F487104

General Info

Members Datasets Scaffolds Average Seq Length
970 508 1940 325

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_0322262|Ga0501044_0322262_364_1455
Length 363
Sequence MRAARAITAVDSHTEGMPTRVVTGGVAPIPGATMAQRRRYAMAHLDELRRFLVDEPRGHGAMSGAILQPPTRDDADWGVLYIEVSGFLPMCGHGTIGVATVLVETGMVPVTEPETVVRLDTPAGLVTARVAVADGAVQQVTLRNVDAFCLERDAVVDVPGLGEVRYDLSYGGNFYAILPIERIGLPFDRGRKGEILAAGLSIMDSINAQRRPAHPTDPDVAGCKHVQFLAPGSDARHSRNAMAIHPGWFDRSPCGTGTCARMAQLHARGELALDTDFVNESFIGTRFTGRLLAETEVGGLPAVVPEFSGRAWITGTATYLLDPTDPFPHGFVLCAPPGAERGRPRAARAEPATLRRRDERLWA

Samples

Sample ID Description Type Environment
1 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
109 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
110 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
166 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
167 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
168 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
169 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
170 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
171 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
172 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
173 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
174 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
184 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
185 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
186 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
187 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
188 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
201 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
202 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
203 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
204 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
205 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
206 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
207 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
208 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
211 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
212 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
213 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
214 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
215 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
216 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
217 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
218 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
219 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
220 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
221 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
222 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
223 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
224 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
225 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
226 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
227 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
228 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
229 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
230 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
231 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
232 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
233 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
234 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
235 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
238 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
239 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
240 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
241 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
242 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
243 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
244 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
245 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
248 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
249 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
250 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
251 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
252 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
253 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
254 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
255 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
256 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
257 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
258 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
259 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
260 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
261 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
262 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
263 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
264 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
265 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
266 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
267 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
268 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
269 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
270 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
271 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
272 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
273 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
274 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
275 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
276 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
277 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
278 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
279 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
280 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
281 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
282 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
283 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
284 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
285 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
286 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
287 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
288 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
289 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
290 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
291 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
292 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
293 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
294 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
295 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
296 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
297 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
298 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
299 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
300 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
301 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
302 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
303 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
304 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
305 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
306 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
307 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
308 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
309 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
310 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
311 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
312 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
313 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
314 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
315 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
316 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
317 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
318 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
319 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
335 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
336 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
337 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
338 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
339 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
340 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
341 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
342 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
343 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
344 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
345 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
346 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
347 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
349 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
350 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
351 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
352 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
353 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
354 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
355 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
356 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
357 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
358 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
359 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
360 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
361 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
362 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
363 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
364 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
365 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
366 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
367 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
368 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
369 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
370 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
371 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
372 2501939600 Micromonospora sp. L5 Isolate Unclassified
373 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
374 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
375 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
376 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
377 2558860280 Kutzneria sp. 744 Isolate Unclassified
378 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
379 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
380 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
381 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
382 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
383 2643221553 Microbacterium sp. Root553 Isolate Unclassified
384 2643221578 Streptomyces sp. Root63 Isolate Unclassified
385 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
386 2643221647 Streptomyces sp. Root369 Isolate Unclassified
387 2643221649 Leifsonia sp. Root4 Isolate Unclassified
388 2643221659 Ensifer sp. Root127 Isolate Unclassified
389 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
390 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
391 2643221679 Angustibacter sp. Root456 Isolate Unclassified
392 2643221714 Streptomyces sp. Root264 Isolate Unclassified
393 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
394 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
395 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
396 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
397 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
398 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
399 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
400 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
401 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
402 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
403 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
404 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
405 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
406 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
407 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
408 2808606372 Agromyces sp. 23-23 Isolate Unclassified
409 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
410 2808606394 Promicromonospora sp. C35 Isolate Unclassified
411 2808606448 Streptomyces sp. 193411 Isolate Unclassified
412 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
413 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
414 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
415 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
416 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
417 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
418 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
419 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
420 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
421 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
422 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
423 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
424 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
425 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
426 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
427 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
428 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
429 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
430 2862574272 Streptomyces sp. AcE210 Isolate Nodule
431 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
432 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
433 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
434 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
435 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
436 2867428634 Streptomyces sp. RP5T Isolate Unclassified
437 2867475112 Streptomyces sp. TM32 Isolate Unclassified
438 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
439 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
440 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
441 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
442 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
443 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
444 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
445 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
446 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
447 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
448 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
449 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
450 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
451 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
452 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
453 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
454 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
455 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
456 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
457 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
458 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
459 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
460 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
461 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
462 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
463 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
464 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
465 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
466 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
467 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
468 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
469 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
470 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
471 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
472 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
473 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
474 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
475 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
476 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
477 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
478 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
479 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
480 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
481 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
482 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
483 649633069 Micromonospora sp. L5 Isolate Unclassified
484 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
485 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
486 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
487 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
488 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
489 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
490 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
491 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
492 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
493 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
494 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
495 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
496 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
497 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
498 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
499 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
500 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
501 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
502 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
503 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
504 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
505 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
506 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
507 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
508 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.77
Metatranscriptomes 0
Isolates 14.23

Biome Distribution

Category Percentage (%)
Aerial Root 0.1
Bulb 0
Endosphere 1.86
Nodule 0.41
Rhizoplane 4.12
Rhizosphere 81.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501044_0322262 3300049823 Bacteria 1469
2 JGI25152J39213_1000445 3300002773 Bacteria 24511
3 JGI25406J46586_10009421 3300003203 Bacteria 4373
4 Ga0070658_10014870 3300005327 Bacteria 6236
5 Ga0070658_10089827 3300005327 Bacteria 2530
6 Ga0070658_10131060 3300005327 Bacteria 2090
7 Ga0070676_10075008 3300005328 Bacteria 2038
8 Ga0070683_100002200 3300005329 Bacteria 15436
9 Ga0070683_100205562 3300005329 Bacteria 1870
10 Ga0070690_100058806 3300005330 Bacteria 2470
11 Ga0070670_100128749 3300005331 Bacteria 2185
12 Ga0068869_100212969 3300005334 Bacteria 1528
13 Ga0070680_100000156 3300005336 Bacteria 42598
14 Ga0070682_100203931 3300005337 Bacteria 1397
15 Ga0068868_100033216 3300005338 Bacteria 3975
16 Ga0068868_100049968 3300005338 Bacteria 3283
17 Ga0068868_100065164 3300005338 Bacteria 2893
18 Ga0070660_100019637 3300005339 Bacteria 4955
19 Ga0070687_100002948 3300005343 Bacteria 6529
20 Ga0070661_100005318 3300005344 Bacteria 8877
21 Ga0070668_100002459 3300005347 Bacteria 13633
22 Ga0070668_100004175 3300005347 Bacteria 10707
23 Ga0070668_100013671 3300005347 Bacteria 6060
24 Ga0070668_100036839 3300005347 Bacteria 3733
25 Ga0070675_100002879 3300005354 Bacteria 12967
26 Ga0070675_100131771 3300005354 Bacteria 2131
27 Ga0070659_100006993 3300005366 Bacteria 8167
28 Ga0070659_100011938 3300005366 Bacteria 6431
29 Ga0070709_10023711 3300005434 Bacteria 3607
30 Ga0070714_100001183 3300005435 Bacteria 18799
31 Ga0070714_100011882 3300005435 Bacteria 6922
32 Ga0070714_100023790 3300005435 Bacteria 5038
33 Ga0070713_100127251 3300005436 Bacteria 2242
34 Ga0070710_10000059 3300005437 Bacteria 50510
35 Ga0070701_10035737 3300005438 Bacteria 2499
36 Ga0070711_100005825 3300005439 Bacteria 7398
37 Ga0070700_100000010 3300005441 Bacteria 176885
38 Ga0070700_100117232 3300005441 Bacteria 1779
39 Ga0070708_100070123 3300005445 Bacteria 3153
40 Ga0070663_100002831 3300005455 Bacteria 9850
41 Ga0070663_100028631 3300005455 Bacteria 3795
42 Ga0070663_100086824 3300005455 Bacteria 2311
43 Ga0070678_100017990 3300005456 Bacteria 4568
44 Ga0070662_100091599 3300005457 Bacteria 2284
45 Ga0070681_10000051 3300005458 Bacteria 82091
46 Ga0070706_100230711 3300005467 Bacteria 1728
47 Ga0070698_100145680 3300005471 Bacteria 2318
48 Ga0070679_100000058 3300005530 Bacteria 82178
49 Ga0070684_100026442 3300005535 Bacteria 4889
50 Ga0068853_100034571 3300005539 Bacteria 4291
51 Ga0068853_100041007 3300005539 Bacteria 3952
52 Ga0070672_100214960 3300005543 Bacteria 1611
53 Ga0070672_100215547 3300005543 Bacteria 1609
54 Ga0070672_100250678 3300005543 Bacteria 1491
55 Ga0070686_100062796 3300005544 Bacteria 2404
56 Ga0070686_100077604 3300005544 Bacteria 2191
57 Ga0070695_100006608 3300005545 Bacteria 6853
58 Ga0070696_100002797 3300005546 Bacteria 11580
59 Ga0070696_100046761 3300005546 Bacteria 3002
60 Ga0070693_100005019 3300005547 Bacteria 6323
61 Ga0070665_100026257 3300005548 Bacteria 5865
62 Ga0070665_100106861 3300005548 Bacteria 2801
63 Ga0070704_100060908 3300005549 Bacteria 2698
64 Ga0068855_100021380 3300005563 Bacteria 7758
65 Ga0068855_100042269 3300005563 Bacteria 5400
66 Ga0068855_100407636 3300005563 Bacteria 1489
67 Ga0070664_100000709 3300005564 Bacteria 25499
68 Ga0070664_100212551 3300005564 Bacteria 1729
69 Ga0068857_100194485 3300005577 Bacteria 1848
70 Ga0068857_100261883 3300005577 Bacteria 1587
71 Ga0068854_100001593 3300005578 Bacteria 13807
72 Ga0068854_100019187 3300005578 Bacteria 4603
73 Ga0068854_100044222 3300005578 Bacteria 3160
74 Ga0068854_100097628 3300005578 Bacteria 2197
75 Ga0068856_100060920 3300005614 Bacteria 3728
76 Ga0068856_100102841 3300005614 Bacteria 2850
77 Ga0068856_100152945 3300005614 Bacteria 2316
78 Ga0070702_100046942 3300005615 Bacteria 2450
79 Ga0070702_100047143 3300005615 Bacteria 2446
80 Ga0070702_100051996 3300005615 Bacteria 2348
81 Ga0068852_100044208 3300005616 Bacteria 3781
82 Ga0068859_100118195 3300005617 Bacteria 2717
83 Ga0068859_100211730 3300005617 Bacteria 2025
84 Ga0068864_100017421 3300005618 Bacteria 5989
85 Ga0068866_10007714 3300005718 Bacteria 4514
86 Ga0068861_100041128 3300005719 Bacteria 3461
87 Ga0068861_100044201 3300005719 Bacteria 3348
88 Ga0068851_10009022 3300005834 Bacteria 4629
89 Ga0068863_100116961 3300005841 Bacteria 2541
90 Ga0068858_100012588 3300005842 Bacteria 7974
91 Ga0068858_100032797 3300005842 Bacteria 4824
92 Ga0068860_100028494 3300005843 Bacteria 5375
93 Ga0068860_100207123 3300005843 Bacteria 1902
94 Ga0068862_100117230 3300005844 Bacteria 2343
95 Ga0081455_10000030 3300005937 Bacteria 148346
96 Ga0081455_10000167 3300005937 Bacteria 81186
97 Ga0081455_10009504 3300005937 Bacteria 9992
98 Ga0081455_10011405 3300005937 Bacteria 8932
99 Ga0081538_10002078 3300005981 Bacteria 19943
100 Ga0081538_10031153 3300005981 Bacteria 3604
101 Ga0081538_10042653 3300005981 Bacteria 2860
102 Ga0081540_1004241 3300005983 Bacteria 11012
103 Ga0081540_1008022 3300005983 Bacteria 7429
104 Ga0081539_10000079 3300005985 Bacteria 223413
105 Ga0081539_10000574 3300005985 Bacteria 75794
106 Ga0081539_10050003 3300005985 Bacteria 2368
107 Ga0070717_10002723 3300006028 Bacteria 12479
108 Ga0070717_10039881 3300006028 Bacteria 3822
109 Ga0075363_100058972 3300006048 Bacteria 2063
110 Ga0070715_10014425 3300006163 Bacteria 2927
111 Ga0070712_100016307 3300006175 Bacteria 4800
112 Ga0070712_100042881 3300006175 Bacteria 3112
113 Ga0075367_10000070 3300006178 Bacteria 25863
114 Ga0097621_100039480 3300006237 Bacteria 3792
115 Ga0097621_100048999 3300006237 Bacteria 3430
116 Ga0068871_100020867 3300006358 Bacteria 5025
117 Ga0075428_100000122 3300006844 Bacteria 67543
118 Ga0075428_100001356 3300006844 Bacteria 25987
119 Ga0075428_100136999 3300006844 Bacteria 2661
120 Ga0075430_100003241 3300006846 Bacteria 13630
121 Ga0075430_100016753 3300006846 Bacteria 6243
122 Ga0075431_100002314 3300006847 Bacteria 18303
123 Ga0075431_100003329 3300006847 Bacteria 15563
124 Ga0075431_100009370 3300006847 Bacteria 9829
125 Ga0075431_100039497 3300006847 Bacteria 4861
126 Ga0075434_100135577 3300006871 Bacteria 2481
127 Ga0075434_100526668 3300006871 Bacteria 1202
128 Ga0075429_100003556 3300006880 Bacteria 13277
129 Ga0075429_100033333 3300006880 Bacteria 4475
130 Ga0075429_100241963 3300006880 Bacteria 1581
131 Ga0068865_100033664 3300006881 Bacteria 3431
132 Ga0097620_100118192 3300006931 Bacteria 2717
133 Ga0097620_100211728 3300006931 Bacteria 2025
134 Ga0099826_10056709 3300006948 Bacteria 2582
135 Ga0075435_100022895 3300007076 Bacteria 4823
136 Ga0105240_10163108 3300009093 Bacteria 2645
137 Ga0111539_10001616 3300009094 Bacteria 30103
138 Ga0111539_10057246 3300009094 Bacteria 4630
139 Ga0111539_10139506 3300009094 Bacteria 2839
140 Ga0105245_10002942 3300009098 Bacteria 15290
141 Ga0105245_10691348 3300009098 Bacteria 1053
142 Ga0105247_10010343 3300009101 Bacteria 5642
143 Ga0105247_10049962 3300009101 Bacteria 2573
144 Ga0105247_10122853 3300009101 Bacteria 1684
145 Ga0105247_10144624 3300009101 Bacteria 1561
146 Ga0114129_10008813 3300009147 Bacteria 14392
147 Ga0114129_10045350 3300009147 Bacteria 6181
148 Ga0114129_10046039 3300009147 Bacteria 6131
149 Ga0114129_10106851 3300009147 Bacteria 3866
150 Ga0105243_10002445 3300009148 Bacteria 15517
151 Ga0105243_10199198 3300009148 Bacteria 1755
152 Ga0105243_10226946 3300009148 Bacteria 1654
153 Ga0105241_10018236 3300009174 Bacteria 5161
154 Ga0105241_10041270 3300009174 Bacteria 3486
155 Ga0105242_10036982 3300009176 Bacteria 3920
156 Ga0105242_10208099 3300009176 Bacteria 1741
157 Ga0105248_10075709 3300009177 Bacteria 3783
158 Ga0105248_10085261 3300009177 Bacteria 3554
159 Ga0105237_10090473 3300009545 Bacteria 3050
160 Ga0105238_10092444 3300009551 Bacteria 3013
161 Ga0105238_10375140 3300009551 Bacteria 1413
162 Ga0105249_10014986 3300009553 Bacteria 6856
163 Ga0105249_10153562 3300009553 Bacteria 2219
164 Ga0105239_10020508 3300010375 Bacteria 7290
165 Ga0105239_10045095 3300010375 Bacteria 4832
166 Ga0105239_10172165 3300010375 Bacteria 2421
167 Ga0105246_10013328 3300011119 Bacteria 5151
168 Ga0105246_10015872 3300011119 Bacteria 4763
169 Ga0105246_10046601 3300011119 Bacteria 2958
170 Ga0105246_10144099 3300011119 Bacteria 1795
171 Ga0157370_10001204 3300013104 Bacteria 32311
172 Ga0157370_10013756 3300013104 Bacteria 8317
173 Ga0157369_10008913 3300013105 Bacteria 11493
174 Ga0157369_10021005 3300013105 Bacteria 7300
175 Ga0157369_10052139 3300013105 Bacteria 4427
176 Ga0157369_10056962 3300013105 Bacteria 4217
177 Ga0157374_10037034 3300013296 Bacteria 4474
178 Ga0157374_10122052 3300013296 Bacteria 2515
179 Ga0157378_10246728 3300013297 Bacteria 1708
180 Ga0163162_10354167 3300013306 Bacteria 1600
181 Ga0157372_10107597 3300013307 Bacteria 3190
182 Ga0157372_10169223 3300013307 Bacteria 2528
183 Ga0157372_10225124 3300013307 Bacteria 2174
184 Ga0157372_10595670 3300013307 Bacteria 1288
185 Ga0157375_10062713 3300013308 Bacteria 3695
186 Ga0163163_10056263 3300014325 Bacteria 3888
187 Ga0163163_10065086 3300014325 Bacteria 3618
188 Ga0163163_10506199 3300014325 Bacteria 1270
189 Ga0157380_10014210 3300014326 Bacteria 5822
190 Ga0157380_10058066 3300014326 Bacteria 3084
191 Ga0157380_10286205 3300014326 Bacteria 1511
192 Ga0157377_10048573 3300014745 Bacteria 2382
193 Ga0157377_10179319 3300014745 Bacteria 1331
194 Ga0157379_10004656 3300014968 Bacteria 11766
195 Ga0157376_10020861 3300014969 Bacteria 5078
196 Ga0182007_10002031 3300015262 Bacteria 10406
197 Ga0183367_1001 3300015688 Bacteria 1225545
198 Ga0163161_10130249 3300017792 Bacteria 1897
199 Ga0213875_10000059 3300021388 Bacteria 135414
200 Ga0209129_1000052 3300025258 Bacteria 265251
201 Ga0207426_1000529 3300025302 Bacteria 55035
202 Ga0207656_10038525 3300025321 Bacteria 2017
203 Ga0207692_10000425 3300025898 Bacteria 14797
204 Ga0207642_10042646 3300025899 Bacteria 1996
205 Ga0207688_10018028 3300025901 Bacteria 3842
206 Ga0207688_10056781 3300025901 Bacteria 2200
207 Ga0207647_10012612 3300025904 Bacteria 5876
208 Ga0207705_10105360 3300025909 Bacteria 2078
209 Ga0207654_10058353 3300025911 Bacteria 2247
210 Ga0207707_10000113 3300025912 Bacteria 82066
211 Ga0207695_10001059 3300025913 Bacteria 48227
212 Ga0207671_10001162 3300025914 Bacteria 31391
213 Ga0207693_10002417 3300025915 Bacteria 16214
214 Ga0207693_10004119 3300025915 Bacteria 12343
215 Ga0207693_10021176 3300025915 Bacteria 5169
216 Ga0207693_10172809 3300025915 Bacteria 1701
217 Ga0207663_10087121 3300025916 Bacteria 2061
218 Ga0207660_10012487 3300025917 Bacteria 5559
219 Ga0207662_10059754 3300025918 Bacteria 2285
220 Ga0207657_10004409 3300025919 Bacteria 14889
221 Ga0207657_10151762 3300025919 Bacteria 1887
222 Ga0207649_10047713 3300025920 Bacteria 2638
223 Ga0207652_10000123 3300025921 Bacteria 82875
224 Ga0207652_10406516 3300025921 Bacteria 1228
225 Ga0207646_10172182 3300025922 Bacteria 1955
226 Ga0207681_10299517 3300025923 Bacteria 1272
227 Ga0207694_10001998 3300025924 Bacteria 16870
228 Ga0207659_10018180 3300025926 Bacteria 4605
229 Ga0207687_10030669 3300025927 Bacteria 3626
230 Ga0207687_10328037 3300025927 Bacteria 1241
231 Ga0207700_10114971 3300025928 Bacteria 2172
232 Ga0207700_10301647 3300025928 Bacteria 1383
233 Ga0207664_10005713 3300025929 Bacteria 8503
234 Ga0207664_10023474 3300025929 Bacteria 4622
235 Ga0207664_10030193 3300025929 Bacteria 4138
236 Ga0207664_10229485 3300025929 Bacteria 1613
237 Ga0207664_10282249 3300025929 Bacteria 1457
238 Ga0207706_10037884 3300025933 Bacteria 4279
239 Ga0207709_10001815 3300025935 Bacteria 14245
240 Ga0207670_10035048 3300025936 Bacteria 3251
241 Ga0207670_10096349 3300025936 Bacteria 2104
242 Ga0207704_10168302 3300025938 Bacteria 1568
243 Ga0207665_10000614 3300025939 Bacteria 23903
244 Ga0207665_10024055 3300025939 Bacteria 4014
245 Ga0207691_10130149 3300025940 Bacteria 2224
246 Ga0207711_10034886 3300025941 Bacteria 4261
247 Ga0207689_10112524 3300025942 Bacteria 2238
248 Ga0207661_10018974 3300025944 Bacteria 5117
249 Ga0207661_10049061 3300025944 Bacteria 3359
250 Ga0207661_10064171 3300025944 Bacteria 2976
251 Ga0207661_10264433 3300025944 Bacteria 1533
252 Ga0207679_10012474 3300025945 Bacteria 5543
253 Ga0207651_10026631 3300025960 Bacteria 3617
254 Ga0207651_10215163 3300025960 Bacteria 1550
255 Ga0207712_10069101 3300025961 Bacteria 2534
256 Ga0207712_10176386 3300025961 Bacteria 1675
257 Ga0207668_10005141 3300025972 Bacteria 7697
258 Ga0207668_10071539 3300025972 Bacteria 2478
259 Ga0207668_10083733 3300025972 Bacteria 2322
260 Ga0207668_10088882 3300025972 Bacteria 2264
261 Ga0207640_10079154 3300025981 Bacteria 2240
262 Ga0207677_10032651 3300026023 Bacteria 3349
263 Ga0207677_10252263 3300026023 Bacteria 1433
264 Ga0207703_10039924 3300026035 Bacteria 3753
265 Ga0207703_10054606 3300026035 Bacteria 3249
266 Ga0207639_10039721 3300026041 Bacteria 3508
267 Ga0207639_10181745 3300026041 Bacteria 1790
268 Ga0207639_10248820 3300026041 Bacteria 1549
269 Ga0207678_10000020 3300026067 Bacteria 132096
270 Ga0207678_10040880 3300026067 Bacteria 4020
271 Ga0207678_10051230 3300026067 Bacteria 3564
272 Ga0207678_10087353 3300026067 Bacteria 2665
273 Ga0207708_10000006 3300026075 Bacteria 266916
274 Ga0207708_10039915 3300026075 Bacteria 3578
275 Ga0207708_10147151 3300026075 Bacteria 1852
276 Ga0207702_10010965 3300026078 Bacteria 7561
277 Ga0207702_10018672 3300026078 Bacteria 5736
278 Ga0207702_10047176 3300026078 Bacteria 3628
279 Ga0207702_10050092 3300026078 Bacteria 3526
280 Ga0207641_10256206 3300026088 Bacteria 1636
281 Ga0207676_10118697 3300026095 Bacteria 2226
282 Ga0207676_10161593 3300026095 Bacteria 1941
283 Ga0207674_10049588 3300026116 Bacteria 4293
284 Ga0207674_10097973 3300026116 Bacteria 2916
285 Ga0207674_10107654 3300026116 Bacteria 2764
286 Ga0207674_10138284 3300026116 Bacteria 2396
287 Ga0207674_10263916 3300026116 Bacteria 1669
288 Ga0207674_10315644 3300026116 Bacteria 1512
289 Ga0207675_100013792 3300026118 Bacteria 7538
290 Ga0207675_100025166 3300026118 Bacteria 5539
291 Ga0207675_100060807 3300026118 Bacteria 3526
292 Ga0207675_100127145 3300026118 Bacteria 2415
293 Ga0207675_100441914 3300026118 Bacteria 1287
294 Ga0207683_10005158 3300026121 Bacteria 11213
295 Ga0207683_10275448 3300026121 Bacteria 1537
296 Ga0207683_10436891 3300026121 Bacteria 1206
297 Ga0207698_10353589 3300026142 Bacteria 1389
298 Ga0207428_10006204 3300027907 Bacteria 11043
299 Ga0268266_10067532 3300028379 Bacteria 3095
300 Ga0268266_10256806 3300028379 Bacteria 1618
301 Ga0268265_10046240 3300028380 Bacteria 3253
302 Ga0268265_10083953 3300028380 Bacteria 2524
303 Ga0268265_10165658 3300028380 Bacteria 1883
304 Ga0268264_10110444 3300028381 Bacteria 2407
305 Ga0268264_10483451 3300028381 Bacteria 1205
306 Ga0307517_10033266 3300028786 Bacteria 5930
307 Ga0307517_10052366 3300028786 Bacteria 4093
308 Ga0307515_10000441 3300028794 Bacteria 99819
309 Ga0307515_10000890 3300028794 Bacteria 68786
310 Ga0307515_10003987 3300028794 Bacteria 30808
311 Ga0307515_10019377 3300028794 Bacteria 12254
312 Ga0307515_10147187 3300028794 Bacteria 2487
313 Ga0307511_10003983 3300030521 Bacteria 15103
314 Ga0307511_10032674 3300030521 Bacteria 4617
315 Ga0307511_10131391 3300030521 Bacteria 1507
316 Ga0307512_10003190 3300030522 Bacteria 19437
317 Ga0307512_10005175 3300030522 Bacteria 13759
318 Ga0307512_10025182 3300030522 Bacteria 5278
319 Ga0307512_10032592 3300030522 Bacteria 4496
320 Ga0307513_10000049 3300031456 Bacteria 153747
321 Ga0307513_10005311 3300031456 Bacteria 17035
322 Ga0307513_10040682 3300031456 Bacteria 5138
323 Ga0307513_10100011 3300031456 Bacteria 2926
324 Ga0307513_10314451 3300031456 Bacteria 1327
325 Ga0307509_10063006 3300031507 Bacteria 3906
326 Ga0307509_10132991 3300031507 Bacteria 2439
327 Ga0307508_10034964 3300031616 Bacteria 4529
328 Ga0307508_10092020 3300031616 Bacteria 2621
329 Ga0307508_10139597 3300031616 Bacteria 2027
330 Ga0307514_10035752 3300031649 Bacteria 3951
331 Ga0316576_10026192 3300031727 Bacteria 4090
332 Ga0307516_10000459 3300031730 Bacteria 53890
333 Ga0307516_10010622 3300031730 Bacteria 10101
334 Ga0307413_10000136 3300031824 Bacteria 19426
335 Ga0307518_10000210 3300031838 Bacteria 44276
336 Ga0307518_10112364 3300031838 Bacteria 1939
337 Ga0307406_10000480 3300031901 Bacteria 23055
338 Ga0307406_10007642 3300031901 Bacteria 6004
339 Ga0307406_10086241 3300031901 Bacteria 2102
340 Ga0307407_10227035 3300031903 Bacteria 1266
341 Ga0307412_10017085 3300031911 Bacteria 4338
342 Ga0307409_100012247 3300031995 Bacteria 5456
343 Ga0307409_100015255 3300031995 Bacteria 5035
344 Ga0307409_100062574 3300031995 Bacteria 2914
345 Ga0307409_100089366 3300031995 Bacteria 2518
346 Ga0307409_100225110 3300031995 Bacteria 1696
347 Ga0307416_100376487 3300032002 Bacteria 1448
348 Ga0307415_100036318 3300032126 Bacteria 3227
349 Ga0307415_100042312 3300032126 Bacteria 3031
350 Ga0307415_100071228 3300032126 Bacteria 2444
351 Ga0307415_100147547 3300032126 Bacteria 1806
352 Ga0307507_10000240 3300033179 Bacteria 106042
353 Ga0307507_10015925 3300033179 Bacteria 8801
354 Ga0307507_10133015 3300033179 Bacteria 1938
355 Ga0307510_10020202 3300033180 Bacteria 7789
356 Ga0307510_10021005 3300033180 Bacteria 7616
357 Ga0373929_0014916 3300035085 Bacteria 1506
358 Ga0373944_0059757 3300035089 Bacteria 1220
359 Ga0373960_0029957 3300035121 Bacteria 1513
360 Ga0373960_0041959 3300035121 Bacteria 1327
361 Ga0373961_0040296 3300035241 Bacteria 1346
362 Ga0373931_0033554 3300035691 Bacteria 2660
363 Ga0373931_0129709 3300035691 Bacteria 1450
364 Ga0373935_0284621 3300035692 Bacteria 1164
365 Ga0373933_0128274 3300035724 Bacteria 1593
366 Ga0373937_0021513 3300036401 Bacteria 5789
367 Ga0316584_0031709 3300036712 Bacteria 3908
368 Ga0373925_0146177 3300037068 Bacteria 1853
369 Ga0395899_0001340 3300037312 Bacteria 21164
370 Ga0395899_0312981 3300037312 Bacteria 1060
371 Ga0395900_0045701 3300037418 Bacteria 4510
372 Ga0395900_0170083 3300037418 Bacteria 2219
373 Ga0395900_0439104 3300037418 Bacteria 1263
374 Ga0395898_0003182 3300037466 Bacteria 18486
375 Ga0395898_0021072 3300037466 Bacteria 6613
376 Ga0395898_0053926 3300037466 Bacteria 3925
377 Ga0395898_0416284 3300037466 Bacteria 1281
378 Ga0436364_0082088 3300037853 Bacteria 178031
379 Ga0436364_0434599 3300037853 Bacteria 6253
380 Ga0436364_1038197 3300037853 Bacteria 2605
381 Ga0395901_0070494 3300038443 Bacteria 3642
382 Ga0395901_0086954 3300038443 Bacteria 3268
383 Ga0395901_0120406 3300038443 Bacteria 2758
384 Ga0395901_0180249 3300038443 Bacteria 2216
385 Ga0395901_0228495 3300038443 Bacteria 1943
386 Ga0436365_0005296 3300039437 Bacteria 1072
387 Ga0436365_0086936 3300039437 Bacteria 1741
388 Ga0436365_1724486 3300039437 Bacteria 5558
389 Ga0436360_0644977 3300039438 Bacteria 1569
390 Ga0436363_1427861 3300039450 Bacteria 1228
391 Ga0439436_0014724 3300041404 Bacteria 2356
392 Ga0439438_012603 3300041405 Bacteria 2587
393 Ga0439439_0003123 3300041406 Bacteria 3617
394 Ga0439439_0005869 3300041406 Bacteria 2824
395 Ga0439466_0021351 3300041411 Bacteria 2296
396 Ga0451797_0641249 3300041453 Bacteria 1088
397 Ga0451841_0401691 3300041498 Bacteria 1421
398 Ga0451853_0901394 3300041512 Bacteria 6437
399 Ga0451853_2187299 3300041512 Bacteria 3692
400 Ga0439431_0031195 3300041997 Bacteria 1324
401 Ga0439442_008243 3300042002 Bacteria 2104
402 Ga0439449_0005291 3300042007 Bacteria 4948
403 Ga0439449_0006288 3300042007 Bacteria 4540
404 Ga0439449_0021245 3300042007 Bacteria 2430
405 Ga0439457_001041 3300042014 Bacteria 8380
406 Ga0439457_001522 3300042014 Bacteria 6960
407 Ga0439457_002767 3300042014 Bacteria 4916
408 Ga0439462_0007584 3300042015 Bacteria 2720
409 Ga0450895_001040 3300042132 Bacteria 1834
410 Ga0450898_000988 3300042134 Bacteria 3594
411 Ga0450899_000974 3300042135 Bacteria 3250
412 Ga0450903_001545 3300042138 Bacteria 4287
413 Ga0450906_004982 3300042145 Bacteria 2755
414 Ga0439458_0000386 3300042157 Bacteria 11115
415 Ga0439458_0008194 3300042157 Bacteria 2323
416 Ga0450908_011499 3300042184 Bacteria 1619
417 Ga0466969_0001812 3300044656 Bacteria 11399
418 Ga0466969_0004618 3300044656 Bacteria 7332
419 Ga0466969_0011774 3300044656 Bacteria 4626
420 Ga0466969_0024437 3300044656 Bacteria 3108
421 Ga0466969_0028597 3300044656 Bacteria 2849
422 Ga0466969_0030546 3300044656 Bacteria 2744
423 Ga0466972_0011041 3300044658 Bacteria 4534
424 Ga0466972_0018352 3300044658 Bacteria 3496
425 Ga0466972_0025141 3300044658 Bacteria 2953
426 Ga0466972_0043254 3300044658 Bacteria 2188
427 Ga0466965_0002520 3300044683 Bacteria 7807
428 Ga0466965_0006268 3300044683 Bacteria 5387
429 Ga0466965_0073123 3300044683 Bacteria 1726
430 Ga0466965_0096930 3300044683 Bacteria 1505
431 Ga0466966_0003935 3300044684 Bacteria 9809
432 Ga0466966_0012226 3300044684 Bacteria 5687
433 Ga0466966_0012941 3300044684 Bacteria 5524
434 Ga0466966_0023881 3300044684 Bacteria 4001
435 Ga0466966_0032031 3300044684 Bacteria 3410
436 Ga0466961_0002630 3300044693 Bacteria 11153
437 Ga0466961_0008124 3300044693 Bacteria 6681
438 Ga0466961_0008808 3300044693 Bacteria 6436
439 Ga0466961_0009249 3300044693 Bacteria 6274
440 Ga0466961_0021521 3300044693 Bacteria 4150
441 Ga0466961_0027411 3300044693 Bacteria 3663
442 Ga0466961_0032383 3300044693 Bacteria 3359
443 Ga0466961_0044944 3300044693 Bacteria 2826
444 Ga0466961_0060687 3300044693 Bacteria 2404
445 Ga0466961_0152224 3300044693 Bacteria 1444
446 Ga0466963_0000099 3300044694 Bacteria 30941
447 Ga0466963_0011870 3300044694 Bacteria 5318
448 Ga0466963_0015542 3300044694 Bacteria 4716
449 Ga0466963_0073742 3300044694 Bacteria 2301
450 Ga0466963_0092372 3300044694 Bacteria 2062
451 Ga0466963_0136836 3300044694 Bacteria 1695
452 Ga0466963_0141224 3300044694 Bacteria 1668
453 Ga0466964_0000321 3300044706 Bacteria 14261
454 Ga0466971_0001426 3300044719 Bacteria 10041
455 Ga0466971_0004999 3300044719 Bacteria 5737
456 Ga0466971_0011152 3300044719 Bacteria 3935
457 Ga0466971_0020296 3300044719 Bacteria 2954
458 Ga0466971_0036870 3300044719 Bacteria 2192
459 Ga0466971_0083150 3300044719 Bacteria 1462
460 Ga0466971_0102158 3300044719 Bacteria 1318
461 Ga0466968_0186336 3300044735 Bacteria 967
462 Ga0466970_0001771 3300044765 Bacteria 10408
463 Ga0466970_0010140 3300044765 Bacteria 4774
464 Ga0466970_0156061 3300044765 Bacteria 1261
465 Ga0466957_0000206 3300044842 Bacteria 27538
466 Ga0466957_0063636 3300044842 Bacteria 2268
467 Ga0466957_0175402 3300044842 Bacteria 1398
468 Ga0466960_0000061 3300044901 Bacteria 36418
469 Ga0466960_0001976 3300044901 Bacteria 7593
470 Ga0466960_0007533 3300044901 Bacteria 4427
471 Ga0466960_0119009 3300044901 Bacteria 1381
472 Ga0466959_0004074 3300045049 Bacteria 9724
473 Ga0466959_0005042 3300045049 Bacteria 8973
474 Ga0466959_0006147 3300045049 Bacteria 8296
475 Ga0466959_0007090 3300045049 Bacteria 7840
476 Ga0466959_0016242 3300045049 Bacteria 5436
477 Ga0466959_0052490 3300045049 Bacteria 2985
478 Ga0466959_0201399 3300045049 Bacteria 1386
479 Ga0466959_0239017 3300045049 Bacteria 1255
480 Ga0466958_0006459 3300045836 Bacteria 6381
481 Ga0466958_0019859 3300045836 Bacteria 3914
482 Ga0466958_0084455 3300045836 Bacteria 1958
483 Ga0466958_0109256 3300045836 Bacteria 1726
484 Ga0466958_0147752 3300045836 Bacteria 1482
485 Ga0466958_0157663 3300045836 Bacteria 1433
486 Ga0466967_0000619 3300045976 Bacteria 17708
487 Ga0466967_0003541 3300045976 Bacteria 10223
488 Ga0466967_0032340 3300045976 Bacteria 4416
489 Ga0466967_0045851 3300045976 Bacteria 3802
490 Ga0466967_0073072 3300045976 Bacteria 3076
491 Ga0466967_0130865 3300045976 Bacteria 2329
492 Ga0466967_0156635 3300045976 Bacteria 2134
493 Ga0466967_0207926 3300045976 Bacteria 1855
494 Ga0466967_0244987 3300045976 Bacteria 1710
495 Ga0466967_0273696 3300045976 Bacteria 1618
496 Ga0466967_0314825 3300045976 Bacteria 1508
497 Ga0466967_0427116 3300045976 Bacteria 1292
498 Ga0466967_0593054 3300045976 Bacteria 1093
499 Ga0495617_010106 3300046452 Bacteria 3233
500 Ga0495592_0002483 3300046454 Bacteria 13033
501 Ga0495592_0020832 3300046454 Bacteria 4988
502 Ga0495592_0191731 3300046454 Bacteria 1385
503 Ga0495592_0204003 3300046454 Bacteria 1332
504 Ga0495603_0001385 3300046455 Bacteria 14073
505 Ga0495603_0006520 3300046455 Bacteria 6998
506 Ga0495603_0027905 3300046455 Bacteria 3404
507 Ga0495603_0032638 3300046455 Bacteria 3132
508 Ga0495629_0006675 3300046459 Bacteria 8542
509 Ga0495629_0009683 3300046459 Bacteria 7039
510 Ga0495629_0011356 3300046459 Bacteria 6469
511 Ga0495629_0023560 3300046459 Bacteria 4385
512 Ga0495629_0083582 3300046459 Bacteria 2228
513 Ga0495629_0112504 3300046459 Bacteria 1897
514 Ga0495651_0003430 3300046462 Bacteria 12161
515 Ga0495651_0009722 3300046462 Bacteria 7394
516 Ga0495651_0032132 3300046462 Bacteria 4095
517 Ga0495653_0010670 3300046463 Bacteria 7522
518 Ga0495650_0073650 3300046471 Bacteria 1334
519 Ga0495582_0076092 3300046473 Bacteria 1860
520 Ga0495605_0005955 3300046474 Bacteria 7051
521 Ga0495639_0019629 3300046475 Bacteria 2950
522 Ga0495639_0062781 3300046475 Bacteria 1705
523 Ga0495662_0000269 3300046476 Bacteria 22106
524 Ga0495662_0000678 3300046476 Bacteria 16092
525 Ga0495662_0017472 3300046476 Bacteria 3471
526 Ga0495662_0032305 3300046476 Bacteria 2528
527 Ga0495664_0002460 3300046477 Bacteria 9970
528 Ga0495664_0066152 3300046477 Bacteria 2155
529 Ga0495594_0006404 3300046499 Bacteria 6056
530 Ga0495594_0009772 3300046499 Bacteria 4966
531 Ga0495594_0030869 3300046499 Bacteria 2902
532 Ga0495607_0051011 3300046501 Bacteria 2405
533 Ga0495607_0101678 3300046501 Bacteria 1539
534 Ga0495606_0017990 3300046507 Bacteria 5317
535 Ga0495608_0053971 3300046511 Bacteria 2658
536 Ga0495608_0130033 3300046511 Bacteria 1612
537 Ga0495616_0001838 3300046513 Bacteria 14375
538 Ga0495618_0012647 3300046514 Bacteria 5127
539 Ga0495618_0018823 3300046514 Bacteria 4242
540 Ga0495618_0238601 3300046514 Bacteria 1143
541 Ga0495628_0006454 3300046516 Bacteria 10242
542 Ga0495628_0012754 3300046516 Bacteria 7077
543 Ga0495628_0042373 3300046516 Bacteria 3630
544 Ga0495628_0053279 3300046516 Bacteria 3193
545 Ga0495630_0003162 3300046517 Bacteria 11431
546 Ga0495630_0137078 3300046517 Bacteria 1860
547 Ga0495643_0025323 3300046522 Bacteria 3357
548 Ga0495666_0002468 3300046526 Bacteria 9183
549 Ga0495666_0020282 3300046526 Bacteria 3294
550 Ga0495652_0001825 3300046529 Bacteria 22600
551 Ga0495652_0007897 3300046529 Bacteria 9770
552 Ga0495652_0020898 3300046529 Bacteria 5817
553 Ga0495652_0027088 3300046529 Bacteria 5053
554 Ga0495652_0030429 3300046529 Bacteria 4736
555 Ga0495652_0107809 3300046529 Bacteria 2246
556 Ga0495640_0013810 3300046533 Bacteria 6134
557 Ga0495640_0017001 3300046533 Bacteria 5429
558 Ga0495640_0098191 3300046533 Bacteria 1925
559 Ga0495587_0002745 3300046536 Bacteria 11739
560 Ga0495609_0052193 3300046538 Bacteria 1819
561 Ga0495645_0037361 3300046543 Bacteria 3539
562 Ga0495645_0044162 3300046543 Bacteria 3251
563 Ga0495645_0050195 3300046543 Bacteria 3038
564 Ga0495645_0071972 3300046543 Bacteria 2492
565 Ga0495622_0040451 3300046557 Bacteria 2169
566 Ga0495667_0008916 3300046559 Bacteria 6819
567 Ga0495667_0108040 3300046559 Bacteria 1798
568 Ga0495667_0240946 3300046559 Bacteria 1152
569 Ga0495656_0086372 3300046615 Bacteria 1427
570 Ga0495668_0009851 3300046616 Bacteria 5830
571 Ga0495634_0004250 3300046642 Bacteria 11292
572 Ga0495634_0121342 3300046642 Bacteria 1673
573 Ga0495611_0009795 3300046648 Bacteria 4052
574 Ga0495611_0069401 3300046648 Bacteria 1610
575 Ga0495635_0004368 3300046663 Bacteria 9787
576 Ga0495635_0006861 3300046663 Bacteria 7955
577 Ga0495635_0036005 3300046663 Bacteria 3432
578 Ga0495588_0001933 3300046674 Bacteria 8852
579 Ga0495588_0003867 3300046674 Bacteria 6562
580 Ga0495588_0145073 3300046674 Bacteria 1254
581 Ga0495657_0004106 3300046675 Bacteria 11678
582 Ga0495657_0010530 3300046675 Bacteria 6955
583 Ga0495657_0020962 3300046675 Bacteria 4696
584 Ga0495657_0045863 3300046675 Bacteria 2963
585 Ga0495657_0055942 3300046675 Bacteria 2630
586 Ga0495599_0006003 3300046678 Bacteria 7307
587 Ga0495599_0037551 3300046678 Bacteria 3043
588 Ga0495623_0002580 3300046679 Bacteria 11971
589 Ga0495623_0112308 3300046679 Bacteria 1650
590 Ga0495646_0000765 3300046680 Bacteria 17921
591 Ga0495646_0014718 3300046680 Bacteria 4972
592 Ga0495613_0001493 3300046689 Bacteria 17818
593 Ga0495613_0009005 3300046689 Bacteria 7407
594 Ga0495613_0018934 3300046689 Bacteria 5128
595 Ga0495613_0019514 3300046689 Bacteria 5052
596 Ga0495613_0117902 3300046689 Bacteria 1908
597 Ga0495624_0042629 3300046690 Bacteria 2900
598 Ga0495624_0101813 3300046690 Bacteria 1768
599 Ga0495624_0229137 3300046690 Bacteria 1125
600 Ga0495670_0044446 3300046691 Bacteria 2218
601 Ga0495670_0056588 3300046691 Bacteria 1968
602 Ga0495671_0046994 3300046692 Bacteria 2158
603 Ga0495671_0068244 3300046692 Bacteria 1748
604 Ga0495649_0023029 3300046694 Bacteria 3480
605 Ga0495589_0001676 3300046794 Bacteria 12681
606 Ga0495589_0009376 3300046794 Bacteria 5090
607 Ga0495589_0016781 3300046794 Bacteria 3760
608 Ga0495589_0047951 3300046794 Bacteria 2115
609 Ga0495589_0120080 3300046794 Bacteria 1266
610 Ga0495600_0002374 3300046809 Bacteria 10763
611 Ga0495600_0007890 3300046809 Bacteria 6522
612 Ga0495600_0034090 3300046809 Bacteria 3305
613 Ga0495581_0036026 3300047315 Bacteria 2862
614 Ga0495581_0115988 3300047315 Bacteria 1557
615 Ga0495581_0193065 3300047315 Bacteria 1191
616 Ga0495604_0000392 3300047317 Bacteria 39604
617 Ga0495604_0004530 3300047317 Bacteria 11008
618 Ga0495604_0011430 3300047317 Bacteria 7048
619 Ga0495604_0012626 3300047317 Bacteria 6720
620 Ga0495604_0014376 3300047317 Bacteria 6313
621 Ga0495636_0003865 3300047318 Bacteria 5844
622 Ga0495636_0005973 3300047318 Bacteria 4780
623 Ga0495674_0013220 3300047319 Bacteria 7759
624 Ga0495674_0067834 3300047319 Bacteria 3089
625 Ga0495672_0018483 3300047320 Bacteria 4624
626 Ga0495676_0011089 3300047321 Bacteria 8144
627 Ga0495676_0019201 3300047321 Bacteria 6013
628 Ga0495676_0133399 3300047321 Bacteria 1789
629 Ga0495676_0258092 3300047321 Bacteria 1186
630 Ga0495680_0015604 3300047322 Bacteria 6550
631 Ga0495683_0012919 3300047323 Bacteria 4379
632 Ga0495683_0132102 3300047323 Bacteria 1176
633 Ga0495687_001678 3300047443 Bacteria 19766
634 Ga0495687_003806 3300047443 Bacteria 10643
635 Ga0495675_0002441 3300047444 Bacteria 11115
636 Ga0495675_0005847 3300047444 Bacteria 7516
637 Ga0495675_0114249 3300047444 Bacteria 1684
638 Ga0495675_0122896 3300047444 Bacteria 1616
639 Ga0495685_008489 3300047447 Bacteria 3413
640 Ga0495685_010168 3300047447 Bacteria 3153
641 Ga0495685_015729 3300047447 Bacteria 2583
642 Ga0495685_025964 3300047447 Bacteria 2016
643 Ga0495681_0009754 3300047470 Bacteria 5880
644 Ga0495681_0012274 3300047470 Bacteria 5044
645 Ga0495684_0004401 3300047471 Bacteria 11008
646 Ga0495684_0072468 3300047471 Bacteria 2617
647 Ga0495686_0036864 3300047472 Bacteria 3136
648 Ga0495593_0136840 3300047673 Bacteria 1241
649 Ga0495602_0005444 3300048088 Bacteria 13353
650 Ga0495602_0035838 3300048088 Bacteria 4623
651 Ga0495602_0037017 3300048088 Bacteria 4534
652 Ga0495602_0101937 3300048088 Bacteria 2353
653 Ga0495614_0008078 3300048089 Bacteria 4677
654 Ga0495614_0010023 3300048089 Bacteria 4183
655 Ga0495626_0031995 3300048091 Bacteria 2528
656 Ga0496100_0183413 3300048903 Bacteria 1515
657 Ga0496101_0226899 3300048904 Bacteria 1451
658 Ga0496104_0008319 3300048907 Bacteria 9213
659 Ga0496104_0017592 3300048907 Bacteria 6513
660 Ga0496104_0126357 3300048907 Bacteria 2456
661 Ga0496104_0139238 3300048907 Bacteria 2332
662 Ga0496104_0198353 3300048907 Bacteria 1919
663 Ga0496105_0010317 3300048908 Bacteria 7343
664 Ga0496105_0011244 3300048908 Bacteria 7063
665 Ga0496105_0135130 3300048908 Bacteria 2032
666 Ga0496105_0175672 3300048908 Bacteria 1755
667 Ga0496106_0055173 3300048909 Bacteria 3002
668 Ga0496106_0111286 3300048909 Bacteria 2132
669 Ga0496107_0032592 3300048910 Bacteria 3724
670 Ga0496108_0140765 3300048911 Bacteria 2078
671 Ga0496109_0022965 3300048912 Bacteria 5530
672 Ga0496109_0030766 3300048912 Bacteria 4811
673 Ga0496109_0074794 3300048912 Bacteria 3114
674 Ga0496109_0222136 3300048912 Bacteria 1776
675 Ga0496109_0415053 3300048912 Bacteria 1272
676 Ga0496110_0073837 3300048913 Bacteria 3027
677 Ga0496110_0092476 3300048913 Bacteria 2707
678 Ga0496110_0309660 3300048913 Bacteria 1438
679 Ga0496110_0353003 3300048913 Bacteria 1339
680 Ga0496111_0006233 3300048914 Bacteria 7729
681 Ga0496111_0043363 3300048914 Bacteria 3233
682 Ga0496111_0381157 3300048914 Bacteria 1043
683 Ga0496112_0022473 3300048915 Bacteria 6010
684 Ga0496112_0053064 3300048915 Bacteria 3980
685 Ga0496112_0190889 3300048915 Bacteria 2011
686 Ga0496112_0284235 3300048915 Bacteria 1601
687 Ga0496113_0018547 3300048916 Bacteria 4848
688 Ga0496113_0360739 3300048916 Bacteria 1166
689 Ga0496114_0037014 3300048917 Bacteria 4035
690 Ga0496114_0486285 3300048917 Bacteria 1092
691 Ga0496115_0030039 3300048918 Bacteria 4273
692 Ga0496115_0059022 3300048918 Bacteria 3089
693 Ga0496115_0091730 3300048918 Bacteria 2483
694 Ga0496117_0098547 3300048920 Bacteria 1858
695 Ga0496120_0026159 3300048923 Bacteria 3608
696 Ga0496123_0092054 3300048926 Bacteria 1796
697 Ga0496126_0146989 3300048929 Bacteria 2023
698 Ga0501031_0058273 3300049568 Bacteria 2517
699 Ga0501032_0000035 3300049569 Bacteria 117554
700 Ga0501032_0046050 3300049569 Bacteria 2948
701 Ga0501032_0048386 3300049569 Bacteria 2871
702 Ga0501032_0101956 3300049569 Bacteria 1902
703 Ga0501033_0000254 3300049570 Bacteria 51199
704 Ga0501033_0009045 3300049570 Bacteria 7683
705 Ga0501034_0001330 3300049571 Bacteria 33387
706 Ga0501034_0014791 3300049571 Bacteria 8029
707 Ga0501034_0020364 3300049571 Bacteria 6772
708 Ga0501034_0118041 3300049571 Bacteria 2640
709 Ga0501034_0148498 3300049571 Bacteria 2320
710 Ga0501034_0340407 3300049571 Bacteria 1430
711 Ga0501036_0000174 3300049572 Bacteria 42286
712 Ga0501036_0003066 3300049572 Bacteria 13318
713 Ga0501036_0004422 3300049572 Bacteria 11349
714 Ga0501036_0015451 3300049572 Bacteria 6377
715 Ga0501036_0216361 3300049572 Bacteria 1609
716 Ga0501037_0000541 3300049573 Bacteria 30177
717 Ga0501037_0071122 3300049573 Bacteria 2531
718 Ga0501038_0000364 3300049574 Bacteria 39107
719 Ga0501038_0000951 3300049574 Bacteria 25879
720 Ga0501038_0010610 3300049574 Bacteria 8420
721 Ga0501038_0113577 3300049574 Bacteria 2241
722 Ga0501038_0116000 3300049574 Bacteria 2213
723 Ga0501038_0189479 3300049574 Bacteria 1656
724 Ga0501038_0397597 3300049574 Bacteria 1066
725 Ga0501039_0000133 3300049575 Bacteria 51845
726 Ga0501039_0004010 3300049575 Bacteria 11070
727 Ga0501039_0049454 3300049575 Bacteria 3250
728 Ga0501039_0062884 3300049575 Bacteria 2876
729 Ga0501040_0060215 3300049576 Bacteria 2609
730 Ga0501040_0081021 3300049576 Bacteria 2249
731 Ga0501041_0042094 3300049577 Bacteria 2774
732 Ga0501042_0011558 3300049578 Bacteria 5959
733 Ga0501042_0028930 3300049578 Bacteria 3908
734 Ga0501043_0000302 3300049579 Bacteria 44708
735 Ga0501043_0001197 3300049579 Bacteria 22839
736 Ga0501046_0000205 3300049580 Bacteria 61540
737 Ga0501046_0085809 3300049580 Bacteria 2427
738 Ga0501047_0001445 3300049581 Bacteria 23262
739 Ga0501047_0007057 3300049581 Bacteria 10550
740 Ga0501047_0104437 3300049581 Bacteria 2713
741 Ga0501047_0227533 3300049581 Bacteria 1719
742 Ga0501048_0000314 3300049582 Bacteria 33141
743 Ga0501048_0002204 3300049582 Bacteria 14821
744 Ga0501067_0072899 3300049583 Bacteria 1903
745 Ga0501068_0016478 3300049584 Bacteria 4260
746 Ga0501069_0000262 3300049585 Bacteria 23850
747 Ga0501070_0000681 3300049586 Bacteria 31106
748 Ga0501070_0079809 3300049586 Bacteria 2708
749 Ga0501070_0167475 3300049586 Bacteria 1811
750 Ga0501072_0216566 3300049588 Bacteria 1526
751 Ga0501073_0005738 3300049589 Bacteria 9284
752 Ga0501073_0021915 3300049589 Bacteria 4603
753 Ga0501074_0000457 3300049590 Bacteria 24565
754 Ga0501074_0007866 3300049590 Bacteria 7720
755 Ga0501074_0085404 3300049590 Bacteria 2262
756 Ga0501075_0155882 3300049591 Bacteria 1741
757 Ga0501076_0074107 3300049592 Bacteria 2726
758 Ga0501076_0149816 3300049592 Bacteria 1898
759 Ga0501079_0112283 3300049741 Bacteria 2118
760 Ga0501079_0173237 3300049741 Bacteria 1683
761 Ga0501080_0000364 3300049742 Bacteria 35069
762 Ga0501080_0028919 3300049742 Bacteria 5159
763 Ga0501081_0070331 3300049743 Bacteria 2439
764 Ga0501083_0031136 3300049744 Bacteria 3661
765 Ga0501035_0003679 3300049822 Bacteria 14614
766 Ga0501035_0005294 3300049822 Bacteria 12213
767 Ga0501035_0052415 3300049822 Bacteria 3651
768 Ga0501035_0077715 3300049822 Bacteria 2933
769 Ga0501035_0135728 3300049822 Bacteria 2142
770 Ga0501044_0001131 3300049823 Bacteria 31710
771 Ga0501044_0004785 3300049823 Bacteria 15145
772 Ga0501044_0045775 3300049823 Bacteria 4532
773 Ga0501044_0055339 3300049823 Bacteria 4075
774 Ga0501044_0122619 3300049823 Bacteria 2598
775 Ga0501045_0275908 3300049824 Bacteria 1251
776 nmdc:mga00v17_45265_c1 3300050491 Bacteria 2658
777 nmdc:mga0yw44_160591_c1 3300050492 Bacteria 1471
778 nmdc:mga07m45_31492_c1 3300050496 Bacteria 2939
779 nmdc:mga05p37_252771_c1 3300050507 Bacteria 2113
780 nmdc:mga05p37_263_c1 3300050507 Bacteria 54412
781 nmdc:mga05p37_33679_c1 3300050507 Bacteria 6275
782 nmdc:mga05p37_52132_c1 3300050507 Bacteria 5031
783 nmdc:mga05p37_672_c1 3300050507 Bacteria 37785
784 nmdc:mga09592_163260_c1 3300050508 Bacteria 1925
785 nmdc:mga09592_2964_c1 3300050508 Bacteria 13758
786 nmdc:mga09592_351690_c1 3300050508 Bacteria 1275
787 nmdc:mga09592_423315_c1 3300050508 Bacteria 1150
788 nmdc:mga09592_7924_c1 3300050508 Bacteria 8633
789 nmdc:mga0qj67_20471_c1 3300050509 Bacteria 5065
790 nmdc:mga0qj67_294_c1 3300050509 Bacteria 34748
791 nmdc:mga0qj67_5016_c1 3300050509 Bacteria 9618
792 nmdc:mga0qj67_65955_c1 3300050509 Bacteria 2883
793 nmdc:mga06r32_217_c1 3300050510 Bacteria 46509
794 nmdc:mga06r32_285_c2 3300050510 Bacteria 37898
795 nmdc:mga06r32_29142_c1 3300050510 Bacteria 5171
796 nmdc:mga06r32_5826_c1 3300050510 Bacteria 11100
797 nmdc:mga06r32_6085_c1 3300050510 Bacteria 10839
798 nmdc:mga06r32_6270_c1 3300050510 Bacteria 10677
799 nmdc:mga06r32_649107_c1 3300050510 Bacteria 1023
800 nmdc:mga08y16_12424_c1 3300050511 Bacteria 8960
801 nmdc:mga08y16_71851_c1 3300050511 Bacteria 3606
802 nmdc:mga0rr50_100493_c1 3300050513 Bacteria 2272
803 Ga0495601_0002431 3300053077 Bacteria 10567
804 Ga0495601_0012631 3300053077 Bacteria 5066
805 Ga0495601_0023571 3300053077 Bacteria 3782
806 Ga0495601_0075180 3300053077 Bacteria 2162
807 Ga0495601_0115629 3300053077 Bacteria 1739
808 Ga0495601_0287420 3300053077 Bacteria 1072
809 Ga0495601_0304408 3300053077 Bacteria 1038
810 Ga0495612_0005805 3300053078 Bacteria 5097
811 Ga0495612_0011994 3300053078 Bacteria 3492
812 Ga0495612_0020048 3300053078 Bacteria 2679
813 Ga0495612_0048694 3300053078 Bacteria 1738
814 Ga0495619_0025865 3300053085 Bacteria 3773
815 Ga0495619_0149306 3300053085 Bacteria 1612
816 Ga0495619_0197485 3300053085 Bacteria 1393
817 Ga0500650_0021699 3300053098 Bacteria 2833
818 Ga0500560_000662 3300053107 Bacteria 5090
819 Ga0500559_0000733 3300053136 Bacteria 21579
820 Ga0500568_0000107 3300053139 Bacteria 77492
821 Ga0500573_0064778 3300053140 Bacteria 2090
822 Ga0500577_0027280 3300053142 Bacteria 1954
823 Ga0500577_0041201 3300053142 Bacteria 1683
824 Ga0500600_0082316 3300053149 Bacteria 1738
825 Ga0500600_0096576 3300053149 Bacteria 1567
826 Ga0500634_0081617 3300053161 Bacteria 1665
827 Ga0501084_0002579 3300054114 Bacteria 14601
828 Ga0501082_0373894 3300060353 Bacteria 1243
829 Ga0466962_0000193 3300061719 Bacteria 25238
830 Ga0466962_0000253 3300061719 Bacteria 22558
831 Ga0466962_0041859 3300061719 Bacteria 2192
832 Ga0466962_0054913 3300061719 Bacteria 1903
833 2501944816 2501939600 Bacteria 6907073
834 2515857250 2515154155 Bacteria 7985436
835 2552112603 2551306166 Bacteria 9731570
836 2554260410 2554235005 Bacteria 6457341
837 2558907112 2558860112 Bacteria 9931328
838 2559427757 2558860280 Bacteria 11429938
839 2585309357 2582581313 Bacteria 10042643
840 2585311910 2582581314 Bacteria 11452267
841 2586061523 2585427649 Bacteria 9053857
842 2616696303 2616644814 Bacteria 11555299
843 2616699080 2616644814 Bacteria 11555299
844 2616902691 2616644941 Bacteria 8510691
845 2643784229 2643221553 Bacteria 3544260
846 2643904335 2643221578 Bacteria 9213798
847 2644174194 2643221631 Bacteria 8168043
848 2644264665 2643221647 Bacteria 10741251
849 2644277864 2643221649 Bacteria 3867359
850 2644333841 2643221659 Bacteria 7890716
851 2644402688 2643221673 Bacteria 9196637
852 2644437972 2643221678 Bacteria 9540101
853 2644447216 2643221679 Bacteria 3839507
854 2644631222 2643221714 Bacteria 9015452
855 2676476482 2675903058 Bacteria 6822861
856 2723643223 2721755702 Bacteria 4373124
857 2738695533 2738541272 Bacteria 6848551
858 2739326324 2738543027 Bacteria 6409078
859 2739604775 2739367654 Bacteria 6049412
860 2760308206 2758568522 Bacteria 5953541
861 2760623215 2758568621 Bacteria 5967089
862 2784591413 2784132148 Bacteria 8627943
863 2785339733 2784746763 Bacteria 9783172
864 2785372403 2784746768 Bacteria 10036182
865 2786673534 2786546132 Bacteria 10419719
866 2793975731 2791355406 Bacteria 11364898
867 2795796884 2795385472 Bacteria 6627535
868 2808628904 2808606306 Bacteria 3608896
869 2808845118 2808606359 Bacteria 9866990
870 2808901759 2808606372 Bacteria 4649509
871 2808914806 2808606375 Bacteria 9466072
872 2809027961 2808606394 Bacteria 6248540
873 2809235015 2808606448 Bacteria 8656184
874 2809589368 2808606522 Bacteria 9488490
875 2811843043 2808606982 Bacteria 7791042
876 2812354494 2811994879 Bacteria 9313447
877 2812477300 2811994917 Bacteria 7761064
878 2816421626 2816332119 Bacteria 8120218
879 2819743762 2818991472 Bacteria 10089953
880 2827632291 2827628540 Bacteria 6858585
881 2837269505 2837268691 Bacteria 7850704
882 2844850960 2844849076 Bacteria 4091819
883 2852678528 2852677369 Bacteria 3768884
884 2856863739 2856858025 Bacteria 7255264
885 2857721453 2857720070 Bacteria 3189373
886 2857733326 2857729791 Bacteria 4040535
887 2858904359 2858902515 Bacteria 7086037
888 2861524026 2861520306 Bacteria 8348283
889 2862180255 2862178590 Bacteria 8583590
890 2862284058 2862281513 Bacteria 9621493
891 2862388723 2862382967 Bacteria 10317375
892 2862575357 2862574272 Bacteria 10567477
893 2862994973 2862993130 Bacteria 3860849
894 2863410275 2863404153 Bacteria 9672205
895 2867305704 2867302475 Bacteria 7087181
896 2867314991 2867312974 Bacteria 7058875
897 2867320012 2867319477 Bacteria 7069771
898 2867434177 2867428634 Bacteria 9590268
899 2867475199 2867475112 Bacteria 6909112
900 2868095011 2868088558 Bacteria 7609351
901 2873152801 2873151551 Bacteria 8625867
902 2873319406 2873314349 Bacteria 8512634
903 2877678257 2877676314 Bacteria 9512378
904 2883822716 2883821847 Bacteria 5121194
905 2884700572 2884693830 Bacteria 11273186
906 2895430746 2895427314 Bacteria 13147766
907 2895450207 2895442618 Bacteria 11027144
908 2899364440 2899359706 Bacteria 10940472
909 2912716891 2912715099 Bacteria 9460473
910 2912726510 2912723979 Bacteria 8557534
911 2912764148 2912757875 Bacteria 7940295
912 2915772562 2915768154 Bacteria 8424322
913 2919471085 2919468124 Bacteria 9133025
914 2928093658 2928090899 Bacteria 3158267
915 2928121520 2928121344 Bacteria 3972376
916 2935391096 2935390628 Bacteria 7043367
917 2935412036 2935409751 Bacteria 4179611
918 2939647351 2939647034 Bacteria 4681660
919 2945958941 2945956166 Bacteria 5110334
920 2946024333 2946024296 Bacteria 3508095
921 2946036304 2946033335 Bacteria 3835514
922 2946047312 2946045630 Bacteria 8527308
923 2946071209 2946064051 Bacteria 8957905
924 2946078990 2946072368 Bacteria 8999607
925 2954010529 2954002825 Bacteria 9173742
926 2954383151 2954380949 Bacteria 10050426
927 2954679840 2954673503 Bacteria 9685905
928 2954684313 2954682443 Bacteria 9862841
929 2954693863 2954691527 Bacteria 10720516
930 2954708974 2954701450 Bacteria 10834262
931 2954713494 2954711539 Bacteria 10867210
932 2954723459 2954721474 Bacteria 10456478
933 2954738370 2954731030 Bacteria 10243860
934 2954742363 2954740390 Bacteria 10229294
935 2954757232 2954749733 Bacteria 10366972
936 2954761333 2954759201 Bacteria 9358192
937 2984582650 2984580707 Bacteria 3351387
938 2990046265 2990044586 Bacteria 6603797
939 2990067028 2990059506 Bacteria 9321252
940 2995469381 2995463766 Bacteria 8577691
941 2997601259 2997600082 Bacteria 9896405
942 3003006367 3002998708 Bacteria 11715108
943 3006489421 3006486233 Bacteria 8157040
944 3006500510 3006493962 Bacteria 8825450
945 649814519 649633069 Bacteria 6962533
946 8003317819 8003314358 Bacteria 10575343
947 8004025408 8004021418 Bacteria 4313954
948 8008489048 8008485437 Bacteria 7198341
949 8008564271 8008558824 Bacteria 10610750
950 8008575804 8008574985 Bacteria 7815457
951 8023630328 8023623736 Bacteria 8593882
952 8025484987 8025478263 Bacteria 8209203
953 8025528531 8025524527 Bacteria 7197316
954 8025535335 8025530807 Bacteria 8495698
955 8033690088 8033684223 Bacteria 6906479
956 8047897436 8047893842 Bacteria 11723082
957 8048133296 8048127548 Bacteria 11053136
958 8048361434 8048356638 Bacteria 11044339
959 8048374423 8048369669 Bacteria 11666822
960 8048383799 8048379754 Bacteria 11877923
961 8048411921 8048406513 Bacteria 8936924
962 8055068630 8055066027 Bacteria 9479577
963 8055174514 8055172936 Bacteria 9305943
964 8056059551 8056054917 Bacteria 5736694
965 8056065356 8056060235 Bacteria 7259403
966 8056213556 8056207758 Bacteria 8639239
967 8056582150 8056579771 Bacteria 5840325
968 8056667681 8056667051 Bacteria 6953971
969 8056832697 8056829672 Bacteria 9045328
970 8057572497 8057568493 Bacteria 7221719
971 Ga0501044_0322262
972 JGI25152J39213_1000445
973 JGI25406J46586_10009421
974 Ga0070658_10014870
975 Ga0070658_10089827
976 Ga0070658_10131060
977 Ga0070676_10075008
978 Ga0070683_100002200
979 Ga0070683_100205562
980 Ga0070690_100058806
981 Ga0070670_100128749
982 Ga0068869_100212969
983 Ga0070680_100000156
984 Ga0070682_100203931
985 Ga0068868_100033216
986 Ga0068868_100049968
987 Ga0068868_100065164
988 Ga0070660_100019637
989 Ga0070687_100002948
990 Ga0070661_100005318
991 Ga0070668_100002459
992 Ga0070668_100004175
993 Ga0070668_100013671
994 Ga0070668_100036839
995 Ga0070675_100002879
996 Ga0070675_100131771
997 Ga0070659_100006993
998 Ga0070659_100011938
999 Ga0070709_10023711
1000 Ga0070714_100001183
1001 Ga0070714_100011882
1002 Ga0070714_100023790
1003 Ga0070713_100127251
1004 Ga0070710_10000059
1005 Ga0070701_10035737
1006 Ga0070711_100005825
1007 Ga0070700_100000010
1008 Ga0070700_100117232
1009 Ga0070708_100070123
1010 Ga0070663_100002831
1011 Ga0070663_100028631
1012 Ga0070663_100086824
1013 Ga0070678_100017990
1014 Ga0070662_100091599
1015 Ga0070681_10000051
1016 Ga0070706_100230711
1017 Ga0070698_100145680
1018 Ga0070679_100000058
1019 Ga0070684_100026442
1020 Ga0068853_100034571
1021 Ga0068853_100041007
1022 Ga0070672_100214960
1023 Ga0070672_100215547
1024 Ga0070672_100250678
1025 Ga0070686_100062796
1026 Ga0070686_100077604
1027 Ga0070695_100006608
1028 Ga0070696_100002797
1029 Ga0070696_100046761
1030 Ga0070693_100005019
1031 Ga0070665_100026257
1032 Ga0070665_100106861
1033 Ga0070704_100060908
1034 Ga0068855_100021380
1035 Ga0068855_100042269
1036 Ga0068855_100407636
1037 Ga0070664_100000709
1038 Ga0070664_100212551
1039 Ga0068857_100194485
1040 Ga0068857_100261883
1041 Ga0068854_100001593
1042 Ga0068854_100019187
1043 Ga0068854_100044222
1044 Ga0068854_100097628
1045 Ga0068856_100060920
1046 Ga0068856_100102841
1047 Ga0068856_100152945
1048 Ga0070702_100046942
1049 Ga0070702_100047143
1050 Ga0070702_100051996
1051 Ga0068852_100044208
1052 Ga0068859_100118195
1053 Ga0068859_100211730
1054 Ga0068864_100017421
1055 Ga0068866_10007714
1056 Ga0068861_100041128
1057 Ga0068861_100044201
1058 Ga0068851_10009022
1059 Ga0068863_100116961
1060 Ga0068858_100012588
1061 Ga0068858_100032797
1062 Ga0068860_100028494
1063 Ga0068860_100207123
1064 Ga0068862_100117230
1065 Ga0081455_10000030
1066 Ga0081455_10000167
1067 Ga0081455_10009504
1068 Ga0081455_10011405
1069 Ga0081538_10002078
1070 Ga0081538_10031153
1071 Ga0081538_10042653
1072 Ga0081540_1004241
1073 Ga0081540_1008022
1074 Ga0081539_10000079
1075 Ga0081539_10000574
1076 Ga0081539_10050003
1077 Ga0070717_10002723
1078 Ga0070717_10039881
1079 Ga0075363_100058972
1080 Ga0070715_10014425
1081 Ga0070712_100016307
1082 Ga0070712_100042881
1083 Ga0075367_10000070
1084 Ga0097621_100039480
1085 Ga0097621_100048999
1086 Ga0068871_100020867
1087 Ga0075428_100000122
1088 Ga0075428_100001356
1089 Ga0075428_100136999
1090 Ga0075430_100003241
1091 Ga0075430_100016753
1092 Ga0075431_100002314
1093 Ga0075431_100003329
1094 Ga0075431_100009370
1095 Ga0075431_100039497
1096 Ga0075434_100135577
1097 Ga0075434_100526668
1098 Ga0075429_100003556
1099 Ga0075429_100033333
1100 Ga0075429_100241963
1101 Ga0068865_100033664
1102 Ga0097620_100118192
1103 Ga0097620_100211728
1104 Ga0099826_10056709
1105 Ga0075435_100022895
1106 Ga0105240_10163108
1107 Ga0111539_10001616
1108 Ga0111539_10057246
1109 Ga0111539_10139506
1110 Ga0105245_10002942
1111 Ga0105245_10691348
1112 Ga0105247_10010343
1113 Ga0105247_10049962
1114 Ga0105247_10122853
1115 Ga0105247_10144624
1116 Ga0114129_10008813
1117 Ga0114129_10045350
1118 Ga0114129_10046039
1119 Ga0114129_10106851
1120 Ga0105243_10002445
1121 Ga0105243_10199198
1122 Ga0105243_10226946
1123 Ga0105241_10018236
1124 Ga0105241_10041270
1125 Ga0105242_10036982
1126 Ga0105242_10208099
1127 Ga0105248_10075709
1128 Ga0105248_10085261
1129 Ga0105237_10090473
1130 Ga0105238_10092444
1131 Ga0105238_10375140
1132 Ga0105249_10014986
1133 Ga0105249_10153562
1134 Ga0105239_10020508
1135 Ga0105239_10045095
1136 Ga0105239_10172165
1137 Ga0105246_10013328
1138 Ga0105246_10015872
1139 Ga0105246_10046601
1140 Ga0105246_10144099
1141 Ga0157370_10001204
1142 Ga0157370_10013756
1143 Ga0157369_10008913
1144 Ga0157369_10021005
1145 Ga0157369_10052139
1146 Ga0157369_10056962
1147 Ga0157374_10037034
1148 Ga0157374_10122052
1149 Ga0157378_10246728
1150 Ga0163162_10354167
1151 Ga0157372_10107597
1152 Ga0157372_10169223
1153 Ga0157372_10225124
1154 Ga0157372_10595670
1155 Ga0157375_10062713
1156 Ga0163163_10056263
1157 Ga0163163_10065086
1158 Ga0163163_10506199
1159 Ga0157380_10014210
1160 Ga0157380_10058066
1161 Ga0157380_10286205
1162 Ga0157377_10048573
1163 Ga0157377_10179319
1164 Ga0157379_10004656
1165 Ga0157376_10020861
1166 Ga0182007_10002031
1167 Ga0183367_1001
1168 Ga0163161_10130249
1169 Ga0213875_10000059
1170 Ga0209129_1000052
1171 Ga0207426_1000529
1172 Ga0207656_10038525
1173 Ga0207692_10000425
1174 Ga0207642_10042646
1175 Ga0207688_10018028
1176 Ga0207688_10056781
1177 Ga0207647_10012612
1178 Ga0207705_10105360
1179 Ga0207654_10058353
1180 Ga0207707_10000113
1181 Ga0207695_10001059
1182 Ga0207671_10001162
1183 Ga0207693_10002417
1184 Ga0207693_10004119
1185 Ga0207693_10021176
1186 Ga0207693_10172809
1187 Ga0207663_10087121
1188 Ga0207660_10012487
1189 Ga0207662_10059754
1190 Ga0207657_10004409
1191 Ga0207657_10151762
1192 Ga0207649_10047713
1193 Ga0207652_10000123
1194 Ga0207652_10406516
1195 Ga0207646_10172182
1196 Ga0207681_10299517
1197 Ga0207694_10001998
1198 Ga0207659_10018180
1199 Ga0207687_10030669
1200 Ga0207687_10328037
1201 Ga0207700_10114971
1202 Ga0207700_10301647
1203 Ga0207664_10005713
1204 Ga0207664_10023474
1205 Ga0207664_10030193
1206 Ga0207664_10229485
1207 Ga0207664_10282249
1208 Ga0207706_10037884
1209 Ga0207709_10001815
1210 Ga0207670_10035048
1211 Ga0207670_10096349
1212 Ga0207704_10168302
1213 Ga0207665_10000614
1214 Ga0207665_10024055
1215 Ga0207691_10130149
1216 Ga0207711_10034886
1217 Ga0207689_10112524
1218 Ga0207661_10018974
1219 Ga0207661_10049061
1220 Ga0207661_10064171
1221 Ga0207661_10264433
1222 Ga0207679_10012474
1223 Ga0207651_10026631
1224 Ga0207651_10215163
1225 Ga0207712_10069101
1226 Ga0207712_10176386
1227 Ga0207668_10005141
1228 Ga0207668_10071539
1229 Ga0207668_10083733
1230 Ga0207668_10088882
1231 Ga0207640_10079154
1232 Ga0207677_10032651
1233 Ga0207677_10252263
1234 Ga0207703_10039924
1235 Ga0207703_10054606
1236 Ga0207639_10039721
1237 Ga0207639_10181745
1238 Ga0207639_10248820
1239 Ga0207678_10000020
1240 Ga0207678_10040880
1241 Ga0207678_10051230
1242 Ga0207678_10087353
1243 Ga0207708_10000006
1244 Ga0207708_10039915
1245 Ga0207708_10147151
1246 Ga0207702_10010965
1247 Ga0207702_10018672
1248 Ga0207702_10047176
1249 Ga0207702_10050092
1250 Ga0207641_10256206
1251 Ga0207676_10118697
1252 Ga0207676_10161593
1253 Ga0207674_10049588
1254 Ga0207674_10097973
1255 Ga0207674_10107654
1256 Ga0207674_10138284
1257 Ga0207674_10263916
1258 Ga0207674_10315644
1259 Ga0207675_100013792
1260 Ga0207675_100025166
1261 Ga0207675_100060807
1262 Ga0207675_100127145
1263 Ga0207675_100441914
1264 Ga0207683_10005158
1265 Ga0207683_10275448
1266 Ga0207683_10436891
1267 Ga0207698_10353589
1268 Ga0207428_10006204
1269 Ga0268266_10067532
1270 Ga0268266_10256806
1271 Ga0268265_10046240
1272 Ga0268265_10083953
1273 Ga0268265_10165658
1274 Ga0268264_10110444
1275 Ga0268264_10483451
1276 Ga0307517_10033266
1277 Ga0307517_10052366
1278 Ga0307515_10000441
1279 Ga0307515_10000890
1280 Ga0307515_10003987
1281 Ga0307515_10019377
1282 Ga0307515_10147187
1283 Ga0307511_10003983
1284 Ga0307511_10032674
1285 Ga0307511_10131391
1286 Ga0307512_10003190
1287 Ga0307512_10005175
1288 Ga0307512_10025182
1289 Ga0307512_10032592
1290 Ga0307513_10000049
1291 Ga0307513_10005311
1292 Ga0307513_10040682
1293 Ga0307513_10100011
1294 Ga0307513_10314451
1295 Ga0307509_10063006
1296 Ga0307509_10132991
1297 Ga0307508_10034964
1298 Ga0307508_10092020
1299 Ga0307508_10139597
1300 Ga0307514_10035752
1301 Ga0316576_10026192
1302 Ga0307516_10000459
1303 Ga0307516_10010622
1304 Ga0307413_10000136
1305 Ga0307518_10000210
1306 Ga0307518_10112364
1307 Ga0307406_10000480
1308 Ga0307406_10007642
1309 Ga0307406_10086241
1310 Ga0307407_10227035
1311 Ga0307412_10017085
1312 Ga0307409_100012247
1313 Ga0307409_100015255
1314 Ga0307409_100062574
1315 Ga0307409_100089366
1316 Ga0307409_100225110
1317 Ga0307416_100376487
1318 Ga0307415_100036318
1319 Ga0307415_100042312
1320 Ga0307415_100071228
1321 Ga0307415_100147547
1322 Ga0307507_10000240
1323 Ga0307507_10015925
1324 Ga0307507_10133015
1325 Ga0307510_10020202
1326 Ga0307510_10021005
1327 Ga0373929_0014916
1328 Ga0373944_0059757
1329 Ga0373960_0029957
1330 Ga0373960_0041959
1331 Ga0373961_0040296
1332 Ga0373931_0033554
1333 Ga0373931_0129709
1334 Ga0373935_0284621
1335 Ga0373933_0128274
1336 Ga0373937_0021513
1337 Ga0316584_0031709
1338 Ga0373925_0146177
1339 Ga0395899_0001340
1340 Ga0395899_0312981
1341 Ga0395900_0045701
1342 Ga0395900_0170083
1343 Ga0395900_0439104
1344 Ga0395898_0003182
1345 Ga0395898_0021072
1346 Ga0395898_0053926
1347 Ga0395898_0416284
1348 Ga0436364_0082088
1349 Ga0436364_0434599
1350 Ga0436364_1038197
1351 Ga0395901_0070494
1352 Ga0395901_0086954
1353 Ga0395901_0120406
1354 Ga0395901_0180249
1355 Ga0395901_0228495
1356 Ga0436365_0005296
1357 Ga0436365_0086936
1358 Ga0436365_1724486
1359 Ga0436360_0644977
1360 Ga0436363_1427861
1361 Ga0439436_0014724
1362 Ga0439438_012603
1363 Ga0439439_0003123
1364 Ga0439439_0005869
1365 Ga0439466_0021351
1366 Ga0451797_0641249
1367 Ga0451841_0401691
1368 Ga0451853_0901394
1369 Ga0451853_2187299
1370 Ga0439431_0031195
1371 Ga0439442_008243
1372 Ga0439449_0005291
1373 Ga0439449_0006288
1374 Ga0439449_0021245
1375 Ga0439457_001041
1376 Ga0439457_001522
1377 Ga0439457_002767
1378 Ga0439462_0007584
1379 Ga0450895_001040
1380 Ga0450898_000988
1381 Ga0450899_000974
1382 Ga0450903_001545
1383 Ga0450906_004982
1384 Ga0439458_0000386
1385 Ga0439458_0008194
1386 Ga0450908_011499
1387 Ga0466969_0001812
1388 Ga0466969_0004618
1389 Ga0466969_0011774
1390 Ga0466969_0024437
1391 Ga0466969_0028597
1392 Ga0466969_0030546
1393 Ga0466972_0011041
1394 Ga0466972_0018352
1395 Ga0466972_0025141
1396 Ga0466972_0043254
1397 Ga0466965_0002520
1398 Ga0466965_0006268
1399 Ga0466965_0073123
1400 Ga0466965_0096930
1401 Ga0466966_0003935
1402 Ga0466966_0012226
1403 Ga0466966_0012941
1404 Ga0466966_0023881
1405 Ga0466966_0032031
1406 Ga0466961_0002630
1407 Ga0466961_0008124
1408 Ga0466961_0008808
1409 Ga0466961_0009249
1410 Ga0466961_0021521
1411 Ga0466961_0027411
1412 Ga0466961_0032383
1413 Ga0466961_0044944
1414 Ga0466961_0060687
1415 Ga0466961_0152224
1416 Ga0466963_0000099
1417 Ga0466963_0011870
1418 Ga0466963_0015542
1419 Ga0466963_0073742
1420 Ga0466963_0092372
1421 Ga0466963_0136836
1422 Ga0466963_0141224
1423 Ga0466964_0000321
1424 Ga0466971_0001426
1425 Ga0466971_0004999
1426 Ga0466971_0011152
1427 Ga0466971_0020296
1428 Ga0466971_0036870
1429 Ga0466971_0083150
1430 Ga0466971_0102158
1431 Ga0466968_0186336
1432 Ga0466970_0001771
1433 Ga0466970_0010140
1434 Ga0466970_0156061
1435 Ga0466957_0000206
1436 Ga0466957_0063636
1437 Ga0466957_0175402
1438 Ga0466960_0000061
1439 Ga0466960_0001976
1440 Ga0466960_0007533
1441 Ga0466960_0119009
1442 Ga0466959_0004074
1443 Ga0466959_0005042
1444 Ga0466959_0006147
1445 Ga0466959_0007090
1446 Ga0466959_0016242
1447 Ga0466959_0052490
1448 Ga0466959_0201399
1449 Ga0466959_0239017
1450 Ga0466958_0006459
1451 Ga0466958_0019859
1452 Ga0466958_0084455
1453 Ga0466958_0109256
1454 Ga0466958_0147752
1455 Ga0466958_0157663
1456 Ga0466967_0000619
1457 Ga0466967_0003541
1458 Ga0466967_0032340
1459 Ga0466967_0045851
1460 Ga0466967_0073072
1461 Ga0466967_0130865
1462 Ga0466967_0156635
1463 Ga0466967_0207926
1464 Ga0466967_0244987
1465 Ga0466967_0273696
1466 Ga0466967_0314825
1467 Ga0466967_0427116
1468 Ga0466967_0593054
1469 Ga0495617_010106
1470 Ga0495592_0002483
1471 Ga0495592_0020832
1472 Ga0495592_0191731
1473 Ga0495592_0204003
1474 Ga0495603_0001385
1475 Ga0495603_0006520
1476 Ga0495603_0027905
1477 Ga0495603_0032638
1478 Ga0495629_0006675
1479 Ga0495629_0009683
1480 Ga0495629_0011356
1481 Ga0495629_0023560
1482 Ga0495629_0083582
1483 Ga0495629_0112504
1484 Ga0495651_0003430
1485 Ga0495651_0009722
1486 Ga0495651_0032132
1487 Ga0495653_0010670
1488 Ga0495650_0073650
1489 Ga0495582_0076092
1490 Ga0495605_0005955
1491 Ga0495639_0019629
1492 Ga0495639_0062781
1493 Ga0495662_0000269
1494 Ga0495662_0000678
1495 Ga0495662_0017472
1496 Ga0495662_0032305
1497 Ga0495664_0002460
1498 Ga0495664_0066152
1499 Ga0495594_0006404
1500 Ga0495594_0009772
1501 Ga0495594_0030869
1502 Ga0495607_0051011
1503 Ga0495607_0101678
1504 Ga0495606_0017990
1505 Ga0495608_0053971
1506 Ga0495608_0130033
1507 Ga0495616_0001838
1508 Ga0495618_0012647
1509 Ga0495618_0018823
1510 Ga0495618_0238601
1511 Ga0495628_0006454
1512 Ga0495628_0012754
1513 Ga0495628_0042373
1514 Ga0495628_0053279
1515 Ga0495630_0003162
1516 Ga0495630_0137078
1517 Ga0495643_0025323
1518 Ga0495666_0002468
1519 Ga0495666_0020282
1520 Ga0495652_0001825
1521 Ga0495652_0007897
1522 Ga0495652_0020898
1523 Ga0495652_0027088
1524 Ga0495652_0030429
1525 Ga0495652_0107809
1526 Ga0495640_0013810
1527 Ga0495640_0017001
1528 Ga0495640_0098191
1529 Ga0495587_0002745
1530 Ga0495609_0052193
1531 Ga0495645_0037361
1532 Ga0495645_0044162
1533 Ga0495645_0050195
1534 Ga0495645_0071972
1535 Ga0495622_0040451
1536 Ga0495667_0008916
1537 Ga0495667_0108040
1538 Ga0495667_0240946
1539 Ga0495656_0086372
1540 Ga0495668_0009851
1541 Ga0495634_0004250
1542 Ga0495634_0121342
1543 Ga0495611_0009795
1544 Ga0495611_0069401
1545 Ga0495635_0004368
1546 Ga0495635_0006861
1547 Ga0495635_0036005
1548 Ga0495588_0001933
1549 Ga0495588_0003867
1550 Ga0495588_0145073
1551 Ga0495657_0004106
1552 Ga0495657_0010530
1553 Ga0495657_0020962
1554 Ga0495657_0045863
1555 Ga0495657_0055942
1556 Ga0495599_0006003
1557 Ga0495599_0037551
1558 Ga0495623_0002580
1559 Ga0495623_0112308
1560 Ga0495646_0000765
1561 Ga0495646_0014718
1562 Ga0495613_0001493
1563 Ga0495613_0009005
1564 Ga0495613_0018934
1565 Ga0495613_0019514
1566 Ga0495613_0117902
1567 Ga0495624_0042629
1568 Ga0495624_0101813
1569 Ga0495624_0229137
1570 Ga0495670_0044446
1571 Ga0495670_0056588
1572 Ga0495671_0046994
1573 Ga0495671_0068244
1574 Ga0495649_0023029
1575 Ga0495589_0001676
1576 Ga0495589_0009376
1577 Ga0495589_0016781
1578 Ga0495589_0047951
1579 Ga0495589_0120080
1580 Ga0495600_0002374
1581 Ga0495600_0007890
1582 Ga0495600_0034090
1583 Ga0495581_0036026
1584 Ga0495581_0115988
1585 Ga0495581_0193065
1586 Ga0495604_0000392
1587 Ga0495604_0004530
1588 Ga0495604_0011430
1589 Ga0495604_0012626
1590 Ga0495604_0014376
1591 Ga0495636_0003865
1592 Ga0495636_0005973
1593 Ga0495674_0013220
1594 Ga0495674_0067834
1595 Ga0495672_0018483
1596 Ga0495676_0011089
1597 Ga0495676_0019201
1598 Ga0495676_0133399
1599 Ga0495676_0258092
1600 Ga0495680_0015604
1601 Ga0495683_0012919
1602 Ga0495683_0132102
1603 Ga0495687_001678
1604 Ga0495687_003806
1605 Ga0495675_0002441
1606 Ga0495675_0005847
1607 Ga0495675_0114249
1608 Ga0495675_0122896
1609 Ga0495685_008489
1610 Ga0495685_010168
1611 Ga0495685_015729
1612 Ga0495685_025964
1613 Ga0495681_0009754
1614 Ga0495681_0012274
1615 Ga0495684_0004401
1616 Ga0495684_0072468
1617 Ga0495686_0036864
1618 Ga0495593_0136840
1619 Ga0495602_0005444
1620 Ga0495602_0035838
1621 Ga0495602_0037017
1622 Ga0495602_0101937
1623 Ga0495614_0008078
1624 Ga0495614_0010023
1625 Ga0495626_0031995
1626 Ga0496100_0183413
1627 Ga0496101_0226899
1628 Ga0496104_0008319
1629 Ga0496104_0017592
1630 Ga0496104_0126357
1631 Ga0496104_0139238
1632 Ga0496104_0198353
1633 Ga0496105_0010317
1634 Ga0496105_0011244
1635 Ga0496105_0135130
1636 Ga0496105_0175672
1637 Ga0496106_0055173
1638 Ga0496106_0111286
1639 Ga0496107_0032592
1640 Ga0496108_0140765
1641 Ga0496109_0022965
1642 Ga0496109_0030766
1643 Ga0496109_0074794
1644 Ga0496109_0222136
1645 Ga0496109_0415053
1646 Ga0496110_0073837
1647 Ga0496110_0092476
1648 Ga0496110_0309660
1649 Ga0496110_0353003
1650 Ga0496111_0006233
1651 Ga0496111_0043363
1652 Ga0496111_0381157
1653 Ga0496112_0022473
1654 Ga0496112_0053064
1655 Ga0496112_0190889
1656 Ga0496112_0284235
1657 Ga0496113_0018547
1658 Ga0496113_0360739
1659 Ga0496114_0037014
1660 Ga0496114_0486285
1661 Ga0496115_0030039
1662 Ga0496115_0059022
1663 Ga0496115_0091730
1664 Ga0496117_0098547
1665 Ga0496120_0026159
1666 Ga0496123_0092054
1667 Ga0496126_0146989
1668 Ga0501031_0058273
1669 Ga0501032_0000035
1670 Ga0501032_0046050
1671 Ga0501032_0048386
1672 Ga0501032_0101956
1673 Ga0501033_0000254
1674 Ga0501033_0009045
1675 Ga0501034_0001330
1676 Ga0501034_0014791
1677 Ga0501034_0020364
1678 Ga0501034_0118041
1679 Ga0501034_0148498
1680 Ga0501034_0340407
1681 Ga0501036_0000174
1682 Ga0501036_0003066
1683 Ga0501036_0004422
1684 Ga0501036_0015451
1685 Ga0501036_0216361
1686 Ga0501037_0000541
1687 Ga0501037_0071122
1688 Ga0501038_0000364
1689 Ga0501038_0000951
1690 Ga0501038_0010610
1691 Ga0501038_0113577
1692 Ga0501038_0116000
1693 Ga0501038_0189479
1694 Ga0501038_0397597
1695 Ga0501039_0000133
1696 Ga0501039_0004010
1697 Ga0501039_0049454
1698 Ga0501039_0062884
1699 Ga0501040_0060215
1700 Ga0501040_0081021
1701 Ga0501041_0042094
1702 Ga0501042_0011558
1703 Ga0501042_0028930
1704 Ga0501043_0000302
1705 Ga0501043_0001197
1706 Ga0501046_0000205
1707 Ga0501046_0085809
1708 Ga0501047_0001445
1709 Ga0501047_0007057
1710 Ga0501047_0104437
1711 Ga0501047_0227533
1712 Ga0501048_0000314
1713 Ga0501048_0002204
1714 Ga0501067_0072899
1715 Ga0501068_0016478
1716 Ga0501069_0000262
1717 Ga0501070_0000681
1718 Ga0501070_0079809
1719 Ga0501070_0167475
1720 Ga0501072_0216566
1721 Ga0501073_0005738
1722 Ga0501073_0021915
1723 Ga0501074_0000457
1724 Ga0501074_0007866
1725 Ga0501074_0085404
1726 Ga0501075_0155882
1727 Ga0501076_0074107
1728 Ga0501076_0149816
1729 Ga0501079_0112283
1730 Ga0501079_0173237
1731 Ga0501080_0000364
1732 Ga0501080_0028919
1733 Ga0501081_0070331
1734 Ga0501083_0031136
1735 Ga0501035_0003679
1736 Ga0501035_0005294
1737 Ga0501035_0052415
1738 Ga0501035_0077715
1739 Ga0501035_0135728
1740 Ga0501044_0001131
1741 Ga0501044_0004785
1742 Ga0501044_0045775
1743 Ga0501044_0055339
1744 Ga0501044_0122619
1745 Ga0501045_0275908
1746 nmdc:mga00v17_45265_c1
1747 nmdc:mga0yw44_160591_c1
1748 nmdc:mga07m45_31492_c1
1749 nmdc:mga05p37_252771_c1
1750 nmdc:mga05p37_263_c1
1751 nmdc:mga05p37_33679_c1
1752 nmdc:mga05p37_52132_c1
1753 nmdc:mga05p37_672_c1
1754 nmdc:mga09592_163260_c1
1755 nmdc:mga09592_2964_c1
1756 nmdc:mga09592_351690_c1
1757 nmdc:mga09592_423315_c1
1758 nmdc:mga09592_7924_c1
1759 nmdc:mga0qj67_20471_c1
1760 nmdc:mga0qj67_294_c1
1761 nmdc:mga0qj67_5016_c1
1762 nmdc:mga0qj67_65955_c1
1763 nmdc:mga06r32_217_c1
1764 nmdc:mga06r32_285_c2
1765 nmdc:mga06r32_29142_c1
1766 nmdc:mga06r32_5826_c1
1767 nmdc:mga06r32_6085_c1
1768 nmdc:mga06r32_6270_c1
1769 nmdc:mga06r32_649107_c1
1770 nmdc:mga08y16_12424_c1
1771 nmdc:mga08y16_71851_c1
1772 nmdc:mga0rr50_100493_c1
1773 Ga0495601_0002431
1774 Ga0495601_0012631
1775 Ga0495601_0023571
1776 Ga0495601_0075180
1777 Ga0495601_0115629
1778 Ga0495601_0287420
1779 Ga0495601_0304408
1780 Ga0495612_0005805
1781 Ga0495612_0011994
1782 Ga0495612_0020048
1783 Ga0495612_0048694
1784 Ga0495619_0025865
1785 Ga0495619_0149306
1786 Ga0495619_0197485
1787 Ga0500650_0021699
1788 Ga0500560_000662
1789 Ga0500559_0000733
1790 Ga0500568_0000107
1791 Ga0500573_0064778
1792 Ga0500577_0027280
1793 Ga0500577_0041201
1794 Ga0500600_0082316
1795 Ga0500600_0096576
1796 Ga0500634_0081617
1797 Ga0501084_0002579
1798 Ga0501082_0373894
1799 Ga0466962_0000193
1800 Ga0466962_0000253
1801 Ga0466962_0041859
1802 Ga0466962_0054913
1803 2501944816
1804 2515857250
1805 2552112603
1806 2554260410
1807 2558907112
1808 2559427757
1809 2585309357
1810 2585311910
1811 2586061523
1812 2616696303
1813 2616699080
1814 2616902691
1815 2643784229
1816 2643904335
1817 2644174194
1818 2644264665
1819 2644277864
1820 2644333841
1821 2644402688
1822 2644437972
1823 2644447216
1824 2644631222
1825 2676476482
1826 2723643223
1827 2738695533
1828 2739326324
1829 2739604775
1830 2760308206
1831 2760623215
1832 2784591413
1833 2785339733
1834 2785372403
1835 2786673534
1836 2793975731
1837 2795796884
1838 2808628904
1839 2808845118
1840 2808901759
1841 2808914806
1842 2809027961
1843 2809235015
1844 2809589368
1845 2811843043
1846 2812354494
1847 2812477300
1848 2816421626
1849 2819743762
1850 2827632291
1851 2837269505
1852 2844850960
1853 2852678528
1854 2856863739
1855 2857721453
1856 2857733326
1857 2858904359
1858 2861524026
1859 2862180255
1860 2862284058
1861 2862388723
1862 2862575357
1863 2862994973
1864 2863410275
1865 2867305704
1866 2867314991
1867 2867320012
1868 2867434177
1869 2867475199
1870 2868095011
1871 2873152801
1872 2873319406
1873 2877678257
1874 2883822716
1875 2884700572
1876 2895430746
1877 2895450207
1878 2899364440
1879 2912716891
1880 2912726510
1881 2912764148
1882 2915772562
1883 2919471085
1884 2928093658
1885 2928121520
1886 2935391096
1887 2935412036
1888 2939647351
1889 2945958941
1890 2946024333
1891 2946036304
1892 2946047312
1893 2946071209
1894 2946078990
1895 2954010529
1896 2954383151
1897 2954679840
1898 2954684313
1899 2954693863
1900 2954708974
1901 2954713494
1902 2954723459
1903 2954738370
1904 2954742363
1905 2954757232
1906 2954761333
1907 2984582650
1908 2990046265
1909 2990067028
1910 2995469381
1911 2997601259
1912 3003006367
1913 3006489421
1914 3006500510
1915 649814519
1916 8003317819
1917 8004025408
1918 8008489048
1919 8008564271
1920 8008575804
1921 8023630328
1922 8025484987
1923 8025528531
1924 8025535335
1925 8033690088
1926 8047897436
1927 8048133296
1928 8048361434
1929 8048374423
1930 8048383799
1931 8048411921
1932 8055068630
1933 8055174514
1934 8056059551
1935 8056065356
1936 8056213556
1937 8056582150
1938 8056667681
1939 8056832697
1940 8057572497

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05544

Pro_racemase

Proline racemase

9

332

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4k7g-assembly1.cif.gz_B crystal structure of a 3-hydroxyproline dehydratse from agrobacterium vitis, target efi-506470, with bound pyrrole 2-carboxylate, ordered active site 0.97 6 333
4q2h-assembly1.cif.gz_B crystal structure of probable proline racemase from agrobacterium radiobacter k84, target efi-506561, with bound carbonate 0.9629 7 333
6r77-assembly1.cif.gz_B crystal structure of trans-3-hydroxy-l-proline dehydratase in complex with substrate - closed conformation 0.9574 6 333
1w62-assembly1.cif.gz_A proline racemase in complex with one molecule of pyrrole-2-carboxylic acid (hemi form) 0.9573 1 333
4lb0-assembly1.cif.gz_B crystal structure of a hydroxyproline epimerase from agrobacterium vitis, target efi-506420, with bound trans-4-oh-l-proline 0.9567 1 333
ID Description Score Start End Superfamily
af_Q868H8_7_132_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9748 9 129 3.10.310.10
1tm0B01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9699 2 143 3.10.310.10
af_Q4DA80_75_217_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9681 7 142 3.10.310.10
4q2hB01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.966 7 142 3.10.310.10
6hjfA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9591 1 142 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A6B3H027-F1-model_v4 Proline racemase family protein 0.9983 173 305 GO:0047580
AF-A0A2A3X5C5-F1-model_v4 Proline racemase 0.9976 1 151 GO:0047580
AF-A0A542FQM5-F1-model_v4 Proline racemase 0.9973 7 333 GO:0047580
AF-A0A6B3GDB1-F1-model_v4 Proline racemase family protein 0.9953 1 178 GO:0047580
AF-A0A7X6EKU3-F1-model_v4 deleted 0.9949 166 332

Map