F487104
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 970 | 508 | 1940 | 325 |
Family's Representative Sequence
| Representative Sequence | 3300049823|Ga0501044_0322262|Ga0501044_0322262_364_1455 |
| Length | 363 |
| Sequence | MRAARAITAVDSHTEGMPTRVVTGGVAPIPGATMAQRRRYAMAHLDELRRFLVDEPRGHGAMSGAILQPPTRDDADWGVLYIEVSGFLPMCGHGTIGVATVLVETGMVPVTEPETVVRLDTPAGLVTARVAVADGAVQQVTLRNVDAFCLERDAVVDVPGLGEVRYDLSYGGNFYAILPIERIGLPFDRGRKGEILAAGLSIMDSINAQRRPAHPTDPDVAGCKHVQFLAPGSDARHSRNAMAIHPGWFDRSPCGTGTCARMAQLHARGELALDTDFVNESFIGTRFTGRLLAETEVGGLPAVVPEFSGRAWITGTATYLLDPTDPFPHGFVLCAPPGAERGRPRAARAEPATLRRRDERLWA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 2 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 65 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 106 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 109 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 162 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 166 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 167 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 168 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 169 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 170 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 171 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 172 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 173 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 174 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 175 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 176 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 177 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 178 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 179 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 180 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 181 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 182 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 183 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 184 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 185 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 186 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 187 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 190 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 192 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 194 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 196 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 197 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 198 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 199 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 200 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 201 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 202 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 203 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 204 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 205 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 206 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 207 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 209 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 210 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 211 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 212 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 213 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 214 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 215 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 216 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 217 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 218 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 219 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 220 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 221 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 222 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 223 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 224 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 225 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 226 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 227 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 228 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 229 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 230 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 231 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 232 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 233 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 234 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 235 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 236 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 237 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 304 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 305 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 306 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 307 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 310 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 311 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 312 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 313 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 314 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 315 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 316 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 317 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 318 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 319 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 350 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 351 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 352 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 362 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 363 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 364 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 365 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 366 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 367 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 368 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 369 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 372 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 373 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 374 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 375 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 376 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 377 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 378 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 379 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 380 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 381 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 382 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 383 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 384 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 385 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 386 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 387 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 388 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 389 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 390 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 391 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 392 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 393 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 394 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 395 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 396 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 397 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 398 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 399 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 400 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 401 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 402 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 403 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 404 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 405 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 406 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 407 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 408 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 409 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 410 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 411 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 412 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 413 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 414 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 415 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 416 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 417 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 418 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 419 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 420 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 421 | 2852677369 | Pseudoclavibacter sp. JAI123 | Isolate | Rhizosphere |
| 422 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 423 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 424 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 425 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 426 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 427 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 428 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 429 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 430 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 431 | 2862993130 | Planctomonas deserti 13S1-3 v2 | Isolate | Rhizosphere |
| 432 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 433 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 434 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 435 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 436 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 437 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 438 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 439 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 440 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 441 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 442 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 443 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 444 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 445 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 446 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 447 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 448 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 449 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 450 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 451 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 452 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
| 453 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 454 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 455 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 456 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 457 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 458 | 2946024296 | Arthrobacter woluwensis W4I2 | Isolate | Rhizosphere |
| 459 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 460 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 461 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 462 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 463 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 464 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 465 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 466 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 467 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 468 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 469 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 470 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 471 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 472 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 473 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 474 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 475 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 476 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 477 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 478 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 479 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 480 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 481 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 482 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 483 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 484 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 485 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 486 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 487 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 488 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 489 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 490 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 491 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 492 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 493 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 494 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 495 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 496 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 497 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 498 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 499 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 500 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 501 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 502 | 8056054917 | Glycomyces luteolus NEAU-A15 | Isolate | Rhizosphere |
| 503 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 504 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
| 505 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
| 506 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 507 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
| 508 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.77 |
| Metatranscriptomes | 0 |
| Isolates | 14.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.1 |
| Bulb | 0 |
| Endosphere | 1.86 |
| Nodule | 0.41 |
| Rhizoplane | 4.12 |
| Rhizosphere | 81.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501044_0322262 | 3300049823 | Bacteria | 1469 |
| 2 | JGI25152J39213_1000445 | 3300002773 | Bacteria | 24511 |
| 3 | JGI25406J46586_10009421 | 3300003203 | Bacteria | 4373 |
| 4 | Ga0070658_10014870 | 3300005327 | Bacteria | 6236 |
| 5 | Ga0070658_10089827 | 3300005327 | Bacteria | 2530 |
| 6 | Ga0070658_10131060 | 3300005327 | Bacteria | 2090 |
| 7 | Ga0070676_10075008 | 3300005328 | Bacteria | 2038 |
| 8 | Ga0070683_100002200 | 3300005329 | Bacteria | 15436 |
| 9 | Ga0070683_100205562 | 3300005329 | Bacteria | 1870 |
| 10 | Ga0070690_100058806 | 3300005330 | Bacteria | 2470 |
| 11 | Ga0070670_100128749 | 3300005331 | Bacteria | 2185 |
| 12 | Ga0068869_100212969 | 3300005334 | Bacteria | 1528 |
| 13 | Ga0070680_100000156 | 3300005336 | Bacteria | 42598 |
| 14 | Ga0070682_100203931 | 3300005337 | Bacteria | 1397 |
| 15 | Ga0068868_100033216 | 3300005338 | Bacteria | 3975 |
| 16 | Ga0068868_100049968 | 3300005338 | Bacteria | 3283 |
| 17 | Ga0068868_100065164 | 3300005338 | Bacteria | 2893 |
| 18 | Ga0070660_100019637 | 3300005339 | Bacteria | 4955 |
| 19 | Ga0070687_100002948 | 3300005343 | Bacteria | 6529 |
| 20 | Ga0070661_100005318 | 3300005344 | Bacteria | 8877 |
| 21 | Ga0070668_100002459 | 3300005347 | Bacteria | 13633 |
| 22 | Ga0070668_100004175 | 3300005347 | Bacteria | 10707 |
| 23 | Ga0070668_100013671 | 3300005347 | Bacteria | 6060 |
| 24 | Ga0070668_100036839 | 3300005347 | Bacteria | 3733 |
| 25 | Ga0070675_100002879 | 3300005354 | Bacteria | 12967 |
| 26 | Ga0070675_100131771 | 3300005354 | Bacteria | 2131 |
| 27 | Ga0070659_100006993 | 3300005366 | Bacteria | 8167 |
| 28 | Ga0070659_100011938 | 3300005366 | Bacteria | 6431 |
| 29 | Ga0070709_10023711 | 3300005434 | Bacteria | 3607 |
| 30 | Ga0070714_100001183 | 3300005435 | Bacteria | 18799 |
| 31 | Ga0070714_100011882 | 3300005435 | Bacteria | 6922 |
| 32 | Ga0070714_100023790 | 3300005435 | Bacteria | 5038 |
| 33 | Ga0070713_100127251 | 3300005436 | Bacteria | 2242 |
| 34 | Ga0070710_10000059 | 3300005437 | Bacteria | 50510 |
| 35 | Ga0070701_10035737 | 3300005438 | Bacteria | 2499 |
| 36 | Ga0070711_100005825 | 3300005439 | Bacteria | 7398 |
| 37 | Ga0070700_100000010 | 3300005441 | Bacteria | 176885 |
| 38 | Ga0070700_100117232 | 3300005441 | Bacteria | 1779 |
| 39 | Ga0070708_100070123 | 3300005445 | Bacteria | 3153 |
| 40 | Ga0070663_100002831 | 3300005455 | Bacteria | 9850 |
| 41 | Ga0070663_100028631 | 3300005455 | Bacteria | 3795 |
| 42 | Ga0070663_100086824 | 3300005455 | Bacteria | 2311 |
| 43 | Ga0070678_100017990 | 3300005456 | Bacteria | 4568 |
| 44 | Ga0070662_100091599 | 3300005457 | Bacteria | 2284 |
| 45 | Ga0070681_10000051 | 3300005458 | Bacteria | 82091 |
| 46 | Ga0070706_100230711 | 3300005467 | Bacteria | 1728 |
| 47 | Ga0070698_100145680 | 3300005471 | Bacteria | 2318 |
| 48 | Ga0070679_100000058 | 3300005530 | Bacteria | 82178 |
| 49 | Ga0070684_100026442 | 3300005535 | Bacteria | 4889 |
| 50 | Ga0068853_100034571 | 3300005539 | Bacteria | 4291 |
| 51 | Ga0068853_100041007 | 3300005539 | Bacteria | 3952 |
| 52 | Ga0070672_100214960 | 3300005543 | Bacteria | 1611 |
| 53 | Ga0070672_100215547 | 3300005543 | Bacteria | 1609 |
| 54 | Ga0070672_100250678 | 3300005543 | Bacteria | 1491 |
| 55 | Ga0070686_100062796 | 3300005544 | Bacteria | 2404 |
| 56 | Ga0070686_100077604 | 3300005544 | Bacteria | 2191 |
| 57 | Ga0070695_100006608 | 3300005545 | Bacteria | 6853 |
| 58 | Ga0070696_100002797 | 3300005546 | Bacteria | 11580 |
| 59 | Ga0070696_100046761 | 3300005546 | Bacteria | 3002 |
| 60 | Ga0070693_100005019 | 3300005547 | Bacteria | 6323 |
| 61 | Ga0070665_100026257 | 3300005548 | Bacteria | 5865 |
| 62 | Ga0070665_100106861 | 3300005548 | Bacteria | 2801 |
| 63 | Ga0070704_100060908 | 3300005549 | Bacteria | 2698 |
| 64 | Ga0068855_100021380 | 3300005563 | Bacteria | 7758 |
| 65 | Ga0068855_100042269 | 3300005563 | Bacteria | 5400 |
| 66 | Ga0068855_100407636 | 3300005563 | Bacteria | 1489 |
| 67 | Ga0070664_100000709 | 3300005564 | Bacteria | 25499 |
| 68 | Ga0070664_100212551 | 3300005564 | Bacteria | 1729 |
| 69 | Ga0068857_100194485 | 3300005577 | Bacteria | 1848 |
| 70 | Ga0068857_100261883 | 3300005577 | Bacteria | 1587 |
| 71 | Ga0068854_100001593 | 3300005578 | Bacteria | 13807 |
| 72 | Ga0068854_100019187 | 3300005578 | Bacteria | 4603 |
| 73 | Ga0068854_100044222 | 3300005578 | Bacteria | 3160 |
| 74 | Ga0068854_100097628 | 3300005578 | Bacteria | 2197 |
| 75 | Ga0068856_100060920 | 3300005614 | Bacteria | 3728 |
| 76 | Ga0068856_100102841 | 3300005614 | Bacteria | 2850 |
| 77 | Ga0068856_100152945 | 3300005614 | Bacteria | 2316 |
| 78 | Ga0070702_100046942 | 3300005615 | Bacteria | 2450 |
| 79 | Ga0070702_100047143 | 3300005615 | Bacteria | 2446 |
| 80 | Ga0070702_100051996 | 3300005615 | Bacteria | 2348 |
| 81 | Ga0068852_100044208 | 3300005616 | Bacteria | 3781 |
| 82 | Ga0068859_100118195 | 3300005617 | Bacteria | 2717 |
| 83 | Ga0068859_100211730 | 3300005617 | Bacteria | 2025 |
| 84 | Ga0068864_100017421 | 3300005618 | Bacteria | 5989 |
| 85 | Ga0068866_10007714 | 3300005718 | Bacteria | 4514 |
| 86 | Ga0068861_100041128 | 3300005719 | Bacteria | 3461 |
| 87 | Ga0068861_100044201 | 3300005719 | Bacteria | 3348 |
| 88 | Ga0068851_10009022 | 3300005834 | Bacteria | 4629 |
| 89 | Ga0068863_100116961 | 3300005841 | Bacteria | 2541 |
| 90 | Ga0068858_100012588 | 3300005842 | Bacteria | 7974 |
| 91 | Ga0068858_100032797 | 3300005842 | Bacteria | 4824 |
| 92 | Ga0068860_100028494 | 3300005843 | Bacteria | 5375 |
| 93 | Ga0068860_100207123 | 3300005843 | Bacteria | 1902 |
| 94 | Ga0068862_100117230 | 3300005844 | Bacteria | 2343 |
| 95 | Ga0081455_10000030 | 3300005937 | Bacteria | 148346 |
| 96 | Ga0081455_10000167 | 3300005937 | Bacteria | 81186 |
| 97 | Ga0081455_10009504 | 3300005937 | Bacteria | 9992 |
| 98 | Ga0081455_10011405 | 3300005937 | Bacteria | 8932 |
| 99 | Ga0081538_10002078 | 3300005981 | Bacteria | 19943 |
| 100 | Ga0081538_10031153 | 3300005981 | Bacteria | 3604 |
| 101 | Ga0081538_10042653 | 3300005981 | Bacteria | 2860 |
| 102 | Ga0081540_1004241 | 3300005983 | Bacteria | 11012 |
| 103 | Ga0081540_1008022 | 3300005983 | Bacteria | 7429 |
| 104 | Ga0081539_10000079 | 3300005985 | Bacteria | 223413 |
| 105 | Ga0081539_10000574 | 3300005985 | Bacteria | 75794 |
| 106 | Ga0081539_10050003 | 3300005985 | Bacteria | 2368 |
| 107 | Ga0070717_10002723 | 3300006028 | Bacteria | 12479 |
| 108 | Ga0070717_10039881 | 3300006028 | Bacteria | 3822 |
| 109 | Ga0075363_100058972 | 3300006048 | Bacteria | 2063 |
| 110 | Ga0070715_10014425 | 3300006163 | Bacteria | 2927 |
| 111 | Ga0070712_100016307 | 3300006175 | Bacteria | 4800 |
| 112 | Ga0070712_100042881 | 3300006175 | Bacteria | 3112 |
| 113 | Ga0075367_10000070 | 3300006178 | Bacteria | 25863 |
| 114 | Ga0097621_100039480 | 3300006237 | Bacteria | 3792 |
| 115 | Ga0097621_100048999 | 3300006237 | Bacteria | 3430 |
| 116 | Ga0068871_100020867 | 3300006358 | Bacteria | 5025 |
| 117 | Ga0075428_100000122 | 3300006844 | Bacteria | 67543 |
| 118 | Ga0075428_100001356 | 3300006844 | Bacteria | 25987 |
| 119 | Ga0075428_100136999 | 3300006844 | Bacteria | 2661 |
| 120 | Ga0075430_100003241 | 3300006846 | Bacteria | 13630 |
| 121 | Ga0075430_100016753 | 3300006846 | Bacteria | 6243 |
| 122 | Ga0075431_100002314 | 3300006847 | Bacteria | 18303 |
| 123 | Ga0075431_100003329 | 3300006847 | Bacteria | 15563 |
| 124 | Ga0075431_100009370 | 3300006847 | Bacteria | 9829 |
| 125 | Ga0075431_100039497 | 3300006847 | Bacteria | 4861 |
| 126 | Ga0075434_100135577 | 3300006871 | Bacteria | 2481 |
| 127 | Ga0075434_100526668 | 3300006871 | Bacteria | 1202 |
| 128 | Ga0075429_100003556 | 3300006880 | Bacteria | 13277 |
| 129 | Ga0075429_100033333 | 3300006880 | Bacteria | 4475 |
| 130 | Ga0075429_100241963 | 3300006880 | Bacteria | 1581 |
| 131 | Ga0068865_100033664 | 3300006881 | Bacteria | 3431 |
| 132 | Ga0097620_100118192 | 3300006931 | Bacteria | 2717 |
| 133 | Ga0097620_100211728 | 3300006931 | Bacteria | 2025 |
| 134 | Ga0099826_10056709 | 3300006948 | Bacteria | 2582 |
| 135 | Ga0075435_100022895 | 3300007076 | Bacteria | 4823 |
| 136 | Ga0105240_10163108 | 3300009093 | Bacteria | 2645 |
| 137 | Ga0111539_10001616 | 3300009094 | Bacteria | 30103 |
| 138 | Ga0111539_10057246 | 3300009094 | Bacteria | 4630 |
| 139 | Ga0111539_10139506 | 3300009094 | Bacteria | 2839 |
| 140 | Ga0105245_10002942 | 3300009098 | Bacteria | 15290 |
| 141 | Ga0105245_10691348 | 3300009098 | Bacteria | 1053 |
| 142 | Ga0105247_10010343 | 3300009101 | Bacteria | 5642 |
| 143 | Ga0105247_10049962 | 3300009101 | Bacteria | 2573 |
| 144 | Ga0105247_10122853 | 3300009101 | Bacteria | 1684 |
| 145 | Ga0105247_10144624 | 3300009101 | Bacteria | 1561 |
| 146 | Ga0114129_10008813 | 3300009147 | Bacteria | 14392 |
| 147 | Ga0114129_10045350 | 3300009147 | Bacteria | 6181 |
| 148 | Ga0114129_10046039 | 3300009147 | Bacteria | 6131 |
| 149 | Ga0114129_10106851 | 3300009147 | Bacteria | 3866 |
| 150 | Ga0105243_10002445 | 3300009148 | Bacteria | 15517 |
| 151 | Ga0105243_10199198 | 3300009148 | Bacteria | 1755 |
| 152 | Ga0105243_10226946 | 3300009148 | Bacteria | 1654 |
| 153 | Ga0105241_10018236 | 3300009174 | Bacteria | 5161 |
| 154 | Ga0105241_10041270 | 3300009174 | Bacteria | 3486 |
| 155 | Ga0105242_10036982 | 3300009176 | Bacteria | 3920 |
| 156 | Ga0105242_10208099 | 3300009176 | Bacteria | 1741 |
| 157 | Ga0105248_10075709 | 3300009177 | Bacteria | 3783 |
| 158 | Ga0105248_10085261 | 3300009177 | Bacteria | 3554 |
| 159 | Ga0105237_10090473 | 3300009545 | Bacteria | 3050 |
| 160 | Ga0105238_10092444 | 3300009551 | Bacteria | 3013 |
| 161 | Ga0105238_10375140 | 3300009551 | Bacteria | 1413 |
| 162 | Ga0105249_10014986 | 3300009553 | Bacteria | 6856 |
| 163 | Ga0105249_10153562 | 3300009553 | Bacteria | 2219 |
| 164 | Ga0105239_10020508 | 3300010375 | Bacteria | 7290 |
| 165 | Ga0105239_10045095 | 3300010375 | Bacteria | 4832 |
| 166 | Ga0105239_10172165 | 3300010375 | Bacteria | 2421 |
| 167 | Ga0105246_10013328 | 3300011119 | Bacteria | 5151 |
| 168 | Ga0105246_10015872 | 3300011119 | Bacteria | 4763 |
| 169 | Ga0105246_10046601 | 3300011119 | Bacteria | 2958 |
| 170 | Ga0105246_10144099 | 3300011119 | Bacteria | 1795 |
| 171 | Ga0157370_10001204 | 3300013104 | Bacteria | 32311 |
| 172 | Ga0157370_10013756 | 3300013104 | Bacteria | 8317 |
| 173 | Ga0157369_10008913 | 3300013105 | Bacteria | 11493 |
| 174 | Ga0157369_10021005 | 3300013105 | Bacteria | 7300 |
| 175 | Ga0157369_10052139 | 3300013105 | Bacteria | 4427 |
| 176 | Ga0157369_10056962 | 3300013105 | Bacteria | 4217 |
| 177 | Ga0157374_10037034 | 3300013296 | Bacteria | 4474 |
| 178 | Ga0157374_10122052 | 3300013296 | Bacteria | 2515 |
| 179 | Ga0157378_10246728 | 3300013297 | Bacteria | 1708 |
| 180 | Ga0163162_10354167 | 3300013306 | Bacteria | 1600 |
| 181 | Ga0157372_10107597 | 3300013307 | Bacteria | 3190 |
| 182 | Ga0157372_10169223 | 3300013307 | Bacteria | 2528 |
| 183 | Ga0157372_10225124 | 3300013307 | Bacteria | 2174 |
| 184 | Ga0157372_10595670 | 3300013307 | Bacteria | 1288 |
| 185 | Ga0157375_10062713 | 3300013308 | Bacteria | 3695 |
| 186 | Ga0163163_10056263 | 3300014325 | Bacteria | 3888 |
| 187 | Ga0163163_10065086 | 3300014325 | Bacteria | 3618 |
| 188 | Ga0163163_10506199 | 3300014325 | Bacteria | 1270 |
| 189 | Ga0157380_10014210 | 3300014326 | Bacteria | 5822 |
| 190 | Ga0157380_10058066 | 3300014326 | Bacteria | 3084 |
| 191 | Ga0157380_10286205 | 3300014326 | Bacteria | 1511 |
| 192 | Ga0157377_10048573 | 3300014745 | Bacteria | 2382 |
| 193 | Ga0157377_10179319 | 3300014745 | Bacteria | 1331 |
| 194 | Ga0157379_10004656 | 3300014968 | Bacteria | 11766 |
| 195 | Ga0157376_10020861 | 3300014969 | Bacteria | 5078 |
| 196 | Ga0182007_10002031 | 3300015262 | Bacteria | 10406 |
| 197 | Ga0183367_1001 | 3300015688 | Bacteria | 1225545 |
| 198 | Ga0163161_10130249 | 3300017792 | Bacteria | 1897 |
| 199 | Ga0213875_10000059 | 3300021388 | Bacteria | 135414 |
| 200 | Ga0209129_1000052 | 3300025258 | Bacteria | 265251 |
| 201 | Ga0207426_1000529 | 3300025302 | Bacteria | 55035 |
| 202 | Ga0207656_10038525 | 3300025321 | Bacteria | 2017 |
| 203 | Ga0207692_10000425 | 3300025898 | Bacteria | 14797 |
| 204 | Ga0207642_10042646 | 3300025899 | Bacteria | 1996 |
| 205 | Ga0207688_10018028 | 3300025901 | Bacteria | 3842 |
| 206 | Ga0207688_10056781 | 3300025901 | Bacteria | 2200 |
| 207 | Ga0207647_10012612 | 3300025904 | Bacteria | 5876 |
| 208 | Ga0207705_10105360 | 3300025909 | Bacteria | 2078 |
| 209 | Ga0207654_10058353 | 3300025911 | Bacteria | 2247 |
| 210 | Ga0207707_10000113 | 3300025912 | Bacteria | 82066 |
| 211 | Ga0207695_10001059 | 3300025913 | Bacteria | 48227 |
| 212 | Ga0207671_10001162 | 3300025914 | Bacteria | 31391 |
| 213 | Ga0207693_10002417 | 3300025915 | Bacteria | 16214 |
| 214 | Ga0207693_10004119 | 3300025915 | Bacteria | 12343 |
| 215 | Ga0207693_10021176 | 3300025915 | Bacteria | 5169 |
| 216 | Ga0207693_10172809 | 3300025915 | Bacteria | 1701 |
| 217 | Ga0207663_10087121 | 3300025916 | Bacteria | 2061 |
| 218 | Ga0207660_10012487 | 3300025917 | Bacteria | 5559 |
| 219 | Ga0207662_10059754 | 3300025918 | Bacteria | 2285 |
| 220 | Ga0207657_10004409 | 3300025919 | Bacteria | 14889 |
| 221 | Ga0207657_10151762 | 3300025919 | Bacteria | 1887 |
| 222 | Ga0207649_10047713 | 3300025920 | Bacteria | 2638 |
| 223 | Ga0207652_10000123 | 3300025921 | Bacteria | 82875 |
| 224 | Ga0207652_10406516 | 3300025921 | Bacteria | 1228 |
| 225 | Ga0207646_10172182 | 3300025922 | Bacteria | 1955 |
| 226 | Ga0207681_10299517 | 3300025923 | Bacteria | 1272 |
| 227 | Ga0207694_10001998 | 3300025924 | Bacteria | 16870 |
| 228 | Ga0207659_10018180 | 3300025926 | Bacteria | 4605 |
| 229 | Ga0207687_10030669 | 3300025927 | Bacteria | 3626 |
| 230 | Ga0207687_10328037 | 3300025927 | Bacteria | 1241 |
| 231 | Ga0207700_10114971 | 3300025928 | Bacteria | 2172 |
| 232 | Ga0207700_10301647 | 3300025928 | Bacteria | 1383 |
| 233 | Ga0207664_10005713 | 3300025929 | Bacteria | 8503 |
| 234 | Ga0207664_10023474 | 3300025929 | Bacteria | 4622 |
| 235 | Ga0207664_10030193 | 3300025929 | Bacteria | 4138 |
| 236 | Ga0207664_10229485 | 3300025929 | Bacteria | 1613 |
| 237 | Ga0207664_10282249 | 3300025929 | Bacteria | 1457 |
| 238 | Ga0207706_10037884 | 3300025933 | Bacteria | 4279 |
| 239 | Ga0207709_10001815 | 3300025935 | Bacteria | 14245 |
| 240 | Ga0207670_10035048 | 3300025936 | Bacteria | 3251 |
| 241 | Ga0207670_10096349 | 3300025936 | Bacteria | 2104 |
| 242 | Ga0207704_10168302 | 3300025938 | Bacteria | 1568 |
| 243 | Ga0207665_10000614 | 3300025939 | Bacteria | 23903 |
| 244 | Ga0207665_10024055 | 3300025939 | Bacteria | 4014 |
| 245 | Ga0207691_10130149 | 3300025940 | Bacteria | 2224 |
| 246 | Ga0207711_10034886 | 3300025941 | Bacteria | 4261 |
| 247 | Ga0207689_10112524 | 3300025942 | Bacteria | 2238 |
| 248 | Ga0207661_10018974 | 3300025944 | Bacteria | 5117 |
| 249 | Ga0207661_10049061 | 3300025944 | Bacteria | 3359 |
| 250 | Ga0207661_10064171 | 3300025944 | Bacteria | 2976 |
| 251 | Ga0207661_10264433 | 3300025944 | Bacteria | 1533 |
| 252 | Ga0207679_10012474 | 3300025945 | Bacteria | 5543 |
| 253 | Ga0207651_10026631 | 3300025960 | Bacteria | 3617 |
| 254 | Ga0207651_10215163 | 3300025960 | Bacteria | 1550 |
| 255 | Ga0207712_10069101 | 3300025961 | Bacteria | 2534 |
| 256 | Ga0207712_10176386 | 3300025961 | Bacteria | 1675 |
| 257 | Ga0207668_10005141 | 3300025972 | Bacteria | 7697 |
| 258 | Ga0207668_10071539 | 3300025972 | Bacteria | 2478 |
| 259 | Ga0207668_10083733 | 3300025972 | Bacteria | 2322 |
| 260 | Ga0207668_10088882 | 3300025972 | Bacteria | 2264 |
| 261 | Ga0207640_10079154 | 3300025981 | Bacteria | 2240 |
| 262 | Ga0207677_10032651 | 3300026023 | Bacteria | 3349 |
| 263 | Ga0207677_10252263 | 3300026023 | Bacteria | 1433 |
| 264 | Ga0207703_10039924 | 3300026035 | Bacteria | 3753 |
| 265 | Ga0207703_10054606 | 3300026035 | Bacteria | 3249 |
| 266 | Ga0207639_10039721 | 3300026041 | Bacteria | 3508 |
| 267 | Ga0207639_10181745 | 3300026041 | Bacteria | 1790 |
| 268 | Ga0207639_10248820 | 3300026041 | Bacteria | 1549 |
| 269 | Ga0207678_10000020 | 3300026067 | Bacteria | 132096 |
| 270 | Ga0207678_10040880 | 3300026067 | Bacteria | 4020 |
| 271 | Ga0207678_10051230 | 3300026067 | Bacteria | 3564 |
| 272 | Ga0207678_10087353 | 3300026067 | Bacteria | 2665 |
| 273 | Ga0207708_10000006 | 3300026075 | Bacteria | 266916 |
| 274 | Ga0207708_10039915 | 3300026075 | Bacteria | 3578 |
| 275 | Ga0207708_10147151 | 3300026075 | Bacteria | 1852 |
| 276 | Ga0207702_10010965 | 3300026078 | Bacteria | 7561 |
| 277 | Ga0207702_10018672 | 3300026078 | Bacteria | 5736 |
| 278 | Ga0207702_10047176 | 3300026078 | Bacteria | 3628 |
| 279 | Ga0207702_10050092 | 3300026078 | Bacteria | 3526 |
| 280 | Ga0207641_10256206 | 3300026088 | Bacteria | 1636 |
| 281 | Ga0207676_10118697 | 3300026095 | Bacteria | 2226 |
| 282 | Ga0207676_10161593 | 3300026095 | Bacteria | 1941 |
| 283 | Ga0207674_10049588 | 3300026116 | Bacteria | 4293 |
| 284 | Ga0207674_10097973 | 3300026116 | Bacteria | 2916 |
| 285 | Ga0207674_10107654 | 3300026116 | Bacteria | 2764 |
| 286 | Ga0207674_10138284 | 3300026116 | Bacteria | 2396 |
| 287 | Ga0207674_10263916 | 3300026116 | Bacteria | 1669 |
| 288 | Ga0207674_10315644 | 3300026116 | Bacteria | 1512 |
| 289 | Ga0207675_100013792 | 3300026118 | Bacteria | 7538 |
| 290 | Ga0207675_100025166 | 3300026118 | Bacteria | 5539 |
| 291 | Ga0207675_100060807 | 3300026118 | Bacteria | 3526 |
| 292 | Ga0207675_100127145 | 3300026118 | Bacteria | 2415 |
| 293 | Ga0207675_100441914 | 3300026118 | Bacteria | 1287 |
| 294 | Ga0207683_10005158 | 3300026121 | Bacteria | 11213 |
| 295 | Ga0207683_10275448 | 3300026121 | Bacteria | 1537 |
| 296 | Ga0207683_10436891 | 3300026121 | Bacteria | 1206 |
| 297 | Ga0207698_10353589 | 3300026142 | Bacteria | 1389 |
| 298 | Ga0207428_10006204 | 3300027907 | Bacteria | 11043 |
| 299 | Ga0268266_10067532 | 3300028379 | Bacteria | 3095 |
| 300 | Ga0268266_10256806 | 3300028379 | Bacteria | 1618 |
| 301 | Ga0268265_10046240 | 3300028380 | Bacteria | 3253 |
| 302 | Ga0268265_10083953 | 3300028380 | Bacteria | 2524 |
| 303 | Ga0268265_10165658 | 3300028380 | Bacteria | 1883 |
| 304 | Ga0268264_10110444 | 3300028381 | Bacteria | 2407 |
| 305 | Ga0268264_10483451 | 3300028381 | Bacteria | 1205 |
| 306 | Ga0307517_10033266 | 3300028786 | Bacteria | 5930 |
| 307 | Ga0307517_10052366 | 3300028786 | Bacteria | 4093 |
| 308 | Ga0307515_10000441 | 3300028794 | Bacteria | 99819 |
| 309 | Ga0307515_10000890 | 3300028794 | Bacteria | 68786 |
| 310 | Ga0307515_10003987 | 3300028794 | Bacteria | 30808 |
| 311 | Ga0307515_10019377 | 3300028794 | Bacteria | 12254 |
| 312 | Ga0307515_10147187 | 3300028794 | Bacteria | 2487 |
| 313 | Ga0307511_10003983 | 3300030521 | Bacteria | 15103 |
| 314 | Ga0307511_10032674 | 3300030521 | Bacteria | 4617 |
| 315 | Ga0307511_10131391 | 3300030521 | Bacteria | 1507 |
| 316 | Ga0307512_10003190 | 3300030522 | Bacteria | 19437 |
| 317 | Ga0307512_10005175 | 3300030522 | Bacteria | 13759 |
| 318 | Ga0307512_10025182 | 3300030522 | Bacteria | 5278 |
| 319 | Ga0307512_10032592 | 3300030522 | Bacteria | 4496 |
| 320 | Ga0307513_10000049 | 3300031456 | Bacteria | 153747 |
| 321 | Ga0307513_10005311 | 3300031456 | Bacteria | 17035 |
| 322 | Ga0307513_10040682 | 3300031456 | Bacteria | 5138 |
| 323 | Ga0307513_10100011 | 3300031456 | Bacteria | 2926 |
| 324 | Ga0307513_10314451 | 3300031456 | Bacteria | 1327 |
| 325 | Ga0307509_10063006 | 3300031507 | Bacteria | 3906 |
| 326 | Ga0307509_10132991 | 3300031507 | Bacteria | 2439 |
| 327 | Ga0307508_10034964 | 3300031616 | Bacteria | 4529 |
| 328 | Ga0307508_10092020 | 3300031616 | Bacteria | 2621 |
| 329 | Ga0307508_10139597 | 3300031616 | Bacteria | 2027 |
| 330 | Ga0307514_10035752 | 3300031649 | Bacteria | 3951 |
| 331 | Ga0316576_10026192 | 3300031727 | Bacteria | 4090 |
| 332 | Ga0307516_10000459 | 3300031730 | Bacteria | 53890 |
| 333 | Ga0307516_10010622 | 3300031730 | Bacteria | 10101 |
| 334 | Ga0307413_10000136 | 3300031824 | Bacteria | 19426 |
| 335 | Ga0307518_10000210 | 3300031838 | Bacteria | 44276 |
| 336 | Ga0307518_10112364 | 3300031838 | Bacteria | 1939 |
| 337 | Ga0307406_10000480 | 3300031901 | Bacteria | 23055 |
| 338 | Ga0307406_10007642 | 3300031901 | Bacteria | 6004 |
| 339 | Ga0307406_10086241 | 3300031901 | Bacteria | 2102 |
| 340 | Ga0307407_10227035 | 3300031903 | Bacteria | 1266 |
| 341 | Ga0307412_10017085 | 3300031911 | Bacteria | 4338 |
| 342 | Ga0307409_100012247 | 3300031995 | Bacteria | 5456 |
| 343 | Ga0307409_100015255 | 3300031995 | Bacteria | 5035 |
| 344 | Ga0307409_100062574 | 3300031995 | Bacteria | 2914 |
| 345 | Ga0307409_100089366 | 3300031995 | Bacteria | 2518 |
| 346 | Ga0307409_100225110 | 3300031995 | Bacteria | 1696 |
| 347 | Ga0307416_100376487 | 3300032002 | Bacteria | 1448 |
| 348 | Ga0307415_100036318 | 3300032126 | Bacteria | 3227 |
| 349 | Ga0307415_100042312 | 3300032126 | Bacteria | 3031 |
| 350 | Ga0307415_100071228 | 3300032126 | Bacteria | 2444 |
| 351 | Ga0307415_100147547 | 3300032126 | Bacteria | 1806 |
| 352 | Ga0307507_10000240 | 3300033179 | Bacteria | 106042 |
| 353 | Ga0307507_10015925 | 3300033179 | Bacteria | 8801 |
| 354 | Ga0307507_10133015 | 3300033179 | Bacteria | 1938 |
| 355 | Ga0307510_10020202 | 3300033180 | Bacteria | 7789 |
| 356 | Ga0307510_10021005 | 3300033180 | Bacteria | 7616 |
| 357 | Ga0373929_0014916 | 3300035085 | Bacteria | 1506 |
| 358 | Ga0373944_0059757 | 3300035089 | Bacteria | 1220 |
| 359 | Ga0373960_0029957 | 3300035121 | Bacteria | 1513 |
| 360 | Ga0373960_0041959 | 3300035121 | Bacteria | 1327 |
| 361 | Ga0373961_0040296 | 3300035241 | Bacteria | 1346 |
| 362 | Ga0373931_0033554 | 3300035691 | Bacteria | 2660 |
| 363 | Ga0373931_0129709 | 3300035691 | Bacteria | 1450 |
| 364 | Ga0373935_0284621 | 3300035692 | Bacteria | 1164 |
| 365 | Ga0373933_0128274 | 3300035724 | Bacteria | 1593 |
| 366 | Ga0373937_0021513 | 3300036401 | Bacteria | 5789 |
| 367 | Ga0316584_0031709 | 3300036712 | Bacteria | 3908 |
| 368 | Ga0373925_0146177 | 3300037068 | Bacteria | 1853 |
| 369 | Ga0395899_0001340 | 3300037312 | Bacteria | 21164 |
| 370 | Ga0395899_0312981 | 3300037312 | Bacteria | 1060 |
| 371 | Ga0395900_0045701 | 3300037418 | Bacteria | 4510 |
| 372 | Ga0395900_0170083 | 3300037418 | Bacteria | 2219 |
| 373 | Ga0395900_0439104 | 3300037418 | Bacteria | 1263 |
| 374 | Ga0395898_0003182 | 3300037466 | Bacteria | 18486 |
| 375 | Ga0395898_0021072 | 3300037466 | Bacteria | 6613 |
| 376 | Ga0395898_0053926 | 3300037466 | Bacteria | 3925 |
| 377 | Ga0395898_0416284 | 3300037466 | Bacteria | 1281 |
| 378 | Ga0436364_0082088 | 3300037853 | Bacteria | 178031 |
| 379 | Ga0436364_0434599 | 3300037853 | Bacteria | 6253 |
| 380 | Ga0436364_1038197 | 3300037853 | Bacteria | 2605 |
| 381 | Ga0395901_0070494 | 3300038443 | Bacteria | 3642 |
| 382 | Ga0395901_0086954 | 3300038443 | Bacteria | 3268 |
| 383 | Ga0395901_0120406 | 3300038443 | Bacteria | 2758 |
| 384 | Ga0395901_0180249 | 3300038443 | Bacteria | 2216 |
| 385 | Ga0395901_0228495 | 3300038443 | Bacteria | 1943 |
| 386 | Ga0436365_0005296 | 3300039437 | Bacteria | 1072 |
| 387 | Ga0436365_0086936 | 3300039437 | Bacteria | 1741 |
| 388 | Ga0436365_1724486 | 3300039437 | Bacteria | 5558 |
| 389 | Ga0436360_0644977 | 3300039438 | Bacteria | 1569 |
| 390 | Ga0436363_1427861 | 3300039450 | Bacteria | 1228 |
| 391 | Ga0439436_0014724 | 3300041404 | Bacteria | 2356 |
| 392 | Ga0439438_012603 | 3300041405 | Bacteria | 2587 |
| 393 | Ga0439439_0003123 | 3300041406 | Bacteria | 3617 |
| 394 | Ga0439439_0005869 | 3300041406 | Bacteria | 2824 |
| 395 | Ga0439466_0021351 | 3300041411 | Bacteria | 2296 |
| 396 | Ga0451797_0641249 | 3300041453 | Bacteria | 1088 |
| 397 | Ga0451841_0401691 | 3300041498 | Bacteria | 1421 |
| 398 | Ga0451853_0901394 | 3300041512 | Bacteria | 6437 |
| 399 | Ga0451853_2187299 | 3300041512 | Bacteria | 3692 |
| 400 | Ga0439431_0031195 | 3300041997 | Bacteria | 1324 |
| 401 | Ga0439442_008243 | 3300042002 | Bacteria | 2104 |
| 402 | Ga0439449_0005291 | 3300042007 | Bacteria | 4948 |
| 403 | Ga0439449_0006288 | 3300042007 | Bacteria | 4540 |
| 404 | Ga0439449_0021245 | 3300042007 | Bacteria | 2430 |
| 405 | Ga0439457_001041 | 3300042014 | Bacteria | 8380 |
| 406 | Ga0439457_001522 | 3300042014 | Bacteria | 6960 |
| 407 | Ga0439457_002767 | 3300042014 | Bacteria | 4916 |
| 408 | Ga0439462_0007584 | 3300042015 | Bacteria | 2720 |
| 409 | Ga0450895_001040 | 3300042132 | Bacteria | 1834 |
| 410 | Ga0450898_000988 | 3300042134 | Bacteria | 3594 |
| 411 | Ga0450899_000974 | 3300042135 | Bacteria | 3250 |
| 412 | Ga0450903_001545 | 3300042138 | Bacteria | 4287 |
| 413 | Ga0450906_004982 | 3300042145 | Bacteria | 2755 |
| 414 | Ga0439458_0000386 | 3300042157 | Bacteria | 11115 |
| 415 | Ga0439458_0008194 | 3300042157 | Bacteria | 2323 |
| 416 | Ga0450908_011499 | 3300042184 | Bacteria | 1619 |
| 417 | Ga0466969_0001812 | 3300044656 | Bacteria | 11399 |
| 418 | Ga0466969_0004618 | 3300044656 | Bacteria | 7332 |
| 419 | Ga0466969_0011774 | 3300044656 | Bacteria | 4626 |
| 420 | Ga0466969_0024437 | 3300044656 | Bacteria | 3108 |
| 421 | Ga0466969_0028597 | 3300044656 | Bacteria | 2849 |
| 422 | Ga0466969_0030546 | 3300044656 | Bacteria | 2744 |
| 423 | Ga0466972_0011041 | 3300044658 | Bacteria | 4534 |
| 424 | Ga0466972_0018352 | 3300044658 | Bacteria | 3496 |
| 425 | Ga0466972_0025141 | 3300044658 | Bacteria | 2953 |
| 426 | Ga0466972_0043254 | 3300044658 | Bacteria | 2188 |
| 427 | Ga0466965_0002520 | 3300044683 | Bacteria | 7807 |
| 428 | Ga0466965_0006268 | 3300044683 | Bacteria | 5387 |
| 429 | Ga0466965_0073123 | 3300044683 | Bacteria | 1726 |
| 430 | Ga0466965_0096930 | 3300044683 | Bacteria | 1505 |
| 431 | Ga0466966_0003935 | 3300044684 | Bacteria | 9809 |
| 432 | Ga0466966_0012226 | 3300044684 | Bacteria | 5687 |
| 433 | Ga0466966_0012941 | 3300044684 | Bacteria | 5524 |
| 434 | Ga0466966_0023881 | 3300044684 | Bacteria | 4001 |
| 435 | Ga0466966_0032031 | 3300044684 | Bacteria | 3410 |
| 436 | Ga0466961_0002630 | 3300044693 | Bacteria | 11153 |
| 437 | Ga0466961_0008124 | 3300044693 | Bacteria | 6681 |
| 438 | Ga0466961_0008808 | 3300044693 | Bacteria | 6436 |
| 439 | Ga0466961_0009249 | 3300044693 | Bacteria | 6274 |
| 440 | Ga0466961_0021521 | 3300044693 | Bacteria | 4150 |
| 441 | Ga0466961_0027411 | 3300044693 | Bacteria | 3663 |
| 442 | Ga0466961_0032383 | 3300044693 | Bacteria | 3359 |
| 443 | Ga0466961_0044944 | 3300044693 | Bacteria | 2826 |
| 444 | Ga0466961_0060687 | 3300044693 | Bacteria | 2404 |
| 445 | Ga0466961_0152224 | 3300044693 | Bacteria | 1444 |
| 446 | Ga0466963_0000099 | 3300044694 | Bacteria | 30941 |
| 447 | Ga0466963_0011870 | 3300044694 | Bacteria | 5318 |
| 448 | Ga0466963_0015542 | 3300044694 | Bacteria | 4716 |
| 449 | Ga0466963_0073742 | 3300044694 | Bacteria | 2301 |
| 450 | Ga0466963_0092372 | 3300044694 | Bacteria | 2062 |
| 451 | Ga0466963_0136836 | 3300044694 | Bacteria | 1695 |
| 452 | Ga0466963_0141224 | 3300044694 | Bacteria | 1668 |
| 453 | Ga0466964_0000321 | 3300044706 | Bacteria | 14261 |
| 454 | Ga0466971_0001426 | 3300044719 | Bacteria | 10041 |
| 455 | Ga0466971_0004999 | 3300044719 | Bacteria | 5737 |
| 456 | Ga0466971_0011152 | 3300044719 | Bacteria | 3935 |
| 457 | Ga0466971_0020296 | 3300044719 | Bacteria | 2954 |
| 458 | Ga0466971_0036870 | 3300044719 | Bacteria | 2192 |
| 459 | Ga0466971_0083150 | 3300044719 | Bacteria | 1462 |
| 460 | Ga0466971_0102158 | 3300044719 | Bacteria | 1318 |
| 461 | Ga0466968_0186336 | 3300044735 | Bacteria | 967 |
| 462 | Ga0466970_0001771 | 3300044765 | Bacteria | 10408 |
| 463 | Ga0466970_0010140 | 3300044765 | Bacteria | 4774 |
| 464 | Ga0466970_0156061 | 3300044765 | Bacteria | 1261 |
| 465 | Ga0466957_0000206 | 3300044842 | Bacteria | 27538 |
| 466 | Ga0466957_0063636 | 3300044842 | Bacteria | 2268 |
| 467 | Ga0466957_0175402 | 3300044842 | Bacteria | 1398 |
| 468 | Ga0466960_0000061 | 3300044901 | Bacteria | 36418 |
| 469 | Ga0466960_0001976 | 3300044901 | Bacteria | 7593 |
| 470 | Ga0466960_0007533 | 3300044901 | Bacteria | 4427 |
| 471 | Ga0466960_0119009 | 3300044901 | Bacteria | 1381 |
| 472 | Ga0466959_0004074 | 3300045049 | Bacteria | 9724 |
| 473 | Ga0466959_0005042 | 3300045049 | Bacteria | 8973 |
| 474 | Ga0466959_0006147 | 3300045049 | Bacteria | 8296 |
| 475 | Ga0466959_0007090 | 3300045049 | Bacteria | 7840 |
| 476 | Ga0466959_0016242 | 3300045049 | Bacteria | 5436 |
| 477 | Ga0466959_0052490 | 3300045049 | Bacteria | 2985 |
| 478 | Ga0466959_0201399 | 3300045049 | Bacteria | 1386 |
| 479 | Ga0466959_0239017 | 3300045049 | Bacteria | 1255 |
| 480 | Ga0466958_0006459 | 3300045836 | Bacteria | 6381 |
| 481 | Ga0466958_0019859 | 3300045836 | Bacteria | 3914 |
| 482 | Ga0466958_0084455 | 3300045836 | Bacteria | 1958 |
| 483 | Ga0466958_0109256 | 3300045836 | Bacteria | 1726 |
| 484 | Ga0466958_0147752 | 3300045836 | Bacteria | 1482 |
| 485 | Ga0466958_0157663 | 3300045836 | Bacteria | 1433 |
| 486 | Ga0466967_0000619 | 3300045976 | Bacteria | 17708 |
| 487 | Ga0466967_0003541 | 3300045976 | Bacteria | 10223 |
| 488 | Ga0466967_0032340 | 3300045976 | Bacteria | 4416 |
| 489 | Ga0466967_0045851 | 3300045976 | Bacteria | 3802 |
| 490 | Ga0466967_0073072 | 3300045976 | Bacteria | 3076 |
| 491 | Ga0466967_0130865 | 3300045976 | Bacteria | 2329 |
| 492 | Ga0466967_0156635 | 3300045976 | Bacteria | 2134 |
| 493 | Ga0466967_0207926 | 3300045976 | Bacteria | 1855 |
| 494 | Ga0466967_0244987 | 3300045976 | Bacteria | 1710 |
| 495 | Ga0466967_0273696 | 3300045976 | Bacteria | 1618 |
| 496 | Ga0466967_0314825 | 3300045976 | Bacteria | 1508 |
| 497 | Ga0466967_0427116 | 3300045976 | Bacteria | 1292 |
| 498 | Ga0466967_0593054 | 3300045976 | Bacteria | 1093 |
| 499 | Ga0495617_010106 | 3300046452 | Bacteria | 3233 |
| 500 | Ga0495592_0002483 | 3300046454 | Bacteria | 13033 |
| 501 | Ga0495592_0020832 | 3300046454 | Bacteria | 4988 |
| 502 | Ga0495592_0191731 | 3300046454 | Bacteria | 1385 |
| 503 | Ga0495592_0204003 | 3300046454 | Bacteria | 1332 |
| 504 | Ga0495603_0001385 | 3300046455 | Bacteria | 14073 |
| 505 | Ga0495603_0006520 | 3300046455 | Bacteria | 6998 |
| 506 | Ga0495603_0027905 | 3300046455 | Bacteria | 3404 |
| 507 | Ga0495603_0032638 | 3300046455 | Bacteria | 3132 |
| 508 | Ga0495629_0006675 | 3300046459 | Bacteria | 8542 |
| 509 | Ga0495629_0009683 | 3300046459 | Bacteria | 7039 |
| 510 | Ga0495629_0011356 | 3300046459 | Bacteria | 6469 |
| 511 | Ga0495629_0023560 | 3300046459 | Bacteria | 4385 |
| 512 | Ga0495629_0083582 | 3300046459 | Bacteria | 2228 |
| 513 | Ga0495629_0112504 | 3300046459 | Bacteria | 1897 |
| 514 | Ga0495651_0003430 | 3300046462 | Bacteria | 12161 |
| 515 | Ga0495651_0009722 | 3300046462 | Bacteria | 7394 |
| 516 | Ga0495651_0032132 | 3300046462 | Bacteria | 4095 |
| 517 | Ga0495653_0010670 | 3300046463 | Bacteria | 7522 |
| 518 | Ga0495650_0073650 | 3300046471 | Bacteria | 1334 |
| 519 | Ga0495582_0076092 | 3300046473 | Bacteria | 1860 |
| 520 | Ga0495605_0005955 | 3300046474 | Bacteria | 7051 |
| 521 | Ga0495639_0019629 | 3300046475 | Bacteria | 2950 |
| 522 | Ga0495639_0062781 | 3300046475 | Bacteria | 1705 |
| 523 | Ga0495662_0000269 | 3300046476 | Bacteria | 22106 |
| 524 | Ga0495662_0000678 | 3300046476 | Bacteria | 16092 |
| 525 | Ga0495662_0017472 | 3300046476 | Bacteria | 3471 |
| 526 | Ga0495662_0032305 | 3300046476 | Bacteria | 2528 |
| 527 | Ga0495664_0002460 | 3300046477 | Bacteria | 9970 |
| 528 | Ga0495664_0066152 | 3300046477 | Bacteria | 2155 |
| 529 | Ga0495594_0006404 | 3300046499 | Bacteria | 6056 |
| 530 | Ga0495594_0009772 | 3300046499 | Bacteria | 4966 |
| 531 | Ga0495594_0030869 | 3300046499 | Bacteria | 2902 |
| 532 | Ga0495607_0051011 | 3300046501 | Bacteria | 2405 |
| 533 | Ga0495607_0101678 | 3300046501 | Bacteria | 1539 |
| 534 | Ga0495606_0017990 | 3300046507 | Bacteria | 5317 |
| 535 | Ga0495608_0053971 | 3300046511 | Bacteria | 2658 |
| 536 | Ga0495608_0130033 | 3300046511 | Bacteria | 1612 |
| 537 | Ga0495616_0001838 | 3300046513 | Bacteria | 14375 |
| 538 | Ga0495618_0012647 | 3300046514 | Bacteria | 5127 |
| 539 | Ga0495618_0018823 | 3300046514 | Bacteria | 4242 |
| 540 | Ga0495618_0238601 | 3300046514 | Bacteria | 1143 |
| 541 | Ga0495628_0006454 | 3300046516 | Bacteria | 10242 |
| 542 | Ga0495628_0012754 | 3300046516 | Bacteria | 7077 |
| 543 | Ga0495628_0042373 | 3300046516 | Bacteria | 3630 |
| 544 | Ga0495628_0053279 | 3300046516 | Bacteria | 3193 |
| 545 | Ga0495630_0003162 | 3300046517 | Bacteria | 11431 |
| 546 | Ga0495630_0137078 | 3300046517 | Bacteria | 1860 |
| 547 | Ga0495643_0025323 | 3300046522 | Bacteria | 3357 |
| 548 | Ga0495666_0002468 | 3300046526 | Bacteria | 9183 |
| 549 | Ga0495666_0020282 | 3300046526 | Bacteria | 3294 |
| 550 | Ga0495652_0001825 | 3300046529 | Bacteria | 22600 |
| 551 | Ga0495652_0007897 | 3300046529 | Bacteria | 9770 |
| 552 | Ga0495652_0020898 | 3300046529 | Bacteria | 5817 |
| 553 | Ga0495652_0027088 | 3300046529 | Bacteria | 5053 |
| 554 | Ga0495652_0030429 | 3300046529 | Bacteria | 4736 |
| 555 | Ga0495652_0107809 | 3300046529 | Bacteria | 2246 |
| 556 | Ga0495640_0013810 | 3300046533 | Bacteria | 6134 |
| 557 | Ga0495640_0017001 | 3300046533 | Bacteria | 5429 |
| 558 | Ga0495640_0098191 | 3300046533 | Bacteria | 1925 |
| 559 | Ga0495587_0002745 | 3300046536 | Bacteria | 11739 |
| 560 | Ga0495609_0052193 | 3300046538 | Bacteria | 1819 |
| 561 | Ga0495645_0037361 | 3300046543 | Bacteria | 3539 |
| 562 | Ga0495645_0044162 | 3300046543 | Bacteria | 3251 |
| 563 | Ga0495645_0050195 | 3300046543 | Bacteria | 3038 |
| 564 | Ga0495645_0071972 | 3300046543 | Bacteria | 2492 |
| 565 | Ga0495622_0040451 | 3300046557 | Bacteria | 2169 |
| 566 | Ga0495667_0008916 | 3300046559 | Bacteria | 6819 |
| 567 | Ga0495667_0108040 | 3300046559 | Bacteria | 1798 |
| 568 | Ga0495667_0240946 | 3300046559 | Bacteria | 1152 |
| 569 | Ga0495656_0086372 | 3300046615 | Bacteria | 1427 |
| 570 | Ga0495668_0009851 | 3300046616 | Bacteria | 5830 |
| 571 | Ga0495634_0004250 | 3300046642 | Bacteria | 11292 |
| 572 | Ga0495634_0121342 | 3300046642 | Bacteria | 1673 |
| 573 | Ga0495611_0009795 | 3300046648 | Bacteria | 4052 |
| 574 | Ga0495611_0069401 | 3300046648 | Bacteria | 1610 |
| 575 | Ga0495635_0004368 | 3300046663 | Bacteria | 9787 |
| 576 | Ga0495635_0006861 | 3300046663 | Bacteria | 7955 |
| 577 | Ga0495635_0036005 | 3300046663 | Bacteria | 3432 |
| 578 | Ga0495588_0001933 | 3300046674 | Bacteria | 8852 |
| 579 | Ga0495588_0003867 | 3300046674 | Bacteria | 6562 |
| 580 | Ga0495588_0145073 | 3300046674 | Bacteria | 1254 |
| 581 | Ga0495657_0004106 | 3300046675 | Bacteria | 11678 |
| 582 | Ga0495657_0010530 | 3300046675 | Bacteria | 6955 |
| 583 | Ga0495657_0020962 | 3300046675 | Bacteria | 4696 |
| 584 | Ga0495657_0045863 | 3300046675 | Bacteria | 2963 |
| 585 | Ga0495657_0055942 | 3300046675 | Bacteria | 2630 |
| 586 | Ga0495599_0006003 | 3300046678 | Bacteria | 7307 |
| 587 | Ga0495599_0037551 | 3300046678 | Bacteria | 3043 |
| 588 | Ga0495623_0002580 | 3300046679 | Bacteria | 11971 |
| 589 | Ga0495623_0112308 | 3300046679 | Bacteria | 1650 |
| 590 | Ga0495646_0000765 | 3300046680 | Bacteria | 17921 |
| 591 | Ga0495646_0014718 | 3300046680 | Bacteria | 4972 |
| 592 | Ga0495613_0001493 | 3300046689 | Bacteria | 17818 |
| 593 | Ga0495613_0009005 | 3300046689 | Bacteria | 7407 |
| 594 | Ga0495613_0018934 | 3300046689 | Bacteria | 5128 |
| 595 | Ga0495613_0019514 | 3300046689 | Bacteria | 5052 |
| 596 | Ga0495613_0117902 | 3300046689 | Bacteria | 1908 |
| 597 | Ga0495624_0042629 | 3300046690 | Bacteria | 2900 |
| 598 | Ga0495624_0101813 | 3300046690 | Bacteria | 1768 |
| 599 | Ga0495624_0229137 | 3300046690 | Bacteria | 1125 |
| 600 | Ga0495670_0044446 | 3300046691 | Bacteria | 2218 |
| 601 | Ga0495670_0056588 | 3300046691 | Bacteria | 1968 |
| 602 | Ga0495671_0046994 | 3300046692 | Bacteria | 2158 |
| 603 | Ga0495671_0068244 | 3300046692 | Bacteria | 1748 |
| 604 | Ga0495649_0023029 | 3300046694 | Bacteria | 3480 |
| 605 | Ga0495589_0001676 | 3300046794 | Bacteria | 12681 |
| 606 | Ga0495589_0009376 | 3300046794 | Bacteria | 5090 |
| 607 | Ga0495589_0016781 | 3300046794 | Bacteria | 3760 |
| 608 | Ga0495589_0047951 | 3300046794 | Bacteria | 2115 |
| 609 | Ga0495589_0120080 | 3300046794 | Bacteria | 1266 |
| 610 | Ga0495600_0002374 | 3300046809 | Bacteria | 10763 |
| 611 | Ga0495600_0007890 | 3300046809 | Bacteria | 6522 |
| 612 | Ga0495600_0034090 | 3300046809 | Bacteria | 3305 |
| 613 | Ga0495581_0036026 | 3300047315 | Bacteria | 2862 |
| 614 | Ga0495581_0115988 | 3300047315 | Bacteria | 1557 |
| 615 | Ga0495581_0193065 | 3300047315 | Bacteria | 1191 |
| 616 | Ga0495604_0000392 | 3300047317 | Bacteria | 39604 |
| 617 | Ga0495604_0004530 | 3300047317 | Bacteria | 11008 |
| 618 | Ga0495604_0011430 | 3300047317 | Bacteria | 7048 |
| 619 | Ga0495604_0012626 | 3300047317 | Bacteria | 6720 |
| 620 | Ga0495604_0014376 | 3300047317 | Bacteria | 6313 |
| 621 | Ga0495636_0003865 | 3300047318 | Bacteria | 5844 |
| 622 | Ga0495636_0005973 | 3300047318 | Bacteria | 4780 |
| 623 | Ga0495674_0013220 | 3300047319 | Bacteria | 7759 |
| 624 | Ga0495674_0067834 | 3300047319 | Bacteria | 3089 |
| 625 | Ga0495672_0018483 | 3300047320 | Bacteria | 4624 |
| 626 | Ga0495676_0011089 | 3300047321 | Bacteria | 8144 |
| 627 | Ga0495676_0019201 | 3300047321 | Bacteria | 6013 |
| 628 | Ga0495676_0133399 | 3300047321 | Bacteria | 1789 |
| 629 | Ga0495676_0258092 | 3300047321 | Bacteria | 1186 |
| 630 | Ga0495680_0015604 | 3300047322 | Bacteria | 6550 |
| 631 | Ga0495683_0012919 | 3300047323 | Bacteria | 4379 |
| 632 | Ga0495683_0132102 | 3300047323 | Bacteria | 1176 |
| 633 | Ga0495687_001678 | 3300047443 | Bacteria | 19766 |
| 634 | Ga0495687_003806 | 3300047443 | Bacteria | 10643 |
| 635 | Ga0495675_0002441 | 3300047444 | Bacteria | 11115 |
| 636 | Ga0495675_0005847 | 3300047444 | Bacteria | 7516 |
| 637 | Ga0495675_0114249 | 3300047444 | Bacteria | 1684 |
| 638 | Ga0495675_0122896 | 3300047444 | Bacteria | 1616 |
| 639 | Ga0495685_008489 | 3300047447 | Bacteria | 3413 |
| 640 | Ga0495685_010168 | 3300047447 | Bacteria | 3153 |
| 641 | Ga0495685_015729 | 3300047447 | Bacteria | 2583 |
| 642 | Ga0495685_025964 | 3300047447 | Bacteria | 2016 |
| 643 | Ga0495681_0009754 | 3300047470 | Bacteria | 5880 |
| 644 | Ga0495681_0012274 | 3300047470 | Bacteria | 5044 |
| 645 | Ga0495684_0004401 | 3300047471 | Bacteria | 11008 |
| 646 | Ga0495684_0072468 | 3300047471 | Bacteria | 2617 |
| 647 | Ga0495686_0036864 | 3300047472 | Bacteria | 3136 |
| 648 | Ga0495593_0136840 | 3300047673 | Bacteria | 1241 |
| 649 | Ga0495602_0005444 | 3300048088 | Bacteria | 13353 |
| 650 | Ga0495602_0035838 | 3300048088 | Bacteria | 4623 |
| 651 | Ga0495602_0037017 | 3300048088 | Bacteria | 4534 |
| 652 | Ga0495602_0101937 | 3300048088 | Bacteria | 2353 |
| 653 | Ga0495614_0008078 | 3300048089 | Bacteria | 4677 |
| 654 | Ga0495614_0010023 | 3300048089 | Bacteria | 4183 |
| 655 | Ga0495626_0031995 | 3300048091 | Bacteria | 2528 |
| 656 | Ga0496100_0183413 | 3300048903 | Bacteria | 1515 |
| 657 | Ga0496101_0226899 | 3300048904 | Bacteria | 1451 |
| 658 | Ga0496104_0008319 | 3300048907 | Bacteria | 9213 |
| 659 | Ga0496104_0017592 | 3300048907 | Bacteria | 6513 |
| 660 | Ga0496104_0126357 | 3300048907 | Bacteria | 2456 |
| 661 | Ga0496104_0139238 | 3300048907 | Bacteria | 2332 |
| 662 | Ga0496104_0198353 | 3300048907 | Bacteria | 1919 |
| 663 | Ga0496105_0010317 | 3300048908 | Bacteria | 7343 |
| 664 | Ga0496105_0011244 | 3300048908 | Bacteria | 7063 |
| 665 | Ga0496105_0135130 | 3300048908 | Bacteria | 2032 |
| 666 | Ga0496105_0175672 | 3300048908 | Bacteria | 1755 |
| 667 | Ga0496106_0055173 | 3300048909 | Bacteria | 3002 |
| 668 | Ga0496106_0111286 | 3300048909 | Bacteria | 2132 |
| 669 | Ga0496107_0032592 | 3300048910 | Bacteria | 3724 |
| 670 | Ga0496108_0140765 | 3300048911 | Bacteria | 2078 |
| 671 | Ga0496109_0022965 | 3300048912 | Bacteria | 5530 |
| 672 | Ga0496109_0030766 | 3300048912 | Bacteria | 4811 |
| 673 | Ga0496109_0074794 | 3300048912 | Bacteria | 3114 |
| 674 | Ga0496109_0222136 | 3300048912 | Bacteria | 1776 |
| 675 | Ga0496109_0415053 | 3300048912 | Bacteria | 1272 |
| 676 | Ga0496110_0073837 | 3300048913 | Bacteria | 3027 |
| 677 | Ga0496110_0092476 | 3300048913 | Bacteria | 2707 |
| 678 | Ga0496110_0309660 | 3300048913 | Bacteria | 1438 |
| 679 | Ga0496110_0353003 | 3300048913 | Bacteria | 1339 |
| 680 | Ga0496111_0006233 | 3300048914 | Bacteria | 7729 |
| 681 | Ga0496111_0043363 | 3300048914 | Bacteria | 3233 |
| 682 | Ga0496111_0381157 | 3300048914 | Bacteria | 1043 |
| 683 | Ga0496112_0022473 | 3300048915 | Bacteria | 6010 |
| 684 | Ga0496112_0053064 | 3300048915 | Bacteria | 3980 |
| 685 | Ga0496112_0190889 | 3300048915 | Bacteria | 2011 |
| 686 | Ga0496112_0284235 | 3300048915 | Bacteria | 1601 |
| 687 | Ga0496113_0018547 | 3300048916 | Bacteria | 4848 |
| 688 | Ga0496113_0360739 | 3300048916 | Bacteria | 1166 |
| 689 | Ga0496114_0037014 | 3300048917 | Bacteria | 4035 |
| 690 | Ga0496114_0486285 | 3300048917 | Bacteria | 1092 |
| 691 | Ga0496115_0030039 | 3300048918 | Bacteria | 4273 |
| 692 | Ga0496115_0059022 | 3300048918 | Bacteria | 3089 |
| 693 | Ga0496115_0091730 | 3300048918 | Bacteria | 2483 |
| 694 | Ga0496117_0098547 | 3300048920 | Bacteria | 1858 |
| 695 | Ga0496120_0026159 | 3300048923 | Bacteria | 3608 |
| 696 | Ga0496123_0092054 | 3300048926 | Bacteria | 1796 |
| 697 | Ga0496126_0146989 | 3300048929 | Bacteria | 2023 |
| 698 | Ga0501031_0058273 | 3300049568 | Bacteria | 2517 |
| 699 | Ga0501032_0000035 | 3300049569 | Bacteria | 117554 |
| 700 | Ga0501032_0046050 | 3300049569 | Bacteria | 2948 |
| 701 | Ga0501032_0048386 | 3300049569 | Bacteria | 2871 |
| 702 | Ga0501032_0101956 | 3300049569 | Bacteria | 1902 |
| 703 | Ga0501033_0000254 | 3300049570 | Bacteria | 51199 |
| 704 | Ga0501033_0009045 | 3300049570 | Bacteria | 7683 |
| 705 | Ga0501034_0001330 | 3300049571 | Bacteria | 33387 |
| 706 | Ga0501034_0014791 | 3300049571 | Bacteria | 8029 |
| 707 | Ga0501034_0020364 | 3300049571 | Bacteria | 6772 |
| 708 | Ga0501034_0118041 | 3300049571 | Bacteria | 2640 |
| 709 | Ga0501034_0148498 | 3300049571 | Bacteria | 2320 |
| 710 | Ga0501034_0340407 | 3300049571 | Bacteria | 1430 |
| 711 | Ga0501036_0000174 | 3300049572 | Bacteria | 42286 |
| 712 | Ga0501036_0003066 | 3300049572 | Bacteria | 13318 |
| 713 | Ga0501036_0004422 | 3300049572 | Bacteria | 11349 |
| 714 | Ga0501036_0015451 | 3300049572 | Bacteria | 6377 |
| 715 | Ga0501036_0216361 | 3300049572 | Bacteria | 1609 |
| 716 | Ga0501037_0000541 | 3300049573 | Bacteria | 30177 |
| 717 | Ga0501037_0071122 | 3300049573 | Bacteria | 2531 |
| 718 | Ga0501038_0000364 | 3300049574 | Bacteria | 39107 |
| 719 | Ga0501038_0000951 | 3300049574 | Bacteria | 25879 |
| 720 | Ga0501038_0010610 | 3300049574 | Bacteria | 8420 |
| 721 | Ga0501038_0113577 | 3300049574 | Bacteria | 2241 |
| 722 | Ga0501038_0116000 | 3300049574 | Bacteria | 2213 |
| 723 | Ga0501038_0189479 | 3300049574 | Bacteria | 1656 |
| 724 | Ga0501038_0397597 | 3300049574 | Bacteria | 1066 |
| 725 | Ga0501039_0000133 | 3300049575 | Bacteria | 51845 |
| 726 | Ga0501039_0004010 | 3300049575 | Bacteria | 11070 |
| 727 | Ga0501039_0049454 | 3300049575 | Bacteria | 3250 |
| 728 | Ga0501039_0062884 | 3300049575 | Bacteria | 2876 |
| 729 | Ga0501040_0060215 | 3300049576 | Bacteria | 2609 |
| 730 | Ga0501040_0081021 | 3300049576 | Bacteria | 2249 |
| 731 | Ga0501041_0042094 | 3300049577 | Bacteria | 2774 |
| 732 | Ga0501042_0011558 | 3300049578 | Bacteria | 5959 |
| 733 | Ga0501042_0028930 | 3300049578 | Bacteria | 3908 |
| 734 | Ga0501043_0000302 | 3300049579 | Bacteria | 44708 |
| 735 | Ga0501043_0001197 | 3300049579 | Bacteria | 22839 |
| 736 | Ga0501046_0000205 | 3300049580 | Bacteria | 61540 |
| 737 | Ga0501046_0085809 | 3300049580 | Bacteria | 2427 |
| 738 | Ga0501047_0001445 | 3300049581 | Bacteria | 23262 |
| 739 | Ga0501047_0007057 | 3300049581 | Bacteria | 10550 |
| 740 | Ga0501047_0104437 | 3300049581 | Bacteria | 2713 |
| 741 | Ga0501047_0227533 | 3300049581 | Bacteria | 1719 |
| 742 | Ga0501048_0000314 | 3300049582 | Bacteria | 33141 |
| 743 | Ga0501048_0002204 | 3300049582 | Bacteria | 14821 |
| 744 | Ga0501067_0072899 | 3300049583 | Bacteria | 1903 |
| 745 | Ga0501068_0016478 | 3300049584 | Bacteria | 4260 |
| 746 | Ga0501069_0000262 | 3300049585 | Bacteria | 23850 |
| 747 | Ga0501070_0000681 | 3300049586 | Bacteria | 31106 |
| 748 | Ga0501070_0079809 | 3300049586 | Bacteria | 2708 |
| 749 | Ga0501070_0167475 | 3300049586 | Bacteria | 1811 |
| 750 | Ga0501072_0216566 | 3300049588 | Bacteria | 1526 |
| 751 | Ga0501073_0005738 | 3300049589 | Bacteria | 9284 |
| 752 | Ga0501073_0021915 | 3300049589 | Bacteria | 4603 |
| 753 | Ga0501074_0000457 | 3300049590 | Bacteria | 24565 |
| 754 | Ga0501074_0007866 | 3300049590 | Bacteria | 7720 |
| 755 | Ga0501074_0085404 | 3300049590 | Bacteria | 2262 |
| 756 | Ga0501075_0155882 | 3300049591 | Bacteria | 1741 |
| 757 | Ga0501076_0074107 | 3300049592 | Bacteria | 2726 |
| 758 | Ga0501076_0149816 | 3300049592 | Bacteria | 1898 |
| 759 | Ga0501079_0112283 | 3300049741 | Bacteria | 2118 |
| 760 | Ga0501079_0173237 | 3300049741 | Bacteria | 1683 |
| 761 | Ga0501080_0000364 | 3300049742 | Bacteria | 35069 |
| 762 | Ga0501080_0028919 | 3300049742 | Bacteria | 5159 |
| 763 | Ga0501081_0070331 | 3300049743 | Bacteria | 2439 |
| 764 | Ga0501083_0031136 | 3300049744 | Bacteria | 3661 |
| 765 | Ga0501035_0003679 | 3300049822 | Bacteria | 14614 |
| 766 | Ga0501035_0005294 | 3300049822 | Bacteria | 12213 |
| 767 | Ga0501035_0052415 | 3300049822 | Bacteria | 3651 |
| 768 | Ga0501035_0077715 | 3300049822 | Bacteria | 2933 |
| 769 | Ga0501035_0135728 | 3300049822 | Bacteria | 2142 |
| 770 | Ga0501044_0001131 | 3300049823 | Bacteria | 31710 |
| 771 | Ga0501044_0004785 | 3300049823 | Bacteria | 15145 |
| 772 | Ga0501044_0045775 | 3300049823 | Bacteria | 4532 |
| 773 | Ga0501044_0055339 | 3300049823 | Bacteria | 4075 |
| 774 | Ga0501044_0122619 | 3300049823 | Bacteria | 2598 |
| 775 | Ga0501045_0275908 | 3300049824 | Bacteria | 1251 |
| 776 | nmdc:mga00v17_45265_c1 | 3300050491 | Bacteria | 2658 |
| 777 | nmdc:mga0yw44_160591_c1 | 3300050492 | Bacteria | 1471 |
| 778 | nmdc:mga07m45_31492_c1 | 3300050496 | Bacteria | 2939 |
| 779 | nmdc:mga05p37_252771_c1 | 3300050507 | Bacteria | 2113 |
| 780 | nmdc:mga05p37_263_c1 | 3300050507 | Bacteria | 54412 |
| 781 | nmdc:mga05p37_33679_c1 | 3300050507 | Bacteria | 6275 |
| 782 | nmdc:mga05p37_52132_c1 | 3300050507 | Bacteria | 5031 |
| 783 | nmdc:mga05p37_672_c1 | 3300050507 | Bacteria | 37785 |
| 784 | nmdc:mga09592_163260_c1 | 3300050508 | Bacteria | 1925 |
| 785 | nmdc:mga09592_2964_c1 | 3300050508 | Bacteria | 13758 |
| 786 | nmdc:mga09592_351690_c1 | 3300050508 | Bacteria | 1275 |
| 787 | nmdc:mga09592_423315_c1 | 3300050508 | Bacteria | 1150 |
| 788 | nmdc:mga09592_7924_c1 | 3300050508 | Bacteria | 8633 |
| 789 | nmdc:mga0qj67_20471_c1 | 3300050509 | Bacteria | 5065 |
| 790 | nmdc:mga0qj67_294_c1 | 3300050509 | Bacteria | 34748 |
| 791 | nmdc:mga0qj67_5016_c1 | 3300050509 | Bacteria | 9618 |
| 792 | nmdc:mga0qj67_65955_c1 | 3300050509 | Bacteria | 2883 |
| 793 | nmdc:mga06r32_217_c1 | 3300050510 | Bacteria | 46509 |
| 794 | nmdc:mga06r32_285_c2 | 3300050510 | Bacteria | 37898 |
| 795 | nmdc:mga06r32_29142_c1 | 3300050510 | Bacteria | 5171 |
| 796 | nmdc:mga06r32_5826_c1 | 3300050510 | Bacteria | 11100 |
| 797 | nmdc:mga06r32_6085_c1 | 3300050510 | Bacteria | 10839 |
| 798 | nmdc:mga06r32_6270_c1 | 3300050510 | Bacteria | 10677 |
| 799 | nmdc:mga06r32_649107_c1 | 3300050510 | Bacteria | 1023 |
| 800 | nmdc:mga08y16_12424_c1 | 3300050511 | Bacteria | 8960 |
| 801 | nmdc:mga08y16_71851_c1 | 3300050511 | Bacteria | 3606 |
| 802 | nmdc:mga0rr50_100493_c1 | 3300050513 | Bacteria | 2272 |
| 803 | Ga0495601_0002431 | 3300053077 | Bacteria | 10567 |
| 804 | Ga0495601_0012631 | 3300053077 | Bacteria | 5066 |
| 805 | Ga0495601_0023571 | 3300053077 | Bacteria | 3782 |
| 806 | Ga0495601_0075180 | 3300053077 | Bacteria | 2162 |
| 807 | Ga0495601_0115629 | 3300053077 | Bacteria | 1739 |
| 808 | Ga0495601_0287420 | 3300053077 | Bacteria | 1072 |
| 809 | Ga0495601_0304408 | 3300053077 | Bacteria | 1038 |
| 810 | Ga0495612_0005805 | 3300053078 | Bacteria | 5097 |
| 811 | Ga0495612_0011994 | 3300053078 | Bacteria | 3492 |
| 812 | Ga0495612_0020048 | 3300053078 | Bacteria | 2679 |
| 813 | Ga0495612_0048694 | 3300053078 | Bacteria | 1738 |
| 814 | Ga0495619_0025865 | 3300053085 | Bacteria | 3773 |
| 815 | Ga0495619_0149306 | 3300053085 | Bacteria | 1612 |
| 816 | Ga0495619_0197485 | 3300053085 | Bacteria | 1393 |
| 817 | Ga0500650_0021699 | 3300053098 | Bacteria | 2833 |
| 818 | Ga0500560_000662 | 3300053107 | Bacteria | 5090 |
| 819 | Ga0500559_0000733 | 3300053136 | Bacteria | 21579 |
| 820 | Ga0500568_0000107 | 3300053139 | Bacteria | 77492 |
| 821 | Ga0500573_0064778 | 3300053140 | Bacteria | 2090 |
| 822 | Ga0500577_0027280 | 3300053142 | Bacteria | 1954 |
| 823 | Ga0500577_0041201 | 3300053142 | Bacteria | 1683 |
| 824 | Ga0500600_0082316 | 3300053149 | Bacteria | 1738 |
| 825 | Ga0500600_0096576 | 3300053149 | Bacteria | 1567 |
| 826 | Ga0500634_0081617 | 3300053161 | Bacteria | 1665 |
| 827 | Ga0501084_0002579 | 3300054114 | Bacteria | 14601 |
| 828 | Ga0501082_0373894 | 3300060353 | Bacteria | 1243 |
| 829 | Ga0466962_0000193 | 3300061719 | Bacteria | 25238 |
| 830 | Ga0466962_0000253 | 3300061719 | Bacteria | 22558 |
| 831 | Ga0466962_0041859 | 3300061719 | Bacteria | 2192 |
| 832 | Ga0466962_0054913 | 3300061719 | Bacteria | 1903 |
| 833 | 2501944816 | 2501939600 | Bacteria | 6907073 |
| 834 | 2515857250 | 2515154155 | Bacteria | 7985436 |
| 835 | 2552112603 | 2551306166 | Bacteria | 9731570 |
| 836 | 2554260410 | 2554235005 | Bacteria | 6457341 |
| 837 | 2558907112 | 2558860112 | Bacteria | 9931328 |
| 838 | 2559427757 | 2558860280 | Bacteria | 11429938 |
| 839 | 2585309357 | 2582581313 | Bacteria | 10042643 |
| 840 | 2585311910 | 2582581314 | Bacteria | 11452267 |
| 841 | 2586061523 | 2585427649 | Bacteria | 9053857 |
| 842 | 2616696303 | 2616644814 | Bacteria | 11555299 |
| 843 | 2616699080 | 2616644814 | Bacteria | 11555299 |
| 844 | 2616902691 | 2616644941 | Bacteria | 8510691 |
| 845 | 2643784229 | 2643221553 | Bacteria | 3544260 |
| 846 | 2643904335 | 2643221578 | Bacteria | 9213798 |
| 847 | 2644174194 | 2643221631 | Bacteria | 8168043 |
| 848 | 2644264665 | 2643221647 | Bacteria | 10741251 |
| 849 | 2644277864 | 2643221649 | Bacteria | 3867359 |
| 850 | 2644333841 | 2643221659 | Bacteria | 7890716 |
| 851 | 2644402688 | 2643221673 | Bacteria | 9196637 |
| 852 | 2644437972 | 2643221678 | Bacteria | 9540101 |
| 853 | 2644447216 | 2643221679 | Bacteria | 3839507 |
| 854 | 2644631222 | 2643221714 | Bacteria | 9015452 |
| 855 | 2676476482 | 2675903058 | Bacteria | 6822861 |
| 856 | 2723643223 | 2721755702 | Bacteria | 4373124 |
| 857 | 2738695533 | 2738541272 | Bacteria | 6848551 |
| 858 | 2739326324 | 2738543027 | Bacteria | 6409078 |
| 859 | 2739604775 | 2739367654 | Bacteria | 6049412 |
| 860 | 2760308206 | 2758568522 | Bacteria | 5953541 |
| 861 | 2760623215 | 2758568621 | Bacteria | 5967089 |
| 862 | 2784591413 | 2784132148 | Bacteria | 8627943 |
| 863 | 2785339733 | 2784746763 | Bacteria | 9783172 |
| 864 | 2785372403 | 2784746768 | Bacteria | 10036182 |
| 865 | 2786673534 | 2786546132 | Bacteria | 10419719 |
| 866 | 2793975731 | 2791355406 | Bacteria | 11364898 |
| 867 | 2795796884 | 2795385472 | Bacteria | 6627535 |
| 868 | 2808628904 | 2808606306 | Bacteria | 3608896 |
| 869 | 2808845118 | 2808606359 | Bacteria | 9866990 |
| 870 | 2808901759 | 2808606372 | Bacteria | 4649509 |
| 871 | 2808914806 | 2808606375 | Bacteria | 9466072 |
| 872 | 2809027961 | 2808606394 | Bacteria | 6248540 |
| 873 | 2809235015 | 2808606448 | Bacteria | 8656184 |
| 874 | 2809589368 | 2808606522 | Bacteria | 9488490 |
| 875 | 2811843043 | 2808606982 | Bacteria | 7791042 |
| 876 | 2812354494 | 2811994879 | Bacteria | 9313447 |
| 877 | 2812477300 | 2811994917 | Bacteria | 7761064 |
| 878 | 2816421626 | 2816332119 | Bacteria | 8120218 |
| 879 | 2819743762 | 2818991472 | Bacteria | 10089953 |
| 880 | 2827632291 | 2827628540 | Bacteria | 6858585 |
| 881 | 2837269505 | 2837268691 | Bacteria | 7850704 |
| 882 | 2844850960 | 2844849076 | Bacteria | 4091819 |
| 883 | 2852678528 | 2852677369 | Bacteria | 3768884 |
| 884 | 2856863739 | 2856858025 | Bacteria | 7255264 |
| 885 | 2857721453 | 2857720070 | Bacteria | 3189373 |
| 886 | 2857733326 | 2857729791 | Bacteria | 4040535 |
| 887 | 2858904359 | 2858902515 | Bacteria | 7086037 |
| 888 | 2861524026 | 2861520306 | Bacteria | 8348283 |
| 889 | 2862180255 | 2862178590 | Bacteria | 8583590 |
| 890 | 2862284058 | 2862281513 | Bacteria | 9621493 |
| 891 | 2862388723 | 2862382967 | Bacteria | 10317375 |
| 892 | 2862575357 | 2862574272 | Bacteria | 10567477 |
| 893 | 2862994973 | 2862993130 | Bacteria | 3860849 |
| 894 | 2863410275 | 2863404153 | Bacteria | 9672205 |
| 895 | 2867305704 | 2867302475 | Bacteria | 7087181 |
| 896 | 2867314991 | 2867312974 | Bacteria | 7058875 |
| 897 | 2867320012 | 2867319477 | Bacteria | 7069771 |
| 898 | 2867434177 | 2867428634 | Bacteria | 9590268 |
| 899 | 2867475199 | 2867475112 | Bacteria | 6909112 |
| 900 | 2868095011 | 2868088558 | Bacteria | 7609351 |
| 901 | 2873152801 | 2873151551 | Bacteria | 8625867 |
| 902 | 2873319406 | 2873314349 | Bacteria | 8512634 |
| 903 | 2877678257 | 2877676314 | Bacteria | 9512378 |
| 904 | 2883822716 | 2883821847 | Bacteria | 5121194 |
| 905 | 2884700572 | 2884693830 | Bacteria | 11273186 |
| 906 | 2895430746 | 2895427314 | Bacteria | 13147766 |
| 907 | 2895450207 | 2895442618 | Bacteria | 11027144 |
| 908 | 2899364440 | 2899359706 | Bacteria | 10940472 |
| 909 | 2912716891 | 2912715099 | Bacteria | 9460473 |
| 910 | 2912726510 | 2912723979 | Bacteria | 8557534 |
| 911 | 2912764148 | 2912757875 | Bacteria | 7940295 |
| 912 | 2915772562 | 2915768154 | Bacteria | 8424322 |
| 913 | 2919471085 | 2919468124 | Bacteria | 9133025 |
| 914 | 2928093658 | 2928090899 | Bacteria | 3158267 |
| 915 | 2928121520 | 2928121344 | Bacteria | 3972376 |
| 916 | 2935391096 | 2935390628 | Bacteria | 7043367 |
| 917 | 2935412036 | 2935409751 | Bacteria | 4179611 |
| 918 | 2939647351 | 2939647034 | Bacteria | 4681660 |
| 919 | 2945958941 | 2945956166 | Bacteria | 5110334 |
| 920 | 2946024333 | 2946024296 | Bacteria | 3508095 |
| 921 | 2946036304 | 2946033335 | Bacteria | 3835514 |
| 922 | 2946047312 | 2946045630 | Bacteria | 8527308 |
| 923 | 2946071209 | 2946064051 | Bacteria | 8957905 |
| 924 | 2946078990 | 2946072368 | Bacteria | 8999607 |
| 925 | 2954010529 | 2954002825 | Bacteria | 9173742 |
| 926 | 2954383151 | 2954380949 | Bacteria | 10050426 |
| 927 | 2954679840 | 2954673503 | Bacteria | 9685905 |
| 928 | 2954684313 | 2954682443 | Bacteria | 9862841 |
| 929 | 2954693863 | 2954691527 | Bacteria | 10720516 |
| 930 | 2954708974 | 2954701450 | Bacteria | 10834262 |
| 931 | 2954713494 | 2954711539 | Bacteria | 10867210 |
| 932 | 2954723459 | 2954721474 | Bacteria | 10456478 |
| 933 | 2954738370 | 2954731030 | Bacteria | 10243860 |
| 934 | 2954742363 | 2954740390 | Bacteria | 10229294 |
| 935 | 2954757232 | 2954749733 | Bacteria | 10366972 |
| 936 | 2954761333 | 2954759201 | Bacteria | 9358192 |
| 937 | 2984582650 | 2984580707 | Bacteria | 3351387 |
| 938 | 2990046265 | 2990044586 | Bacteria | 6603797 |
| 939 | 2990067028 | 2990059506 | Bacteria | 9321252 |
| 940 | 2995469381 | 2995463766 | Bacteria | 8577691 |
| 941 | 2997601259 | 2997600082 | Bacteria | 9896405 |
| 942 | 3003006367 | 3002998708 | Bacteria | 11715108 |
| 943 | 3006489421 | 3006486233 | Bacteria | 8157040 |
| 944 | 3006500510 | 3006493962 | Bacteria | 8825450 |
| 945 | 649814519 | 649633069 | Bacteria | 6962533 |
| 946 | 8003317819 | 8003314358 | Bacteria | 10575343 |
| 947 | 8004025408 | 8004021418 | Bacteria | 4313954 |
| 948 | 8008489048 | 8008485437 | Bacteria | 7198341 |
| 949 | 8008564271 | 8008558824 | Bacteria | 10610750 |
| 950 | 8008575804 | 8008574985 | Bacteria | 7815457 |
| 951 | 8023630328 | 8023623736 | Bacteria | 8593882 |
| 952 | 8025484987 | 8025478263 | Bacteria | 8209203 |
| 953 | 8025528531 | 8025524527 | Bacteria | 7197316 |
| 954 | 8025535335 | 8025530807 | Bacteria | 8495698 |
| 955 | 8033690088 | 8033684223 | Bacteria | 6906479 |
| 956 | 8047897436 | 8047893842 | Bacteria | 11723082 |
| 957 | 8048133296 | 8048127548 | Bacteria | 11053136 |
| 958 | 8048361434 | 8048356638 | Bacteria | 11044339 |
| 959 | 8048374423 | 8048369669 | Bacteria | 11666822 |
| 960 | 8048383799 | 8048379754 | Bacteria | 11877923 |
| 961 | 8048411921 | 8048406513 | Bacteria | 8936924 |
| 962 | 8055068630 | 8055066027 | Bacteria | 9479577 |
| 963 | 8055174514 | 8055172936 | Bacteria | 9305943 |
| 964 | 8056059551 | 8056054917 | Bacteria | 5736694 |
| 965 | 8056065356 | 8056060235 | Bacteria | 7259403 |
| 966 | 8056213556 | 8056207758 | Bacteria | 8639239 |
| 967 | 8056582150 | 8056579771 | Bacteria | 5840325 |
| 968 | 8056667681 | 8056667051 | Bacteria | 6953971 |
| 969 | 8056832697 | 8056829672 | Bacteria | 9045328 |
| 970 | 8057572497 | 8057568493 | Bacteria | 7221719 |
| 971 | Ga0501044_0322262 | |||
| 972 | JGI25152J39213_1000445 | |||
| 973 | JGI25406J46586_10009421 | |||
| 974 | Ga0070658_10014870 | |||
| 975 | Ga0070658_10089827 | |||
| 976 | Ga0070658_10131060 | |||
| 977 | Ga0070676_10075008 | |||
| 978 | Ga0070683_100002200 | |||
| 979 | Ga0070683_100205562 | |||
| 980 | Ga0070690_100058806 | |||
| 981 | Ga0070670_100128749 | |||
| 982 | Ga0068869_100212969 | |||
| 983 | Ga0070680_100000156 | |||
| 984 | Ga0070682_100203931 | |||
| 985 | Ga0068868_100033216 | |||
| 986 | Ga0068868_100049968 | |||
| 987 | Ga0068868_100065164 | |||
| 988 | Ga0070660_100019637 | |||
| 989 | Ga0070687_100002948 | |||
| 990 | Ga0070661_100005318 | |||
| 991 | Ga0070668_100002459 | |||
| 992 | Ga0070668_100004175 | |||
| 993 | Ga0070668_100013671 | |||
| 994 | Ga0070668_100036839 | |||
| 995 | Ga0070675_100002879 | |||
| 996 | Ga0070675_100131771 | |||
| 997 | Ga0070659_100006993 | |||
| 998 | Ga0070659_100011938 | |||
| 999 | Ga0070709_10023711 | |||
| 1000 | Ga0070714_100001183 | |||
| 1001 | Ga0070714_100011882 | |||
| 1002 | Ga0070714_100023790 | |||
| 1003 | Ga0070713_100127251 | |||
| 1004 | Ga0070710_10000059 | |||
| 1005 | Ga0070701_10035737 | |||
| 1006 | Ga0070711_100005825 | |||
| 1007 | Ga0070700_100000010 | |||
| 1008 | Ga0070700_100117232 | |||
| 1009 | Ga0070708_100070123 | |||
| 1010 | Ga0070663_100002831 | |||
| 1011 | Ga0070663_100028631 | |||
| 1012 | Ga0070663_100086824 | |||
| 1013 | Ga0070678_100017990 | |||
| 1014 | Ga0070662_100091599 | |||
| 1015 | Ga0070681_10000051 | |||
| 1016 | Ga0070706_100230711 | |||
| 1017 | Ga0070698_100145680 | |||
| 1018 | Ga0070679_100000058 | |||
| 1019 | Ga0070684_100026442 | |||
| 1020 | Ga0068853_100034571 | |||
| 1021 | Ga0068853_100041007 | |||
| 1022 | Ga0070672_100214960 | |||
| 1023 | Ga0070672_100215547 | |||
| 1024 | Ga0070672_100250678 | |||
| 1025 | Ga0070686_100062796 | |||
| 1026 | Ga0070686_100077604 | |||
| 1027 | Ga0070695_100006608 | |||
| 1028 | Ga0070696_100002797 | |||
| 1029 | Ga0070696_100046761 | |||
| 1030 | Ga0070693_100005019 | |||
| 1031 | Ga0070665_100026257 | |||
| 1032 | Ga0070665_100106861 | |||
| 1033 | Ga0070704_100060908 | |||
| 1034 | Ga0068855_100021380 | |||
| 1035 | Ga0068855_100042269 | |||
| 1036 | Ga0068855_100407636 | |||
| 1037 | Ga0070664_100000709 | |||
| 1038 | Ga0070664_100212551 | |||
| 1039 | Ga0068857_100194485 | |||
| 1040 | Ga0068857_100261883 | |||
| 1041 | Ga0068854_100001593 | |||
| 1042 | Ga0068854_100019187 | |||
| 1043 | Ga0068854_100044222 | |||
| 1044 | Ga0068854_100097628 | |||
| 1045 | Ga0068856_100060920 | |||
| 1046 | Ga0068856_100102841 | |||
| 1047 | Ga0068856_100152945 | |||
| 1048 | Ga0070702_100046942 | |||
| 1049 | Ga0070702_100047143 | |||
| 1050 | Ga0070702_100051996 | |||
| 1051 | Ga0068852_100044208 | |||
| 1052 | Ga0068859_100118195 | |||
| 1053 | Ga0068859_100211730 | |||
| 1054 | Ga0068864_100017421 | |||
| 1055 | Ga0068866_10007714 | |||
| 1056 | Ga0068861_100041128 | |||
| 1057 | Ga0068861_100044201 | |||
| 1058 | Ga0068851_10009022 | |||
| 1059 | Ga0068863_100116961 | |||
| 1060 | Ga0068858_100012588 | |||
| 1061 | Ga0068858_100032797 | |||
| 1062 | Ga0068860_100028494 | |||
| 1063 | Ga0068860_100207123 | |||
| 1064 | Ga0068862_100117230 | |||
| 1065 | Ga0081455_10000030 | |||
| 1066 | Ga0081455_10000167 | |||
| 1067 | Ga0081455_10009504 | |||
| 1068 | Ga0081455_10011405 | |||
| 1069 | Ga0081538_10002078 | |||
| 1070 | Ga0081538_10031153 | |||
| 1071 | Ga0081538_10042653 | |||
| 1072 | Ga0081540_1004241 | |||
| 1073 | Ga0081540_1008022 | |||
| 1074 | Ga0081539_10000079 | |||
| 1075 | Ga0081539_10000574 | |||
| 1076 | Ga0081539_10050003 | |||
| 1077 | Ga0070717_10002723 | |||
| 1078 | Ga0070717_10039881 | |||
| 1079 | Ga0075363_100058972 | |||
| 1080 | Ga0070715_10014425 | |||
| 1081 | Ga0070712_100016307 | |||
| 1082 | Ga0070712_100042881 | |||
| 1083 | Ga0075367_10000070 | |||
| 1084 | Ga0097621_100039480 | |||
| 1085 | Ga0097621_100048999 | |||
| 1086 | Ga0068871_100020867 | |||
| 1087 | Ga0075428_100000122 | |||
| 1088 | Ga0075428_100001356 | |||
| 1089 | Ga0075428_100136999 | |||
| 1090 | Ga0075430_100003241 | |||
| 1091 | Ga0075430_100016753 | |||
| 1092 | Ga0075431_100002314 | |||
| 1093 | Ga0075431_100003329 | |||
| 1094 | Ga0075431_100009370 | |||
| 1095 | Ga0075431_100039497 | |||
| 1096 | Ga0075434_100135577 | |||
| 1097 | Ga0075434_100526668 | |||
| 1098 | Ga0075429_100003556 | |||
| 1099 | Ga0075429_100033333 | |||
| 1100 | Ga0075429_100241963 | |||
| 1101 | Ga0068865_100033664 | |||
| 1102 | Ga0097620_100118192 | |||
| 1103 | Ga0097620_100211728 | |||
| 1104 | Ga0099826_10056709 | |||
| 1105 | Ga0075435_100022895 | |||
| 1106 | Ga0105240_10163108 | |||
| 1107 | Ga0111539_10001616 | |||
| 1108 | Ga0111539_10057246 | |||
| 1109 | Ga0111539_10139506 | |||
| 1110 | Ga0105245_10002942 | |||
| 1111 | Ga0105245_10691348 | |||
| 1112 | Ga0105247_10010343 | |||
| 1113 | Ga0105247_10049962 | |||
| 1114 | Ga0105247_10122853 | |||
| 1115 | Ga0105247_10144624 | |||
| 1116 | Ga0114129_10008813 | |||
| 1117 | Ga0114129_10045350 | |||
| 1118 | Ga0114129_10046039 | |||
| 1119 | Ga0114129_10106851 | |||
| 1120 | Ga0105243_10002445 | |||
| 1121 | Ga0105243_10199198 | |||
| 1122 | Ga0105243_10226946 | |||
| 1123 | Ga0105241_10018236 | |||
| 1124 | Ga0105241_10041270 | |||
| 1125 | Ga0105242_10036982 | |||
| 1126 | Ga0105242_10208099 | |||
| 1127 | Ga0105248_10075709 | |||
| 1128 | Ga0105248_10085261 | |||
| 1129 | Ga0105237_10090473 | |||
| 1130 | Ga0105238_10092444 | |||
| 1131 | Ga0105238_10375140 | |||
| 1132 | Ga0105249_10014986 | |||
| 1133 | Ga0105249_10153562 | |||
| 1134 | Ga0105239_10020508 | |||
| 1135 | Ga0105239_10045095 | |||
| 1136 | Ga0105239_10172165 | |||
| 1137 | Ga0105246_10013328 | |||
| 1138 | Ga0105246_10015872 | |||
| 1139 | Ga0105246_10046601 | |||
| 1140 | Ga0105246_10144099 | |||
| 1141 | Ga0157370_10001204 | |||
| 1142 | Ga0157370_10013756 | |||
| 1143 | Ga0157369_10008913 | |||
| 1144 | Ga0157369_10021005 | |||
| 1145 | Ga0157369_10052139 | |||
| 1146 | Ga0157369_10056962 | |||
| 1147 | Ga0157374_10037034 | |||
| 1148 | Ga0157374_10122052 | |||
| 1149 | Ga0157378_10246728 | |||
| 1150 | Ga0163162_10354167 | |||
| 1151 | Ga0157372_10107597 | |||
| 1152 | Ga0157372_10169223 | |||
| 1153 | Ga0157372_10225124 | |||
| 1154 | Ga0157372_10595670 | |||
| 1155 | Ga0157375_10062713 | |||
| 1156 | Ga0163163_10056263 | |||
| 1157 | Ga0163163_10065086 | |||
| 1158 | Ga0163163_10506199 | |||
| 1159 | Ga0157380_10014210 | |||
| 1160 | Ga0157380_10058066 | |||
| 1161 | Ga0157380_10286205 | |||
| 1162 | Ga0157377_10048573 | |||
| 1163 | Ga0157377_10179319 | |||
| 1164 | Ga0157379_10004656 | |||
| 1165 | Ga0157376_10020861 | |||
| 1166 | Ga0182007_10002031 | |||
| 1167 | Ga0183367_1001 | |||
| 1168 | Ga0163161_10130249 | |||
| 1169 | Ga0213875_10000059 | |||
| 1170 | Ga0209129_1000052 | |||
| 1171 | Ga0207426_1000529 | |||
| 1172 | Ga0207656_10038525 | |||
| 1173 | Ga0207692_10000425 | |||
| 1174 | Ga0207642_10042646 | |||
| 1175 | Ga0207688_10018028 | |||
| 1176 | Ga0207688_10056781 | |||
| 1177 | Ga0207647_10012612 | |||
| 1178 | Ga0207705_10105360 | |||
| 1179 | Ga0207654_10058353 | |||
| 1180 | Ga0207707_10000113 | |||
| 1181 | Ga0207695_10001059 | |||
| 1182 | Ga0207671_10001162 | |||
| 1183 | Ga0207693_10002417 | |||
| 1184 | Ga0207693_10004119 | |||
| 1185 | Ga0207693_10021176 | |||
| 1186 | Ga0207693_10172809 | |||
| 1187 | Ga0207663_10087121 | |||
| 1188 | Ga0207660_10012487 | |||
| 1189 | Ga0207662_10059754 | |||
| 1190 | Ga0207657_10004409 | |||
| 1191 | Ga0207657_10151762 | |||
| 1192 | Ga0207649_10047713 | |||
| 1193 | Ga0207652_10000123 | |||
| 1194 | Ga0207652_10406516 | |||
| 1195 | Ga0207646_10172182 | |||
| 1196 | Ga0207681_10299517 | |||
| 1197 | Ga0207694_10001998 | |||
| 1198 | Ga0207659_10018180 | |||
| 1199 | Ga0207687_10030669 | |||
| 1200 | Ga0207687_10328037 | |||
| 1201 | Ga0207700_10114971 | |||
| 1202 | Ga0207700_10301647 | |||
| 1203 | Ga0207664_10005713 | |||
| 1204 | Ga0207664_10023474 | |||
| 1205 | Ga0207664_10030193 | |||
| 1206 | Ga0207664_10229485 | |||
| 1207 | Ga0207664_10282249 | |||
| 1208 | Ga0207706_10037884 | |||
| 1209 | Ga0207709_10001815 | |||
| 1210 | Ga0207670_10035048 | |||
| 1211 | Ga0207670_10096349 | |||
| 1212 | Ga0207704_10168302 | |||
| 1213 | Ga0207665_10000614 | |||
| 1214 | Ga0207665_10024055 | |||
| 1215 | Ga0207691_10130149 | |||
| 1216 | Ga0207711_10034886 | |||
| 1217 | Ga0207689_10112524 | |||
| 1218 | Ga0207661_10018974 | |||
| 1219 | Ga0207661_10049061 | |||
| 1220 | Ga0207661_10064171 | |||
| 1221 | Ga0207661_10264433 | |||
| 1222 | Ga0207679_10012474 | |||
| 1223 | Ga0207651_10026631 | |||
| 1224 | Ga0207651_10215163 | |||
| 1225 | Ga0207712_10069101 | |||
| 1226 | Ga0207712_10176386 | |||
| 1227 | Ga0207668_10005141 | |||
| 1228 | Ga0207668_10071539 | |||
| 1229 | Ga0207668_10083733 | |||
| 1230 | Ga0207668_10088882 | |||
| 1231 | Ga0207640_10079154 | |||
| 1232 | Ga0207677_10032651 | |||
| 1233 | Ga0207677_10252263 | |||
| 1234 | Ga0207703_10039924 | |||
| 1235 | Ga0207703_10054606 | |||
| 1236 | Ga0207639_10039721 | |||
| 1237 | Ga0207639_10181745 | |||
| 1238 | Ga0207639_10248820 | |||
| 1239 | Ga0207678_10000020 | |||
| 1240 | Ga0207678_10040880 | |||
| 1241 | Ga0207678_10051230 | |||
| 1242 | Ga0207678_10087353 | |||
| 1243 | Ga0207708_10000006 | |||
| 1244 | Ga0207708_10039915 | |||
| 1245 | Ga0207708_10147151 | |||
| 1246 | Ga0207702_10010965 | |||
| 1247 | Ga0207702_10018672 | |||
| 1248 | Ga0207702_10047176 | |||
| 1249 | Ga0207702_10050092 | |||
| 1250 | Ga0207641_10256206 | |||
| 1251 | Ga0207676_10118697 | |||
| 1252 | Ga0207676_10161593 | |||
| 1253 | Ga0207674_10049588 | |||
| 1254 | Ga0207674_10097973 | |||
| 1255 | Ga0207674_10107654 | |||
| 1256 | Ga0207674_10138284 | |||
| 1257 | Ga0207674_10263916 | |||
| 1258 | Ga0207674_10315644 | |||
| 1259 | Ga0207675_100013792 | |||
| 1260 | Ga0207675_100025166 | |||
| 1261 | Ga0207675_100060807 | |||
| 1262 | Ga0207675_100127145 | |||
| 1263 | Ga0207675_100441914 | |||
| 1264 | Ga0207683_10005158 | |||
| 1265 | Ga0207683_10275448 | |||
| 1266 | Ga0207683_10436891 | |||
| 1267 | Ga0207698_10353589 | |||
| 1268 | Ga0207428_10006204 | |||
| 1269 | Ga0268266_10067532 | |||
| 1270 | Ga0268266_10256806 | |||
| 1271 | Ga0268265_10046240 | |||
| 1272 | Ga0268265_10083953 | |||
| 1273 | Ga0268265_10165658 | |||
| 1274 | Ga0268264_10110444 | |||
| 1275 | Ga0268264_10483451 | |||
| 1276 | Ga0307517_10033266 | |||
| 1277 | Ga0307517_10052366 | |||
| 1278 | Ga0307515_10000441 | |||
| 1279 | Ga0307515_10000890 | |||
| 1280 | Ga0307515_10003987 | |||
| 1281 | Ga0307515_10019377 | |||
| 1282 | Ga0307515_10147187 | |||
| 1283 | Ga0307511_10003983 | |||
| 1284 | Ga0307511_10032674 | |||
| 1285 | Ga0307511_10131391 | |||
| 1286 | Ga0307512_10003190 | |||
| 1287 | Ga0307512_10005175 | |||
| 1288 | Ga0307512_10025182 | |||
| 1289 | Ga0307512_10032592 | |||
| 1290 | Ga0307513_10000049 | |||
| 1291 | Ga0307513_10005311 | |||
| 1292 | Ga0307513_10040682 | |||
| 1293 | Ga0307513_10100011 | |||
| 1294 | Ga0307513_10314451 | |||
| 1295 | Ga0307509_10063006 | |||
| 1296 | Ga0307509_10132991 | |||
| 1297 | Ga0307508_10034964 | |||
| 1298 | Ga0307508_10092020 | |||
| 1299 | Ga0307508_10139597 | |||
| 1300 | Ga0307514_10035752 | |||
| 1301 | Ga0316576_10026192 | |||
| 1302 | Ga0307516_10000459 | |||
| 1303 | Ga0307516_10010622 | |||
| 1304 | Ga0307413_10000136 | |||
| 1305 | Ga0307518_10000210 | |||
| 1306 | Ga0307518_10112364 | |||
| 1307 | Ga0307406_10000480 | |||
| 1308 | Ga0307406_10007642 | |||
| 1309 | Ga0307406_10086241 | |||
| 1310 | Ga0307407_10227035 | |||
| 1311 | Ga0307412_10017085 | |||
| 1312 | Ga0307409_100012247 | |||
| 1313 | Ga0307409_100015255 | |||
| 1314 | Ga0307409_100062574 | |||
| 1315 | Ga0307409_100089366 | |||
| 1316 | Ga0307409_100225110 | |||
| 1317 | Ga0307416_100376487 | |||
| 1318 | Ga0307415_100036318 | |||
| 1319 | Ga0307415_100042312 | |||
| 1320 | Ga0307415_100071228 | |||
| 1321 | Ga0307415_100147547 | |||
| 1322 | Ga0307507_10000240 | |||
| 1323 | Ga0307507_10015925 | |||
| 1324 | Ga0307507_10133015 | |||
| 1325 | Ga0307510_10020202 | |||
| 1326 | Ga0307510_10021005 | |||
| 1327 | Ga0373929_0014916 | |||
| 1328 | Ga0373944_0059757 | |||
| 1329 | Ga0373960_0029957 | |||
| 1330 | Ga0373960_0041959 | |||
| 1331 | Ga0373961_0040296 | |||
| 1332 | Ga0373931_0033554 | |||
| 1333 | Ga0373931_0129709 | |||
| 1334 | Ga0373935_0284621 | |||
| 1335 | Ga0373933_0128274 | |||
| 1336 | Ga0373937_0021513 | |||
| 1337 | Ga0316584_0031709 | |||
| 1338 | Ga0373925_0146177 | |||
| 1339 | Ga0395899_0001340 | |||
| 1340 | Ga0395899_0312981 | |||
| 1341 | Ga0395900_0045701 | |||
| 1342 | Ga0395900_0170083 | |||
| 1343 | Ga0395900_0439104 | |||
| 1344 | Ga0395898_0003182 | |||
| 1345 | Ga0395898_0021072 | |||
| 1346 | Ga0395898_0053926 | |||
| 1347 | Ga0395898_0416284 | |||
| 1348 | Ga0436364_0082088 | |||
| 1349 | Ga0436364_0434599 | |||
| 1350 | Ga0436364_1038197 | |||
| 1351 | Ga0395901_0070494 | |||
| 1352 | Ga0395901_0086954 | |||
| 1353 | Ga0395901_0120406 | |||
| 1354 | Ga0395901_0180249 | |||
| 1355 | Ga0395901_0228495 | |||
| 1356 | Ga0436365_0005296 | |||
| 1357 | Ga0436365_0086936 | |||
| 1358 | Ga0436365_1724486 | |||
| 1359 | Ga0436360_0644977 | |||
| 1360 | Ga0436363_1427861 | |||
| 1361 | Ga0439436_0014724 | |||
| 1362 | Ga0439438_012603 | |||
| 1363 | Ga0439439_0003123 | |||
| 1364 | Ga0439439_0005869 | |||
| 1365 | Ga0439466_0021351 | |||
| 1366 | Ga0451797_0641249 | |||
| 1367 | Ga0451841_0401691 | |||
| 1368 | Ga0451853_0901394 | |||
| 1369 | Ga0451853_2187299 | |||
| 1370 | Ga0439431_0031195 | |||
| 1371 | Ga0439442_008243 | |||
| 1372 | Ga0439449_0005291 | |||
| 1373 | Ga0439449_0006288 | |||
| 1374 | Ga0439449_0021245 | |||
| 1375 | Ga0439457_001041 | |||
| 1376 | Ga0439457_001522 | |||
| 1377 | Ga0439457_002767 | |||
| 1378 | Ga0439462_0007584 | |||
| 1379 | Ga0450895_001040 | |||
| 1380 | Ga0450898_000988 | |||
| 1381 | Ga0450899_000974 | |||
| 1382 | Ga0450903_001545 | |||
| 1383 | Ga0450906_004982 | |||
| 1384 | Ga0439458_0000386 | |||
| 1385 | Ga0439458_0008194 | |||
| 1386 | Ga0450908_011499 | |||
| 1387 | Ga0466969_0001812 | |||
| 1388 | Ga0466969_0004618 | |||
| 1389 | Ga0466969_0011774 | |||
| 1390 | Ga0466969_0024437 | |||
| 1391 | Ga0466969_0028597 | |||
| 1392 | Ga0466969_0030546 | |||
| 1393 | Ga0466972_0011041 | |||
| 1394 | Ga0466972_0018352 | |||
| 1395 | Ga0466972_0025141 | |||
| 1396 | Ga0466972_0043254 | |||
| 1397 | Ga0466965_0002520 | |||
| 1398 | Ga0466965_0006268 | |||
| 1399 | Ga0466965_0073123 | |||
| 1400 | Ga0466965_0096930 | |||
| 1401 | Ga0466966_0003935 | |||
| 1402 | Ga0466966_0012226 | |||
| 1403 | Ga0466966_0012941 | |||
| 1404 | Ga0466966_0023881 | |||
| 1405 | Ga0466966_0032031 | |||
| 1406 | Ga0466961_0002630 | |||
| 1407 | Ga0466961_0008124 | |||
| 1408 | Ga0466961_0008808 | |||
| 1409 | Ga0466961_0009249 | |||
| 1410 | Ga0466961_0021521 | |||
| 1411 | Ga0466961_0027411 | |||
| 1412 | Ga0466961_0032383 | |||
| 1413 | Ga0466961_0044944 | |||
| 1414 | Ga0466961_0060687 | |||
| 1415 | Ga0466961_0152224 | |||
| 1416 | Ga0466963_0000099 | |||
| 1417 | Ga0466963_0011870 | |||
| 1418 | Ga0466963_0015542 | |||
| 1419 | Ga0466963_0073742 | |||
| 1420 | Ga0466963_0092372 | |||
| 1421 | Ga0466963_0136836 | |||
| 1422 | Ga0466963_0141224 | |||
| 1423 | Ga0466964_0000321 | |||
| 1424 | Ga0466971_0001426 | |||
| 1425 | Ga0466971_0004999 | |||
| 1426 | Ga0466971_0011152 | |||
| 1427 | Ga0466971_0020296 | |||
| 1428 | Ga0466971_0036870 | |||
| 1429 | Ga0466971_0083150 | |||
| 1430 | Ga0466971_0102158 | |||
| 1431 | Ga0466968_0186336 | |||
| 1432 | Ga0466970_0001771 | |||
| 1433 | Ga0466970_0010140 | |||
| 1434 | Ga0466970_0156061 | |||
| 1435 | Ga0466957_0000206 | |||
| 1436 | Ga0466957_0063636 | |||
| 1437 | Ga0466957_0175402 | |||
| 1438 | Ga0466960_0000061 | |||
| 1439 | Ga0466960_0001976 | |||
| 1440 | Ga0466960_0007533 | |||
| 1441 | Ga0466960_0119009 | |||
| 1442 | Ga0466959_0004074 | |||
| 1443 | Ga0466959_0005042 | |||
| 1444 | Ga0466959_0006147 | |||
| 1445 | Ga0466959_0007090 | |||
| 1446 | Ga0466959_0016242 | |||
| 1447 | Ga0466959_0052490 | |||
| 1448 | Ga0466959_0201399 | |||
| 1449 | Ga0466959_0239017 | |||
| 1450 | Ga0466958_0006459 | |||
| 1451 | Ga0466958_0019859 | |||
| 1452 | Ga0466958_0084455 | |||
| 1453 | Ga0466958_0109256 | |||
| 1454 | Ga0466958_0147752 | |||
| 1455 | Ga0466958_0157663 | |||
| 1456 | Ga0466967_0000619 | |||
| 1457 | Ga0466967_0003541 | |||
| 1458 | Ga0466967_0032340 | |||
| 1459 | Ga0466967_0045851 | |||
| 1460 | Ga0466967_0073072 | |||
| 1461 | Ga0466967_0130865 | |||
| 1462 | Ga0466967_0156635 | |||
| 1463 | Ga0466967_0207926 | |||
| 1464 | Ga0466967_0244987 | |||
| 1465 | Ga0466967_0273696 | |||
| 1466 | Ga0466967_0314825 | |||
| 1467 | Ga0466967_0427116 | |||
| 1468 | Ga0466967_0593054 | |||
| 1469 | Ga0495617_010106 | |||
| 1470 | Ga0495592_0002483 | |||
| 1471 | Ga0495592_0020832 | |||
| 1472 | Ga0495592_0191731 | |||
| 1473 | Ga0495592_0204003 | |||
| 1474 | Ga0495603_0001385 | |||
| 1475 | Ga0495603_0006520 | |||
| 1476 | Ga0495603_0027905 | |||
| 1477 | Ga0495603_0032638 | |||
| 1478 | Ga0495629_0006675 | |||
| 1479 | Ga0495629_0009683 | |||
| 1480 | Ga0495629_0011356 | |||
| 1481 | Ga0495629_0023560 | |||
| 1482 | Ga0495629_0083582 | |||
| 1483 | Ga0495629_0112504 | |||
| 1484 | Ga0495651_0003430 | |||
| 1485 | Ga0495651_0009722 | |||
| 1486 | Ga0495651_0032132 | |||
| 1487 | Ga0495653_0010670 | |||
| 1488 | Ga0495650_0073650 | |||
| 1489 | Ga0495582_0076092 | |||
| 1490 | Ga0495605_0005955 | |||
| 1491 | Ga0495639_0019629 | |||
| 1492 | Ga0495639_0062781 | |||
| 1493 | Ga0495662_0000269 | |||
| 1494 | Ga0495662_0000678 | |||
| 1495 | Ga0495662_0017472 | |||
| 1496 | Ga0495662_0032305 | |||
| 1497 | Ga0495664_0002460 | |||
| 1498 | Ga0495664_0066152 | |||
| 1499 | Ga0495594_0006404 | |||
| 1500 | Ga0495594_0009772 | |||
| 1501 | Ga0495594_0030869 | |||
| 1502 | Ga0495607_0051011 | |||
| 1503 | Ga0495607_0101678 | |||
| 1504 | Ga0495606_0017990 | |||
| 1505 | Ga0495608_0053971 | |||
| 1506 | Ga0495608_0130033 | |||
| 1507 | Ga0495616_0001838 | |||
| 1508 | Ga0495618_0012647 | |||
| 1509 | Ga0495618_0018823 | |||
| 1510 | Ga0495618_0238601 | |||
| 1511 | Ga0495628_0006454 | |||
| 1512 | Ga0495628_0012754 | |||
| 1513 | Ga0495628_0042373 | |||
| 1514 | Ga0495628_0053279 | |||
| 1515 | Ga0495630_0003162 | |||
| 1516 | Ga0495630_0137078 | |||
| 1517 | Ga0495643_0025323 | |||
| 1518 | Ga0495666_0002468 | |||
| 1519 | Ga0495666_0020282 | |||
| 1520 | Ga0495652_0001825 | |||
| 1521 | Ga0495652_0007897 | |||
| 1522 | Ga0495652_0020898 | |||
| 1523 | Ga0495652_0027088 | |||
| 1524 | Ga0495652_0030429 | |||
| 1525 | Ga0495652_0107809 | |||
| 1526 | Ga0495640_0013810 | |||
| 1527 | Ga0495640_0017001 | |||
| 1528 | Ga0495640_0098191 | |||
| 1529 | Ga0495587_0002745 | |||
| 1530 | Ga0495609_0052193 | |||
| 1531 | Ga0495645_0037361 | |||
| 1532 | Ga0495645_0044162 | |||
| 1533 | Ga0495645_0050195 | |||
| 1534 | Ga0495645_0071972 | |||
| 1535 | Ga0495622_0040451 | |||
| 1536 | Ga0495667_0008916 | |||
| 1537 | Ga0495667_0108040 | |||
| 1538 | Ga0495667_0240946 | |||
| 1539 | Ga0495656_0086372 | |||
| 1540 | Ga0495668_0009851 | |||
| 1541 | Ga0495634_0004250 | |||
| 1542 | Ga0495634_0121342 | |||
| 1543 | Ga0495611_0009795 | |||
| 1544 | Ga0495611_0069401 | |||
| 1545 | Ga0495635_0004368 | |||
| 1546 | Ga0495635_0006861 | |||
| 1547 | Ga0495635_0036005 | |||
| 1548 | Ga0495588_0001933 | |||
| 1549 | Ga0495588_0003867 | |||
| 1550 | Ga0495588_0145073 | |||
| 1551 | Ga0495657_0004106 | |||
| 1552 | Ga0495657_0010530 | |||
| 1553 | Ga0495657_0020962 | |||
| 1554 | Ga0495657_0045863 | |||
| 1555 | Ga0495657_0055942 | |||
| 1556 | Ga0495599_0006003 | |||
| 1557 | Ga0495599_0037551 | |||
| 1558 | Ga0495623_0002580 | |||
| 1559 | Ga0495623_0112308 | |||
| 1560 | Ga0495646_0000765 | |||
| 1561 | Ga0495646_0014718 | |||
| 1562 | Ga0495613_0001493 | |||
| 1563 | Ga0495613_0009005 | |||
| 1564 | Ga0495613_0018934 | |||
| 1565 | Ga0495613_0019514 | |||
| 1566 | Ga0495613_0117902 | |||
| 1567 | Ga0495624_0042629 | |||
| 1568 | Ga0495624_0101813 | |||
| 1569 | Ga0495624_0229137 | |||
| 1570 | Ga0495670_0044446 | |||
| 1571 | Ga0495670_0056588 | |||
| 1572 | Ga0495671_0046994 | |||
| 1573 | Ga0495671_0068244 | |||
| 1574 | Ga0495649_0023029 | |||
| 1575 | Ga0495589_0001676 | |||
| 1576 | Ga0495589_0009376 | |||
| 1577 | Ga0495589_0016781 | |||
| 1578 | Ga0495589_0047951 | |||
| 1579 | Ga0495589_0120080 | |||
| 1580 | Ga0495600_0002374 | |||
| 1581 | Ga0495600_0007890 | |||
| 1582 | Ga0495600_0034090 | |||
| 1583 | Ga0495581_0036026 | |||
| 1584 | Ga0495581_0115988 | |||
| 1585 | Ga0495581_0193065 | |||
| 1586 | Ga0495604_0000392 | |||
| 1587 | Ga0495604_0004530 | |||
| 1588 | Ga0495604_0011430 | |||
| 1589 | Ga0495604_0012626 | |||
| 1590 | Ga0495604_0014376 | |||
| 1591 | Ga0495636_0003865 | |||
| 1592 | Ga0495636_0005973 | |||
| 1593 | Ga0495674_0013220 | |||
| 1594 | Ga0495674_0067834 | |||
| 1595 | Ga0495672_0018483 | |||
| 1596 | Ga0495676_0011089 | |||
| 1597 | Ga0495676_0019201 | |||
| 1598 | Ga0495676_0133399 | |||
| 1599 | Ga0495676_0258092 | |||
| 1600 | Ga0495680_0015604 | |||
| 1601 | Ga0495683_0012919 | |||
| 1602 | Ga0495683_0132102 | |||
| 1603 | Ga0495687_001678 | |||
| 1604 | Ga0495687_003806 | |||
| 1605 | Ga0495675_0002441 | |||
| 1606 | Ga0495675_0005847 | |||
| 1607 | Ga0495675_0114249 | |||
| 1608 | Ga0495675_0122896 | |||
| 1609 | Ga0495685_008489 | |||
| 1610 | Ga0495685_010168 | |||
| 1611 | Ga0495685_015729 | |||
| 1612 | Ga0495685_025964 | |||
| 1613 | Ga0495681_0009754 | |||
| 1614 | Ga0495681_0012274 | |||
| 1615 | Ga0495684_0004401 | |||
| 1616 | Ga0495684_0072468 | |||
| 1617 | Ga0495686_0036864 | |||
| 1618 | Ga0495593_0136840 | |||
| 1619 | Ga0495602_0005444 | |||
| 1620 | Ga0495602_0035838 | |||
| 1621 | Ga0495602_0037017 | |||
| 1622 | Ga0495602_0101937 | |||
| 1623 | Ga0495614_0008078 | |||
| 1624 | Ga0495614_0010023 | |||
| 1625 | Ga0495626_0031995 | |||
| 1626 | Ga0496100_0183413 | |||
| 1627 | Ga0496101_0226899 | |||
| 1628 | Ga0496104_0008319 | |||
| 1629 | Ga0496104_0017592 | |||
| 1630 | Ga0496104_0126357 | |||
| 1631 | Ga0496104_0139238 | |||
| 1632 | Ga0496104_0198353 | |||
| 1633 | Ga0496105_0010317 | |||
| 1634 | Ga0496105_0011244 | |||
| 1635 | Ga0496105_0135130 | |||
| 1636 | Ga0496105_0175672 | |||
| 1637 | Ga0496106_0055173 | |||
| 1638 | Ga0496106_0111286 | |||
| 1639 | Ga0496107_0032592 | |||
| 1640 | Ga0496108_0140765 | |||
| 1641 | Ga0496109_0022965 | |||
| 1642 | Ga0496109_0030766 | |||
| 1643 | Ga0496109_0074794 | |||
| 1644 | Ga0496109_0222136 | |||
| 1645 | Ga0496109_0415053 | |||
| 1646 | Ga0496110_0073837 | |||
| 1647 | Ga0496110_0092476 | |||
| 1648 | Ga0496110_0309660 | |||
| 1649 | Ga0496110_0353003 | |||
| 1650 | Ga0496111_0006233 | |||
| 1651 | Ga0496111_0043363 | |||
| 1652 | Ga0496111_0381157 | |||
| 1653 | Ga0496112_0022473 | |||
| 1654 | Ga0496112_0053064 | |||
| 1655 | Ga0496112_0190889 | |||
| 1656 | Ga0496112_0284235 | |||
| 1657 | Ga0496113_0018547 | |||
| 1658 | Ga0496113_0360739 | |||
| 1659 | Ga0496114_0037014 | |||
| 1660 | Ga0496114_0486285 | |||
| 1661 | Ga0496115_0030039 | |||
| 1662 | Ga0496115_0059022 | |||
| 1663 | Ga0496115_0091730 | |||
| 1664 | Ga0496117_0098547 | |||
| 1665 | Ga0496120_0026159 | |||
| 1666 | Ga0496123_0092054 | |||
| 1667 | Ga0496126_0146989 | |||
| 1668 | Ga0501031_0058273 | |||
| 1669 | Ga0501032_0000035 | |||
| 1670 | Ga0501032_0046050 | |||
| 1671 | Ga0501032_0048386 | |||
| 1672 | Ga0501032_0101956 | |||
| 1673 | Ga0501033_0000254 | |||
| 1674 | Ga0501033_0009045 | |||
| 1675 | Ga0501034_0001330 | |||
| 1676 | Ga0501034_0014791 | |||
| 1677 | Ga0501034_0020364 | |||
| 1678 | Ga0501034_0118041 | |||
| 1679 | Ga0501034_0148498 | |||
| 1680 | Ga0501034_0340407 | |||
| 1681 | Ga0501036_0000174 | |||
| 1682 | Ga0501036_0003066 | |||
| 1683 | Ga0501036_0004422 | |||
| 1684 | Ga0501036_0015451 | |||
| 1685 | Ga0501036_0216361 | |||
| 1686 | Ga0501037_0000541 | |||
| 1687 | Ga0501037_0071122 | |||
| 1688 | Ga0501038_0000364 | |||
| 1689 | Ga0501038_0000951 | |||
| 1690 | Ga0501038_0010610 | |||
| 1691 | Ga0501038_0113577 | |||
| 1692 | Ga0501038_0116000 | |||
| 1693 | Ga0501038_0189479 | |||
| 1694 | Ga0501038_0397597 | |||
| 1695 | Ga0501039_0000133 | |||
| 1696 | Ga0501039_0004010 | |||
| 1697 | Ga0501039_0049454 | |||
| 1698 | Ga0501039_0062884 | |||
| 1699 | Ga0501040_0060215 | |||
| 1700 | Ga0501040_0081021 | |||
| 1701 | Ga0501041_0042094 | |||
| 1702 | Ga0501042_0011558 | |||
| 1703 | Ga0501042_0028930 | |||
| 1704 | Ga0501043_0000302 | |||
| 1705 | Ga0501043_0001197 | |||
| 1706 | Ga0501046_0000205 | |||
| 1707 | Ga0501046_0085809 | |||
| 1708 | Ga0501047_0001445 | |||
| 1709 | Ga0501047_0007057 | |||
| 1710 | Ga0501047_0104437 | |||
| 1711 | Ga0501047_0227533 | |||
| 1712 | Ga0501048_0000314 | |||
| 1713 | Ga0501048_0002204 | |||
| 1714 | Ga0501067_0072899 | |||
| 1715 | Ga0501068_0016478 | |||
| 1716 | Ga0501069_0000262 | |||
| 1717 | Ga0501070_0000681 | |||
| 1718 | Ga0501070_0079809 | |||
| 1719 | Ga0501070_0167475 | |||
| 1720 | Ga0501072_0216566 | |||
| 1721 | Ga0501073_0005738 | |||
| 1722 | Ga0501073_0021915 | |||
| 1723 | Ga0501074_0000457 | |||
| 1724 | Ga0501074_0007866 | |||
| 1725 | Ga0501074_0085404 | |||
| 1726 | Ga0501075_0155882 | |||
| 1727 | Ga0501076_0074107 | |||
| 1728 | Ga0501076_0149816 | |||
| 1729 | Ga0501079_0112283 | |||
| 1730 | Ga0501079_0173237 | |||
| 1731 | Ga0501080_0000364 | |||
| 1732 | Ga0501080_0028919 | |||
| 1733 | Ga0501081_0070331 | |||
| 1734 | Ga0501083_0031136 | |||
| 1735 | Ga0501035_0003679 | |||
| 1736 | Ga0501035_0005294 | |||
| 1737 | Ga0501035_0052415 | |||
| 1738 | Ga0501035_0077715 | |||
| 1739 | Ga0501035_0135728 | |||
| 1740 | Ga0501044_0001131 | |||
| 1741 | Ga0501044_0004785 | |||
| 1742 | Ga0501044_0045775 | |||
| 1743 | Ga0501044_0055339 | |||
| 1744 | Ga0501044_0122619 | |||
| 1745 | Ga0501045_0275908 | |||
| 1746 | nmdc:mga00v17_45265_c1 | |||
| 1747 | nmdc:mga0yw44_160591_c1 | |||
| 1748 | nmdc:mga07m45_31492_c1 | |||
| 1749 | nmdc:mga05p37_252771_c1 | |||
| 1750 | nmdc:mga05p37_263_c1 | |||
| 1751 | nmdc:mga05p37_33679_c1 | |||
| 1752 | nmdc:mga05p37_52132_c1 | |||
| 1753 | nmdc:mga05p37_672_c1 | |||
| 1754 | nmdc:mga09592_163260_c1 | |||
| 1755 | nmdc:mga09592_2964_c1 | |||
| 1756 | nmdc:mga09592_351690_c1 | |||
| 1757 | nmdc:mga09592_423315_c1 | |||
| 1758 | nmdc:mga09592_7924_c1 | |||
| 1759 | nmdc:mga0qj67_20471_c1 | |||
| 1760 | nmdc:mga0qj67_294_c1 | |||
| 1761 | nmdc:mga0qj67_5016_c1 | |||
| 1762 | nmdc:mga0qj67_65955_c1 | |||
| 1763 | nmdc:mga06r32_217_c1 | |||
| 1764 | nmdc:mga06r32_285_c2 | |||
| 1765 | nmdc:mga06r32_29142_c1 | |||
| 1766 | nmdc:mga06r32_5826_c1 | |||
| 1767 | nmdc:mga06r32_6085_c1 | |||
| 1768 | nmdc:mga06r32_6270_c1 | |||
| 1769 | nmdc:mga06r32_649107_c1 | |||
| 1770 | nmdc:mga08y16_12424_c1 | |||
| 1771 | nmdc:mga08y16_71851_c1 | |||
| 1772 | nmdc:mga0rr50_100493_c1 | |||
| 1773 | Ga0495601_0002431 | |||
| 1774 | Ga0495601_0012631 | |||
| 1775 | Ga0495601_0023571 | |||
| 1776 | Ga0495601_0075180 | |||
| 1777 | Ga0495601_0115629 | |||
| 1778 | Ga0495601_0287420 | |||
| 1779 | Ga0495601_0304408 | |||
| 1780 | Ga0495612_0005805 | |||
| 1781 | Ga0495612_0011994 | |||
| 1782 | Ga0495612_0020048 | |||
| 1783 | Ga0495612_0048694 | |||
| 1784 | Ga0495619_0025865 | |||
| 1785 | Ga0495619_0149306 | |||
| 1786 | Ga0495619_0197485 | |||
| 1787 | Ga0500650_0021699 | |||
| 1788 | Ga0500560_000662 | |||
| 1789 | Ga0500559_0000733 | |||
| 1790 | Ga0500568_0000107 | |||
| 1791 | Ga0500573_0064778 | |||
| 1792 | Ga0500577_0027280 | |||
| 1793 | Ga0500577_0041201 | |||
| 1794 | Ga0500600_0082316 | |||
| 1795 | Ga0500600_0096576 | |||
| 1796 | Ga0500634_0081617 | |||
| 1797 | Ga0501084_0002579 | |||
| 1798 | Ga0501082_0373894 | |||
| 1799 | Ga0466962_0000193 | |||
| 1800 | Ga0466962_0000253 | |||
| 1801 | Ga0466962_0041859 | |||
| 1802 | Ga0466962_0054913 | |||
| 1803 | 2501944816 | |||
| 1804 | 2515857250 | |||
| 1805 | 2552112603 | |||
| 1806 | 2554260410 | |||
| 1807 | 2558907112 | |||
| 1808 | 2559427757 | |||
| 1809 | 2585309357 | |||
| 1810 | 2585311910 | |||
| 1811 | 2586061523 | |||
| 1812 | 2616696303 | |||
| 1813 | 2616699080 | |||
| 1814 | 2616902691 | |||
| 1815 | 2643784229 | |||
| 1816 | 2643904335 | |||
| 1817 | 2644174194 | |||
| 1818 | 2644264665 | |||
| 1819 | 2644277864 | |||
| 1820 | 2644333841 | |||
| 1821 | 2644402688 | |||
| 1822 | 2644437972 | |||
| 1823 | 2644447216 | |||
| 1824 | 2644631222 | |||
| 1825 | 2676476482 | |||
| 1826 | 2723643223 | |||
| 1827 | 2738695533 | |||
| 1828 | 2739326324 | |||
| 1829 | 2739604775 | |||
| 1830 | 2760308206 | |||
| 1831 | 2760623215 | |||
| 1832 | 2784591413 | |||
| 1833 | 2785339733 | |||
| 1834 | 2785372403 | |||
| 1835 | 2786673534 | |||
| 1836 | 2793975731 | |||
| 1837 | 2795796884 | |||
| 1838 | 2808628904 | |||
| 1839 | 2808845118 | |||
| 1840 | 2808901759 | |||
| 1841 | 2808914806 | |||
| 1842 | 2809027961 | |||
| 1843 | 2809235015 | |||
| 1844 | 2809589368 | |||
| 1845 | 2811843043 | |||
| 1846 | 2812354494 | |||
| 1847 | 2812477300 | |||
| 1848 | 2816421626 | |||
| 1849 | 2819743762 | |||
| 1850 | 2827632291 | |||
| 1851 | 2837269505 | |||
| 1852 | 2844850960 | |||
| 1853 | 2852678528 | |||
| 1854 | 2856863739 | |||
| 1855 | 2857721453 | |||
| 1856 | 2857733326 | |||
| 1857 | 2858904359 | |||
| 1858 | 2861524026 | |||
| 1859 | 2862180255 | |||
| 1860 | 2862284058 | |||
| 1861 | 2862388723 | |||
| 1862 | 2862575357 | |||
| 1863 | 2862994973 | |||
| 1864 | 2863410275 | |||
| 1865 | 2867305704 | |||
| 1866 | 2867314991 | |||
| 1867 | 2867320012 | |||
| 1868 | 2867434177 | |||
| 1869 | 2867475199 | |||
| 1870 | 2868095011 | |||
| 1871 | 2873152801 | |||
| 1872 | 2873319406 | |||
| 1873 | 2877678257 | |||
| 1874 | 2883822716 | |||
| 1875 | 2884700572 | |||
| 1876 | 2895430746 | |||
| 1877 | 2895450207 | |||
| 1878 | 2899364440 | |||
| 1879 | 2912716891 | |||
| 1880 | 2912726510 | |||
| 1881 | 2912764148 | |||
| 1882 | 2915772562 | |||
| 1883 | 2919471085 | |||
| 1884 | 2928093658 | |||
| 1885 | 2928121520 | |||
| 1886 | 2935391096 | |||
| 1887 | 2935412036 | |||
| 1888 | 2939647351 | |||
| 1889 | 2945958941 | |||
| 1890 | 2946024333 | |||
| 1891 | 2946036304 | |||
| 1892 | 2946047312 | |||
| 1893 | 2946071209 | |||
| 1894 | 2946078990 | |||
| 1895 | 2954010529 | |||
| 1896 | 2954383151 | |||
| 1897 | 2954679840 | |||
| 1898 | 2954684313 | |||
| 1899 | 2954693863 | |||
| 1900 | 2954708974 | |||
| 1901 | 2954713494 | |||
| 1902 | 2954723459 | |||
| 1903 | 2954738370 | |||
| 1904 | 2954742363 | |||
| 1905 | 2954757232 | |||
| 1906 | 2954761333 | |||
| 1907 | 2984582650 | |||
| 1908 | 2990046265 | |||
| 1909 | 2990067028 | |||
| 1910 | 2995469381 | |||
| 1911 | 2997601259 | |||
| 1912 | 3003006367 | |||
| 1913 | 3006489421 | |||
| 1914 | 3006500510 | |||
| 1915 | 649814519 | |||
| 1916 | 8003317819 | |||
| 1917 | 8004025408 | |||
| 1918 | 8008489048 | |||
| 1919 | 8008564271 | |||
| 1920 | 8008575804 | |||
| 1921 | 8023630328 | |||
| 1922 | 8025484987 | |||
| 1923 | 8025528531 | |||
| 1924 | 8025535335 | |||
| 1925 | 8033690088 | |||
| 1926 | 8047897436 | |||
| 1927 | 8048133296 | |||
| 1928 | 8048361434 | |||
| 1929 | 8048374423 | |||
| 1930 | 8048383799 | |||
| 1931 | 8048411921 | |||
| 1932 | 8055068630 | |||
| 1933 | 8055174514 | |||
| 1934 | 8056059551 | |||
| 1935 | 8056065356 | |||
| 1936 | 8056213556 | |||
| 1937 | 8056582150 | |||
| 1938 | 8056667681 | |||
| 1939 | 8056832697 | |||
| 1940 | 8057572497 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4k7g-assembly1.cif.gz_B | crystal structure of a 3-hydroxyproline dehydratse from agrobacterium vitis, target efi-506470, with bound pyrrole 2-carboxylate, ordered active site | 0.97 | 6 | 333 |
| 4q2h-assembly1.cif.gz_B | crystal structure of probable proline racemase from agrobacterium radiobacter k84, target efi-506561, with bound carbonate | 0.9629 | 7 | 333 |
| 6r77-assembly1.cif.gz_B | crystal structure of trans-3-hydroxy-l-proline dehydratase in complex with substrate - closed conformation | 0.9574 | 6 | 333 |
| 1w62-assembly1.cif.gz_A | proline racemase in complex with one molecule of pyrrole-2-carboxylic acid (hemi form) | 0.9573 | 1 | 333 |
| 4lb0-assembly1.cif.gz_B | crystal structure of a hydroxyproline epimerase from agrobacterium vitis, target efi-506420, with bound trans-4-oh-l-proline | 0.9567 | 1 | 333 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q868H8_7_132_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9748 | 9 | 129 | 3.10.310.10 |
| 1tm0B01 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9699 | 2 | 143 | 3.10.310.10 |
| af_Q4DA80_75_217_3.10.310.10 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9681 | 7 | 142 | 3.10.310.10 |
| 4q2hB01 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.966 | 7 | 142 | 3.10.310.10 |
| 6hjfA01 | Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 | 0.9591 | 1 | 142 | 3.10.310.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B3H027-F1-model_v4 | Proline racemase family protein | 0.9983 | 173 | 305 |
GO:0047580
|
| AF-A0A2A3X5C5-F1-model_v4 | Proline racemase | 0.9976 | 1 | 151 |
GO:0047580
|
| AF-A0A542FQM5-F1-model_v4 | Proline racemase | 0.9973 | 7 | 333 |
GO:0047580
|
| AF-A0A6B3GDB1-F1-model_v4 | Proline racemase family protein | 0.9953 | 1 | 178 |
GO:0047580
|
| AF-A0A7X6EKU3-F1-model_v4 | deleted | 0.9949 | 166 | 332 |
|