962 | 2916048280 | 261 |
| 322 | iso_pu_bacteria | 2916048683 | 2916051976 | 261 |
| 323 | iso_pu_bacteria | 2916055098 | 2916057069 | 261 |
| 324 | iso_pu_bacteria | 2916068649 | 2916076386 | 261 |
| 325 | iso_pu_bacteria | 2916076590 | 2916077872 | 261 |
| 326 | iso_pu_bacteria | 2919100787 | 2919105677 | 261 |
| 327 | iso_pu_bacteria | 2921201388 | 2921203736 | 261 |
| 328 | iso_pu_bacteria | 2921208531 | 2921212355 | 261 |
| 329 | iso_pu_bacteria | 2921237296 | 2921242759 | 261 |
| 330 | iso_pu_bacteria | 2921244191 | 2921248993 | 261 |
| 331 | iso_pu_bacteria | 2921257292 | 2921262732 | 261 |
| 332 | iso_pu_bacteria | 2921263974 | 2921268815 | 261 |
| 333 | iso_pu_bacteria | 2921282425 | 2921287005 | 261 |
| 334 | iso_pu_bacteria | 2921289301 | 2921289799 | 261 |
| 335 | iso_pu_bacteria | 2921296804 | 2921298629 | 261 |
| 336 | iso_pu_bacteria | 2924144063 | 2924148879 | 261 |
| 337 | iso_pu_bacteria | 2924150972 | 2924154326 | 261 |
| 338 | iso_pu_bacteria | 2924158325 | 2924164644 | 261 |
| 339 | iso_pu_bacteria | 2924165586 | 2924170794 | 261 |
| 340 | iso_pu_bacteria | 2924172951 | 2924179248 | 261 |
| 341 | iso_pu_bacteria | 2924179722 | 2924181134 | 261 |
| 342 | iso_pu_bacteria | 2924186466 | 2924189436 | 261 |
| 343 | iso_pu_bacteria | 2924193448 | 2924200187 | 261 |
| 344 | iso_pu_bacteria | 2924200457 | 2924204656 | 261 |
| 345 | iso_pu_bacteria | 2924207177 | 2924211733 | 261 |
| 346 | iso_pu_bacteria | 2924214083 | 2924214650 | 261 |
| 347 | iso_pu_bacteria | 2924221636 | 2924226405 | 261 |
| 348 | iso_pu_bacteria | 2924228884 | 2924230038 | 261 |
| 349 | iso_pu_bacteria | 2933570622 | 2933571323 | 261 |
| 350 | iso_pu_bacteria | 2933586486 | 2933591911 | 261 |
| 351 | iso_pu_bacteria | 2933599457 | 2933600458 | 261 |
| 352 | iso_pu_bacteria | 2935894831 | 2935896510 | 261 |
| 353 | iso_pu_bacteria | 2935901341 | 2935901402 | 261 |
| 354 | iso_pu_bacteria | 2936367885 | 2936371548 | 261 |
| 355 | iso_pu_bacteria | 2936375103 | 2936376919 | 261 |
| 356 | iso_pu_bacteria | 2936381700 | 2936383491 | 261 |
| 357 | iso_pu_bacteria | 2936996657 | 2936998556 | 261 |
| 358 | iso_pu_bacteria | 2937002841 | 2937007462 | 261 |
| 359 | iso_pu_bacteria | 2937009748 | 2937015578 | 261 |
| 360 | iso_pu_bacteria | 2937016420 | 2937021365 | 261 |
| 361 | iso_pu_bacteria | 2937023124 | 2937023473 | 261 |
| 362 | iso_pu_bacteria | 2937042894 | 2937047393 | 261 |
| 363 | iso_pu_bacteria | 2937049772 | 2937053248 | 261 |
| 364 | iso_pu_bacteria | 2937056579 | 2937060786 | 261 |
| 365 | iso_pu_bacteria | 2937063883 | 2937066776 | 261 |
| 366 | iso_pu_bacteria | 2937071275 | 2937072807 | 261 |
| 367 | iso_pu_bacteria | 2937091812 | 2937097062 | 261 |
| 368 | iso_pu_bacteria | 2937098957 | 2937102801 | 261 |
| 369 | iso_pu_bacteria | 2937106411 | 2937106515 | 261 |
| 370 | iso_pu_bacteria | 2937113482 | 2937119374 | 261 |
| 371 | iso_pu_bacteria | 2937119839 | 2937124296 | 261 |
| 372 | iso_pu_bacteria | 2937126314 | 2937130876 | 261 |
| 373 | iso_pu_bacteria | 2957382221 | 2957386461 | 261 |
| 374 | iso_pu_bacteria | 2957388812 | 2957393280 | 261 |
| 375 | iso_pu_bacteria | 2957395598 | 2957397590 | 261 |
| 376 | iso_pu_bacteria | 2957402308 | 2957403400 | 261 |
| 377 | iso_pu_bacteria | 2957408893 | 2957413421 | 261 |
| 378 | iso_pu_bacteria | 2957415311 | 2957420851 | 261 |
| 379 | iso_pu_bacteria | 2957422303 | 2957423585 | 261 |
| 380 | iso_pu_bacteria | 2957430029 | 2957435918 | 261 |
| 381 | iso_pu_bacteria | 2957443900 | 2957449250 | 261 |
| 382 | iso_pu_bacteria | 2957450854 | 2957455647 | 261 |
| 383 | iso_pu_bacteria | 2957457609 | 2957461867 | 261 |
| 384 | iso_pu_bacteria | 2957464669 | 2957469420 | 261 |
| 385 | iso_pu_bacteria | 2957471148 | 2957473226 | 261 |
| 386 | iso_pu_bacteria | 2957478035 | 2957481880 | 261 |
| 387 | iso_pu_bacteria | 2957484790 | 2957490984 | 261 |
| 388 | iso_pu_bacteria | 2957491536 | 2957494030 | 261 |
| 389 | iso_pu_bacteria | 2957498199 | 2957500767 | 261 |
| 390 | iso_pu_bacteria | 2957505466 | 2957505907 | 261 |
| 391 | iso_pu_bacteria | 2960584000 | 2960590436 | 261 |
| 392 | iso_pu_bacteria | 2960597568 | 2960601247 | 261 |
| 393 | iso_pu_bacteria | 2960603979 | 2960604350 | 261 |
| 394 | iso_pu_bacteria | 2960610863 | 2960613303 | 261 |
| 395 | iso_pu_bacteria | 2960617483 | 2960620127 | 261 |
| 396 | iso_pu_bacteria | 2960624210 | 2960626230 | 261 |
| 397 | iso_pu_bacteria | 2960637947 | 2960644144 | 261 |
| 398 | iso_pu_bacteria | 2960645483 | 2960650390 | 261 |
| 399 | iso_pu_bacteria | 2960652885 | 2960658890 | 261 |
| 400 | iso_pu_bacteria | 2960660292 | 2960660681 | 261 |
| 401 | iso_pu_bacteria | 2960667422 | 2960673047 | 261 |
| 402 | iso_pu_bacteria | 2960674078 | 2960677720 | 261 |
| 403 | iso_pu_bacteria | 2960687367 | 2960687401 | 261 |
| 404 | iso_pu_bacteria | 2964607997 | 2964614786 | 261 |
| 405 | iso_pu_bacteria | 2964615318 | 2964618328 | 261 |
| 406 | iso_pu_bacteria | 2964621998 | 2964626601 | 261 |
| 407 | iso_pu_bacteria | 2964628898 | 2964633376 | 261 |
| 408 | iso_pu_bacteria | 2964636051 | 2964642263 | 261 |
| 409 | iso_pu_bacteria | 2964643177 | 2964649811 | 261 |
| 410 | iso_pu_bacteria | 2964649959 | 2964650046 | 261 |
| 411 | iso_pu_bacteria | 2964656573 | 2964661674 | 261 |
| 412 | iso_pu_bacteria | 2964663802 | 2964670247 | 261 |
| 413 | iso_pu_bacteria | 2964670856 | 2964675752 | 261 |
| 414 | iso_pu_bacteria | 2964678106 | 2964683601 | 261 |
| 415 | iso_pu_bacteria | 2964685014 | 2964689840 | 261 |
| 416 | iso_pu_bacteria | 2964691889 | 2964696179 | 261 |
| 417 | iso_pu_bacteria | 2964698721 | 2964702854 | 261 |
| 418 | iso_pu_bacteria | 2964705432 | 2964710731 | 261 |
| 419 | iso_pu_bacteria | 2964712639 | 2964712988 | 261 |
| 420 | iso_pu_bacteria | 2964719344 | 2964724399 | 261 |
| 421 | iso_pu_bacteria | 2967664464 | 2967667512 | 261 |
| 422 | iso_pu_bacteria | 2967671571 | 2967676838 | 261 |
| 423 | iso_pu_bacteria | 2967678726 | 2967682593 | 261 |
| 424 | iso_pu_bacteria | 2967693043 | 2967694801 | 261 |
| 425 | iso_pu_bacteria | 2967699805 | 2967706914 | 261 |
| 426 | iso_pu_bacteria | 2967706974 | 2967711502 | 261 |
| 427 | iso_pu_bacteria | 2967714385 | 2967714395 | 261 |
| 428 | iso_pu_bacteria | 2967721400 | 2967723719 | 261 |
| 429 | iso_pu_bacteria | 2967735183 | 2967739145 | 261 |
| 430 | iso_pu_bacteria | 2967742019 | 2967745732 | 261 |
| 431 | iso_pu_bacteria | 2967748971 | 2967754559 | 261 |
| 432 | iso_pu_bacteria | 2967755722 | 2967757246 | 261 |
| 433 | iso_pu_bacteria | 2967762386 | 2967768775 | 261 |
| 434 | iso_pu_bacteria | 2967769361 | 2967773767 | 261 |
| 435 | iso_pu_bacteria | 2967775926 | 2967780048 | 261 |
| 436 | iso_pu_bacteria | 2970019648 | 2970021234 | 261 |
| 437 | iso_pu_bacteria | 2970033650 | 2970037480 | 261 |
| 438 | iso_pu_bacteria | 2970040964 | 2970040995 | 261 |
| 439 | iso_pu_bacteria | 2970047711 | 2970048159 | 261 |
| 440 | iso_pu_bacteria | 2970054988 | 2970056952 | 261 |
| 441 | iso_pu_bacteria | 2970061556 | 2970068339 | 261 |
| 442 | iso_pu_bacteria | 2970068827 | 2970069186 | 261 |
| 443 | iso_pu_bacteria | 2970076120 | 2970080466 | 261 |
| 444 | iso_pu_bacteria | 2970082768 | 2970088086 | 261 |
| 445 | iso_pu_bacteria | 2970088815 | 2970093737 | 261 |
| 446 | iso_pu_bacteria | 2970095765 | 2970100803 | 261 |
| 447 | iso_pu_bacteria | 2970102677 | 2970106085 | 261 |
| 448 | iso_pu_bacteria | 2970109326 | 2970111543 | 261 |
| 449 | iso_pu_bacteria | 2970116247 | 2970121378 | 261 |
| 450 | iso_pu_bacteria | 2970129317 | 2970131299 | 261 |
| 451 | iso_pu_bacteria | 2970136068 | 2970140811 | 261 |
| 452 | iso_pu_bacteria | 2970149975 | 2970151880 | 261 |
| 453 | iso_pu_bacteria | 2970156795 | 2970162607 | 261 |
| 454 | iso_pu_bacteria | 2970164137 | 2970169574 | 261 |
| 455 | iso_pu_bacteria | 2970170962 | 2970175699 | 261 |
| 456 | iso_pu_bacteria | 2970177841 | 2970179388 | 261 |
| 457 | iso_pu_bacteria | 2970184632 | 2970185657 | 261 |
| 458 | iso_pu_bacteria | 2970191845 | 2970196576 | 261 |
| 459 | iso_pu_bacteria | 2977516862 | 2977518296 | 261 |
| 460 | iso_pu_bacteria | 2977523885 | 2977528444 | 261 |
| 461 | iso_pu_bacteria | 2977537788 | 2977538514 | 261 |
| 462 | iso_pu_bacteria | 2977551784 | 2977554718 | 261 |
| 463 | iso_pu_bacteria | 2977558990 | 2977563350 | 261 |
| 464 | iso_pu_bacteria | 2977565890 | 2977570072 | 261 |
| 465 | iso_pu_bacteria | 2977572785 | 2977575584 | 261 |
| 466 | iso_pu_bacteria | 2977579622 | 2977584319 | 261 |
| 467 | iso_pu_bacteria | 3005445848 | 3005448916 | 261 |
| 468 | iso_pu_bacteria | 643692032 | 643824273 | 261 |
| 469 | iso_pu_bacteria | 648276728 | 648736775 | 261 |
| 470 | iso_pu_bacteria | 8003992118 | 8003992178 | 261 |
| 471 | iso_pu_bacteria | 8005275841 | 8005281728 | 261 |
| 472 | iso_pu_bacteria | 8005282627 | 8005284316 | 261 |
| 473 | iso_pu_bacteria | 8005289223 | 8005289568 | 261 |
| 474 | iso_pu_bacteria | 8005307578 | 8005314152 | 261 |
| 475 | iso_pu_bacteria | 8005376324 | 8005382608 | 261 |
| 476 | iso_pu_bacteria | 8005382845 | 8005384570 | 261 |
| 477 | iso_pu_bacteria | 8005395548 | 8005395598 | 261 |
| 478 | iso_pu_bacteria | 8005430974 | 8005434446 | 261 |
| 479 | iso_pu_bacteria | 8005460587 | 8005464295 | 261 |
| 480 | iso_pu_bacteria | 8005497431 | 8005501398 | 261 |
| 481 | iso_pu_bacteria | 8005556819 | 8005561709 | 261 |
| 482 | iso_pu_bacteria | 8005563573 | 8005568488 | 261 |
| 483 | iso_pu_bacteria | 8005570704 | 8005572976 | 261 |
| 484 | iso_pu_bacteria | 8005619151 | 8005622761 | 261 |
| 485 | iso_pu_bacteria | 8005626139 | 8005630275 | 261 |
| 486 | iso_pu_bacteria | 8005668836 | 8005672818 | 261 |
| 487 | iso_pu_bacteria | 8005695170 | 8005696719 | 261 |
| 488 | iso_pu_bacteria | 8018163183 | 8018163270 | 261 |
| 489 | iso_pu_bacteria | 8023680758 | 8023682678 | 261 |
| 490 | iso_pu_bacteria | 8024479707 | 8024486035 | 261 |
| 491 | iso_pu_bacteria | 8024501048 | 8024501114 | 261 |
| 492 | iso_pu_bacteria | 8056375014 | 8056377093 | 261 |
| 493 | iso_pu_bacteria | 8056382006 | 8056387415 | 261 |
| 494 | iso_pu_bacteria | 8057874678 | 8057881848 | 261 |
| 495 | 3300044712 | Ga0453684_0009469 | Ga0453684_0009469_3814_4671 | 262 |
| 496 | 3300002704 | JGI25155J39150_1000098 | JGI25155J39150_100009844 | 263 |
| 497 | 3300002705 | JGI25156J39149_1000163 | JGI25156J39149_100016344 | 263 |
| 498 | 3300002738 | JGI25154J39366_1000183 | JGI25154J39366_100018344 | 263 |
| 499 | 3300002741 | JGI25157J39369_1000209 | JGI25157J39369_10002096 | 263 |
| 500 | 3300003187 | JGI25151J46595_10005186 | JGI25151J46595_100051866 | 263 |
| 501 | 3300003187 | JGI25151J46595_10007415 | JGI25151J46595_100074156 | 263 |
| 502 | 3300003187 | JGI25151J46595_10009835 | JGI25151J46595_100098352 | 263 |
| 503 | 3300003354 | JGI25160J50197_1000212 | JGI25160J50197_10002126 | 263 |
| 504 | 3300003374 | JGI25161J50226_1000151 | JGI25161J50226_10001516 | 263 |
| 505 | 3300003773 | Ga0055537_1000709 | Ga0055537_10007099 | 263 |
| 506 | 3300003775 | Ga0055524_1000082 | Ga0055524_1000082110 | 263 |
| 507 | 3300003775 | Ga0055524_1001237 | Ga0055524_10012379 | 263 |
| 508 | 3300003781 | Ga0055536_1001960 | Ga0055536_10019603 | 263 |
| 509 | 3300003784 | Ga0055534_1003222 | Ga0055534_10032226 | 263 |
| 510 | 3300003784 | Ga0055534_1005336 | Ga0055534_10053362 | 263 |
| 511 | 3300003784 | Ga0055534_1013334 | Ga0055534_10133342 | 263 |
| 512 | 3300003790 | Ga0055528_1002394 | Ga0055528_10023944 | 263 |
| 513 | 3300003791 | Ga0055530_10000688 | Ga0055530_1000068810 | 263 |
| 514 | 3300003791 | Ga0055530_10046368 | Ga0055530_100463681 | 263 |
| 515 | 3300003792 | Ga0055540_1000010 | Ga0055540_1000010246 | 263 |
| 516 | 3300003794 | Ga0055531_10019143 | Ga0055531_100191431 | 263 |
| 517 | 3300003856 | Ga0058692_1001275 | Ga0058692_10012757 | 263 |
| 518 | 3300004625 | Ga0055543_1000526 | Ga0055543_100052624 | 263 |
| 519 | 3300005262 | Ga0065165_1015536 | Ga0065165_10155362 | 263 |
| 520 | 3300005262 | Ga0065165_1032167 | Ga0065165_10321672 | 263 |
| 521 | 3300005262 | Ga0065165_1042739 | Ga0065165_10427391 | 263 |
| 522 | 3300025206 | Ga0209435_100010 | Ga0209435_100010387 | 263 |
| 523 | 3300025208 | Ga0209436_107364 | Ga0209436_1073641 | 263 |
| 524 | 3300025245 | Ga0207425_1001995 | Ga0207425_10019955 | 263 |
| 525 | 3300025246 | Ga0209646_1000001 | Ga0209646_10000011755 | 263 |
| 526 | 3300025250 | Ga0209026_1000001 | Ga0209026_1000001409 | 263 |
| 527 | 3300025256 | Ga0209759_1000001 | Ga0209759_10000011386 | 263 |
| 528 | 3300025258 | Ga0209129_1013977 | Ga0209129_10139771 | 263 |
| 529 | 3300025263 | Ga0209565_1000036 | Ga0209565_1000036112 | 263 |
| 530 | 3300025263 | Ga0209565_1000226 | Ga0209565_10002268 | 263 |
| 531 | 3300025273 | Ga0209673_1000282 | Ga0209673_100028222 | 263 |
| 532 | 3300025284 | Ga0209130_1000042 | Ga0209130_1000042125 | 263 |
| 533 | 3300025291 | Ga0209675_1000289 | Ga0209675_100028947 | 263 |
| 534 | 3300025291 | Ga0209675_1003625 | Ga0209675_10036252 | 263 |
| 535 | 3300025292 | Ga0209676_1000007 | Ga0209676_1000007272 | 263 |
| 536 | 3300025294 | Ga0209025_1002347 | Ga0209025_100234714 | 263 |
| 537 | 3300025294 | Ga0209025_1006388 | Ga0209025_10063883 | 263 |
| 538 | 3300025295 | Ga0209564_1024341 | Ga0209564_10243412 | 263 |
| 539 | 3300025295 | Ga0209564_1025207 | Ga0209564_10252072 | 263 |
| 540 | 3300025297 | Ga0209758_1004703 | Ga0209758_10047037 | 263 |
| 541 | 3300025298 | Ga0209050_1000003 | Ga0209050_10000031236 | 263 |
| 542 | 3300025298 | Ga0209050_1004120 | Ga0209050_10041204 | 263 |
| 543 | 3300025298 | Ga0209050_1013661 | Ga0209050_10136613 | 263 |
| 544 | 3300025299 | Ga0209256_1000001 | Ga0209256_10000011239 | 263 |
| 545 | 3300025302 | Ga0207426_1000097 | Ga0207426_1000097131 | 263 |
| 546 | 3300025302 | Ga0207426_1001878 | Ga0207426_100187810 | 263 |
| 547 | 3300025303 | Ga0209051_1000003 | Ga0209051_10000031236 | 263 |
| 548 | 3300025304 | Ga0209257_1000020 | Ga0209257_1000020272 | 263 |
| 549 | 3300025304 | Ga0209257_1005878 | Ga0209257_100587810 | 263 |
| 550 | 3300027312 | Ga0209371_1001191 | Ga0209371_10011916 | 263 |
| 551 | 3300030500 | Ga0268256_1005648 | Ga0268256_10056485 | 263 |
| 552 | 3300031456 | Ga0307513_10000011 | Ga0307513_10000011163 | 263 |
| 553 | 3300031548 | Ga0307408_100344065 | Ga0307408_1003440652 | 263 |
| 554 | 3300031731 | Ga0307405_10157461 | Ga0307405_101574612 | 263 |
| 555 | 3300031911 | Ga0307412_10436561 | Ga0307412_104365611 | 263 |
| 556 | 3300048919 | Ga0496116_0041823 | Ga0496116_0041823_728_1534 | 263 |
| 557 | 3300048921 | Ga0496118_0046582 | Ga0496118_0046582_17_823 | 263 |
| 558 | 3300053098 | Ga0500650_0025695 | Ga0500650_0025695_902_1774 | 263 |
| 559 | 3300053117 | Ga0500593_003321 | Ga0500593_003321_1990_2862 | 263 |
| 560 | 3300053730 | Ga0500645_010175 | Ga0500645_010175_868_1740 | 263 |
| 561 | 3300053730 | Ga0500645_041416 | Ga0500645_041416_74_955 | 263 |
| 562 | iso_pu_bacteria | 8024486573 | 8024488527 | 263 |
| 563 | 3300003322 | rootL2_10320304 | rootL2_103203042 | 264 |
| 564 | 3300003323 | rootH1_10117136 | rootH1_101171362 | 264 |
| 565 | 3300003323 | rootH1_10170367 | rootH1_101703673 | 264 |
| 566 | 3300003771 | Ga0055526_1017186 | Ga0055526_10171863 | 264 |
| 567 | 3300003775 | Ga0055524_1004997 | Ga0055524_10049972 | 264 |
| 568 | 3300003790 | Ga0055528_1001182 | Ga0055528_10011828 | 264 |
| 569 | 3300005564 | Ga0070664_100468505 | Ga0070664_1004685052 | 264 |
| 570 | 3300006038 | Ga0075365_10006669 | Ga0075365_100066694 | 264 |
| 571 | 3300006048 | Ga0075363_100026618 | Ga0075363_1000266183 | 264 |
| 572 | 3300006051 | Ga0075364_10007185 | Ga0075364_100071853 | 264 |
| 573 | 3300006051 | Ga0075364_10012908 | Ga0075364_100129082 | 264 |
| 574 | 3300006177 | Ga0075362_10001572 | Ga0075362_100015723 | 264 |
| 575 | 3300006178 | Ga0075367_10005561 | Ga0075367_100055611 | 264 |
| 576 | 3300006178 | Ga0075367_10021211 | Ga0075367_100212113 | 264 |
| 577 | 3300006186 | Ga0075369_10001899 | Ga0075369_100018993 | 264 |
| 578 | 3300006186 | Ga0075369_10027942 | Ga0075369_100279422 | 264 |
| 579 | 3300006195 | Ga0075366_10022758 | Ga0075366_100227583 | 264 |
| 580 | 3300006353 | Ga0075370_10020155 | Ga0075370_100201552 | 264 |
| 581 | 3300006946 | Ga0079104_1004704 | Ga0079104_10047043 | 264 |
| 582 | 3300006948 | Ga0099826_10002615 | Ga0099826_100026152 | 264 |
| 583 | 3300009148 | Ga0105243_10131709 | Ga0105243_101317092 | 264 |
| 584 | 3300009551 | Ga0105238_10659264 | Ga0105238_106592641 | 264 |
| 585 | 3300009766 | Ga0123342_1018063 | Ga0123342_10180633 | 264 |
| 586 | 3300010375 | Ga0105239_10316635 | Ga0105239_103166352 | 264 |
| 587 | 3300011119 | Ga0105246_10050655 | Ga0105246_100506553 | 264 |
| 588 | 3300013100 | Ga0157373_10049545 | Ga0157373_100495453 | 264 |
| 589 | 3300013100 | Ga0157373_10106668 | Ga0157373_101066682 | 264 |
| 590 | 3300013102 | Ga0157371_10000966 | Ga0157371_100009669 | 264 |
| 591 | 3300013102 | Ga0157371_10002118 | Ga0157371_100021183 | 264 |
| 592 | 3300013104 | Ga0157370_10000338 | Ga0157370_100003388 | 264 |
| 593 | 3300013105 | Ga0157369_10020309 | Ga0157369_100203093 | 264 |
| 594 | 3300013307 | Ga0157372_10239097 | Ga0157372_102390973 | 264 |
| 595 | 3300021320 | Ga0214544_1000105 | Ga0214544_100010541 | 264 |
| 596 | 3300021321 | Ga0214542_1000029 | Ga0214542_1000029128 | 264 |
| 597 | 3300021327 | Ga0214543_1000040 | Ga0214543_1000040128 | 264 |
| 598 | 3300022739 | Ga0228711_1000013 | Ga0228711_100001336 | 264 |
| 599 | 3300022740 | Ga0228710_1000008 | Ga0228710_100000893 | 264 |
| 600 | 3300025258 | Ga0209129_1000226 | Ga0209129_100022620 | 264 |
| 601 | 3300025273 | Ga0209673_1000239 | Ga0209673_100023982 | 264 |
| 602 | 3300025284 | Ga0209130_1008226 | Ga0209130_10082262 | 264 |
| 603 | 3300025284 | Ga0209130_1014063 | Ga0209130_10140633 | 264 |
| 604 | 3300025292 | Ga0209676_1018097 | Ga0209676_10180972 | 264 |
| 605 | 3300025294 | Ga0209025_1000288 | Ga0209025_1000288111 | 264 |
| 606 | 3300025294 | Ga0209025_1037708 | Ga0209025_10377081 | 264 |
| 607 | 3300025294 | Ga0209025_1051255 | Ga0209025_10512551 | 264 |
| 608 | 3300025294 | Ga0209025_1081354 | Ga0209025_10813542 | 264 |
| 609 | 3300025295 | Ga0209564_1007458 | Ga0209564_10074583 | 264 |
| 610 | 3300025299 | Ga0209256_1000619 | Ga0209256_100061932 | 264 |
| 611 | 3300025935 | Ga0207709_10086633 | Ga0207709_100866332 | 264 |
| 612 | 3300027111 | Ga0209281_1000134 | Ga0209281_1000134155 | 264 |
| 613 | 3300027312 | Ga0209371_1000022 | Ga0209371_1000022453 | 264 |
| 614 | 3300027312 | Ga0209371_1000370 | Ga0209371_100037023 | 264 |
| 615 | 3300027666 | Ga0209282_1000029 | Ga0209282_1000029123 | 264 |
| 616 | 3300027666 | Ga0209282_1001507 | Ga0209282_10015079 | 264 |
| 617 | 3300027866 | Ga0209813_10003505 | Ga0209813_100035052 | 264 |
| 618 | 3300028794 | Ga0307515_10209541 | Ga0307515_102095412 | 264 |
| 619 | 3300030500 | Ga0268256_1000019 | Ga0268256_100001967 | 264 |
| 620 | 3300030744 | Ga0316181_1086484 | Ga0316181_10864842 | 264 |
| 621 | 3300031967 | Ga0315914_1000021 | Ga0315914_100002122 | 264 |
| 622 | 3300031995 | Ga0307409_100381438 | Ga0307409_1003814382 | 264 |
| 623 | 3300032004 | Ga0307414_10073553 | Ga0307414_100735532 | 264 |
| 624 | 3300033430 | Ga0315913_1000014 | Ga0315913_100001488 | 264 |
| 625 | 3300033464 | Ga0315915_1000003 | Ga0315915_100000322 | 264 |
| 626 | 3300046460 | Ga0495638_0014856 | Ga0495638_0014856_2832_3644 | 264 |
| 627 | 3300046460 | Ga0495638_0025826 | Ga0495638_0025826_1684_2496 | 264 |
| 628 | 3300046506 | Ga0495583_0032155 | Ga0495583_0032155_132_953 | 264 |
| 629 | 3300046558 | Ga0495633_0032451 | Ga0495633_0032451_1486_2283 | 264 |
| 630 | 3300047470 | Ga0495681_0000688 | Ga0495681_0000688_2343_3140 | 264 |
| 631 | 3300047470 | Ga0495681_0136781 | Ga0495681_0136781_170_991 | 264 |
| 632 | 3300048907 | Ga0496104_0114639 | Ga0496104_0114639_1565_2362 | 264 |
| 633 | 3300048916 | Ga0496113_0061214 | Ga0496113_0061214_698_1495 | 264 |
| 634 | 3300048919 | Ga0496116_0000049 | Ga0496116_0000049_126057_126860 | 264 |
| 635 | 3300048920 | Ga0496117_0000002 | Ga0496117_0000002_96785_97582 | 264 |
| 636 | 3300048920 | Ga0496117_0097498 | Ga0496117_0097498_858_1655 | 264 |
| 637 | 3300048921 | Ga0496118_0003513 | Ga0496118_0003513_10739_11536 | 264 |
| 638 | 3300048921 | Ga0496118_0083291 | Ga0496118_0083291_61_939 | 264 |
| 639 | 3300048922 | Ga0496119_0011799 | Ga0496119_0011799_2906_3703 | 264 |
| 640 | 3300048922 | Ga0496119_0026727 | Ga0496119_0026727_1329_2126 | 264 |
| 641 | 3300048923 | Ga0496120_0000093 | Ga0496120_0000093_49636_50433 | 264 |
| 642 | 3300048923 | Ga0496120_0048286 | Ga0496120_0048286_133_930 | 264 |
| 643 | 3300048923 | Ga0496120_0077123 | Ga0496120_0077123_549_1346 | 264 |
| 644 | 3300048924 | Ga0496121_0000005 | Ga0496121_0000005_979666_980463 | 264 |
| 645 | 3300048925 | Ga0496122_0000004 | Ga0496122_0000004_548094_548891 | 264 |
| 646 | 3300048925 | Ga0496122_0016047 | Ga0496122_0016047_4572_5411 | 264 |
| 647 | 3300048925 | Ga0496122_0066691 | Ga0496122_0066691_239_1081 | 264 |
| 648 | 3300048926 | Ga0496123_0000007 | Ga0496123_0000007_548094_548891 | 264 |
| 649 | 3300048927 | Ga0496124_0000091 | Ga0496124_0000091_138182_138979 | 264 |
| 650 | 3300048927 | Ga0496124_0006058 | Ga0496124_0006058_7737_8534 | 264 |
| 651 | 3300048927 | Ga0496124_0118925 | Ga0496124_0118925_1135_1956 | 264 |
| 652 | 3300048927 | Ga0496124_0268973 | Ga0496124_0268973_394_1197 | 264 |
| 653 | 3300048928 | Ga0496125_0000159 | Ga0496125_0000159_103744_104586 | 264 |
| 654 | 3300048928 | Ga0496125_0030598 | Ga0496125_0030598_131_928 | 264 |
| 655 | 3300048928 | Ga0496125_0128119 | Ga0496125_0128119_636_1433 | 264 |
| 656 | 3300048929 | Ga0496126_0000081 | Ga0496126_0000081_117981_118784 | 264 |
| 657 | 3300048929 | Ga0496126_0012281 | Ga0496126_0012281_3331_4149 | 264 |
| 658 | 3300048929 | Ga0496126_0283502 | Ga0496126_0283502_411_1208 | 264 |
| 659 | 3300050489 | nmdc:mga03683_34324_c1 | nmdc:mga03683_34324_c1_805_1602 | 264 |
| 660 | 3300050491 | nmdc:mga00v17_19670_c1 | nmdc:mga00v17_19670_c1_575_1372 | 264 |
| 661 | 3300050492 | nmdc:mga0yw44_213678_c1 | nmdc:mga0yw44_213678_c1_344_1162 | 264 |
| 662 | 3300050492 | nmdc:mga0yw44_431_c1 | nmdc:mga0yw44_431_c1_9949_10746 | 264 |
| 663 | 3300050495 | nmdc:mga04h51_39557_c1 | nmdc:mga04h51_39557_c1_377_1186 | 264 |
| 664 | 3300050516 | nmdc:mga0sz30_26_c1 | nmdc:mga0sz30_26_c1_11443_12240 | 264 |
| 665 | 3300053111 | Ga0500572_001165 | Ga0500572_001165_1843_2673 | 264 |
| 666 | 3300053122 | Ga0500608_012503 | Ga0500608_012503_1945_2742 | 264 |
| 667 | 3300053136 | Ga0500559_0009290 | Ga0500559_0009290_1693_2505 | 264 |
| 668 | 3300053137 | Ga0500561_0005831 | Ga0500561_0005831_818_1615 | 264 |
| 669 | 3300053153 | Ga0500616_0000400 | Ga0500616_0000400_36116_36937 | 264 |
| 670 | 3300053156 | Ga0500622_0003374 | Ga0500622_0003374_8840_9637 | 264 |
| 671 | 3300053157 | Ga0500624_000600 | Ga0500624_000600_2476_3273 | 264 |
| 672 | 3300053177 | Ga0500636_0000001 | Ga0500636_0000001_31148_31945 | 264 |
| 673 | 3300053177 | Ga0500636_0021680 | Ga0500636_0021680_1374_2171 | 264 |
| 674 | 3300053730 | Ga0500645_001087 | Ga0500645_001087_1594_2466 | 264 |
| 675 | 3300053730 | Ga0500645_044187 | Ga0500645_044187_223_1044 | 264 |
| 676 | iso_pu_bacteria | 2510461069 | 2510838947 | 264 |
| 677 | iso_pu_bacteria | 8054460903 | 8054464715 | 264 |
| 678 | 3300002739 | JGI25158J39367_1000927 | JGI25158J39367_10009273 | 265 |
| 679 | 3300002773 | JGI25152J39213_1003227 | JGI25152J39213_10032273 | 265 |
| 680 | 3300002773 | JGI25152J39213_1010470 | JGI25152J39213_10104702 | 265 |
| 681 | 3300002987 | JGI25159J45721_1004685 | JGI25159J45721_10046852 | 265 |
| 682 | 3300003187 | JGI25151J46595_10002096 | JGI25151J46595_1000209611 | 265 |
| 683 | 3300003187 | JGI25151J46595_10026849 | JGI25151J46595_100268492 | 265 |
| 684 | 3300003215 | JGI25153J46596_10006886 | JGI25153J46596_100068862 | 265 |
| 685 | 3300003215 | JGI25153J46596_10007510 | JGI25153J46596_100075105 | 265 |
| 686 | 3300003215 | JGI25153J46596_10011704 | JGI25153J46596_100117042 | 265 |
| 687 | 3300003320 | rootH2_10045333 | rootH2_100453332 | 265 |
| 688 | 3300003354 | JGI25160J50197_1000917 | JGI25160J50197_100091710 | 265 |
| 689 | 3300003354 | JGI25160J50197_1009247 | JGI25160J50197_10092472 | 265 |
| 690 | 3300003374 | JGI25161J50226_1000238 | JGI25161J50226_10002383 | 265 |
| 691 | 3300003374 | JGI25161J50226_1000331 | JGI25161J50226_100033120 | 265 |
| 692 | 3300003374 | JGI25161J50226_1001587 | JGI25161J50226_10015877 | 265 |
| 693 | 3300003771 | Ga0055526_1002806 | Ga0055526_10028066 | 265 |
| 694 | 3300003771 | Ga0055526_1004625 | Ga0055526_10046253 | 265 |
| 695 | 3300003771 | Ga0055526_1012519 | Ga0055526_10125193 | 265 |
| 696 | 3300003775 | Ga0055524_1006292 | Ga0055524_10062923 | 265 |
| 697 | 3300003775 | Ga0055524_1021578 | Ga0055524_10215782 | 265 |
| 698 | 3300003790 | Ga0055528_1000525 | Ga0055528_10005253 | 265 |
| 699 | 3300003790 | Ga0055528_1003139 | Ga0055528_10031395 | 265 |
| 700 | 3300003790 | Ga0055528_1009964 | Ga0055528_10099643 | 265 |
| 701 | 3300003790 | Ga0055528_1019332 | Ga0055528_10193322 | 265 |
| 702 | 3300003790 | Ga0055528_1019744 | Ga0055528_10197442 | 265 |
| 703 | 3300003792 | Ga0055540_1001376 | Ga0055540_10013762 | 265 |
| 704 | 3300003792 | Ga0055540_1003377 | Ga0055540_10033771 | 265 |
| 705 | 3300004625 | Ga0055543_1000419 | Ga0055543_100041922 | 265 |
| 706 | 3300004625 | Ga0055543_1000646 | Ga0055543_10006463 | 265 |
| 707 | 3300005353 | Ga0070669_100286700 | Ga0070669_1002867002 | 265 |
| 708 | 3300006038 | Ga0075365_10004644 | Ga0075365_100046442 | 265 |
| 709 | 3300006177 | Ga0075362_10000300 | Ga0075362_1000030012 | 265 |
| 710 | 3300006178 | Ga0075367_10004384 | Ga0075367_100043842 | 265 |
| 711 | 3300006186 | Ga0075369_10001967 | Ga0075369_100019672 | 265 |
| 712 | 3300006186 | Ga0075369_10031219 | Ga0075369_100312192 | 265 |
| 713 | 3300006186 | Ga0075369_10055396 | Ga0075369_100553962 | 265 |
| 714 | 3300006195 | Ga0075366_10009357 | Ga0075366_100093573 | 265 |
| 715 | 3300006353 | Ga0075370_10045619 | Ga0075370_100456192 | 265 |
| 716 | 3300006353 | Ga0075370_10062684 | Ga0075370_100626841 | 265 |
| 717 | 3300006946 | Ga0079104_1005831 | Ga0079104_10058313 | 265 |
| 718 | 3300009765 | Ga0123341_1000011 | Ga0123341_100001184 | 265 |
| 719 | 3300009766 | Ga0123342_1008752 | Ga0123342_10087526 | 265 |
| 720 | 3300021327 | Ga0214543_1000027 | Ga0214543_100002752 | 265 |
| 721 | 3300025208 | Ga0209436_100110 | Ga0209436_10011032 | 265 |
| 722 | 3300025245 | Ga0207425_1001956 | Ga0207425_10019562 | 265 |
| 723 | 3300025245 | Ga0207425_1013334 | Ga0207425_10133342 | 265 |
| 724 | 3300025258 | Ga0209129_1001492 | Ga0209129_10014929 | 265 |
| 725 | 3300025258 | Ga0209129_1002108 | Ga0209129_10021085 | 265 |
| 726 | 3300025258 | Ga0209129_1005143 | Ga0209129_10051431 | 265 |
| 727 | 3300025258 | Ga0209129_1005786 | Ga0209129_10057864 | 265 |
| 728 | 3300025258 | Ga0209129_1010068 | Ga0209129_10100682 | 265 |
| 729 | 3300025273 | Ga0209673_1000478 | Ga0209673_100047837 | 265 |
| 730 | 3300025273 | Ga0209673_1001495 | Ga0209673_100149514 | 265 |
| 731 | 3300025273 | Ga0209673_1001737 | Ga0209673_100173716 | 265 |
| 732 | 3300025273 | Ga0209673_1002506 | Ga0209673_10025062 | 265 |
| 733 | 3300025273 | Ga0209673_1018821 | Ga0209673_10188212 | 265 |
| 734 | 3300025284 | Ga0209130_1000023 | Ga0209130_1000023217 | 265 |
| 735 | 3300025284 | Ga0209130_1017324 | Ga0209130_10173242 | 265 |
| 736 | 3300025294 | Ga0209025_1000411 | Ga0209025_100041160 | 265 |
| 737 | 3300025294 | Ga0209025_1013965 | Ga0209025_10139651 | 265 |
| 738 | 3300025295 | Ga0209564_1000259 | Ga0209564_10002592 | 265 |
| 739 | 3300025295 | Ga0209564_1000393 | Ga0209564_100039328 | 265 |
| 740 | 3300025295 | Ga0209564_1001326 | Ga0209564_10013268 | 265 |
| 741 | 3300025295 | Ga0209564_1026301 | Ga0209564_10263012 | 265 |
| 742 | 3300025297 | Ga0209758_1000390 | Ga0209758_100039050 | 265 |
| 743 | 3300025297 | Ga0209758_1001594 | Ga0209758_10015943 | 265 |
| 744 | 3300025297 | Ga0209758_1008994 | Ga0209758_10089942 | 265 |
| 745 | 3300025297 | Ga0209758_1078594 | Ga0209758_10785941 | 265 |
| 746 | 3300025298 | Ga0209050_1007028 | Ga0209050_10070284 | 265 |
| 747 | 3300025299 | Ga0209256_1000155 | Ga0209256_1000155117 | 265 |
| 748 | 3300025299 | Ga0209256_1001902 | Ga0209256_10019022 | 265 |
| 749 | 3300025299 | Ga0209256_1004144 | Ga0209256_10041444 | 265 |
| 750 | 3300025299 | Ga0209256_1007631 | Ga0209256_10076316 | 265 |
| 751 | 3300025302 | Ga0207426_1000087 | Ga0207426_1000087145 | 265 |
| 752 | 3300025302 | Ga0207426_1000386 | Ga0207426_100038650 | 265 |
| 753 | 3300025303 | Ga0209051_1000321 | Ga0209051_100032111 | 265 |
| 754 | 3300025303 | Ga0209051_1003739 | Ga0209051_10037398 | 265 |
| 755 | 3300025303 | Ga0209051_1004393 | Ga0209051_10043932 | 265 |
| 756 | 3300025303 | Ga0209051_1018086 | Ga0209051_10180862 | 265 |
| 757 | 3300025304 | Ga0209257_1010077 | Ga0209257_10100774 | 265 |
| 758 | 3300025923 | Ga0207681_10101055 | Ga0207681_101010551 | 265 |
| 759 | 3300027111 | Ga0209281_1000783 | Ga0209281_10007835 | 265 |
| 760 | 3300028379 | Ga0268266_10112087 | Ga0268266_101120872 | 265 |
| 761 | 3300028794 | Ga0307515_10007465 | Ga0307515_1000746519 | 265 |
| 762 | 3300031456 | Ga0307513_10015921 | Ga0307513_100159215 | 265 |
| 763 | 3300031548 | Ga0307408_100068413 | Ga0307408_1000684132 | 265 |
| 764 | 3300031911 | Ga0307412_10025014 | Ga0307412_100250142 | 265 |
| 765 | 3300031995 | Ga0307409_100331407 | Ga0307409_1003314072 | 265 |
| 766 | 3300041413 | Ga0439465_0007062 | Ga0439465_0007062_255_1079 | 265 |
| 767 | 3300041413 | Ga0439465_0018167 | Ga0439465_0018167_1250_2125 | 265 |
| 768 | 3300041441 | Ga0451787_279068 | Ga0451787_279068_1935_2774 | 265 |
| 769 | 3300041458 | Ga0451798_0814015 | Ga0451798_0814015_128_967 | 265 |
| 770 | 3300041491 | Ga0451833_0644275 | Ga0451833_0644275_1547_2386 | 265 |
| 771 | 3300041497 | Ga0451840_11731 | Ga0451840_11731_332_1144 | 265 |
| 772 | 3300041498 | Ga0451841_0397021 | Ga0451841_0397021_322_1134 | 265 |
| 773 | 3300041498 | Ga0451841_1005621 | Ga0451841_1005621_15_827 | 265 |
| 774 | 3300041501 | Ga0451845_0927883 | Ga0451845_0927883_292_1131 | 265 |
| 775 | 3300041501 | Ga0451845_0929104 | Ga0451845_0929104_166_978 | 265 |
| 776 | 3300041502 | Ga0451846_05577 | Ga0451846_05577_902_1741 | 265 |
| 777 | 3300041503 | Ga0451847_0008387 | Ga0451847_0008387_2987_3799 | 265 |
| 778 | 3300041503 | Ga0451847_0691945 | Ga0451847_0691945_224_1036 | 265 |
| 779 | 3300041507 | Ga0451851_0548143 | Ga0451851_0548143_845_1684 | 265 |
| 780 | 3300041511 | Ga0451855_0189021 | Ga0451855_0189021_33_872 | 265 |
| 781 | 3300041512 | Ga0451853_1500900 | Ga0451853_1500900_2708_3547 | 265 |
| 782 | 3300041907 | Ga0452268_38528 | Ga0452268_38528_523_1335 | 265 |
| 783 | 3300042006 | Ga0439432_013219 | Ga0439432_013219_862_1686 | 265 |
| 784 | 3300042007 | Ga0439449_0022025 | Ga0439449_0022025_1066_1881 | 265 |
| 785 | 3300042007 | Ga0439449_0086854 | Ga0439449_0086854_152_976 | 265 |
| 786 | 3300046452 | Ga0495617_054991 | Ga0495617_054991_143_955 | 265 |
| 787 | 3300046460 | Ga0495638_0000300 | Ga0495638_0000300_60398_61222 | 265 |
| 788 | 3300046474 | Ga0495605_0000998 | Ga0495605_0000998_6920_7744 | 265 |
| 789 | 3300046474 | Ga0495605_0036369 | Ga0495605_0036369_711_1550 | 265 |
| 790 | 3300046492 | Ga0495585_0037288 | Ga0495585_0037288_1783_2607 | 265 |
| 791 | 3300046501 | Ga0495607_0073056 | Ga0495607_0073056_32_871 | 265 |
| 792 | 3300046506 | Ga0495583_0044005 | Ga0495583_0044005_871_1695 | 265 |
| 793 | 3300046507 | Ga0495606_0048548 | Ga0495606_0048548_1399_2238 | 265 |
| 794 | 3300046512 | Ga0495610_0022471 | Ga0495610_0022471_497_1336 | 265 |
| 795 | 3300046513 | Ga0495616_0036507 | Ga0495616_0036507_237_1061 | 265 |
| 796 | 3300046513 | Ga0495616_0080039 | Ga0495616_0080039_26_838 | 265 |
| 797 | 3300046515 | Ga0495620_0006745 | Ga0495620_0006745_1413_2252 | 265 |
| 798 | 3300046515 | Ga0495620_0022657 | Ga0495620_0022657_899_1723 | 265 |
| 799 | 3300046518 | Ga0495631_0002311 | Ga0495631_0002311_1506_2330 | 265 |
| 800 | 3300046519 | Ga0495632_0008599 | Ga0495632_0008599_4166_4990 | 265 |
| 801 | 3300046519 | Ga0495632_0029795 | Ga0495632_0029795_1631_2470 | 265 |
| 802 | 3300046522 | Ga0495643_0018843 | Ga0495643_0018843_2817_3743 | 265 |
| 803 | 3300046522 | Ga0495643_0022292 | Ga0495643_0022292_1221_2033 | 265 |
| 804 | 3300046523 | Ga0495644_0047387 | Ga0495644_0047387_505_1344 | 265 |
| 805 | 3300046538 | Ga0495609_0014796 | Ga0495609_0014796_1239_2063 | 265 |
| 806 | 3300046538 | Ga0495609_0060177 | Ga0495609_0060177_504_1343 | 265 |
| 807 | 3300046542 | Ga0495597_0025376 | Ga0495597_0025376_1025_1864 | 265 |
| 808 | 3300046615 | Ga0495656_0053175 | Ga0495656_0053175_83_922 | 265 |
| 809 | 3300046616 | Ga0495668_0004998 | Ga0495668_0004998_7796_8620 | 265 |
| 810 | 3300046616 | Ga0495668_0028712 | Ga0495668_0028712_2150_2989 | 265 |
| 811 | 3300046648 | Ga0495611_0011812 | Ga0495611_0011812_1482_2306 | 265 |
| 812 | 3300046660 | Ga0495625_0008370 | Ga0495625_0008370_2477_3301 | 265 |
| 813 | 3300046660 | Ga0495625_0021355 | Ga0495625_0021355_288_1127 | 265 |
| 814 | 3300046660 | Ga0495625_0023158 | Ga0495625_0023158_3832_4671 | 265 |
| 815 | 3300046692 | Ga0495671_0041582 | Ga0495671_0041582_1443_2282 | 265 |
| 816 | 3300046694 | Ga0495649_0010942 | Ga0495649_0010942_2107_3033 | 265 |
| 817 | 3300046694 | Ga0495649_0030253 | Ga0495649_0030253_1738_2589 | 265 |
| 818 | 3300046810 | Ga0495660_0015968 | Ga0495660_0015968_359_1198 | 265 |
| 819 | 3300047318 | Ga0495636_0006453 | Ga0495636_0006453_740_1579 | 265 |
| 820 | 3300047320 | Ga0495672_0011865 | Ga0495672_0011865_1811_2635 | 265 |
| 821 | 3300047323 | Ga0495683_0069995 | Ga0495683_0069995_728_1567 | 265 |
| 822 | 3300047443 | Ga0495687_116962 | Ga0495687_116962_75_899 | 265 |
| 823 | 3300047472 | Ga0495686_0002120 | Ga0495686_0002120_11509_12348 | 265 |
| 824 | 3300047472 | Ga0495686_0064325 | Ga0495686_0064325_801_1652 | 265 |
| 825 | 3300048090 | Ga0495615_0008384 | Ga0495615_0008384_810_1649 | 265 |
| 826 | 3300048091 | Ga0495626_0057492 | Ga0495626_0057492_233_1159 | 265 |
| 827 | 3300048909 | Ga0496106_0000028 | Ga0496106_0000028_138300_139166 | 265 |
| 828 | 3300048919 | Ga0496116_0101314 | Ga0496116_0101314_604_1419 | 265 |
| 829 | 3300048920 | Ga0496117_0036587 | Ga0496117_0036587_326_1138 | 265 |
| 830 | 3300048921 | Ga0496118_0011225 | Ga0496118_0011225_2648_3460 | 265 |
| 831 | 3300048921 | Ga0496118_0015019 | Ga0496118_0015019_4664_5479 | 265 |
| 832 | 3300048924 | Ga0496121_0033662 | Ga0496121_0033662_1427_2239 | 265 |
| 833 | 3300048924 | Ga0496121_0186523 | Ga0496121_0186523_352_1170 | 265 |
| 834 | 3300048924 | Ga0496121_0196021 | Ga0496121_0196021_538_1377 | 265 |
| 835 | 3300048925 | Ga0496122_0030501 | Ga0496122_0030501_219_1085 | 265 |
| 836 | 3300048926 | Ga0496123_0031684 | Ga0496123_0031684_327_1139 | 265 |
| 837 | 3300048927 | Ga0496124_0049468 | Ga0496124_0049468_2518_3330 | 265 |
| 838 | 3300048927 | Ga0496124_0371616 | Ga0496124_0371616_168_980 | 265 |
| 839 | 3300048928 | Ga0496125_0004359 | Ga0496125_0004359_11770_12636 | 265 |
| 840 | 3300049460 | Ga0495682_0080327 | Ga0495682_0080327_31_855 | 265 |
| 841 | 3300049569 | Ga0501032_0146820 | Ga0501032_0146820_80_922 | 265 |
| 842 | 3300049570 | Ga0501033_0051370 | Ga0501033_0051370_1074_1916 | 265 |
| 843 | 3300049571 | Ga0501034_0161912 | Ga0501034_0161912_1301_2140 | 265 |
| 844 | 3300049572 | Ga0501036_0015259 | Ga0501036_0015259_2951_3793 | 265 |
| 845 | 3300049573 | Ga0501037_0085812 | Ga0501037_0085812_530_1372 | 265 |
| 846 | 3300049574 | Ga0501038_0185118 | Ga0501038_0185118_251_1093 | 265 |
| 847 | 3300049579 | Ga0501043_0044713 | Ga0501043_0044713_1892_2731 | 265 |
| 848 | 3300049579 | Ga0501043_0129810 | Ga0501043_0129810_442_1284 | 265 |
| 849 | 3300049581 | Ga0501047_0059512 | Ga0501047_0059512_2117_2959 | 265 |
| 850 | 3300049581 | Ga0501047_0061221 | Ga0501047_0061221_1214_2053 | 265 |
| 851 | 3300049742 | Ga0501080_0047331 | Ga0501080_0047331_1798_2640 | 265 |
| 852 | 3300049744 | Ga0501083_0040392 | Ga0501083_0040392_1362_2204 | 265 |
| 853 | 3300049744 | Ga0501083_0086468 | Ga0501083_0086468_735_1574 | 265 |
| 854 | 3300049823 | Ga0501044_0031639 | Ga0501044_0031639_811_1653 | 265 |
| 855 | 3300050489 | nmdc:mga03683_51438_c1 | nmdc:mga03683_51438_c1_765_1577 | 265 |
| 856 | 3300050490 | nmdc:mga03n38_68598_c1 | nmdc:mga03n38_68598_c1_35_850 | 265 |
| 857 | 3300050490 | nmdc:mga03n38_84311_c1 | nmdc:mga03n38_84311_c1_363_1175 | 265 |
| 858 | 3300050492 | nmdc:mga0yw44_3224_c1 | nmdc:mga0yw44_3224_c1_5311_6123 | 265 |
| 859 | 3300050493 | nmdc:mga0k408_3813_c1 | nmdc:mga0k408_3813_c1_6400_7212 | 265 |
| 860 | 3300050494 | nmdc:mga06z11_102447_c1 | nmdc:mga06z11_102447_c1_448_1260 | 265 |
| 861 | 3300050496 | nmdc:mga07m45_38680_c1 | nmdc:mga07m45_38680_c1_699_1511 | 265 |
| 862 | 3300050516 | nmdc:mga0sz30_25294_c1 | nmdc:mga0sz30_25294_c1_529_1341 | 265 |
| 863 | 3300050516 | nmdc:mga0sz30_2699_c1 | nmdc:mga0sz30_2699_c1_1511_2323 | 265 |
| 864 | 3300053083 | Ga0495655_0003456 | Ga0495655_0003456_894_1733 | 265 |
| 865 | 3300053086 | Ga0500578_0063248 | Ga0500578_0063248_1025_1864 | 265 |
| 866 | 3300053105 | Ga0500557_000894 | Ga0500557_000894_64_888 | 265 |
| 867 | 3300053108 | Ga0500562_031322 | Ga0500562_031322_405_1229 | 265 |
| 868 | 3300053109 | Ga0500569_000971 | Ga0500569_000971_2900_3739 | 265 |
| 869 | 3300053109 | Ga0500569_011125 | Ga0500569_011125_972_1796 | 265 |
| 870 | 3300053118 | Ga0500594_0001842 | Ga0500594_0001842_277_1098 | 265 |
| 871 | 3300053118 | Ga0500594_0010520 | Ga0500594_0010520_751_1590 | 265 |
| 872 | 3300053129 | Ga0500628_006682 | Ga0500628_006682_708_1547 | 265 |
| 873 | 3300053134 | Ga0500658_0001192 | Ga0500658_0001192_1909_2748 | 265 |
| 874 | 3300053134 | Ga0500658_0037330 | Ga0500658_0037330_308_1174 | 265 |
| 875 | 3300053139 | Ga0500568_0001664 | Ga0500568_0001664_9807_10673 | 265 |
| 876 | 3300053139 | Ga0500568_0002341 | Ga0500568_0002341_7983_8807 | 265 |
| 877 | 3300053142 | Ga0500577_0010406 | Ga0500577_0010406_662_1486 | 265 |
| 878 | 3300053151 | Ga0500604_0011839 | Ga0500604_0011839_625_1491 | 265 |
| 879 | 3300053153 | Ga0500616_0001502 | Ga0500616_0001502_12706_13530 | 265 |
| 880 | 3300053153 | Ga0500616_0040719 | Ga0500616_0040719_535_1374 | 265 |
| 881 | 3300053156 | Ga0500622_0000593 | Ga0500622_0000593_3303_4154 | 265 |
| 882 | 3300053156 | Ga0500622_0138141 | Ga0500622_0138141_52_864 | 265 |
| 883 | 3300053158 | Ga0500627_0043016 | Ga0500627_0043016_588_1427 | 265 |
| 884 | 3300053160 | Ga0500633_0000975 | Ga0500633_0000975_918_1784 | 265 |
| 885 | 3300053727 | Ga0500611_029383 | Ga0500611_029383_268_1092 | 265 |
| 886 | 3300060353 | Ga0501082_0149894 | Ga0501082_0149894_914_1753 | 265 |
| 887 | iso_pu_bacteria | 2791355261 | 2793330156 | 265 |
| 888 | iso_pu_bacteria | 2838074704 | 2838075082 | 265 |
| 889 | iso_pu_bacteria | 2896384573 | 2896384792 | 265 |
| 890 | iso_pu_bacteria | 2920760137 | 2920763660 | 265 |
| 891 | iso_pu_bacteria | 639633055 | 639649651 | 265 |
| 892 | 3300005331 | Ga0070670_100000560 | Ga0070670_10000056010 | 266 |
| 893 | 3300025925 | Ga0207650_10007237 | Ga0207650_100072375 | 266 |
| 894 | 3300046507 | Ga0495606_0001142 | Ga0495606_0001142_1719_2531 | 266 |
| 895 | 3300047472 | Ga0495686_0000422 | Ga0495686_0000422_39157_39969 | 266 |
| 896 | 3300047472 | Ga0495686_0027768 | Ga0495686_0027768_813_1625 | 266 |
| 897 | 3300047472 | Ga0495686_0143729 | Ga0495686_0143729_214_1023 | 266 |
| 898 | iso_pu_bacteria | 2510917022 | 2511137331 | 266 |
| 899 | iso_pu_bacteria | 2524023209 | 2524459103 | 266 |
| 900 | iso_pu_bacteria | 2582581307 | 2585274070 | 266 |
| 901 | iso_pu_bacteria | 2582581308 | 2585279528 | 266 |
| 902 | iso_pu_bacteria | 2582581315 | 2585322812 | 266 |
| 903 | iso_pu_bacteria | 2582581316 | 2585330982 | 266 |
| 904 | iso_pu_bacteria | 2585427527 | 2585530988 | 266 |
| 905 | iso_pu_bacteria | 2585427530 | 2585553091 | 266 |
| 906 | iso_pu_bacteria | 2585427531 | 2585560520 | 266 |
| 907 | iso_pu_bacteria | 2585427608 | 2585898713 | 266 |
| 908 | iso_pu_bacteria | 2585427609 | 2585903698 | 266 |
| 909 | iso_pu_bacteria | 2585428125 | 2587981183 | 266 |
| 910 | iso_pu_bacteria | 2615840626 | 2616307102 | 266 |
| 911 | iso_pu_bacteria | 2615840698 | 2616554706 | 266 |
| 912 | iso_pu_bacteria | 2617270742 | 2617383058 | 266 |
| 913 | iso_pu_bacteria | 2667528174 | 2671111942 | 266 |
| 914 | iso_pu_bacteria | 2775507266 | 2778175777 | 266 |
| 915 | iso_pu_bacteria | 2818991448 | 2819609834 | 266 |
| 916 | iso_pu_bacteria | 2818991453 | 2819639939 | 266 |
| 917 | iso_pu_bacteria | 2838029111 | 2838034058 | 266 |
| 918 | iso_pu_bacteria | 2842298080 | 2842298456 | 266 |
| 919 | iso_pu_bacteria | 2842357229 | 2842360468 | 266 |
| 920 | iso_pu_bacteria | 2842475841 | 2842480774 | 266 |
| 921 | iso_pu_bacteria | 2842482326 | 2842483623 | 266 |
| 922 | iso_pu_bacteria | 2842502639 | 2842507415 | 266 |
| 923 | iso_pu_bacteria | 2842509118 | 2842510485 | 266 |
| 924 | iso_pu_bacteria | 2852387548 | 2852390909 | 266 |
| 925 | iso_pu_bacteria | 2919408235 | 2919410445 | 266 |
| 926 | iso_pu_bacteria | 8005484373 | 8005488730 | 266 |
| 927 | iso_pu_bacteria | 8005645114 | 8005645888 | 266 |
| 928 | iso_pu_bacteria | 8005682033 | 8005682433 | 266 |
| 929 | iso_pu_bacteria | 8046767195 | 8046772544 | 266 |
| 930 | iso_pu_bacteria | 8057575449 | 8057576998 | 266 |
| 931 | 3300031456 | Ga0307513_10129858 | Ga0307513_101298582 | 267 |
| 932 | 3300046459 | Ga0495629_0019024 | Ga0495629_0019024_4032_4859 | 267 |
| 933 | 3300046462 | Ga0495651_0066767 | Ga0495651_0066767_1454_2281 | 267 |
| 934 | 3300046476 | Ga0495662_0017093 | Ga0495662_0017093_2569_3396 | 267 |
| 935 | 3300046477 | Ga0495664_0058057 | Ga0495664_0058057_755_1582 | 267 |
| 936 | 3300046511 | Ga0495608_0116000 | Ga0495608_0116000_159_986 | 267 |
| 937 | 3300046529 | Ga0495652_0140687 | Ga0495652_0140687_118_945 | 267 |
| 938 | 3300046663 | Ga0495635_0048244 | Ga0495635_0048244_1368_2195 | 267 |
| 939 | 3300046674 | Ga0495588_0019961 | Ga0495588_0019961_295_1122 | 267 |
| 940 | 3300046675 | Ga0495657_0051262 | Ga0495657_0051262_274_1101 | 267 |
| 941 | 3300046689 | Ga0495613_0131417 | Ga0495613_0131417_38_865 | 267 |
| 942 | 3300046690 | Ga0495624_0228488 | Ga0495624_0228488_138_965 | 267 |
| 943 | 3300046809 | Ga0495600_0034660 | Ga0495600_0034660_897_1724 | 267 |
| 944 | 3300047317 | Ga0495604_0003714 | Ga0495604_0003714_9076_9903 | 267 |
| 945 | 3300048088 | Ga0495602_0359792 | Ga0495602_0359792_11_838 | 267 |
| 946 | 3300048903 | Ga0496100_0358463 | Ga0496100_0358463_165_977 | 267 |
| 947 | 3300053148 | Ga0500590_005672 | Ga0500590_005672_1012_1839 | 267 |
| 948 | 3300001979 | JGI24740J21852_10000564 | JGI24740J21852_100005644 | 270 |
| 949 | 3300002704 | JGI25155J39150_1000065 | JGI25155J39150_100006559 | 270 |
| 950 | 3300002705 | JGI25156J39149_1000144 | JGI25156J39149_100014447 | 270 |
| 951 | 3300002738 | JGI25154J39366_1000035 | JGI25154J39366_1000035153 | 270 |
| 952 | 3300002741 | JGI25157J39369_1001004 | JGI25157J39369_10010046 | 270 |
| 953 | 3300003316 | rootH1_10074966 | rootH1_100749662 | 270 |
| 954 | 3300003320 | rootH2_10008438 | rootH2_100084383 | 270 |
| 955 | 3300003322 | rootL2_10016820 | rootL2_100168203 | 270 |
| 956 | 3300003323 | rootH1_10063714 | rootH1_100637141 | 270 |
| 957 | 3300006353 | Ga0075370_10027128 | Ga0075370_100271283 | 270 |
| 958 | 3300013100 | Ga0157373_10081630 | Ga0157373_100816303 | 270 |
| 959 | 3300025206 | Ga0209435_100005 | Ga0209435_100005389 | 270 |
| 960 | 3300025228 | Ga0209672_103287 | Ga0209672_1032872 | 270 |
| 961 | 3300025233 | Ga0209437_100058 | Ga0209437_100058189 | 270 |
| 962 | 3300025233 | Ga0209437_100060 | Ga0209437_10006074 | 270 |
| 963 | 3300025246 | Ga0209646_1000011 | Ga0209646_1000011389 | 270 |
| 964 | 3300025250 | Ga0209026_1000008 | Ga0209026_1000008389 | 270 |
| 965 | 3300025254 | Ga0209148_1004917 | Ga0209148_10049174 | 270 |
| 966 | 3300025256 | Ga0209759_1000004 | Ga0209759_1000004389 | 270 |
| 967 | 3300025272 | Ga0209455_1012080 | Ga0209455_10120802 | 270 |
| 968 | 3300030500 | Ga0268256_1002822 | Ga0268256_10028228 | 270 |
| 969 | iso_pu_bacteria | 3005416602 | 3005418722 | 270 |
| 970 | iso_pu_bacteria | 8005314921 | 8005318386 | 270 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3aim-assembly1.cif.gz_A | r267e mutant of a hsl-like carboxylesterase from sulfolobus tokodaii | 0.8674 | 4 | 268 |
| 3aik-assembly1.cif.gz_A | crystal structure of a hsl-like carboxylesterase from sulfolobus tokodaii | 0.8458 | 4 | 268 |
| 4ob7-assembly1.cif.gz_A-2 | crystal structure of esterase rppe mutant w187h | 0.8444 | 2 | 270 |
| 4ob8-assembly1.cif.gz_A-2 | crystal structure of a novel thermostable esterase from pseudomonas putida ecu1011 | 0.8444 | 2 | 270 |
| 4ou5-assembly1.cif.gz_A | crystal structure of esterase rppe mutant s159a/w187h | 0.8433 | 2 | 270 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3aikA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8458 | 4 | 268 | 3.40.50.1820 |
| 4ob8A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8444 | 2 | 270 | 3.40.50.1820 |
| 4ob8A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8386 | 2 | 270 | 3.40.50.1820 |
| 5jd4D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8371 | 1 | 266 | 3.40.50.1820 |
| 3wj2A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8332 | 1 | 268 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-F7U5Z8-F1-model_v4 | deleted | 0.9518 | 35 | 270 |
|
| AF-F7U5Z8-F1-model_v4 | deleted | 0.9438 | 35 | 270 |
|
| AF-A0A4Q3YDS7-F1-model_v4 | Alpha/beta hydrolase | 0.9334 | 180 | 269 |
GO:0016787
|
| AF-A0A7G6RUS5-F1-model_v4 | deleted | 0.9311 | 51 | 270 |
|
| AF-A0A1M3ANF6-F1-model_v4 | deleted | 0.9262 | 1 | 269 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar