F487100
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 970 | 413 | 921 | 217 |
Family's Representative Sequence
| Representative Sequence | 3300046460|Ga0495638_0020265|Ga0495638_0020265_491_1285 |
| Length | 264 |
| Sequence | LRWAADRSAIVSYTESRQQQGTHFQCRRKRSPALRQRPLTITARRSNMAIRIGDEAPDFTAQTTEGTLNFHQWIGDGWAILFSHPKDFTPVCTTELGYLAKLKPEFDKRNTKILGLSIDPVSDHEKWVGDIEETQGNAVNYPLIGDENLVVAKLYDMIHPNASGGTRTAVDNATVRSVFLVGPDKKIKAMLIYPMSAGRNFDEVLRLLDSLQLNAKHTVATPVNWRPGEDVIIPTSVSDEDAKKKYPDGFKTLKPYLRTVAQPK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 4 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 5 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 6 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 7 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 8 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 9 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 10 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 11 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 12 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 13 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 14 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 15 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 16 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 17 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 18 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 19 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 20 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 21 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 22 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 23 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 24 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 25 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 26 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 27 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 28 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 29 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 30 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 31 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 32 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 33 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 34 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 35 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 36 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 37 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 38 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 39 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 40 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 41 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 42 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 43 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 44 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 45 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 46 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 47 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 48 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 49 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 50 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 51 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 52 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 53 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 54 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 55 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 56 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 57 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 58 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 59 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 60 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 61 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 62 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 63 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 64 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 65 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 66 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 83 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 84 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 90 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 91 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 92 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 93 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 94 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 95 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 96 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 97 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 98 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 99 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 100 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 101 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 102 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 103 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 104 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 105 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 106 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 107 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 108 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 109 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 110 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 111 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 112 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 113 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 115 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 116 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 137 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 139 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 140 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 144 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 152 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 188 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 193 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 195 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 196 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 198 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 199 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 200 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 201 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 203 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 204 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 205 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 206 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 207 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 208 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 210 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 211 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 212 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 213 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 214 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 215 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 216 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 217 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 218 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 219 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 220 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 221 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 222 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 223 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 224 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 225 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 226 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 227 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 228 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 229 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 230 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 231 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 232 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 233 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 234 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 235 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 236 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 237 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 238 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 239 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 240 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 241 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 242 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 243 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 244 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 245 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 246 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 247 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 248 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 249 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 250 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 251 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 252 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 253 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 254 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 255 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 256 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 257 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 258 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 259 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 260 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 261 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 262 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 335 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 336 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 337 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 338 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 339 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 340 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 341 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 342 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 343 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 344 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 345 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 346 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 347 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 348 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 349 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 350 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 351 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 383 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 384 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 385 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 386 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 396 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 398 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 399 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 400 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 401 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 402 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 403 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 404 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 405 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 410 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 411 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 412 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 413 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.2 |
| Metatranscriptomes | 1.75 |
| Isolates | 5.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.22 |
| Nodule | 1.55 |
| Rhizoplane | 1.75 |
| Rhizosphere | 85.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_16 | 2124908027 | Bacteria | 42770 |
| 2 | MRS2a_Contig_7135 | 2124908027 | Bacteria | 4188 |
| 3 | MRS2a_Contig_9103 | 2124908027 | Bacteria | 4155 |
| 4 | SwRhRL2b_contig_1791376 | 2162886007 | Bacteria | 3602 |
| 5 | SwRhRL2b_contig_275942 | 2162886007 | Bacteria | 816 |
| 6 | JGI25162J39368_1000045 | 3300002737 | Bacteria | 170731 |
| 7 | JGI25163J39215_1000297 | 3300002771 | Bacteria | 16793 |
| 8 | JGI25164J39214_1000147 | 3300002772 | Bacteria | 67564 |
| 9 | JGI25151J46595_10000065 | 3300003187 | Bacteria | 145136 |
| 10 | JGI25151J46595_10056448 | 3300003187 | Bacteria | 1287 |
| 11 | JGI25165J46597_1000086 | 3300003214 | Bacteria | 170731 |
| 12 | Ga0006562J51391_1007874 | 3300003578 | Bacteria | 1416 |
| 13 | Ga0055537_1000409 | 3300003773 | Bacteria | 28111 |
| 14 | Ga0055524_1021663 | 3300003775 | Bacteria | 2122 |
| 15 | Ga0055536_1000028 | 3300003781 | Bacteria | 162550 |
| 16 | Ga0055534_1000189 | 3300003784 | Bacteria | 45268 |
| 17 | Ga0055530_10000030 | 3300003791 | Bacteria | 125301 |
| 18 | Ga0055530_10014884 | 3300003791 | Bacteria | 2568 |
| 19 | Ga0055540_1000262 | 3300003792 | Bacteria | 47599 |
| 20 | Ga0058863_10027487 | 3300004799 | Bacteria | 1250 |
| 21 | Ga0065714_10000003 | 3300005288 | Bacteria | 32061 |
| 22 | Ga0065714_10004301 | 3300005288 | Bacteria | 6888 |
| 23 | Ga0065714_10004791 | 3300005288 | Bacteria | 4459 |
| 24 | Ga0065714_10005115 | 3300005288 | Bacteria | 9819 |
| 25 | Ga0065714_10005580 | 3300005288 | Bacteria | 12212 |
| 26 | Ga0065714_10066220 | 3300005288 | Bacteria | 7333 |
| 27 | Ga0065714_10084673 | 3300005288 | Bacteria | 2153 |
| 28 | Ga0065714_10105443 | 3300005288 | Bacteria | 1566 |
| 29 | Ga0065714_10120013 | 3300005288 | Bacteria | 1342 |
| 30 | Ga0065704_10079095 | 3300005289 | Bacteria | 4258 |
| 31 | Ga0065704_10112878 | 3300005289 | Bacteria | 1914 |
| 32 | Ga0065704_10146359 | 3300005289 | Bacteria | 1468 |
| 33 | Ga0065712_10002579 | 3300005290 | Bacteria | 5346 |
| 34 | Ga0065715_10101780 | 3300005293 | Bacteria | 3102 |
| 35 | Ga0065707_10128004 | 3300005295 | Bacteria | 1973 |
| 36 | Ga0070666_10027722 | 3300005335 | Bacteria | 3712 |
| 37 | Ga0070661_100127962 | 3300005344 | Bacteria | 1906 |
| 38 | Ga0070661_100181536 | 3300005344 | Bacteria | 1601 |
| 39 | Ga0070668_100117988 | 3300005347 | Bacteria | 2118 |
| 40 | Ga0070675_100857004 | 3300005354 | Bacteria | 832 |
| 41 | Ga0070674_100116330 | 3300005356 | Bacteria | 1973 |
| 42 | Ga0070674_100476319 | 3300005356 | Bacteria | 1035 |
| 43 | Ga0070674_100969041 | 3300005356 | Bacteria | 745 |
| 44 | Ga0070673_100306202 | 3300005364 | Bacteria | 1400 |
| 45 | Ga0070713_100419852 | 3300005436 | Bacteria | 1252 |
| 46 | Ga0070705_100004662 | 3300005440 | Bacteria | 6675 |
| 47 | Ga0070705_100493441 | 3300005440 | Bacteria | 928 |
| 48 | Ga0070694_100014594 | 3300005444 | Bacteria | 4919 |
| 49 | Ga0070708_100036681 | 3300005445 | Bacteria | 4277 |
| 50 | Ga0070708_100499237 | 3300005445 | Bacteria | 1148 |
| 51 | Ga0070678_100039595 | 3300005456 | Bacteria | 3327 |
| 52 | Ga0070678_100796008 | 3300005456 | Bacteria | 858 |
| 53 | Ga0070681_10084016 | 3300005458 | Bacteria | 3136 |
| 54 | Ga0070681_10502913 | 3300005458 | Bacteria | 1125 |
| 55 | Ga0070706_100009094 | 3300005467 | Bacteria | 9252 |
| 56 | Ga0070706_100016861 | 3300005467 | Bacteria | 6746 |
| 57 | Ga0070706_100083731 | 3300005467 | Bacteria | 2955 |
| 58 | Ga0070707_100650196 | 3300005468 | Bacteria | 1017 |
| 59 | Ga0070698_100001874 | 3300005471 | Bacteria | 23434 |
| 60 | Ga0070698_100050404 | 3300005471 | Bacteria | 4245 |
| 61 | Ga0070699_100000814 | 3300005518 | Bacteria | 28861 |
| 62 | Ga0070699_100002404 | 3300005518 | Bacteria | 16798 |
| 63 | Ga0070699_100059013 | 3300005518 | Bacteria | 3325 |
| 64 | Ga0070699_100099564 | 3300005518 | Bacteria | 2547 |
| 65 | Ga0070699_100103653 | 3300005518 | Bacteria | 2495 |
| 66 | Ga0070679_100137439 | 3300005530 | Bacteria | 2425 |
| 67 | Ga0070679_100329000 | 3300005530 | Bacteria | 1477 |
| 68 | Ga0070679_100750491 | 3300005530 | Bacteria | 919 |
| 69 | Ga0068853_100008756 | 3300005539 | Bacteria | 8139 |
| 70 | Ga0068853_100050648 | 3300005539 | Bacteria | 3573 |
| 71 | Ga0070672_100123927 | 3300005543 | Bacteria | 2118 |
| 72 | Ga0070672_100249747 | 3300005543 | Bacteria | 1494 |
| 73 | Ga0070695_100114785 | 3300005545 | Bacteria | 1834 |
| 74 | Ga0070696_100001106 | 3300005546 | Bacteria | 17448 |
| 75 | Ga0070696_100080896 | 3300005546 | Bacteria | 2301 |
| 76 | Ga0070696_100206054 | 3300005546 | Bacteria | 1470 |
| 77 | Ga0070665_100053117 | 3300005548 | Bacteria | 4064 |
| 78 | Ga0070665_100644904 | 3300005548 | Bacteria | 1072 |
| 79 | Ga0070704_100159504 | 3300005549 | Bacteria | 1782 |
| 80 | Ga0068855_100067729 | 3300005563 | Bacteria | 4158 |
| 81 | Ga0068855_100192437 | 3300005563 | Bacteria | 2300 |
| 82 | Ga0068856_100004119 | 3300005614 | Bacteria | 14533 |
| 83 | Ga0068852_100316995 | 3300005616 | Bacteria | 1513 |
| 84 | Ga0068852_101030868 | 3300005616 | Bacteria | 842 |
| 85 | Ga0068859_100159859 | 3300005617 | Bacteria | 2332 |
| 86 | Ga0068860_100135331 | 3300005843 | Bacteria | 2366 |
| 87 | Ga0068862_100666199 | 3300005844 | Bacteria | 1005 |
| 88 | Ga0081455_10183998 | 3300005937 | Bacteria | 1579 |
| 89 | Ga0081455_10197492 | 3300005937 | Bacteria | 1509 |
| 90 | Ga0081455_10230493 | 3300005937 | Bacteria | 1367 |
| 91 | Ga0075365_10191220 | 3300006038 | Bacteria | 1432 |
| 92 | Ga0075368_10027474 | 3300006042 | Bacteria | 2196 |
| 93 | Ga0075368_10047722 | 3300006042 | Bacteria | 1695 |
| 94 | Ga0075363_100076711 | 3300006048 | Bacteria | 1823 |
| 95 | Ga0075364_10010255 | 3300006051 | Bacteria | 5653 |
| 96 | Ga0075364_10015174 | 3300006051 | Bacteria | 4771 |
| 97 | Ga0075364_10026491 | 3300006051 | Bacteria | 3699 |
| 98 | Ga0075364_10032030 | 3300006051 | Bacteria | 3377 |
| 99 | Ga0075432_10003245 | 3300006058 | Bacteria | 5488 |
| 100 | Ga0075432_10003498 | 3300006058 | Bacteria | 5318 |
| 101 | Ga0075432_10177981 | 3300006058 | Bacteria | 831 |
| 102 | Ga0075362_10176928 | 3300006177 | Bacteria | 1033 |
| 103 | Ga0075367_10006727 | 3300006178 | Bacteria | 5834 |
| 104 | Ga0075369_10056579 | 3300006186 | Bacteria | 1705 |
| 105 | Ga0075369_10256479 | 3300006186 | Bacteria | 813 |
| 106 | Ga0075370_10019361 | 3300006353 | Bacteria | 3707 |
| 107 | Ga0075370_10057075 | 3300006353 | Bacteria | 2219 |
| 108 | Ga0075370_10127917 | 3300006353 | Bacteria | 1481 |
| 109 | Ga0068871_100259576 | 3300006358 | Bacteria | 1515 |
| 110 | Ga0068871_100446309 | 3300006358 | Bacteria | 1159 |
| 111 | Ga0075428_100047960 | 3300006844 | Bacteria | 4690 |
| 112 | Ga0075428_100080257 | 3300006844 | Bacteria | 3560 |
| 113 | Ga0075428_100261448 | 3300006844 | Bacteria | 1863 |
| 114 | Ga0075430_100267414 | 3300006846 | Bacteria | 1416 |
| 115 | Ga0075431_100004080 | 3300006847 | Bacteria | 14244 |
| 116 | Ga0075431_100159825 | 3300006847 | Bacteria | 2317 |
| 117 | Ga0075431_100368703 | 3300006847 | Bacteria | 1441 |
| 118 | Ga0075433_10519587 | 3300006852 | Bacteria | 1047 |
| 119 | Ga0075434_100006602 | 3300006871 | Bacteria | 10647 |
| 120 | Ga0075429_100093930 | 3300006880 | Bacteria | 2616 |
| 121 | Ga0075436_100008107 | 3300006914 | Bacteria | 7191 |
| 122 | Ga0075436_100024079 | 3300006914 | Bacteria | 4185 |
| 123 | Ga0075436_100028764 | 3300006914 | Bacteria | 3823 |
| 124 | Ga0075436_100048957 | 3300006914 | Bacteria | 2916 |
| 125 | Ga0075436_100077100 | 3300006914 | Bacteria | 2309 |
| 126 | Ga0097620_100159866 | 3300006931 | Bacteria | 2332 |
| 127 | Ga0097620_100892470 | 3300006931 | Bacteria | 974 |
| 128 | Ga0079104_1000142 | 3300006946 | Bacteria | 101403 |
| 129 | Ga0075435_100708387 | 3300007076 | Bacteria | 875 |
| 130 | Ga0105251_10004626 | 3300009011 | Bacteria | 9277 |
| 131 | Ga0105244_10002532 | 3300009036 | Bacteria | 13729 |
| 132 | Ga0105244_10063319 | 3300009036 | Bacteria | 1857 |
| 133 | Ga0105240_10258621 | 3300009093 | Bacteria | 2009 |
| 134 | Ga0111539_10408583 | 3300009094 | Bacteria | 1581 |
| 135 | Ga0111539_10831499 | 3300009094 | Bacteria | 1074 |
| 136 | Ga0105245_10022120 | 3300009098 | Bacteria | 5583 |
| 137 | Ga0114129_10009271 | 3300009147 | Bacteria | 14036 |
| 138 | Ga0114129_10261499 | 3300009147 | Bacteria | 2319 |
| 139 | Ga0105243_10069412 | 3300009148 | Bacteria | 2843 |
| 140 | Ga0105237_10139362 | 3300009545 | Bacteria | 2420 |
| 141 | Ga0105249_10142451 | 3300009553 | Bacteria | 2300 |
| 142 | Ga0105239_10387528 | 3300010375 | Bacteria | 1580 |
| 143 | Ga0105239_10877916 | 3300010375 | Bacteria | 1029 |
| 144 | Ga0105246_10045067 | 3300011119 | Bacteria | 3001 |
| 145 | Ga0157373_10002776 | 3300013100 | Bacteria | 13252 |
| 146 | Ga0157373_10360227 | 3300013100 | Bacteria | 1038 |
| 147 | Ga0157370_10004153 | 3300013104 | Bacteria | 16762 |
| 148 | Ga0157370_10042606 | 3300013104 | Bacteria | 4373 |
| 149 | Ga0157370_10154518 | 3300013104 | Bacteria | 2135 |
| 150 | Ga0157370_10321525 | 3300013104 | Bacteria | 1427 |
| 151 | Ga0157369_10047541 | 3300013105 | Bacteria | 4657 |
| 152 | Ga0157369_10086985 | 3300013105 | Bacteria | 3337 |
| 153 | Ga0157369_10120305 | 3300013105 | Bacteria | 2787 |
| 154 | Ga0157374_10030634 | 3300013296 | Bacteria | 4887 |
| 155 | Ga0157374_10127693 | 3300013296 | Bacteria | 2458 |
| 156 | Ga0157374_10301093 | 3300013296 | Bacteria | 1586 |
| 157 | Ga0163162_11130794 | 3300013306 | Bacteria | 888 |
| 158 | Ga0157372_10029964 | 3300013307 | Bacteria | 5947 |
| 159 | Ga0157372_10628220 | 3300013307 | Bacteria | 1251 |
| 160 | Ga0157375_10826208 | 3300013308 | Bacteria | 1074 |
| 161 | Ga0163163_10309828 | 3300014325 | Bacteria | 1631 |
| 162 | Ga0163163_11162738 | 3300014325 | Bacteria | 834 |
| 163 | Ga0157380_10327161 | 3300014326 | Bacteria | 1424 |
| 164 | Ga0157380_10673742 | 3300014326 | Bacteria | 1035 |
| 165 | Ga0157380_10750972 | 3300014326 | Bacteria | 987 |
| 166 | Ga0182008_10005589 | 3300014497 | Bacteria | 7130 |
| 167 | Ga0182008_10007190 | 3300014497 | Bacteria | 6161 |
| 168 | Ga0182008_10011159 | 3300014497 | Bacteria | 4791 |
| 169 | Ga0182008_10023599 | 3300014497 | Bacteria | 3140 |
| 170 | Ga0182008_10036263 | 3300014497 | Bacteria | 2468 |
| 171 | Ga0157376_10034639 | 3300014969 | Bacteria | 4079 |
| 172 | Ga0157376_10258665 | 3300014969 | Bacteria | 1630 |
| 173 | Ga0157376_10324382 | 3300014969 | Bacteria | 1465 |
| 174 | Ga0182006_1000083 | 3300015261 | Bacteria | 118727 |
| 175 | Ga0182005_1001254 | 3300015265 | Bacteria | 10436 |
| 176 | Ga0182005_1006914 | 3300015265 | Bacteria | 3433 |
| 177 | Ga0182005_1023824 | 3300015265 | Bacteria | 1672 |
| 178 | Ga0182005_1067993 | 3300015265 | Bacteria | 977 |
| 179 | Ga0163161_10002966 | 3300017792 | Bacteria | 12023 |
| 180 | Ga0163161_10039468 | 3300017792 | Bacteria | 3389 |
| 181 | Ga0163161_10098276 | 3300017792 | Bacteria | 2175 |
| 182 | Ga0197907_10262403 | 3300020069 | Bacteria | 829 |
| 183 | Ga0197907_10324341 | 3300020069 | Bacteria | 733 |
| 184 | Ga0197907_10358230 | 3300020069 | Bacteria | 1235 |
| 185 | Ga0206356_11534046 | 3300020070 | Bacteria | 666 |
| 186 | Ga0206355_1011593 | 3300020076 | Bacteria | 899 |
| 187 | Ga0206355_1314941 | 3300020076 | Bacteria | 769 |
| 188 | Ga0206355_1571517 | 3300020076 | Bacteria | 1065 |
| 189 | Ga0206351_10232290 | 3300020077 | Bacteria | 764 |
| 190 | Ga0206351_10699157 | 3300020077 | Bacteria | 825 |
| 191 | Ga0206354_10217960 | 3300020081 | Bacteria | 872 |
| 192 | Ga0206353_11403311 | 3300020082 | Bacteria | 786 |
| 193 | Ga0224712_10104057 | 3300022467 | Bacteria | 1208 |
| 194 | Ga0224712_10272325 | 3300022467 | Bacteria | 786 |
| 195 | Ga0209760_100019 | 3300025207 | Bacteria | 170806 |
| 196 | Ga0207427_100011 | 3300025231 | Bacteria | 640076 |
| 197 | Ga0209437_100044 | 3300025233 | Bacteria | 430619 |
| 198 | Ga0209759_1001894 | 3300025256 | Bacteria | 10298 |
| 199 | Ga0209233_1000057 | 3300025261 | Bacteria | 430619 |
| 200 | Ga0209565_1000109 | 3300025263 | Bacteria | 120345 |
| 201 | Ga0209673_1034456 | 3300025273 | Bacteria | 1529 |
| 202 | Ga0209675_1000118 | 3300025291 | Bacteria | 110507 |
| 203 | Ga0209676_1000062 | 3300025292 | Bacteria | 332319 |
| 204 | Ga0209025_1000159 | 3300025294 | Bacteria | 167081 |
| 205 | Ga0209025_1002020 | 3300025294 | Bacteria | 23152 |
| 206 | Ga0209025_1048697 | 3300025294 | Bacteria | 1715 |
| 207 | Ga0209758_1010371 | 3300025297 | Bacteria | 5588 |
| 208 | Ga0209050_1000150 | 3300025298 | Bacteria | 162946 |
| 209 | Ga0209050_1000684 | 3300025298 | Bacteria | 50962 |
| 210 | Ga0209256_1001890 | 3300025299 | Bacteria | 19210 |
| 211 | Ga0209256_1014655 | 3300025299 | Bacteria | 2800 |
| 212 | Ga0209051_1000162 | 3300025303 | Bacteria | 125696 |
| 213 | Ga0209051_1004106 | 3300025303 | Bacteria | 9141 |
| 214 | Ga0209051_1029433 | 3300025303 | Bacteria | 2150 |
| 215 | Ga0207696_1021703 | 3300025711 | Bacteria | 2053 |
| 216 | Ga0207655_1000481 | 3300025728 | Bacteria | 51474 |
| 217 | Ga0207655_1007663 | 3300025728 | Bacteria | 6968 |
| 218 | Ga0207655_1049284 | 3300025728 | Bacteria | 1721 |
| 219 | Ga0207655_1057603 | 3300025728 | Bacteria | 1525 |
| 220 | Ga0207713_1005276 | 3300025735 | Bacteria | 8130 |
| 221 | Ga0207713_1013027 | 3300025735 | Bacteria | 4411 |
| 222 | Ga0207653_10010636 | 3300025885 | Bacteria | 2872 |
| 223 | Ga0207684_10031488 | 3300025910 | Bacteria | 4512 |
| 224 | Ga0207707_10002069 | 3300025912 | Bacteria | 18184 |
| 225 | Ga0207663_10823405 | 3300025916 | Bacteria | 740 |
| 226 | Ga0207660_10077534 | 3300025917 | Bacteria | 2433 |
| 227 | Ga0207657_10167548 | 3300025919 | Bacteria | 1781 |
| 228 | Ga0207652_10171900 | 3300025921 | Bacteria | 1945 |
| 229 | Ga0207646_10467462 | 3300025922 | Bacteria | 1137 |
| 230 | Ga0207650_10333309 | 3300025925 | Bacteria | 1245 |
| 231 | Ga0207659_10315634 | 3300025926 | Bacteria | 1288 |
| 232 | Ga0207669_10099785 | 3300025937 | Bacteria | 1916 |
| 233 | Ga0207691_10222981 | 3300025940 | Bacteria | 1634 |
| 234 | Ga0207691_10629764 | 3300025940 | Bacteria | 907 |
| 235 | Ga0207689_10491043 | 3300025942 | Bacteria | 1028 |
| 236 | Ga0207679_10026985 | 3300025945 | Bacteria | 3966 |
| 237 | Ga0207667_10045365 | 3300025949 | Bacteria | 4656 |
| 238 | Ga0207651_10289560 | 3300025960 | Bacteria | 1357 |
| 239 | Ga0207712_10094815 | 3300025961 | Bacteria | 2205 |
| 240 | Ga0207668_10097056 | 3300025972 | Bacteria | 2180 |
| 241 | Ga0207639_10088761 | 3300026041 | Bacteria | 2468 |
| 242 | Ga0207639_10632024 | 3300026041 | Bacteria | 989 |
| 243 | Ga0207708_10641113 | 3300026075 | Bacteria | 903 |
| 244 | Ga0207675_100692499 | 3300026118 | Bacteria | 1027 |
| 245 | Ga0207683_10014559 | 3300026121 | Bacteria | 6699 |
| 246 | Ga0207683_10448633 | 3300026121 | Bacteria | 1189 |
| 247 | Ga0209281_1000262 | 3300027111 | Bacteria | 101417 |
| 248 | Ga0209813_10034384 | 3300027866 | Bacteria | 1513 |
| 249 | Ga0207428_10047709 | 3300027907 | Bacteria | 3438 |
| 250 | Ga0207428_10085522 | 3300027907 | Bacteria | 2456 |
| 251 | Ga0207428_10130436 | 3300027907 | Bacteria | 1924 |
| 252 | Ga0207428_10141121 | 3300027907 | Bacteria | 1839 |
| 253 | Ga0207428_10164918 | 3300027907 | Bacteria | 1681 |
| 254 | Ga0207428_10275962 | 3300027907 | Bacteria | 1249 |
| 255 | Ga0207428_10323448 | 3300027907 | Bacteria | 1139 |
| 256 | Ga0268266_10183856 | 3300028379 | Bacteria | 1905 |
| 257 | Ga0268266_10636712 | 3300028379 | Bacteria | 1026 |
| 258 | Ga0268265_10219441 | 3300028380 | Bacteria | 1663 |
| 259 | Ga0268265_10658413 | 3300028380 | Bacteria | 1007 |
| 260 | Ga0265323_10125744 | 3300028653 | Bacteria | 833 |
| 261 | Ga0265338_10076532 | 3300028800 | Bacteria | 2834 |
| 262 | Ga0265338_10209017 | 3300028800 | Bacteria | 1466 |
| 263 | Ga0265327_10091961 | 3300031251 | Bacteria | 1477 |
| 264 | Ga0307408_100652223 | 3300031548 | Bacteria | 941 |
| 265 | Ga0307405_10373914 | 3300031731 | Bacteria | 1107 |
| 266 | Ga0307413_10056041 | 3300031824 | Bacteria | 2402 |
| 267 | Ga0307413_10347394 | 3300031824 | Bacteria | 1143 |
| 268 | Ga0307410_10014366 | 3300031852 | Bacteria | 4657 |
| 269 | Ga0307410_10066547 | 3300031852 | Bacteria | 2483 |
| 270 | Ga0307406_10014079 | 3300031901 | Bacteria | 4597 |
| 271 | Ga0307407_10025967 | 3300031903 | Bacteria | 3096 |
| 272 | Ga0307407_10045096 | 3300031903 | Bacteria | 2489 |
| 273 | Ga0307407_10461172 | 3300031903 | Bacteria | 924 |
| 274 | Ga0307407_10782680 | 3300031903 | Bacteria | 724 |
| 275 | Ga0307412_10667877 | 3300031911 | Bacteria | 888 |
| 276 | Ga0307409_100009144 | 3300031995 | Bacteria | 6071 |
| 277 | Ga0307409_100235840 | 3300031995 | Bacteria | 1662 |
| 278 | Ga0307409_100293291 | 3300031995 | Bacteria | 1509 |
| 279 | Ga0307416_100101103 | 3300032002 | Bacteria | 2510 |
| 280 | Ga0307416_100194992 | 3300032002 | Bacteria | 1915 |
| 281 | Ga0307414_10257190 | 3300032004 | Bacteria | 1455 |
| 282 | Ga0307411_10029681 | 3300032005 | Bacteria | 3343 |
| 283 | Ga0307411_10276555 | 3300032005 | Bacteria | 1334 |
| 284 | Ga0307411_10280097 | 3300032005 | Bacteria | 1327 |
| 285 | Ga0373927_0283142 | 3300035695 | Bacteria | 1091 |
| 286 | Ga0373947_0059733 | 3300035725 | Bacteria | 2312 |
| 287 | Ga0373925_0118821 | 3300037068 | Bacteria | 2050 |
| 288 | Ga0395899_0192124 | 3300037312 | Bacteria | 1428 |
| 289 | Ga0395899_0309829 | 3300037312 | Bacteria | 1066 |
| 290 | Ga0395900_0358145 | 3300037418 | Bacteria | 1431 |
| 291 | Ga0395898_0565308 | 3300037466 | Bacteria | 1080 |
| 292 | Ga0395905_0186624 | 3300037471 | Bacteria | 1946 |
| 293 | Ga0436365_0924268 | 3300039437 | Bacteria | 3116 |
| 294 | Ga0436360_0011970 | 3300039438 | Bacteria | 1059 |
| 295 | Ga0439436_0000762 | 3300041404 | Bacteria | 8712 |
| 296 | Ga0439438_000379 | 3300041405 | Bacteria | 19968 |
| 297 | Ga0439438_001079 | 3300041405 | Bacteria | 12190 |
| 298 | Ga0439438_001796 | 3300041405 | Bacteria | 9418 |
| 299 | Ga0439438_004736 | 3300041405 | Bacteria | 5153 |
| 300 | Ga0439438_011170 | 3300041405 | Bacteria | 2807 |
| 301 | Ga0439447_000016 | 3300041407 | Bacteria | 61120 |
| 302 | Ga0439447_000054 | 3300041407 | Bacteria | 39346 |
| 303 | Ga0439447_000101 | 3300041407 | Bacteria | 29978 |
| 304 | Ga0439447_000519 | 3300041407 | Bacteria | 14291 |
| 305 | Ga0439447_001146 | 3300041407 | Bacteria | 9651 |
| 306 | Ga0439447_005206 | 3300041407 | Bacteria | 4349 |
| 307 | Ga0439461_0017956 | 3300041410 | Bacteria | 1380 |
| 308 | Ga0439466_0000101 | 3300041411 | Bacteria | 33127 |
| 309 | Ga0439466_0003430 | 3300041411 | Bacteria | 6152 |
| 310 | Ga0439466_0008454 | 3300041411 | Bacteria | 3879 |
| 311 | Ga0439466_0008895 | 3300041411 | Bacteria | 3775 |
| 312 | Ga0439466_0013095 | 3300041411 | Bacteria | 3039 |
| 313 | Ga0439466_0051597 | 3300041411 | Bacteria | 1346 |
| 314 | Ga0439465_0044696 | 3300041413 | Bacteria | 1439 |
| 315 | Ga0451845_0227851 | 3300041501 | Bacteria | 973 |
| 316 | Ga0439433_0068448 | 3300041999 | Bacteria | 853 |
| 317 | Ga0439432_000233 | 3300042006 | Bacteria | 20049 |
| 318 | Ga0439432_008552 | 3300042006 | Bacteria | 3592 |
| 319 | Ga0439432_016390 | 3300042006 | Bacteria | 2494 |
| 320 | Ga0439451_000450 | 3300042009 | Bacteria | 8019 |
| 321 | Ga0439451_006682 | 3300042009 | Bacteria | 2357 |
| 322 | Ga0439451_006802 | 3300042009 | Bacteria | 2339 |
| 323 | Ga0439452_000287 | 3300042010 | Bacteria | 32645 |
| 324 | Ga0439452_000939 | 3300042010 | Bacteria | 13100 |
| 325 | Ga0439452_001970 | 3300042010 | Bacteria | 7852 |
| 326 | Ga0439452_004038 | 3300042010 | Bacteria | 4992 |
| 327 | Ga0439452_006076 | 3300042010 | Bacteria | 3815 |
| 328 | Ga0439456_000745 | 3300042013 | Bacteria | 6624 |
| 329 | Ga0439456_001138 | 3300042013 | Bacteria | 5270 |
| 330 | Ga0439456_001454 | 3300042013 | Bacteria | 4767 |
| 331 | Ga0439456_008929 | 3300042013 | Bacteria | 2069 |
| 332 | Ga0439456_026889 | 3300042013 | Bacteria | 1225 |
| 333 | Ga0439456_058581 | 3300042013 | Bacteria | 845 |
| 334 | Ga0439462_0012322 | 3300042015 | Bacteria | 2183 |
| 335 | Ga0439463_000007 | 3300042016 | Bacteria | 44178 |
| 336 | Ga0439463_004030 | 3300042016 | Bacteria | 3694 |
| 337 | Ga0450911_000781 | 3300042115 | Bacteria | 8919 |
| 338 | Ga0450911_001463 | 3300042115 | Bacteria | 5418 |
| 339 | Ga0450911_002978 | 3300042115 | Bacteria | 3118 |
| 340 | Ga0450919_014287 | 3300042121 | Bacteria | 897 |
| 341 | Ga0450920_000220 | 3300042122 | Bacteria | 8536 |
| 342 | Ga0450922_004730 | 3300042124 | Bacteria | 1254 |
| 343 | Ga0450890_000293 | 3300042127 | Bacteria | 7283 |
| 344 | Ga0450892_006597 | 3300042130 | Bacteria | 968 |
| 345 | Ga0450903_000835 | 3300042138 | Bacteria | 6009 |
| 346 | Ga0450903_002032 | 3300042138 | Bacteria | 3649 |
| 347 | Ga0450903_004133 | 3300042138 | Bacteria | 2488 |
| 348 | Ga0450903_004819 | 3300042138 | Bacteria | 2279 |
| 349 | Ga0450904_000497 | 3300042139 | Bacteria | 7723 |
| 350 | Ga0450905_009553 | 3300042142 | Bacteria | 1336 |
| 351 | Ga0450906_000952 | 3300042145 | Bacteria | 6331 |
| 352 | Ga0450906_001246 | 3300042145 | Bacteria | 5618 |
| 353 | Ga0450907_000001 | 3300042146 | Bacteria | 236562 |
| 354 | Ga0450907_001863 | 3300042146 | Bacteria | 4323 |
| 355 | Ga0450907_007968 | 3300042146 | Bacteria | 1764 |
| 356 | Ga0450910_000235 | 3300042147 | Bacteria | 6316 |
| 357 | Ga0439446_0000210 | 3300042156 | Bacteria | 10703 |
| 358 | Ga0439446_0000222 | 3300042156 | Bacteria | 10452 |
| 359 | Ga0439446_0003553 | 3300042156 | Bacteria | 3882 |
| 360 | Ga0439446_0041583 | 3300042156 | Bacteria | 1355 |
| 361 | Ga0450908_001049 | 3300042184 | Bacteria | 5355 |
| 362 | Ga0450909_000158 | 3300042185 | Bacteria | 7292 |
| 363 | Ga0450909_000192 | 3300042185 | Bacteria | 6991 |
| 364 | Ga0439434_0000057 | 3300042435 | Bacteria | 27366 |
| 365 | Ga0439460_0001544 | 3300042461 | Bacteria | 5421 |
| 366 | Ga0439460_0017057 | 3300042461 | Bacteria | 1941 |
| 367 | Ga0450893_0014890 | 3300042532 | Bacteria | 1308 |
| 368 | Ga0451577_0279906 | 3300042876 | Bacteria | 1511 |
| 369 | Ga0439440_0000252 | 3300042993 | Bacteria | 8658 |
| 370 | Ga0439440_0002205 | 3300042993 | Bacteria | 3650 |
| 371 | Ga0439440_0012574 | 3300042993 | Bacteria | 1801 |
| 372 | Ga0466969_0013651 | 3300044656 | Bacteria | 4275 |
| 373 | Ga0453683_0503235 | 3300044673 | Bacteria | 786 |
| 374 | Ga0466966_0012062 | 3300044684 | Bacteria | 5726 |
| 375 | Ga0466961_0192849 | 3300044693 | Bacteria | 1262 |
| 376 | Ga0466964_0174205 | 3300044706 | Bacteria | 1015 |
| 377 | Ga0453684_0330988 | 3300044712 | Bacteria | 1722 |
| 378 | Ga0466971_0286610 | 3300044719 | Bacteria | 789 |
| 379 | Ga0466968_0013865 | 3300044735 | Bacteria | 3175 |
| 380 | Ga0466970_0025318 | 3300044765 | Bacteria | 3106 |
| 381 | Ga0466970_0187245 | 3300044765 | Bacteria | 1149 |
| 382 | Ga0466957_0037733 | 3300044842 | Bacteria | 2909 |
| 383 | Ga0466959_0015461 | 3300045049 | Bacteria | 5560 |
| 384 | Ga0451576_0036741 | 3300045051 | Bacteria | 5190 |
| 385 | Ga0466958_0018299 | 3300045836 | Bacteria | 4064 |
| 386 | Ga0466958_0316142 | 3300045836 | Bacteria | 1003 |
| 387 | Ga0495617_000204 | 3300046452 | Bacteria | 37490 |
| 388 | Ga0495617_001096 | 3300046452 | Bacteria | 12306 |
| 389 | Ga0495617_002458 | 3300046452 | Bacteria | 7362 |
| 390 | Ga0495617_002836 | 3300046452 | Bacteria | 6678 |
| 391 | Ga0495617_004958 | 3300046452 | Bacteria | 4786 |
| 392 | Ga0495617_005427 | 3300046452 | Bacteria | 4519 |
| 393 | Ga0495617_025087 | 3300046452 | Bacteria | 2010 |
| 394 | Ga0495617_027628 | 3300046452 | Bacteria | 1908 |
| 395 | Ga0495617_045668 | 3300046452 | Bacteria | 1460 |
| 396 | Ga0495627_000124 | 3300046453 | Bacteria | 93651 |
| 397 | Ga0495627_001657 | 3300046453 | Bacteria | 12330 |
| 398 | Ga0495627_034261 | 3300046453 | Bacteria | 1587 |
| 399 | Ga0495603_0002282 | 3300046455 | Bacteria | 11268 |
| 400 | Ga0495603_0045148 | 3300046455 | Bacteria | 2628 |
| 401 | Ga0495603_0129686 | 3300046455 | Bacteria | 1469 |
| 402 | Ga0495590_0000114 | 3300046457 | Bacteria | 48407 |
| 403 | Ga0495590_0000628 | 3300046457 | Bacteria | 16425 |
| 404 | Ga0495590_0004576 | 3300046457 | Bacteria | 5567 |
| 405 | Ga0495590_0012548 | 3300046457 | Bacteria | 3142 |
| 406 | Ga0495590_0044981 | 3300046457 | Bacteria | 1539 |
| 407 | Ga0495591_000021 | 3300046458 | Bacteria | 203554 |
| 408 | Ga0495591_001154 | 3300046458 | Bacteria | 17320 |
| 409 | Ga0495591_004409 | 3300046458 | Bacteria | 6907 |
| 410 | Ga0495591_009642 | 3300046458 | Bacteria | 3816 |
| 411 | Ga0495591_011532 | 3300046458 | Bacteria | 3343 |
| 412 | Ga0495591_017906 | 3300046458 | Bacteria | 2417 |
| 413 | Ga0495591_022356 | 3300046458 | Bacteria | 2045 |
| 414 | Ga0495638_0000073 | 3300046460 | Bacteria | 164378 |
| 415 | Ga0495638_0001071 | 3300046460 | Bacteria | 26689 |
| 416 | Ga0495638_0001173 | 3300046460 | Bacteria | 25137 |
| 417 | Ga0495638_0001643 | 3300046460 | Bacteria | 19841 |
| 418 | Ga0495638_0001675 | 3300046460 | Bacteria | 19601 |
| 419 | Ga0495638_0003795 | 3300046460 | Bacteria | 11742 |
| 420 | Ga0495638_0006166 | 3300046460 | Bacteria | 8758 |
| 421 | Ga0495638_0012543 | 3300046460 | Bacteria | 5802 |
| 422 | Ga0495638_0020265 | 3300046460 | Bacteria | 4393 |
| 423 | Ga0495638_0036061 | 3300046460 | Bacteria | 3151 |
| 424 | Ga0495638_0040995 | 3300046460 | Bacteria | 2931 |
| 425 | Ga0495638_0126384 | 3300046460 | Bacteria | 1506 |
| 426 | Ga0495638_0153048 | 3300046460 | Bacteria | 1336 |
| 427 | Ga0495653_0101918 | 3300046463 | Bacteria | 2078 |
| 428 | Ga0495650_0000822 | 3300046471 | Bacteria | 37641 |
| 429 | Ga0495650_0001066 | 3300046471 | Bacteria | 30414 |
| 430 | Ga0495650_0001224 | 3300046471 | Bacteria | 26826 |
| 431 | Ga0495650_0001886 | 3300046471 | Bacteria | 18639 |
| 432 | Ga0495650_0002534 | 3300046471 | Bacteria | 14579 |
| 433 | Ga0495650_0008706 | 3300046471 | Bacteria | 5876 |
| 434 | Ga0495605_0000391 | 3300046474 | Bacteria | 40370 |
| 435 | Ga0495605_0000446 | 3300046474 | Bacteria | 37125 |
| 436 | Ga0495605_0000751 | 3300046474 | Bacteria | 23782 |
| 437 | Ga0495605_0003866 | 3300046474 | Bacteria | 8887 |
| 438 | Ga0495605_0010911 | 3300046474 | Bacteria | 5076 |
| 439 | Ga0495605_0043419 | 3300046474 | Bacteria | 2229 |
| 440 | Ga0495605_0052934 | 3300046474 | Bacteria | 1971 |
| 441 | Ga0495605_0103442 | 3300046474 | Bacteria | 1306 |
| 442 | Ga0495639_0001776 | 3300046475 | Bacteria | 9555 |
| 443 | Ga0495584_0000019 | 3300046491 | Bacteria | 140608 |
| 444 | Ga0495584_0000176 | 3300046491 | Bacteria | 45031 |
| 445 | Ga0495584_0000296 | 3300046491 | Bacteria | 35158 |
| 446 | Ga0495584_0000568 | 3300046491 | Bacteria | 24896 |
| 447 | Ga0495584_0004039 | 3300046491 | Bacteria | 7917 |
| 448 | Ga0495584_0005778 | 3300046491 | Bacteria | 6525 |
| 449 | Ga0495584_0015243 | 3300046491 | Bacteria | 3915 |
| 450 | Ga0495584_0073558 | 3300046491 | Bacteria | 1717 |
| 451 | Ga0495584_0251961 | 3300046491 | Bacteria | 897 |
| 452 | Ga0495585_0000165 | 3300046492 | Bacteria | 71444 |
| 453 | Ga0495585_0004259 | 3300046492 | Bacteria | 9320 |
| 454 | Ga0495585_0016293 | 3300046492 | Bacteria | 4306 |
| 455 | Ga0495585_0041395 | 3300046492 | Bacteria | 2583 |
| 456 | Ga0495585_0071007 | 3300046492 | Bacteria | 1898 |
| 457 | Ga0495585_0077305 | 3300046492 | Bacteria | 1807 |
| 458 | Ga0495585_0085811 | 3300046492 | Bacteria | 1701 |
| 459 | Ga0495585_0194445 | 3300046492 | Bacteria | 1036 |
| 460 | Ga0495585_0239726 | 3300046492 | Bacteria | 908 |
| 461 | Ga0495594_0000316 | 3300046499 | Bacteria | 23873 |
| 462 | Ga0495594_0001211 | 3300046499 | Bacteria | 13483 |
| 463 | Ga0495594_0042317 | 3300046499 | Bacteria | 2494 |
| 464 | Ga0495596_0000209 | 3300046500 | Bacteria | 40288 |
| 465 | Ga0495607_0000188 | 3300046501 | Bacteria | 66018 |
| 466 | Ga0495607_0000709 | 3300046501 | Bacteria | 32137 |
| 467 | Ga0495607_0006930 | 3300046501 | Bacteria | 7903 |
| 468 | Ga0495607_0012463 | 3300046501 | Bacteria | 5612 |
| 469 | Ga0495607_0049007 | 3300046501 | Bacteria | 2466 |
| 470 | Ga0495607_0051036 | 3300046501 | Bacteria | 2404 |
| 471 | Ga0495607_0059322 | 3300046501 | Bacteria | 2183 |
| 472 | Ga0495607_0113049 | 3300046501 | Bacteria | 1436 |
| 473 | Ga0495583_0001277 | 3300046506 | Bacteria | 26327 |
| 474 | Ga0495583_0005600 | 3300046506 | Bacteria | 8465 |
| 475 | Ga0495583_0010683 | 3300046506 | Bacteria | 5334 |
| 476 | Ga0495583_0023101 | 3300046506 | Bacteria | 3152 |
| 477 | Ga0495606_0000347 | 3300046507 | Bacteria | 79388 |
| 478 | Ga0495606_0004664 | 3300046507 | Bacteria | 13547 |
| 479 | Ga0495606_0029004 | 3300046507 | Bacteria | 3892 |
| 480 | Ga0495606_0060018 | 3300046507 | Bacteria | 2437 |
| 481 | Ga0495606_0283666 | 3300046507 | Bacteria | 904 |
| 482 | Ga0495610_0004063 | 3300046512 | Bacteria | 10982 |
| 483 | Ga0495610_0005350 | 3300046512 | Bacteria | 9158 |
| 484 | Ga0495610_0006965 | 3300046512 | Bacteria | 7654 |
| 485 | Ga0495610_0009997 | 3300046512 | Bacteria | 5930 |
| 486 | Ga0495610_0022448 | 3300046512 | Bacteria | 3452 |
| 487 | Ga0495610_0030486 | 3300046512 | Bacteria | 2826 |
| 488 | Ga0495610_0038437 | 3300046512 | Bacteria | 2429 |
| 489 | Ga0495610_0044935 | 3300046512 | Bacteria | 2188 |
| 490 | Ga0495610_0071691 | 3300046512 | Bacteria | 1614 |
| 491 | Ga0495616_0001952 | 3300046513 | Bacteria | 13876 |
| 492 | Ga0495616_0006371 | 3300046513 | Bacteria | 7149 |
| 493 | Ga0495616_0017139 | 3300046513 | Bacteria | 3997 |
| 494 | Ga0495616_0028257 | 3300046513 | Bacteria | 2969 |
| 495 | Ga0495616_0034385 | 3300046513 | Bacteria | 2632 |
| 496 | Ga0495616_0127435 | 3300046513 | Bacteria | 1169 |
| 497 | Ga0495616_0190414 | 3300046513 | Bacteria | 907 |
| 498 | Ga0495616_0214611 | 3300046513 | Bacteria | 840 |
| 499 | Ga0495620_0000308 | 3300046515 | Bacteria | 34889 |
| 500 | Ga0495620_0002940 | 3300046515 | Bacteria | 9796 |
| 501 | Ga0495620_0035239 | 3300046515 | Bacteria | 2252 |
| 502 | Ga0495620_0036621 | 3300046515 | Bacteria | 2193 |
| 503 | Ga0495620_0103192 | 3300046515 | Bacteria | 1135 |
| 504 | Ga0495630_0001104 | 3300046517 | Bacteria | 18552 |
| 505 | Ga0495630_0195039 | 3300046517 | Bacteria | 1545 |
| 506 | Ga0495630_0400453 | 3300046517 | Bacteria | 1051 |
| 507 | Ga0495631_0000005 | 3300046518 | Bacteria | 159179 |
| 508 | Ga0495631_0002159 | 3300046518 | Bacteria | 11362 |
| 509 | Ga0495631_0029040 | 3300046518 | Bacteria | 2519 |
| 510 | Ga0495631_0042894 | 3300046518 | Bacteria | 1997 |
| 511 | Ga0495631_0102238 | 3300046518 | Bacteria | 1233 |
| 512 | Ga0495632_0000270 | 3300046519 | Bacteria | 51498 |
| 513 | Ga0495632_0000533 | 3300046519 | Bacteria | 35890 |
| 514 | Ga0495632_0000693 | 3300046519 | Bacteria | 30620 |
| 515 | Ga0495632_0001677 | 3300046519 | Bacteria | 18117 |
| 516 | Ga0495632_0003778 | 3300046519 | Bacteria | 10579 |
| 517 | Ga0495632_0005075 | 3300046519 | Bacteria | 8805 |
| 518 | Ga0495632_0008319 | 3300046519 | Bacteria | 6386 |
| 519 | Ga0495632_0015102 | 3300046519 | Bacteria | 4341 |
| 520 | Ga0495632_0015668 | 3300046519 | Bacteria | 4239 |
| 521 | Ga0495632_0016160 | 3300046519 | Bacteria | 4160 |
| 522 | Ga0495632_0025415 | 3300046519 | Bacteria | 3132 |
| 523 | Ga0495632_0066506 | 3300046519 | Bacteria | 1739 |
| 524 | Ga0495632_0093900 | 3300046519 | Bacteria | 1419 |
| 525 | Ga0495637_0000499 | 3300046520 | Bacteria | 28432 |
| 526 | Ga0495637_0001804 | 3300046520 | Bacteria | 12251 |
| 527 | Ga0495637_0003265 | 3300046520 | Bacteria | 8626 |
| 528 | Ga0495637_0010990 | 3300046520 | Bacteria | 4361 |
| 529 | Ga0495637_0012856 | 3300046520 | Bacteria | 3992 |
| 530 | Ga0495637_0016974 | 3300046520 | Bacteria | 3399 |
| 531 | Ga0495637_0037619 | 3300046520 | Bacteria | 2099 |
| 532 | Ga0495637_0076372 | 3300046520 | Bacteria | 1342 |
| 533 | Ga0495643_0005530 | 3300046522 | Bacteria | 8521 |
| 534 | Ga0495643_0006979 | 3300046522 | Bacteria | 7340 |
| 535 | Ga0495643_0007123 | 3300046522 | Bacteria | 7256 |
| 536 | Ga0495643_0009829 | 3300046522 | Bacteria | 5916 |
| 537 | Ga0495643_0014019 | 3300046522 | Bacteria | 4779 |
| 538 | Ga0495643_0061386 | 3300046522 | Bacteria | 1994 |
| 539 | Ga0495644_0000108 | 3300046523 | Bacteria | 39503 |
| 540 | Ga0495644_0000143 | 3300046523 | Bacteria | 34300 |
| 541 | Ga0495644_0007098 | 3300046523 | Bacteria | 4333 |
| 542 | Ga0495648_0000049 | 3300046524 | Bacteria | 164366 |
| 543 | Ga0495648_0000092 | 3300046524 | Bacteria | 111529 |
| 544 | Ga0495648_0003675 | 3300046524 | Bacteria | 13411 |
| 545 | Ga0495648_0004541 | 3300046524 | Bacteria | 11829 |
| 546 | Ga0495648_0008097 | 3300046524 | Bacteria | 8310 |
| 547 | Ga0495648_0008400 | 3300046524 | Bacteria | 8134 |
| 548 | Ga0495648_0010547 | 3300046524 | Bacteria | 7027 |
| 549 | Ga0495648_0011830 | 3300046524 | Bacteria | 6547 |
| 550 | Ga0495648_0135431 | 3300046524 | Bacteria | 1303 |
| 551 | Ga0495666_0000088 | 3300046526 | Bacteria | 37174 |
| 552 | Ga0495666_0014084 | 3300046526 | Bacteria | 3987 |
| 553 | Ga0495666_0067413 | 3300046526 | Bacteria | 1705 |
| 554 | Ga0495642_0000003 | 3300046528 | Bacteria | 185425 |
| 555 | Ga0495642_0000018 | 3300046528 | Bacteria | 108992 |
| 556 | Ga0495642_0000599 | 3300046528 | Bacteria | 18124 |
| 557 | Ga0495654_0000088 | 3300046530 | Bacteria | 104763 |
| 558 | Ga0495654_0001088 | 3300046530 | Bacteria | 19751 |
| 559 | Ga0495654_0001307 | 3300046530 | Bacteria | 17424 |
| 560 | Ga0495654_0004804 | 3300046530 | Bacteria | 7947 |
| 561 | Ga0495654_0007459 | 3300046530 | Bacteria | 6107 |
| 562 | Ga0495654_0008806 | 3300046530 | Bacteria | 5553 |
| 563 | Ga0495654_0016497 | 3300046530 | Bacteria | 3903 |
| 564 | Ga0495654_0018347 | 3300046530 | Bacteria | 3668 |
| 565 | Ga0495654_0025747 | 3300046530 | Bacteria | 3029 |
| 566 | Ga0495654_0031557 | 3300046530 | Bacteria | 2689 |
| 567 | Ga0495654_0084049 | 3300046530 | Bacteria | 1487 |
| 568 | Ga0495654_0107052 | 3300046530 | Bacteria | 1279 |
| 569 | Ga0495654_0111662 | 3300046530 | Bacteria | 1246 |
| 570 | Ga0495609_0000409 | 3300046538 | Bacteria | 35874 |
| 571 | Ga0495609_0002918 | 3300046538 | Bacteria | 10176 |
| 572 | Ga0495609_0026937 | 3300046538 | Bacteria | 2628 |
| 573 | Ga0495609_0125128 | 3300046538 | Bacteria | 1103 |
| 574 | Ga0495597_0003792 | 3300046542 | Bacteria | 8600 |
| 575 | Ga0495597_0005486 | 3300046542 | Bacteria | 6708 |
| 576 | Ga0495597_0009049 | 3300046542 | Bacteria | 4946 |
| 577 | Ga0495597_0011043 | 3300046542 | Bacteria | 4389 |
| 578 | Ga0495597_0096501 | 3300046542 | Bacteria | 1250 |
| 579 | Ga0495597_0115631 | 3300046542 | Bacteria | 1121 |
| 580 | Ga0495622_0000193 | 3300046557 | Bacteria | 48480 |
| 581 | Ga0495622_0000347 | 3300046557 | Bacteria | 33186 |
| 582 | Ga0495622_0007820 | 3300046557 | Bacteria | 4964 |
| 583 | Ga0495622_0042330 | 3300046557 | Bacteria | 2117 |
| 584 | Ga0495633_0017843 | 3300046558 | Bacteria | 3615 |
| 585 | Ga0495633_0096991 | 3300046558 | Bacteria | 1369 |
| 586 | Ga0495656_0003888 | 3300046615 | Bacteria | 5079 |
| 587 | Ga0495656_0007882 | 3300046615 | Bacteria | 3785 |
| 588 | Ga0495656_0024651 | 3300046615 | Bacteria | 2378 |
| 589 | Ga0495656_0058921 | 3300046615 | Bacteria | 1668 |
| 590 | Ga0495656_0179777 | 3300046615 | Bacteria | 1039 |
| 591 | Ga0495668_0000467 | 3300046616 | Bacteria | 51372 |
| 592 | Ga0495668_0009442 | 3300046616 | Bacteria | 5992 |
| 593 | Ga0495611_0007442 | 3300046648 | Bacteria | 4649 |
| 594 | Ga0495625_0000397 | 3300046660 | Bacteria | 66539 |
| 595 | Ga0495625_0001435 | 3300046660 | Bacteria | 29011 |
| 596 | Ga0495625_0005691 | 3300046660 | Bacteria | 11288 |
| 597 | Ga0495625_0007778 | 3300046660 | Bacteria | 9254 |
| 598 | Ga0495625_0014487 | 3300046660 | Bacteria | 6288 |
| 599 | Ga0495625_0015160 | 3300046660 | Bacteria | 6116 |
| 600 | Ga0495625_0045240 | 3300046660 | Bacteria | 3183 |
| 601 | Ga0495625_0089279 | 3300046660 | Bacteria | 2133 |
| 602 | Ga0495659_0000002 | 3300046664 | Bacteria | 176698 |
| 603 | Ga0495659_0000641 | 3300046664 | Bacteria | 12731 |
| 604 | Ga0495659_0003771 | 3300046664 | Bacteria | 4815 |
| 605 | Ga0495661_0013350 | 3300046665 | Bacteria | 5521 |
| 606 | Ga0495661_0031938 | 3300046665 | Bacteria | 3333 |
| 607 | Ga0495661_0082342 | 3300046665 | Bacteria | 1852 |
| 608 | Ga0495588_0004596 | 3300046674 | Bacteria | 6098 |
| 609 | Ga0495588_0019536 | 3300046674 | Bacteria | 3319 |
| 610 | Ga0495588_0123428 | 3300046674 | Bacteria | 1365 |
| 611 | Ga0495623_0001478 | 3300046679 | Bacteria | 15908 |
| 612 | Ga0495623_0002571 | 3300046679 | Bacteria | 11991 |
| 613 | Ga0495658_0155476 | 3300046683 | Bacteria | 1407 |
| 614 | Ga0495669_0000279 | 3300046684 | Bacteria | 29265 |
| 615 | Ga0495669_0001673 | 3300046684 | Bacteria | 9091 |
| 616 | Ga0495669_0009985 | 3300046684 | Bacteria | 4014 |
| 617 | Ga0495613_0045217 | 3300046689 | Bacteria | 3257 |
| 618 | Ga0495624_0089391 | 3300046690 | Bacteria | 1901 |
| 619 | Ga0495670_0000112 | 3300046691 | Bacteria | 36057 |
| 620 | Ga0495670_0000620 | 3300046691 | Bacteria | 16990 |
| 621 | Ga0495670_0001315 | 3300046691 | Bacteria | 12114 |
| 622 | Ga0495670_0013560 | 3300046691 | Bacteria | 4008 |
| 623 | Ga0495670_0017942 | 3300046691 | Bacteria | 3485 |
| 624 | Ga0495670_0022028 | 3300046691 | Bacteria | 3146 |
| 625 | Ga0495670_0032135 | 3300046691 | Bacteria | 2609 |
| 626 | Ga0495670_0062329 | 3300046691 | Bacteria | 1876 |
| 627 | Ga0495670_0089262 | 3300046691 | Bacteria | 1576 |
| 628 | Ga0495670_0108992 | 3300046691 | Bacteria | 1431 |
| 629 | Ga0495670_0189817 | 3300046691 | Bacteria | 1086 |
| 630 | Ga0495671_0000066 | 3300046692 | Bacteria | 105167 |
| 631 | Ga0495671_0000160 | 3300046692 | Bacteria | 59259 |
| 632 | Ga0495671_0005604 | 3300046692 | Bacteria | 7327 |
| 633 | Ga0495671_0019876 | 3300046692 | Bacteria | 3544 |
| 634 | Ga0495671_0033611 | 3300046692 | Bacteria | 2611 |
| 635 | Ga0495671_0094409 | 3300046692 | Bacteria | 1463 |
| 636 | Ga0495671_0094867 | 3300046692 | Bacteria | 1459 |
| 637 | Ga0495671_0121270 | 3300046692 | Bacteria | 1275 |
| 638 | Ga0495671_0135752 | 3300046692 | Bacteria | 1199 |
| 639 | Ga0495671_0252794 | 3300046692 | Bacteria | 850 |
| 640 | Ga0495649_0000013 | 3300046694 | Bacteria | 316013 |
| 641 | Ga0495649_0000814 | 3300046694 | Bacteria | 25112 |
| 642 | Ga0495649_0001154 | 3300046694 | Bacteria | 20537 |
| 643 | Ga0495649_0005808 | 3300046694 | Bacteria | 7771 |
| 644 | Ga0495649_0006677 | 3300046694 | Bacteria | 7160 |
| 645 | Ga0495649_0016472 | 3300046694 | Bacteria | 4188 |
| 646 | Ga0495649_0043216 | 3300046694 | Bacteria | 2460 |
| 647 | Ga0495649_0095279 | 3300046694 | Bacteria | 1584 |
| 648 | Ga0495649_0164511 | 3300046694 | Bacteria | 1162 |
| 649 | Ga0495589_0000123 | 3300046794 | Bacteria | 72582 |
| 650 | Ga0495589_0001395 | 3300046794 | Bacteria | 14016 |
| 651 | Ga0495589_0003200 | 3300046794 | Bacteria | 8940 |
| 652 | Ga0495589_0005346 | 3300046794 | Bacteria | 6776 |
| 653 | Ga0495589_0006827 | 3300046794 | Bacteria | 6002 |
| 654 | Ga0495589_0033379 | 3300046794 | Bacteria | 2585 |
| 655 | Ga0495589_0041175 | 3300046794 | Bacteria | 2305 |
| 656 | Ga0495589_0054318 | 3300046794 | Bacteria | 1975 |
| 657 | Ga0495589_0133423 | 3300046794 | Bacteria | 1191 |
| 658 | Ga0495600_0025520 | 3300046809 | Bacteria | 3809 |
| 659 | Ga0495660_0001517 | 3300046810 | Bacteria | 15674 |
| 660 | Ga0495660_0001634 | 3300046810 | Bacteria | 15043 |
| 661 | Ga0495660_0002240 | 3300046810 | Bacteria | 12445 |
| 662 | Ga0495660_0013001 | 3300046810 | Bacteria | 4825 |
| 663 | Ga0495660_0019231 | 3300046810 | Bacteria | 3921 |
| 664 | Ga0495660_0020036 | 3300046810 | Bacteria | 3836 |
| 665 | Ga0495660_0023755 | 3300046810 | Bacteria | 3496 |
| 666 | Ga0495660_0030094 | 3300046810 | Bacteria | 3060 |
| 667 | Ga0495660_0030283 | 3300046810 | Bacteria | 3049 |
| 668 | Ga0495660_0042483 | 3300046810 | Bacteria | 2512 |
| 669 | Ga0495660_0065169 | 3300046810 | Bacteria | 1945 |
| 670 | Ga0495660_0081658 | 3300046810 | Bacteria | 1694 |
| 671 | Ga0495660_0128573 | 3300046810 | Bacteria | 1273 |
| 672 | Ga0495581_0088882 | 3300047315 | Bacteria | 1792 |
| 673 | Ga0495604_0001925 | 3300047317 | Bacteria | 16807 |
| 674 | Ga0495636_0007111 | 3300047318 | Bacteria | 4404 |
| 675 | Ga0495636_0066107 | 3300047318 | Bacteria | 1536 |
| 676 | Ga0495674_0005938 | 3300047319 | Bacteria | 11717 |
| 677 | Ga0495672_0000442 | 3300047320 | Bacteria | 49513 |
| 678 | Ga0495672_0000773 | 3300047320 | Bacteria | 34808 |
| 679 | Ga0495672_0000891 | 3300047320 | Bacteria | 31355 |
| 680 | Ga0495672_0001663 | 3300047320 | Bacteria | 21577 |
| 681 | Ga0495672_0001947 | 3300047320 | Bacteria | 19521 |
| 682 | Ga0495672_0006676 | 3300047320 | Bacteria | 8864 |
| 683 | Ga0495672_0010062 | 3300047320 | Bacteria | 6771 |
| 684 | Ga0495672_0045791 | 3300047320 | Bacteria | 2614 |
| 685 | Ga0495672_0101971 | 3300047320 | Bacteria | 1554 |
| 686 | Ga0495676_0229954 | 3300047321 | Bacteria | 1274 |
| 687 | Ga0495680_0053758 | 3300047322 | Bacteria | 3131 |
| 688 | Ga0495680_0434782 | 3300047322 | Bacteria | 900 |
| 689 | Ga0495683_0000010 | 3300047323 | Bacteria | 223494 |
| 690 | Ga0495683_0000337 | 3300047323 | Bacteria | 38955 |
| 691 | Ga0495683_0002492 | 3300047323 | Bacteria | 11095 |
| 692 | Ga0495683_0006146 | 3300047323 | Bacteria | 6582 |
| 693 | Ga0495683_0011122 | 3300047323 | Bacteria | 4743 |
| 694 | Ga0495683_0011848 | 3300047323 | Bacteria | 4583 |
| 695 | Ga0495683_0014403 | 3300047323 | Bacteria | 4119 |
| 696 | Ga0495683_0018156 | 3300047323 | Bacteria | 3639 |
| 697 | Ga0495683_0020399 | 3300047323 | Bacteria | 3418 |
| 698 | Ga0495683_0038365 | 3300047323 | Bacteria | 2426 |
| 699 | Ga0495687_003205 | 3300047443 | Bacteria | 12125 |
| 700 | Ga0495687_004845 | 3300047443 | Bacteria | 8848 |
| 701 | Ga0495687_007840 | 3300047443 | Bacteria | 6211 |
| 702 | Ga0495687_020289 | 3300047443 | Bacteria | 3240 |
| 703 | Ga0495677_0000471 | 3300047445 | Bacteria | 17236 |
| 704 | Ga0495679_001961 | 3300047446 | Bacteria | 10972 |
| 705 | Ga0495679_009228 | 3300047446 | Bacteria | 3962 |
| 706 | Ga0495679_012799 | 3300047446 | Bacteria | 3176 |
| 707 | Ga0495685_012690 | 3300047447 | Bacteria | 2854 |
| 708 | Ga0495673_0000434 | 3300047469 | Bacteria | 46894 |
| 709 | Ga0495673_0000553 | 3300047469 | Bacteria | 38181 |
| 710 | Ga0495673_0001485 | 3300047469 | Bacteria | 18547 |
| 711 | Ga0495673_0002017 | 3300047469 | Bacteria | 14933 |
| 712 | Ga0495673_0002389 | 3300047469 | Bacteria | 13263 |
| 713 | Ga0495673_0005784 | 3300047469 | Bacteria | 7405 |
| 714 | Ga0495673_0046284 | 3300047469 | Bacteria | 1928 |
| 715 | Ga0495681_0000010 | 3300047470 | Bacteria | 203548 |
| 716 | Ga0495681_0000259 | 3300047470 | Bacteria | 43196 |
| 717 | Ga0495681_0000262 | 3300047470 | Bacteria | 42740 |
| 718 | Ga0495681_0000419 | 3300047470 | Bacteria | 32654 |
| 719 | Ga0495681_0000703 | 3300047470 | Bacteria | 25565 |
| 720 | Ga0495681_0009052 | 3300047470 | Bacteria | 6172 |
| 721 | Ga0495681_0010676 | 3300047470 | Bacteria | 5540 |
| 722 | Ga0495681_0024186 | 3300047470 | Bacteria | 3207 |
| 723 | Ga0495681_0031963 | 3300047470 | Bacteria | 2654 |
| 724 | Ga0495681_0039958 | 3300047470 | Bacteria | 2287 |
| 725 | Ga0495681_0183092 | 3300047470 | Bacteria | 859 |
| 726 | Ga0495684_0035906 | 3300047471 | Bacteria | 3800 |
| 727 | Ga0495686_0008941 | 3300047472 | Bacteria | 7279 |
| 728 | Ga0495686_0041603 | 3300047472 | Bacteria | 2925 |
| 729 | Ga0495686_0138116 | 3300047472 | Bacteria | 1440 |
| 730 | Ga0495686_0144097 | 3300047472 | Bacteria | 1404 |
| 731 | Ga0495686_0150522 | 3300047472 | Bacteria | 1366 |
| 732 | Ga0495593_0000018 | 3300047673 | Bacteria | 74926 |
| 733 | Ga0495593_0000777 | 3300047673 | Bacteria | 18553 |
| 734 | Ga0495615_0000105 | 3300048090 | Bacteria | 23071 |
| 735 | Ga0495615_0048847 | 3300048090 | Bacteria | 1083 |
| 736 | Ga0495626_0000031 | 3300048091 | Bacteria | 197930 |
| 737 | Ga0495626_0000079 | 3300048091 | Bacteria | 129922 |
| 738 | Ga0495626_0000242 | 3300048091 | Bacteria | 63298 |
| 739 | Ga0495626_0000329 | 3300048091 | Bacteria | 50091 |
| 740 | Ga0495626_0000759 | 3300048091 | Bacteria | 29787 |
| 741 | Ga0495626_0001357 | 3300048091 | Bacteria | 19791 |
| 742 | Ga0495626_0005157 | 3300048091 | Bacteria | 7746 |
| 743 | Ga0495626_0013146 | 3300048091 | Bacteria | 4312 |
| 744 | Ga0495626_0014268 | 3300048091 | Bacteria | 4103 |
| 745 | Ga0496100_0590620 | 3300048903 | Bacteria | 862 |
| 746 | Ga0496102_0235272 | 3300048905 | Bacteria | 1727 |
| 747 | Ga0496102_0380623 | 3300048905 | Bacteria | 1328 |
| 748 | Ga0496105_0049697 | 3300048908 | Bacteria | 3463 |
| 749 | Ga0496106_0189660 | 3300048909 | Bacteria | 1634 |
| 750 | Ga0496107_0177192 | 3300048910 | Bacteria | 1583 |
| 751 | Ga0496110_0078555 | 3300048913 | Bacteria | 2938 |
| 752 | Ga0496110_0099864 | 3300048913 | Bacteria | 2601 |
| 753 | Ga0496110_0666980 | 3300048913 | Bacteria | 940 |
| 754 | Ga0496111_0188066 | 3300048914 | Bacteria | 1535 |
| 755 | Ga0496112_0014420 | 3300048915 | Bacteria | 7331 |
| 756 | Ga0496112_0020807 | 3300048915 | Bacteria | 6227 |
| 757 | Ga0496113_0062287 | 3300048916 | Bacteria | 2817 |
| 758 | Ga0496113_0413008 | 3300048916 | Bacteria | 1084 |
| 759 | Ga0496116_0001237 | 3300048919 | Bacteria | 29731 |
| 760 | Ga0496116_0002307 | 3300048919 | Bacteria | 20229 |
| 761 | Ga0496117_0129555 | 3300048920 | Bacteria | 1532 |
| 762 | Ga0496118_0195987 | 3300048921 | Bacteria | 1202 |
| 763 | Ga0496121_0095310 | 3300048924 | Bacteria | 2313 |
| 764 | Ga0496122_0002525 | 3300048925 | Bacteria | 25773 |
| 765 | Ga0496122_0002963 | 3300048925 | Bacteria | 23155 |
| 766 | Ga0496123_0002451 | 3300048926 | Bacteria | 22992 |
| 767 | Ga0496124_0002900 | 3300048927 | Bacteria | 21631 |
| 768 | Ga0496124_0010024 | 3300048927 | Bacteria | 9668 |
| 769 | Ga0496124_0043609 | 3300048927 | Bacteria | 3855 |
| 770 | Ga0496124_0093915 | 3300048927 | Bacteria | 2441 |
| 771 | Ga0496124_0123802 | 3300048927 | Bacteria | 2062 |
| 772 | Ga0496125_0004944 | 3300048928 | Bacteria | 15081 |
| 773 | Ga0496125_0018626 | 3300048928 | Bacteria | 6590 |
| 774 | Ga0496126_0087602 | 3300048929 | Bacteria | 2744 |
| 775 | Ga0495678_000701 | 3300049459 | Bacteria | 30500 |
| 776 | Ga0495678_001245 | 3300049459 | Bacteria | 20717 |
| 777 | Ga0495678_005843 | 3300049459 | Bacteria | 6667 |
| 778 | Ga0495678_009163 | 3300049459 | Bacteria | 4925 |
| 779 | Ga0495678_022535 | 3300049459 | Bacteria | 2751 |
| 780 | Ga0495678_024222 | 3300049459 | Bacteria | 2624 |
| 781 | Ga0495678_080520 | 3300049459 | Bacteria | 1170 |
| 782 | Ga0495678_114602 | 3300049459 | Bacteria | 914 |
| 783 | Ga0495682_0001309 | 3300049460 | Bacteria | 13842 |
| 784 | Ga0495682_0003820 | 3300049460 | Bacteria | 6617 |
| 785 | Ga0495682_0011988 | 3300049460 | Bacteria | 3331 |
| 786 | Ga0501031_0030749 | 3300049568 | Bacteria | 3503 |
| 787 | Ga0501031_0033103 | 3300049568 | Bacteria | 3370 |
| 788 | Ga0501031_0167040 | 3300049568 | Bacteria | 1438 |
| 789 | Ga0501031_0597796 | 3300049568 | Bacteria | 710 |
| 790 | Ga0501033_0007048 | 3300049570 | Bacteria | 8777 |
| 791 | Ga0501034_0100599 | 3300049571 | Bacteria | 2885 |
| 792 | Ga0501036_0001193 | 3300049572 | Bacteria | 19803 |
| 793 | Ga0501036_0024335 | 3300049572 | Bacteria | 5105 |
| 794 | Ga0501036_0045902 | 3300049572 | Bacteria | 3700 |
| 795 | Ga0501036_0097970 | 3300049572 | Bacteria | 2479 |
| 796 | Ga0501038_0212540 | 3300049574 | Bacteria | 1547 |
| 797 | Ga0501038_0432642 | 3300049574 | Bacteria | 1014 |
| 798 | Ga0501039_0033563 | 3300049575 | Bacteria | 3957 |
| 799 | Ga0501039_0044040 | 3300049575 | Bacteria | 3447 |
| 800 | Ga0501039_0101858 | 3300049575 | Bacteria | 2241 |
| 801 | Ga0501039_0279936 | 3300049575 | Bacteria | 1311 |
| 802 | Ga0501040_0001724 | 3300049576 | Bacteria | 14028 |
| 803 | Ga0501040_0065708 | 3300049576 | Bacteria | 2499 |
| 804 | Ga0501040_0079561 | 3300049576 | Bacteria | 2269 |
| 805 | Ga0501041_0011140 | 3300049577 | Bacteria | 5310 |
| 806 | Ga0501041_0018736 | 3300049577 | Bacteria | 4123 |
| 807 | Ga0501041_0059613 | 3300049577 | Bacteria | 2336 |
| 808 | Ga0501041_0076801 | 3300049577 | Bacteria | 2055 |
| 809 | Ga0501042_0005577 | 3300049578 | Bacteria | 8108 |
| 810 | Ga0501042_0126712 | 3300049578 | Bacteria | 1839 |
| 811 | Ga0501043_0092185 | 3300049579 | Bacteria | 2382 |
| 812 | Ga0501043_0543683 | 3300049579 | Bacteria | 864 |
| 813 | Ga0501046_0107619 | 3300049580 | Bacteria | 2133 |
| 814 | Ga0501047_0186360 | 3300049581 | Bacteria | 1940 |
| 815 | Ga0501047_0459801 | 3300049581 | Bacteria | 1102 |
| 816 | Ga0501048_0050547 | 3300049582 | Bacteria | 2960 |
| 817 | Ga0501068_0005672 | 3300049584 | Bacteria | 6837 |
| 818 | Ga0501068_0141862 | 3300049584 | Bacteria | 1506 |
| 819 | Ga0501069_0294780 | 3300049585 | Bacteria | 950 |
| 820 | Ga0501070_0198410 | 3300049586 | Bacteria | 1648 |
| 821 | Ga0501071_0007936 | 3300049587 | Bacteria | 7002 |
| 822 | Ga0501071_0009804 | 3300049587 | Bacteria | 6393 |
| 823 | Ga0501071_0135125 | 3300049587 | Bacteria | 1835 |
| 824 | Ga0501072_0005608 | 3300049588 | Bacteria | 9551 |
| 825 | Ga0501072_0011565 | 3300049588 | Bacteria | 6744 |
| 826 | Ga0501072_0095836 | 3300049588 | Bacteria | 2358 |
| 827 | Ga0501072_0253513 | 3300049588 | Bacteria | 1401 |
| 828 | Ga0501072_0262375 | 3300049588 | Bacteria | 1375 |
| 829 | Ga0501073_0042142 | 3300049589 | Bacteria | 3223 |
| 830 | Ga0501073_0071178 | 3300049589 | Bacteria | 2424 |
| 831 | Ga0501074_0062661 | 3300049590 | Bacteria | 2679 |
| 832 | Ga0501074_0100816 | 3300049590 | Bacteria | 2067 |
| 833 | Ga0501074_0109025 | 3300049590 | Bacteria | 1981 |
| 834 | Ga0501074_0173184 | 3300049590 | Bacteria | 1540 |
| 835 | Ga0501074_0220991 | 3300049590 | Bacteria | 1349 |
| 836 | Ga0501074_0289274 | 3300049590 | Bacteria | 1165 |
| 837 | Ga0501075_0011542 | 3300049591 | Bacteria | 6253 |
| 838 | Ga0501075_0023427 | 3300049591 | Bacteria | 4521 |
| 839 | Ga0501075_0025157 | 3300049591 | Bacteria | 4373 |
| 840 | Ga0501075_0034455 | 3300049591 | Bacteria | 3770 |
| 841 | Ga0501075_0116664 | 3300049591 | Bacteria | 2030 |
| 842 | Ga0501076_0022693 | 3300049592 | Bacteria | 4825 |
| 843 | Ga0501076_0023798 | 3300049592 | Bacteria | 4725 |
| 844 | Ga0501076_0043988 | 3300049592 | Bacteria | 3521 |
| 845 | Ga0501077_0031361 | 3300049593 | Bacteria | 3381 |
| 846 | Ga0501077_0120177 | 3300049593 | Bacteria | 1665 |
| 847 | Ga0501079_0038714 | 3300049741 | Bacteria | 3677 |
| 848 | Ga0501079_0100709 | 3300049741 | Bacteria | 2240 |
| 849 | Ga0501079_0139474 | 3300049741 | Bacteria | 1888 |
| 850 | Ga0501079_0595572 | 3300049741 | Bacteria | 870 |
| 851 | Ga0501080_0644458 | 3300049742 | Bacteria | 938 |
| 852 | Ga0501081_0011107 | 3300049743 | Bacteria | 5890 |
| 853 | Ga0501081_0064537 | 3300049743 | Bacteria | 2543 |
| 854 | Ga0501081_0104547 | 3300049743 | Bacteria | 2005 |
| 855 | Ga0501035_0026432 | 3300049822 | Bacteria | 5310 |
| 856 | Ga0501035_0735758 | 3300049822 | Bacteria | 793 |
| 857 | Ga0501044_0043020 | 3300049823 | Bacteria | 4694 |
| 858 | Ga0501045_0012473 | 3300049824 | Bacteria | 5985 |
| 859 | Ga0501045_0016327 | 3300049824 | Bacteria | 5272 |
| 860 | Ga0501045_0025200 | 3300049824 | Bacteria | 4274 |
| 861 | nmdc:mga00v17_209825_c1 | 3300050491 | Bacteria | 1260 |
| 862 | nmdc:mga00v17_209969_c1 | 3300050491 | Bacteria | 1260 |
| 863 | nmdc:mga00v17_26563_c1 | 3300050491 | Bacteria | 3375 |
| 864 | nmdc:mga00v17_58430_c1 | 3300050491 | Bacteria | 1301 |
| 865 | nmdc:mga00v17_88236_c1 | 3300050491 | Bacteria | 1945 |
| 866 | nmdc:mga06z11_35824_c1 | 3300050494 | Bacteria | 2445 |
| 867 | nmdc:mga04h51_13771_c1 | 3300050495 | Bacteria | 2297 |
| 868 | nmdc:mga07m45_123412_c1 | 3300050496 | Bacteria | 1497 |
| 869 | nmdc:mga07m45_8603_c1 | 3300050496 | Bacteria | 5256 |
| 870 | nmdc:mga07m45_90954_c1 | 3300050496 | Bacteria | 1748 |
| 871 | nmdc:mga05p37_20057_c1 | 3300050507 | Bacteria | 8089 |
| 872 | nmdc:mga05p37_200676_c1 | 3300050507 | Bacteria | 2416 |
| 873 | nmdc:mga05p37_610024_c1 | 3300050507 | Bacteria | 1230 |
| 874 | nmdc:mga05p37_682271_c1 | 3300050507 | Bacteria | 1145 |
| 875 | nmdc:mga09592_20431_c1 | 3300050508 | Bacteria | 5444 |
| 876 | nmdc:mga09592_266351_c1 | 3300050508 | Bacteria | 1486 |
| 877 | nmdc:mga09592_459552_c1 | 3300050508 | Bacteria | 1098 |
| 878 | nmdc:mga0qj67_121249_c1 | 3300050509 | Bacteria | 2115 |
| 879 | nmdc:mga0qj67_447253_c1 | 3300050509 | Bacteria | 1041 |
| 880 | nmdc:mga0qj67_98346_c1 | 3300050509 | Bacteria | 2357 |
| 881 | nmdc:mga06r32_1070187_c1 | 3300050510 | Bacteria | 757 |
| 882 | nmdc:mga06r32_148916_c1 | 3300050510 | Bacteria | 2318 |
| 883 | nmdc:mga06r32_258614_c1 | 3300050510 | Bacteria | 1729 |
| 884 | nmdc:mga08y16_320082_c1 | 3300050511 | Bacteria | 1597 |
| 885 | nmdc:mga0n895_179639_c1 | 3300050512 | Bacteria | 2148 |
| 886 | nmdc:mga0rr50_102939_c1 | 3300050513 | Bacteria | 2246 |
| 887 | nmdc:mga0rr50_671860_c1 | 3300050513 | Bacteria | 884 |
| 888 | nmdc:mga0rr50_6947_c1 | 3300050513 | Bacteria | 6940 |
| 889 | nmdc:mga08x19_156712_c1 | 3300050514 | Bacteria | 1545 |
| 890 | nmdc:mga08x19_247988_c1 | 3300050514 | Bacteria | 1229 |
| 891 | nmdc:mga08x19_26165_c1 | 3300050514 | Bacteria | 3639 |
| 892 | nmdc:mga08x19_36808_c1 | 3300050514 | Bacteria | 3101 |
| 893 | nmdc:mga08x19_5919_c1 | 3300050514 | Bacteria | 7233 |
| 894 | nmdc:mga0a205_14835_c1 | 3300050515 | Bacteria | 7272 |
| 895 | nmdc:mga0sz30_16921_c2 | 3300050516 | Bacteria | 2130 |
| 896 | nmdc:mga0sz30_75741_c1 | 3300050516 | Bacteria | 1452 |
| 897 | Ga0495612_0231950 | 3300053078 | Bacteria | 819 |
| 898 | Ga0500566_0000044 | 3300053094 | Bacteria | 61711 |
| 899 | Ga0500641_0060647 | 3300053096 | Bacteria | 1574 |
| 900 | Ga0500555_005902 | 3300053103 | Bacteria | 3474 |
| 901 | Ga0500593_000006 | 3300053117 | Bacteria | 88644 |
| 902 | Ga0500559_0004626 | 3300053136 | Bacteria | 6495 |
| 903 | Ga0500568_0000005 | 3300053139 | Bacteria | 614296 |
| 904 | Ga0500568_0022253 | 3300053139 | Bacteria | 2716 |
| 905 | Ga0500577_0001370 | 3300053142 | Bacteria | 6224 |
| 906 | Ga0500577_0092089 | 3300053142 | Bacteria | 1227 |
| 907 | Ga0500616_0020681 | 3300053153 | Bacteria | 3696 |
| 908 | Ga0501084_0045923 | 3300054114 | Bacteria | 3657 |
| 909 | Ga0501084_0103954 | 3300054114 | Bacteria | 2386 |
| 910 | Ga0587073_0098291 | 3300059492 | Bacteria | 756 |
| 911 | Ga0587091_075971 | 3300059511 | Bacteria | 744 |
| 912 | Ga0501082_0045823 | 3300060353 | Bacteria | 3770 |
| 913 | Ga0501082_0099541 | 3300060353 | Bacteria | 2514 |
| 914 | Ga0501082_0197956 | 3300060353 | Bacteria | 1748 |
| 915 | Ga0501082_0224692 | 3300060353 | Bacteria | 1634 |
| 916 | Ga0501082_0237481 | 3300060353 | Bacteria | 1586 |
| 917 | Ga0530510_0012041 | 3300061734 | Bacteria | 6066 |
| 918 | Ga0530510_0013473 | 3300061734 | Bacteria | 5748 |
| 919 | Ga0530510_0014529 | 3300061734 | Bacteria | 5554 |
| 920 | Ga0530510_0021620 | 3300061734 | Bacteria | 4577 |
| 921 | Ga0530510_0079955 | 3300061734 | Bacteria | 2378 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300022467 | Ga0224712_10272325 | Ga0224712_102723252 | 177 |
| 2 | 3300046684 | Ga0495669_0009985 | Ga0495669_0009985_1784_2389 | 187 |
| 3 | 3300049741 | Ga0501079_0100709 | Ga0501079_0100709_20_625 | 198 |
| 4 | 3300050491 | nmdc:mga00v17_26563_c1 | nmdc:mga00v17_26563_c1_1036_1665 | 202 |
| 5 | 3300050491 | nmdc:mga00v17_88236_c1 | nmdc:mga00v17_88236_c1_755_1384 | 202 |
| 6 | 3300050494 | nmdc:mga06z11_35824_c1 | nmdc:mga06z11_35824_c1_489_1118 | 202 |
| 7 | 3300050495 | nmdc:mga04h51_13771_c1 | nmdc:mga04h51_13771_c1_869_1498 | 202 |
| 8 | 3300050496 | nmdc:mga07m45_123412_c1 | nmdc:mga07m45_123412_c1_548_1177 | 202 |
| 9 | 3300050496 | nmdc:mga07m45_90954_c1 | nmdc:mga07m45_90954_c1_303_932 | 202 |
| 10 | iso_pu_bacteria | 2513237087 | 2513592536 | 206 |
| 11 | iso_pu_bacteria | 2582581280 | 2585153353 | 206 |
| 12 | iso_pu_bacteria | 2582581293 | 2585196714 | 206 |
| 13 | iso_pu_bacteria | 2643221552 | 2643781844 | 206 |
| 14 | iso_pu_bacteria | 2643221584 | 2643930433 | 206 |
| 15 | iso_pu_bacteria | 2818991435 | 2819537829 | 206 |
| 16 | iso_pu_bacteria | 2818991454 | 2819647607 | 206 |
| 17 | iso_pu_bacteria | 2828305725 | 2828306528 | 206 |
| 18 | iso_pu_bacteria | 2939669807 | 2939674401 | 206 |
| 19 | 3300006914 | Ga0075436_100008107 | Ga0075436_1000081071 | 208 |
| 20 | 3300014326 | Ga0157380_10750972 | Ga0157380_107509722 | 208 |
| 21 | 3300050514 | nmdc:mga08x19_156712_c1 | nmdc:mga08x19_156712_c1_843_1469 | 208 |
| 22 | 3300050514 | nmdc:mga08x19_5919_c1 | nmdc:mga08x19_5919_c1_1926_2552 | 208 |
| 23 | 3300005295 | Ga0065707_10128004 | Ga0065707_101280042 | 209 |
| 24 | 3300005347 | Ga0070668_100117988 | Ga0070668_1001179882 | 209 |
| 25 | 3300005471 | Ga0070698_100001874 | Ga0070698_10000187425 | 209 |
| 26 | 3300005518 | Ga0070699_100002404 | Ga0070699_1000024042 | 209 |
| 27 | 3300005530 | Ga0070679_100750491 | Ga0070679_1007504911 | 209 |
| 28 | 3300005543 | Ga0070672_100249747 | Ga0070672_1002497472 | 209 |
| 29 | 3300005546 | Ga0070696_100080896 | Ga0070696_1000808961 | 209 |
| 30 | 3300005548 | Ga0070665_100053117 | Ga0070665_1000531173 | 209 |
| 31 | 3300005844 | Ga0068862_100666199 | Ga0068862_1006661991 | 209 |
| 32 | 3300005937 | Ga0081455_10230493 | Ga0081455_102304932 | 209 |
| 33 | 3300006042 | Ga0075368_10027474 | Ga0075368_100274743 | 209 |
| 34 | 3300006042 | Ga0075368_10047722 | Ga0075368_100477223 | 209 |
| 35 | 3300006048 | Ga0075363_100076711 | Ga0075363_1000767112 | 209 |
| 36 | 3300006051 | Ga0075364_10010255 | Ga0075364_100102553 | 209 |
| 37 | 3300006051 | Ga0075364_10026491 | Ga0075364_100264913 | 209 |
| 38 | 3300006178 | Ga0075367_10006727 | Ga0075367_100067272 | 209 |
| 39 | 3300006353 | Ga0075370_10057075 | Ga0075370_100570753 | 209 |
| 40 | 3300006353 | Ga0075370_10127917 | Ga0075370_101279173 | 209 |
| 41 | 3300006844 | Ga0075428_100080257 | Ga0075428_1000802572 | 209 |
| 42 | 3300009147 | Ga0114129_10009271 | Ga0114129_100092713 | 209 |
| 43 | 3300014325 | Ga0163163_11162738 | Ga0163163_111627381 | 209 |
| 44 | 3300025919 | Ga0207657_10167548 | Ga0207657_101675481 | 209 |
| 45 | 3300025940 | Ga0207691_10222981 | Ga0207691_102229812 | 209 |
| 46 | 3300025942 | Ga0207689_10491043 | Ga0207689_104910432 | 209 |
| 47 | 3300025972 | Ga0207668_10097056 | Ga0207668_100970562 | 209 |
| 48 | 3300027866 | Ga0209813_10034384 | Ga0209813_100343841 | 209 |
| 49 | 3300028379 | Ga0268266_10183856 | Ga0268266_101838562 | 209 |
| 50 | 3300028380 | Ga0268265_10219441 | Ga0268265_102194412 | 209 |
| 51 | 3300028380 | Ga0268265_10658413 | Ga0268265_106584131 | 209 |
| 52 | 3300028653 | Ga0265323_10125744 | Ga0265323_101257442 | 209 |
| 53 | 3300031824 | Ga0307413_10347394 | Ga0307413_103473942 | 209 |
| 54 | 3300031852 | Ga0307410_10014366 | Ga0307410_100143663 | 209 |
| 55 | 3300031903 | Ga0307407_10025967 | Ga0307407_100259672 | 209 |
| 56 | 3300031903 | Ga0307407_10461172 | Ga0307407_104611721 | 209 |
| 57 | 3300031995 | Ga0307409_100009144 | Ga0307409_1000091449 | 209 |
| 58 | 3300032002 | Ga0307416_100101103 | Ga0307416_1001011032 | 209 |
| 59 | 3300032004 | Ga0307414_10257190 | Ga0307414_102571902 | 209 |
| 60 | 3300032005 | Ga0307411_10029681 | Ga0307411_100296812 | 209 |
| 61 | 3300032005 | Ga0307411_10280097 | Ga0307411_102800972 | 209 |
| 62 | 3300037312 | Ga0395899_0309829 | Ga0395899_0309829_230_859 | 209 |
| 63 | 3300037466 | Ga0395898_0565308 | Ga0395898_0565308_16_645 | 209 |
| 64 | 3300037471 | Ga0395905_0186624 | Ga0395905_0186624_1159_1788 | 209 |
| 65 | 3300046522 | Ga0495643_0007123 | Ga0495643_0007123_907_1548 | 209 |
| 66 | 3300046615 | Ga0495656_0179777 | Ga0495656_0179777_90_737 | 209 |
| 67 | 3300046683 | Ga0495658_0155476 | Ga0495658_0155476_51_686 | 209 |
| 68 | 3300046690 | Ga0495624_0089391 | Ga0495624_0089391_570_1202 | 209 |
| 69 | 3300047443 | Ga0495687_020289 | Ga0495687_020289_1237_1872 | 209 |
| 70 | 3300048929 | Ga0496126_0087602 | Ga0496126_0087602_1296_1943 | 209 |
| 71 | 3300049568 | Ga0501031_0030749 | Ga0501031_0030749_1137_1784 | 209 |
| 72 | 3300049572 | Ga0501036_0045902 | Ga0501036_0045902_103_750 | 209 |
| 73 | 3300049575 | Ga0501039_0101858 | Ga0501039_0101858_1542_2189 | 209 |
| 74 | 3300049577 | Ga0501041_0059613 | Ga0501041_0059613_1594_2241 | 209 |
| 75 | 3300049578 | Ga0501042_0126712 | Ga0501042_0126712_604_1251 | 209 |
| 76 | 3300049585 | Ga0501069_0294780 | Ga0501069_0294780_215_844 | 209 |
| 77 | 3300049587 | Ga0501071_0135125 | Ga0501071_0135125_271_918 | 209 |
| 78 | 3300049588 | Ga0501072_0253513 | Ga0501072_0253513_588_1235 | 209 |
| 79 | 3300049590 | Ga0501074_0173184 | Ga0501074_0173184_201_848 | 209 |
| 80 | 3300049590 | Ga0501074_0220991 | Ga0501074_0220991_562_1221 | 209 |
| 81 | 3300049591 | Ga0501075_0023427 | Ga0501075_0023427_1020_1667 | 209 |
| 82 | 3300049593 | Ga0501077_0120177 | Ga0501077_0120177_354_1013 | 209 |
| 83 | 3300049741 | Ga0501079_0038714 | Ga0501079_0038714_511_1158 | 209 |
| 84 | 3300049822 | Ga0501035_0735758 | Ga0501035_0735758_104_751 | 209 |
| 85 | 3300049824 | Ga0501045_0012473 | Ga0501045_0012473_1530_2177 | 209 |
| 86 | 3300050507 | nmdc:mga05p37_20057_c1 | nmdc:mga05p37_20057_c1_3906_4538 | 209 |
| 87 | 3300053078 | Ga0495612_0231950 | Ga0495612_0231950_49_690 | 209 |
| 88 | 3300053136 | Ga0500559_0004626 | Ga0500559_0004626_5831_6466 | 209 |
| 89 | 3300054114 | Ga0501084_0045923 | Ga0501084_0045923_2937_3584 | 209 |
| 90 | 3300054114 | Ga0501084_0103954 | Ga0501084_0103954_106_765 | 209 |
| 91 | 3300060353 | Ga0501082_0099541 | Ga0501082_0099541_1769_2416 | 209 |
| 92 | 3300060353 | Ga0501082_0197956 | Ga0501082_0197956_106_765 | 209 |
| 93 | 3300061734 | Ga0530510_0012041 | Ga0530510_0012041_2884_3528 | 209 |
| 94 | 3300061734 | Ga0530510_0079955 | Ga0530510_0079955_283_930 | 209 |
| 95 | 3300004799 | Ga0058863_10027487 | Ga0058863_100274872 | 210 |
| 96 | 3300005344 | Ga0070661_100127962 | Ga0070661_1001279622 | 210 |
| 97 | 3300005344 | Ga0070661_100181536 | Ga0070661_1001815362 | 210 |
| 98 | 3300005354 | Ga0070675_100857004 | Ga0070675_1008570041 | 210 |
| 99 | 3300005356 | Ga0070674_100116330 | Ga0070674_1001163301 | 210 |
| 100 | 3300005356 | Ga0070674_100476319 | Ga0070674_1004763191 | 210 |
| 101 | 3300005364 | Ga0070673_100306202 | Ga0070673_1003062021 | 210 |
| 102 | 3300005436 | Ga0070713_100419852 | Ga0070713_1004198522 | 210 |
| 103 | 3300005440 | Ga0070705_100004662 | Ga0070705_1000046624 | 210 |
| 104 | 3300005440 | Ga0070705_100493441 | Ga0070705_1004934411 | 210 |
| 105 | 3300005444 | Ga0070694_100014594 | Ga0070694_1000145942 | 210 |
| 106 | 3300005445 | Ga0070708_100036681 | Ga0070708_1000366812 | 210 |
| 107 | 3300005445 | Ga0070708_100499237 | Ga0070708_1004992372 | 210 |
| 108 | 3300005456 | Ga0070678_100039595 | Ga0070678_1000395954 | 210 |
| 109 | 3300005456 | Ga0070678_100796008 | Ga0070678_1007960082 | 210 |
| 110 | 3300005458 | Ga0070681_10084016 | Ga0070681_100840164 | 210 |
| 111 | 3300005458 | Ga0070681_10502913 | Ga0070681_105029132 | 210 |
| 112 | 3300005467 | Ga0070706_100009094 | Ga0070706_1000090947 | 210 |
| 113 | 3300005467 | Ga0070706_100016861 | Ga0070706_1000168617 | 210 |
| 114 | 3300005467 | Ga0070706_100083731 | Ga0070706_1000837312 | 210 |
| 115 | 3300005468 | Ga0070707_100650196 | Ga0070707_1006501961 | 210 |
| 116 | 3300005471 | Ga0070698_100050404 | Ga0070698_1000504043 | 210 |
| 117 | 3300005518 | Ga0070699_100000814 | Ga0070699_1000008149 | 210 |
| 118 | 3300005518 | Ga0070699_100059013 | Ga0070699_1000590135 | 210 |
| 119 | 3300005518 | Ga0070699_100099564 | Ga0070699_1000995643 | 210 |
| 120 | 3300005518 | Ga0070699_100103653 | Ga0070699_1001036531 | 210 |
| 121 | 3300005530 | Ga0070679_100137439 | Ga0070679_1001374392 | 210 |
| 122 | 3300005530 | Ga0070679_100329000 | Ga0070679_1003290002 | 210 |
| 123 | 3300005539 | Ga0068853_100008756 | Ga0068853_1000087564 | 210 |
| 124 | 3300005539 | Ga0068853_100050648 | Ga0068853_1000506483 | 210 |
| 125 | 3300005543 | Ga0070672_100123927 | Ga0070672_1001239272 | 210 |
| 126 | 3300005545 | Ga0070695_100114785 | Ga0070695_1001147852 | 210 |
| 127 | 3300005546 | Ga0070696_100001106 | Ga0070696_1000011068 | 210 |
| 128 | 3300005546 | Ga0070696_100206054 | Ga0070696_1002060542 | 210 |
| 129 | 3300005548 | Ga0070665_100644904 | Ga0070665_1006449042 | 210 |
| 130 | 3300005549 | Ga0070704_100159504 | Ga0070704_1001595041 | 210 |
| 131 | 3300005563 | Ga0068855_100067729 | Ga0068855_1000677294 | 210 |
| 132 | 3300005563 | Ga0068855_100192437 | Ga0068855_1001924372 | 210 |
| 133 | 3300005614 | Ga0068856_100004119 | Ga0068856_10000411911 | 210 |
| 134 | 3300005616 | Ga0068852_100316995 | Ga0068852_1003169952 | 210 |
| 135 | 3300005616 | Ga0068852_101030868 | Ga0068852_1010308681 | 210 |
| 136 | 3300005617 | Ga0068859_100159859 | Ga0068859_1001598592 | 210 |
| 137 | 3300005937 | Ga0081455_10183998 | Ga0081455_101839982 | 210 |
| 138 | 3300005937 | Ga0081455_10197492 | Ga0081455_101974923 | 210 |
| 139 | 3300006038 | Ga0075365_10191220 | Ga0075365_101912203 | 210 |
| 140 | 3300006051 | Ga0075364_10015174 | Ga0075364_100151742 | 210 |
| 141 | 3300006177 | Ga0075362_10176928 | Ga0075362_101769282 | 210 |
| 142 | 3300006353 | Ga0075370_10019361 | Ga0075370_100193613 | 210 |
| 143 | 3300006844 | Ga0075428_100047960 | Ga0075428_1000479603 | 210 |
| 144 | 3300006844 | Ga0075428_100261448 | Ga0075428_1002614482 | 210 |
| 145 | 3300006846 | Ga0075430_100267414 | Ga0075430_1002674142 | 210 |
| 146 | 3300006847 | Ga0075431_100004080 | Ga0075431_10000408013 | 210 |
| 147 | 3300006847 | Ga0075431_100159825 | Ga0075431_1001598254 | 210 |
| 148 | 3300006847 | Ga0075431_100368703 | Ga0075431_1003687032 | 210 |
| 149 | 3300006852 | Ga0075433_10519587 | Ga0075433_105195871 | 210 |
| 150 | 3300006871 | Ga0075434_100006602 | Ga0075434_1000066026 | 210 |
| 151 | 3300006880 | Ga0075429_100093930 | Ga0075429_1000939305 | 210 |
| 152 | 3300006914 | Ga0075436_100024079 | Ga0075436_1000240795 | 210 |
| 153 | 3300006914 | Ga0075436_100028764 | Ga0075436_1000287643 | 210 |
| 154 | 3300006931 | Ga0097620_100159866 | Ga0097620_1001598662 | 210 |
| 155 | 3300006931 | Ga0097620_100892470 | Ga0097620_1008924702 | 210 |
| 156 | 3300007076 | Ga0075435_100708387 | Ga0075435_1007083871 | 210 |
| 157 | 3300009093 | Ga0105240_10258621 | Ga0105240_102586212 | 210 |
| 158 | 3300009094 | Ga0111539_10408583 | Ga0111539_104085832 | 210 |
| 159 | 3300009094 | Ga0111539_10831499 | Ga0111539_108314991 | 210 |
| 160 | 3300009147 | Ga0114129_10261499 | Ga0114129_102614992 | 210 |
| 161 | 3300009553 | Ga0105249_10142451 | Ga0105249_101424514 | 210 |
| 162 | 3300010375 | Ga0105239_10387528 | Ga0105239_103875282 | 210 |
| 163 | 3300010375 | Ga0105239_10877916 | Ga0105239_108779161 | 210 |
| 164 | 3300013104 | Ga0157370_10321525 | Ga0157370_103215252 | 210 |
| 165 | 3300013105 | Ga0157369_10047541 | Ga0157369_100475413 | 210 |
| 166 | 3300013105 | Ga0157369_10086985 | Ga0157369_100869852 | 210 |
| 167 | 3300013296 | Ga0157374_10030634 | Ga0157374_100306343 | 210 |
| 168 | 3300013296 | Ga0157374_10127693 | Ga0157374_101276933 | 210 |
| 169 | 3300013307 | Ga0157372_10029964 | Ga0157372_100299644 | 210 |
| 170 | 3300013307 | Ga0157372_10628220 | Ga0157372_106282201 | 210 |
| 171 | 3300013308 | Ga0157375_10826208 | Ga0157375_108262081 | 210 |
| 172 | 3300014325 | Ga0163163_10309828 | Ga0163163_103098281 | 210 |
| 173 | 3300014326 | Ga0157380_10673742 | Ga0157380_106737421 | 210 |
| 174 | 3300014969 | Ga0157376_10034639 | Ga0157376_100346392 | 210 |
| 175 | 3300014969 | Ga0157376_10258665 | Ga0157376_102586652 | 210 |
| 176 | 3300014969 | Ga0157376_10324382 | Ga0157376_103243822 | 210 |
| 177 | 3300015265 | Ga0182005_1006914 | Ga0182005_10069143 | 210 |
| 178 | 3300017792 | Ga0163161_10098276 | Ga0163161_100982762 | 210 |
| 179 | 3300020069 | Ga0197907_10262403 | Ga0197907_102624031 | 210 |
| 180 | 3300020069 | Ga0197907_10324341 | Ga0197907_103243412 | 210 |
| 181 | 3300020069 | Ga0197907_10358230 | Ga0197907_103582302 | 210 |
| 182 | 3300020070 | Ga0206356_11534046 | Ga0206356_115340461 | 210 |
| 183 | 3300020076 | Ga0206355_1011593 | Ga0206355_10115932 | 210 |
| 184 | 3300020076 | Ga0206355_1314941 | Ga0206355_13149411 | 210 |
| 185 | 3300020076 | Ga0206355_1571517 | Ga0206355_15715171 | 210 |
| 186 | 3300020077 | Ga0206351_10232290 | Ga0206351_102322901 | 210 |
| 187 | 3300020077 | Ga0206351_10699157 | Ga0206351_106991571 | 210 |
| 188 | 3300020081 | Ga0206354_10217960 | Ga0206354_102179601 | 210 |
| 189 | 3300020082 | Ga0206353_11403311 | Ga0206353_114033111 | 210 |
| 190 | 3300022467 | Ga0224712_10104057 | Ga0224712_101040572 | 210 |
| 191 | 3300025299 | Ga0209256_1014655 | Ga0209256_10146552 | 210 |
| 192 | 3300025885 | Ga0207653_10010636 | Ga0207653_100106363 | 210 |
| 193 | 3300025910 | Ga0207684_10031488 | Ga0207684_100314884 | 210 |
| 194 | 3300025912 | Ga0207707_10002069 | Ga0207707_1000206910 | 210 |
| 195 | 3300025916 | Ga0207663_10823405 | Ga0207663_108234051 | 210 |
| 196 | 3300025917 | Ga0207660_10077534 | Ga0207660_100775342 | 210 |
| 197 | 3300025921 | Ga0207652_10171900 | Ga0207652_101719002 | 210 |
| 198 | 3300025922 | Ga0207646_10467462 | Ga0207646_104674622 | 210 |
| 199 | 3300025925 | Ga0207650_10333309 | Ga0207650_103333091 | 210 |
| 200 | 3300025926 | Ga0207659_10315634 | Ga0207659_103156341 | 210 |
| 201 | 3300025937 | Ga0207669_10099785 | Ga0207669_100997852 | 210 |
| 202 | 3300025940 | Ga0207691_10629764 | Ga0207691_106297641 | 210 |
| 203 | 3300025945 | Ga0207679_10026985 | Ga0207679_100269854 | 210 |
| 204 | 3300025949 | Ga0207667_10045365 | Ga0207667_100453652 | 210 |
| 205 | 3300025960 | Ga0207651_10289560 | Ga0207651_102895601 | 210 |
| 206 | 3300025961 | Ga0207712_10094815 | Ga0207712_100948151 | 210 |
| 207 | 3300026041 | Ga0207639_10088761 | Ga0207639_100887612 | 210 |
| 208 | 3300026041 | Ga0207639_10632024 | Ga0207639_106320241 | 210 |
| 209 | 3300026075 | Ga0207708_10641113 | Ga0207708_106411131 | 210 |
| 210 | 3300026118 | Ga0207675_100692499 | Ga0207675_1006924991 | 210 |
| 211 | 3300026121 | Ga0207683_10014559 | Ga0207683_100145594 | 210 |
| 212 | 3300026121 | Ga0207683_10448633 | Ga0207683_104486332 | 210 |
| 213 | 3300028379 | Ga0268266_10636712 | Ga0268266_106367122 | 210 |
| 214 | 3300028800 | Ga0265338_10076532 | Ga0265338_100765323 | 210 |
| 215 | 3300028800 | Ga0265338_10209017 | Ga0265338_102090172 | 210 |
| 216 | 3300031251 | Ga0265327_10091961 | Ga0265327_100919612 | 210 |
| 217 | 3300031548 | Ga0307408_100652223 | Ga0307408_1006522231 | 210 |
| 218 | 3300031731 | Ga0307405_10373914 | Ga0307405_103739142 | 210 |
| 219 | 3300031824 | Ga0307413_10056041 | Ga0307413_100560412 | 210 |
| 220 | 3300031852 | Ga0307410_10066547 | Ga0307410_100665472 | 210 |
| 221 | 3300031901 | Ga0307406_10014079 | Ga0307406_100140794 | 210 |
| 222 | 3300031903 | Ga0307407_10045096 | Ga0307407_100450962 | 210 |
| 223 | 3300031903 | Ga0307407_10782680 | Ga0307407_107826801 | 210 |
| 224 | 3300031911 | Ga0307412_10667877 | Ga0307412_106678771 | 210 |
| 225 | 3300031995 | Ga0307409_100235840 | Ga0307409_1002358402 | 210 |
| 226 | 3300031995 | Ga0307409_100293291 | Ga0307409_1002932912 | 210 |
| 227 | 3300032002 | Ga0307416_100194992 | Ga0307416_1001949922 | 210 |
| 228 | 3300032005 | Ga0307411_10276555 | Ga0307411_102765552 | 210 |
| 229 | 3300035695 | Ga0373927_0283142 | Ga0373927_0283142_185_892 | 210 |
| 230 | 3300035725 | Ga0373947_0059733 | Ga0373947_0059733_143_778 | 210 |
| 231 | 3300037068 | Ga0373925_0118821 | Ga0373925_0118821_179_814 | 210 |
| 232 | 3300039437 | Ga0436365_0924268 | Ga0436365_0924268_258_893 | 210 |
| 233 | 3300039438 | Ga0436360_0011970 | Ga0436360_0011970_95_730 | 210 |
| 234 | 3300041501 | Ga0451845_0227851 | Ga0451845_0227851_29_664 | 210 |
| 235 | 3300041999 | Ga0439433_0068448 | Ga0439433_0068448_189_824 | 210 |
| 236 | 3300042015 | Ga0439462_0012322 | Ga0439462_0012322_224_859 | 210 |
| 237 | 3300042156 | Ga0439446_0041583 | Ga0439446_0041583_132_767 | 210 |
| 238 | 3300042876 | Ga0451577_0279906 | Ga0451577_0279906_361_1017 | 210 |
| 239 | 3300044673 | Ga0453683_0503235 | Ga0453683_0503235_60_716 | 210 |
| 240 | 3300044712 | Ga0453684_0330988 | Ga0453684_0330988_472_1128 | 210 |
| 241 | 3300044719 | Ga0466971_0286610 | Ga0466971_0286610_12_644 | 210 |
| 242 | 3300044765 | Ga0466970_0187245 | Ga0466970_0187245_384_1022 | 210 |
| 243 | 3300045051 | Ga0451576_0036741 | Ga0451576_0036741_833_1489 | 210 |
| 244 | 3300046453 | Ga0495627_000124 | Ga0495627_000124_78978_79631 | 210 |
| 245 | 3300046455 | Ga0495603_0129686 | Ga0495603_0129686_674_1309 | 210 |
| 246 | 3300046460 | Ga0495638_0000073 | Ga0495638_0000073_117614_118267 | 210 |
| 247 | 3300046471 | Ga0495650_0000822 | Ga0495650_0000822_22843_23496 | 210 |
| 248 | 3300046515 | Ga0495620_0035239 | Ga0495620_0035239_1193_1846 | 210 |
| 249 | 3300046517 | Ga0495630_0195039 | Ga0495630_0195039_622_1257 | 210 |
| 250 | 3300046518 | Ga0495631_0102238 | Ga0495631_0102238_365_1018 | 210 |
| 251 | 3300046519 | Ga0495632_0000270 | Ga0495632_0000270_4040_4693 | 210 |
| 252 | 3300046519 | Ga0495632_0000533 | Ga0495632_0000533_19785_20438 | 210 |
| 253 | 3300046524 | Ga0495648_0000049 | Ga0495648_0000049_117614_118267 | 210 |
| 254 | 3300046660 | Ga0495625_0000397 | Ga0495625_0000397_35204_35845 | 210 |
| 255 | 3300046689 | Ga0495613_0045217 | Ga0495613_0045217_729_1364 | 210 |
| 256 | 3300047315 | Ga0495581_0088882 | Ga0495581_0088882_1130_1765 | 210 |
| 257 | 3300047321 | Ga0495676_0229954 | Ga0495676_0229954_11_646 | 210 |
| 258 | 3300047470 | Ga0495681_0000010 | Ga0495681_0000010_26096_26749 | 210 |
| 259 | 3300048090 | Ga0495615_0000105 | Ga0495615_0000105_10588_11220 | 210 |
| 260 | 3300048903 | Ga0496100_0590620 | Ga0496100_0590620_189_824 | 210 |
| 261 | 3300048908 | Ga0496105_0049697 | Ga0496105_0049697_964_1599 | 210 |
| 262 | 3300048915 | Ga0496112_0020807 | Ga0496112_0020807_2536_3171 | 210 |
| 263 | 3300048916 | Ga0496113_0062287 | Ga0496113_0062287_355_990 | 210 |
| 264 | 3300048925 | Ga0496122_0002963 | Ga0496122_0002963_10611_11243 | 210 |
| 265 | 3300048926 | Ga0496123_0002451 | Ga0496123_0002451_11863_12495 | 210 |
| 266 | 3300048927 | Ga0496124_0123802 | Ga0496124_0123802_304_936 | 210 |
| 267 | 3300049568 | Ga0501031_0033103 | Ga0501031_0033103_788_1447 | 210 |
| 268 | 3300049568 | Ga0501031_0167040 | Ga0501031_0167040_62_721 | 210 |
| 269 | 3300049568 | Ga0501031_0597796 | Ga0501031_0597796_47_697 | 210 |
| 270 | 3300049570 | Ga0501033_0007048 | Ga0501033_0007048_2491_3126 | 210 |
| 271 | 3300049571 | Ga0501034_0100599 | Ga0501034_0100599_970_1605 | 210 |
| 272 | 3300049572 | Ga0501036_0001193 | Ga0501036_0001193_3459_4118 | 210 |
| 273 | 3300049572 | Ga0501036_0024335 | Ga0501036_0024335_1586_2236 | 210 |
| 274 | 3300049572 | Ga0501036_0097970 | Ga0501036_0097970_207_866 | 210 |
| 275 | 3300049574 | Ga0501038_0212540 | Ga0501038_0212540_133_768 | 210 |
| 276 | 3300049574 | Ga0501038_0432642 | Ga0501038_0432642_142_816 | 210 |
| 277 | 3300049575 | Ga0501039_0033563 | Ga0501039_0033563_1161_1820 | 210 |
| 278 | 3300049575 | Ga0501039_0044040 | Ga0501039_0044040_1898_2548 | 210 |
| 279 | 3300049575 | Ga0501039_0279936 | Ga0501039_0279936_469_1119 | 210 |
| 280 | 3300049576 | Ga0501040_0001724 | Ga0501040_0001724_10100_10759 | 210 |
| 281 | 3300049576 | Ga0501040_0065708 | Ga0501040_0065708_1177_1827 | 210 |
| 282 | 3300049576 | Ga0501040_0079561 | Ga0501040_0079561_826_1485 | 210 |
| 283 | 3300049577 | Ga0501041_0011140 | Ga0501041_0011140_3311_3970 | 210 |
| 284 | 3300049577 | Ga0501041_0018736 | Ga0501041_0018736_325_975 | 210 |
| 285 | 3300049577 | Ga0501041_0076801 | Ga0501041_0076801_146_805 | 210 |
| 286 | 3300049578 | Ga0501042_0005577 | Ga0501042_0005577_4628_5287 | 210 |
| 287 | 3300049579 | Ga0501043_0092185 | Ga0501043_0092185_1218_1877 | 210 |
| 288 | 3300049579 | Ga0501043_0543683 | Ga0501043_0543683_32_682 | 210 |
| 289 | 3300049580 | Ga0501046_0107619 | Ga0501046_0107619_1018_1677 | 210 |
| 290 | 3300049581 | Ga0501047_0186360 | Ga0501047_0186360_124_756 | 210 |
| 291 | 3300049581 | Ga0501047_0459801 | Ga0501047_0459801_131_766 | 210 |
| 292 | 3300049582 | Ga0501048_0050547 | Ga0501048_0050547_1256_1915 | 210 |
| 293 | 3300049584 | Ga0501068_0005672 | Ga0501068_0005672_5274_5933 | 210 |
| 294 | 3300049584 | Ga0501068_0141862 | Ga0501068_0141862_31_702 | 210 |
| 295 | 3300049586 | Ga0501070_0198410 | Ga0501070_0198410_722_1354 | 210 |
| 296 | 3300049587 | Ga0501071_0007936 | Ga0501071_0007936_2610_3269 | 210 |
| 297 | 3300049587 | Ga0501071_0009804 | Ga0501071_0009804_5551_6210 | 210 |
| 298 | 3300049588 | Ga0501072_0005608 | Ga0501072_0005608_249_908 | 210 |
| 299 | 3300049588 | Ga0501072_0011565 | Ga0501072_0011565_1362_2021 | 210 |
| 300 | 3300049588 | Ga0501072_0095836 | Ga0501072_0095836_747_1397 | 210 |
| 301 | 3300049588 | Ga0501072_0262375 | Ga0501072_0262375_79_792 | 210 |
| 302 | 3300049589 | Ga0501073_0042142 | Ga0501073_0042142_1317_1952 | 210 |
| 303 | 3300049589 | Ga0501073_0071178 | Ga0501073_0071178_1560_2192 | 210 |
| 304 | 3300049590 | Ga0501074_0062661 | Ga0501074_0062661_1970_2629 | 210 |
| 305 | 3300049590 | Ga0501074_0100816 | Ga0501074_0100816_474_1124 | 210 |
| 306 | 3300049590 | Ga0501074_0109025 | Ga0501074_0109025_1294_1926 | 210 |
| 307 | 3300049590 | Ga0501074_0289274 | Ga0501074_0289274_317_967 | 210 |
| 308 | 3300049591 | Ga0501075_0011542 | Ga0501075_0011542_1006_1665 | 210 |
| 309 | 3300049591 | Ga0501075_0025157 | Ga0501075_0025157_3549_4208 | 210 |
| 310 | 3300049591 | Ga0501075_0034455 | Ga0501075_0034455_1065_1715 | 210 |
| 311 | 3300049591 | Ga0501075_0116664 | Ga0501075_0116664_142_801 | 210 |
| 312 | 3300049592 | Ga0501076_0022693 | Ga0501076_0022693_449_1108 | 210 |
| 313 | 3300049592 | Ga0501076_0023798 | Ga0501076_0023798_589_1248 | 210 |
| 314 | 3300049592 | Ga0501076_0043988 | Ga0501076_0043988_256_906 | 210 |
| 315 | 3300049593 | Ga0501077_0031361 | Ga0501077_0031361_1478_2137 | 210 |
| 316 | 3300049741 | Ga0501079_0139474 | Ga0501079_0139474_1220_1870 | 210 |
| 317 | 3300049741 | Ga0501079_0595572 | Ga0501079_0595572_35_694 | 210 |
| 318 | 3300049742 | Ga0501080_0644458 | Ga0501080_0644458_259_909 | 210 |
| 319 | 3300049743 | Ga0501081_0011107 | Ga0501081_0011107_2131_2790 | 210 |
| 320 | 3300049743 | Ga0501081_0064537 | Ga0501081_0064537_956_1615 | 210 |
| 321 | 3300049743 | Ga0501081_0104547 | Ga0501081_0104547_1102_1752 | 210 |
| 322 | 3300049822 | Ga0501035_0026432 | Ga0501035_0026432_4195_4854 | 210 |
| 323 | 3300049823 | Ga0501044_0043020 | Ga0501044_0043020_2467_3102 | 210 |
| 324 | 3300049824 | Ga0501045_0016327 | Ga0501045_0016327_1321_1971 | 210 |
| 325 | 3300049824 | Ga0501045_0025200 | Ga0501045_0025200_1837_2496 | 210 |
| 326 | 3300050491 | nmdc:mga00v17_209969_c1 | nmdc:mga00v17_209969_c1_342_977 | 210 |
| 327 | 3300050496 | nmdc:mga07m45_8603_c1 | nmdc:mga07m45_8603_c1_2215_2868 | 210 |
| 328 | 3300050507 | nmdc:mga05p37_200676_c1 | nmdc:mga05p37_200676_c1_319_951 | 210 |
| 329 | 3300050507 | nmdc:mga05p37_610024_c1 | nmdc:mga05p37_610024_c1_178_813 | 210 |
| 330 | 3300050507 | nmdc:mga05p37_682271_c1 | nmdc:mga05p37_682271_c1_220_855 | 210 |
| 331 | 3300050508 | nmdc:mga09592_20431_c1 | nmdc:mga09592_20431_c1_3127_3762 | 210 |
| 332 | 3300050508 | nmdc:mga09592_266351_c1 | nmdc:mga09592_266351_c1_357_992 | 210 |
| 333 | 3300050508 | nmdc:mga09592_459552_c1 | nmdc:mga09592_459552_c1_384_1055 | 210 |
| 334 | 3300050509 | nmdc:mga0qj67_121249_c1 | nmdc:mga0qj67_121249_c1_1308_1943 | 210 |
| 335 | 3300050509 | nmdc:mga0qj67_447253_c1 | nmdc:mga0qj67_447253_c1_202_837 | 210 |
| 336 | 3300050509 | nmdc:mga0qj67_98346_c1 | nmdc:mga0qj67_98346_c1_322_957 | 210 |
| 337 | 3300050510 | nmdc:mga06r32_1070187_c1 | nmdc:mga06r32_1070187_c1_57_692 | 210 |
| 338 | 3300050510 | nmdc:mga06r32_148916_c1 | nmdc:mga06r32_148916_c1_275_946 | 210 |
| 339 | 3300050510 | nmdc:mga06r32_258614_c1 | nmdc:mga06r32_258614_c1_740_1375 | 210 |
| 340 | 3300050511 | nmdc:mga08y16_320082_c1 | nmdc:mga08y16_320082_c1_212_847 | 210 |
| 341 | 3300050512 | nmdc:mga0n895_179639_c1 | nmdc:mga0n895_179639_c1_577_1212 | 210 |
| 342 | 3300050513 | nmdc:mga0rr50_102939_c1 | nmdc:mga0rr50_102939_c1_671_1306 | 210 |
| 343 | 3300050513 | nmdc:mga0rr50_671860_c1 | nmdc:mga0rr50_671860_c1_134_793 | 210 |
| 344 | 3300050513 | nmdc:mga0rr50_6947_c1 | nmdc:mga0rr50_6947_c1_6101_6736 | 210 |
| 345 | 3300050515 | nmdc:mga0a205_14835_c1 | nmdc:mga0a205_14835_c1_2231_2866 | 210 |
| 346 | 3300053094 | Ga0500566_0000044 | Ga0500566_0000044_28258_28893 | 210 |
| 347 | 3300053096 | Ga0500641_0060647 | Ga0500641_0060647_239_880 | 210 |
| 348 | 3300053103 | Ga0500555_005902 | Ga0500555_005902_602_1399 | 210 |
| 349 | 3300053117 | Ga0500593_000006 | Ga0500593_000006_57837_58472 | 210 |
| 350 | 3300053139 | Ga0500568_0000005 | Ga0500568_0000005_369230_369865 | 210 |
| 351 | 3300053139 | Ga0500568_0022253 | Ga0500568_0022253_1437_2078 | 210 |
| 352 | 3300053142 | Ga0500577_0001370 | Ga0500577_0001370_127_762 | 210 |
| 353 | 3300053142 | Ga0500577_0092089 | Ga0500577_0092089_425_1057 | 210 |
| 354 | 3300053153 | Ga0500616_0020681 | Ga0500616_0020681_259_900 | 210 |
| 355 | 3300059492 | Ga0587073_0098291 | Ga0587073_0098291_63_698 | 210 |
| 356 | 3300059511 | Ga0587091_075971 | Ga0587091_075971_13_648 | 210 |
| 357 | 3300060353 | Ga0501082_0045823 | Ga0501082_0045823_1522_2181 | 210 |
| 358 | 3300060353 | Ga0501082_0224692 | Ga0501082_0224692_513_1163 | 210 |
| 359 | 3300060353 | Ga0501082_0237481 | Ga0501082_0237481_894_1544 | 210 |
| 360 | 3300061734 | Ga0530510_0013473 | Ga0530510_0013473_2873_3523 | 210 |
| 361 | 3300061734 | Ga0530510_0014529 | Ga0530510_0014529_2758_3417 | 210 |
| 362 | 3300061734 | Ga0530510_0021620 | Ga0530510_0021620_2665_3324 | 210 |
| 363 | iso_pu_bacteria | 2511231004 | 2511257125 | 213 |
| 364 | iso_pu_bacteria | 2511231006 | 2511264323 | 213 |
| 365 | iso_pu_bacteria | 2511231007 | 2511270396 | 213 |
| 366 | iso_pu_bacteria | 2511231008 | 2511275481 | 213 |
| 367 | iso_pu_bacteria | 2511231012 | 2511302077 | 213 |
| 368 | iso_pu_bacteria | 2511231014 | 2511313773 | 213 |
| 369 | iso_pu_bacteria | 2511231015 | 2511323157 | 213 |
| 370 | iso_pu_bacteria | 2511231016 | 2511325567 | 213 |
| 371 | iso_pu_bacteria | 2511231017 | 2511333339 | 213 |
| 372 | iso_pu_bacteria | 2511231020 | 2511350151 | 213 |
| 373 | iso_pu_bacteria | 2511231021 | 2511357440 | 213 |
| 374 | iso_pu_bacteria | 2511231022 | 2511361151 | 213 |
| 375 | iso_pu_bacteria | 2512047018 | 2512329181 | 213 |
| 376 | iso_pu_bacteria | 2582580891 | 2583793317 | 213 |
| 377 | iso_pu_bacteria | 2597489887 | 2597857289 | 213 |
| 378 | iso_pu_bacteria | 2599185185 | 2599484776 | 213 |
| 379 | iso_pu_bacteria | 2599185257 | 2599801960 | 213 |
| 380 | iso_pu_bacteria | 2643221565 | 2643842236 | 213 |
| 381 | iso_pu_bacteria | 2643221589 | 2643956692 | 213 |
| 382 | iso_pu_bacteria | 2643221602 | 2644021915 | 213 |
| 383 | iso_pu_bacteria | 2643221633 | 2644188269 | 213 |
| 384 | iso_pu_bacteria | 2671180172 | 2671768908 | 213 |
| 385 | iso_pu_bacteria | 2738543004 | 2739197784 | 213 |
| 386 | iso_pu_bacteria | 2738543015 | 2739262237 | 213 |
| 387 | iso_pu_bacteria | 2740892503 | 2743736712 | 213 |
| 388 | iso_pu_bacteria | 2773857670 | 2774118805 | 213 |
| 389 | iso_pu_bacteria | 2784132072 | 2784312443 | 213 |
| 390 | iso_pu_bacteria | 2808606377 | 2808933193 | 213 |
| 391 | iso_pu_bacteria | 2808606381 | 2808955300 | 213 |
| 392 | iso_pu_bacteria | 2808606445 | 2809214685 | 213 |
| 393 | iso_pu_bacteria | 2858688981 | 2858693607 | 213 |
| 394 | iso_pu_bacteria | 2904550169 | 2904551848 | 213 |
| 395 | iso_pu_bacteria | 2919456309 | 2919459136 | 213 |
| 396 | iso_pu_bacteria | 2923153595 | 2923155730 | 213 |
| 397 | iso_pu_bacteria | 2939636861 | 2939639985 | 213 |
| 398 | iso_pu_bacteria | 2984286254 | 2984290295 | 213 |
| 399 | iso_pu_bacteria | 8015687852 | 8015689982 | 213 |
| 400 | iso_pu_bacteria | 8055770955 | 8055773085 | 213 |
| 401 | iso_pu_bacteria | 8056125926 | 8056129470 | 213 |
| 402 | iso_pu_bacteria | 8056177738 | 8056178640 | 213 |
| 403 | 3300009098 | Ga0105245_10022120 | Ga0105245_100221207 | 215 |
| 404 | 3300013296 | Ga0157374_10301093 | Ga0157374_103010932 | 215 |
| 405 | 3300005843 | Ga0068860_100135331 | Ga0068860_1001353312 | 216 |
| 406 | 3300006358 | Ga0068871_100259576 | Ga0068871_1002595763 | 216 |
| 407 | 2124908027 | MRS2a_Contig_16 | MRS2a_00059450 | 217 |
| 408 | 2124908027 | MRS2a_Contig_7135 | MRS2a_00035740 | 217 |
| 409 | 2124908027 | MRS2a_Contig_9103 | MRS2a_00006130 | 217 |
| 410 | 2162886007 | SwRhRL2b_contig_1791376 | SwRhRL2b_0662.00000540 | 217 |
| 411 | 2162886007 | SwRhRL2b_contig_275942 | SwRhRL2b_0885.00008400 | 217 |
| 412 | 3300002737 | JGI25162J39368_1000045 | JGI25162J39368_100004541 | 217 |
| 413 | 3300002771 | JGI25163J39215_1000297 | JGI25163J39215_100029717 | 217 |
| 414 | 3300002772 | JGI25164J39214_1000147 | JGI25164J39214_100014730 | 217 |
| 415 | 3300003187 | JGI25151J46595_10000065 | JGI25151J46595_1000006537 | 217 |
| 416 | 3300003187 | JGI25151J46595_10056448 | JGI25151J46595_100564481 | 217 |
| 417 | 3300003214 | JGI25165J46597_1000086 | JGI25165J46597_100008641 | 217 |
| 418 | 3300003578 | Ga0006562J51391_1007874 | Ga0006562J51391_10078741 | 217 |
| 419 | 3300003773 | Ga0055537_1000409 | Ga0055537_10004091 | 217 |
| 420 | 3300003775 | Ga0055524_1021663 | Ga0055524_10216631 | 217 |
| 421 | 3300003781 | Ga0055536_1000028 | Ga0055536_1000028101 | 217 |
| 422 | 3300003784 | Ga0055534_1000189 | Ga0055534_100018942 | 217 |
| 423 | 3300003791 | Ga0055530_10000030 | Ga0055530_1000003064 | 217 |
| 424 | 3300003791 | Ga0055530_10014884 | Ga0055530_100148842 | 217 |
| 425 | 3300003792 | Ga0055540_1000262 | Ga0055540_100026229 | 217 |
| 426 | 3300005288 | Ga0065714_10000003 | Ga0065714_1000000326 | 217 |
| 427 | 3300005288 | Ga0065714_10004301 | Ga0065714_100043014 | 217 |
| 428 | 3300005288 | Ga0065714_10004791 | Ga0065714_100047913 | 217 |
| 429 | 3300005288 | Ga0065714_10005115 | Ga0065714_100051155 | 217 |
| 430 | 3300005288 | Ga0065714_10005580 | Ga0065714_1000558013 | 217 |
| 431 | 3300005288 | Ga0065714_10066220 | Ga0065714_100662207 | 217 |
| 432 | 3300005288 | Ga0065714_10084673 | Ga0065714_100846732 | 217 |
| 433 | 3300005288 | Ga0065714_10105443 | Ga0065714_101054432 | 217 |
| 434 | 3300005288 | Ga0065714_10120013 | Ga0065714_101200132 | 217 |
| 435 | 3300005289 | Ga0065704_10079095 | Ga0065704_100790955 | 217 |
| 436 | 3300005289 | Ga0065704_10112878 | Ga0065704_101128782 | 217 |
| 437 | 3300005289 | Ga0065704_10146359 | Ga0065704_101463593 | 217 |
| 438 | 3300005290 | Ga0065712_10002579 | Ga0065712_100025795 | 217 |
| 439 | 3300005293 | Ga0065715_10101780 | Ga0065715_101017802 | 217 |
| 440 | 3300005335 | Ga0070666_10027722 | Ga0070666_100277221 | 217 |
| 441 | 3300005356 | Ga0070674_100969041 | Ga0070674_1009690411 | 217 |
| 442 | 3300006051 | Ga0075364_10032030 | Ga0075364_100320303 | 217 |
| 443 | 3300006058 | Ga0075432_10003245 | Ga0075432_100032454 | 217 |
| 444 | 3300006058 | Ga0075432_10003498 | Ga0075432_100034985 | 217 |
| 445 | 3300006058 | Ga0075432_10177981 | Ga0075432_101779812 | 217 |
| 446 | 3300006186 | Ga0075369_10056579 | Ga0075369_100565792 | 217 |
| 447 | 3300006186 | Ga0075369_10256479 | Ga0075369_102564791 | 217 |
| 448 | 3300006358 | Ga0068871_100446309 | Ga0068871_1004463091 | 217 |
| 449 | 3300006914 | Ga0075436_100048957 | Ga0075436_1000489571 | 217 |
| 450 | 3300006914 | Ga0075436_100077100 | Ga0075436_1000771003 | 217 |
| 451 | 3300006946 | Ga0079104_1000142 | Ga0079104_100014291 | 217 |
| 452 | 3300009011 | Ga0105251_10004626 | Ga0105251_100046266 | 217 |
| 453 | 3300009036 | Ga0105244_10002532 | Ga0105244_1000253214 | 217 |
| 454 | 3300009036 | Ga0105244_10063319 | Ga0105244_100633192 | 217 |
| 455 | 3300009148 | Ga0105243_10069412 | Ga0105243_100694123 | 217 |
| 456 | 3300009545 | Ga0105237_10139362 | Ga0105237_101393621 | 217 |
| 457 | 3300011119 | Ga0105246_10045067 | Ga0105246_100450674 | 217 |
| 458 | 3300013100 | Ga0157373_10002776 | Ga0157373_1000277611 | 217 |
| 459 | 3300013100 | Ga0157373_10360227 | Ga0157373_103602272 | 217 |
| 460 | 3300013104 | Ga0157370_10004153 | Ga0157370_1000415316 | 217 |
| 461 | 3300013104 | Ga0157370_10042606 | Ga0157370_100426066 | 217 |
| 462 | 3300013104 | Ga0157370_10154518 | Ga0157370_101545182 | 217 |
| 463 | 3300013105 | Ga0157369_10120305 | Ga0157369_101203052 | 217 |
| 464 | 3300013306 | Ga0163162_11130794 | Ga0163162_111307942 | 217 |
| 465 | 3300014326 | Ga0157380_10327161 | Ga0157380_103271612 | 217 |
| 466 | 3300014497 | Ga0182008_10005589 | Ga0182008_100055896 | 217 |
| 467 | 3300014497 | Ga0182008_10007190 | Ga0182008_100071906 | 217 |
| 468 | 3300014497 | Ga0182008_10011159 | Ga0182008_100111596 | 217 |
| 469 | 3300014497 | Ga0182008_10023599 | Ga0182008_100235993 | 217 |
| 470 | 3300014497 | Ga0182008_10036263 | Ga0182008_100362633 | 217 |
| 471 | 3300015261 | Ga0182006_1000083 | Ga0182006_100008348 | 217 |
| 472 | 3300015265 | Ga0182005_1001254 | Ga0182005_100125412 | 217 |
| 473 | 3300015265 | Ga0182005_1023824 | Ga0182005_10238242 | 217 |
| 474 | 3300015265 | Ga0182005_1067993 | Ga0182005_10679932 | 217 |
| 475 | 3300017792 | Ga0163161_10002966 | Ga0163161_100029665 | 217 |
| 476 | 3300017792 | Ga0163161_10039468 | Ga0163161_100394683 | 217 |
| 477 | 3300025207 | Ga0209760_100019 | Ga0209760_100019128 | 217 |
| 478 | 3300025231 | Ga0207427_100011 | Ga0207427_100011128 | 217 |
| 479 | 3300025233 | Ga0209437_100044 | Ga0209437_100044128 | 217 |
| 480 | 3300025256 | Ga0209759_1001894 | Ga0209759_100189411 | 217 |
| 481 | 3300025261 | Ga0209233_1000057 | Ga0209233_1000057128 | 217 |
| 482 | 3300025263 | Ga0209565_1000109 | Ga0209565_1000109112 | 217 |
| 483 | 3300025273 | Ga0209673_1034456 | Ga0209673_10344562 | 217 |
| 484 | 3300025291 | Ga0209675_1000118 | Ga0209675_10001181 | 217 |
| 485 | 3300025292 | Ga0209676_1000062 | Ga0209676_1000062257 | 217 |
| 486 | 3300025294 | Ga0209025_1000159 | Ga0209025_100015946 | 217 |
| 487 | 3300025294 | Ga0209025_1002020 | Ga0209025_100202014 | 217 |
| 488 | 3300025294 | Ga0209025_1048697 | Ga0209025_10486972 | 217 |
| 489 | 3300025297 | Ga0209758_1010371 | Ga0209758_10103713 | 217 |
| 490 | 3300025298 | Ga0209050_1000150 | Ga0209050_100015097 | 217 |
| 491 | 3300025298 | Ga0209050_1000684 | Ga0209050_100068412 | 217 |
| 492 | 3300025299 | Ga0209256_1001890 | Ga0209256_100189018 | 217 |
| 493 | 3300025303 | Ga0209051_1000162 | Ga0209051_100016265 | 217 |
| 494 | 3300025303 | Ga0209051_1004106 | Ga0209051_10041061 | 217 |
| 495 | 3300025303 | Ga0209051_1029433 | Ga0209051_10294332 | 217 |
| 496 | 3300025711 | Ga0207696_1021703 | Ga0207696_10217032 | 217 |
| 497 | 3300025728 | Ga0207655_1000481 | Ga0207655_100048150 | 217 |
| 498 | 3300025728 | Ga0207655_1007663 | Ga0207655_10076634 | 217 |
| 499 | 3300025728 | Ga0207655_1049284 | Ga0207655_10492842 | 217 |
| 500 | 3300025728 | Ga0207655_1057603 | Ga0207655_10576031 | 217 |
| 501 | 3300025735 | Ga0207713_1005276 | Ga0207713_10052766 | 217 |
| 502 | 3300025735 | Ga0207713_1013027 | Ga0207713_10130275 | 217 |
| 503 | 3300027111 | Ga0209281_1000262 | Ga0209281_100026214 | 217 |
| 504 | 3300027907 | Ga0207428_10047709 | Ga0207428_100477094 | 217 |
| 505 | 3300027907 | Ga0207428_10085522 | Ga0207428_100855222 | 217 |
| 506 | 3300027907 | Ga0207428_10130436 | Ga0207428_101304361 | 217 |
| 507 | 3300027907 | Ga0207428_10141121 | Ga0207428_101411212 | 217 |
| 508 | 3300027907 | Ga0207428_10164918 | Ga0207428_101649182 | 217 |
| 509 | 3300027907 | Ga0207428_10275962 | Ga0207428_102759622 | 217 |
| 510 | 3300027907 | Ga0207428_10323448 | Ga0207428_103234482 | 217 |
| 511 | 3300037312 | Ga0395899_0192124 | Ga0395899_0192124_598_1251 | 217 |
| 512 | 3300037418 | Ga0395900_0358145 | Ga0395900_0358145_499_1152 | 217 |
| 513 | 3300041404 | Ga0439436_0000762 | Ga0439436_0000762_1339_1992 | 217 |
| 514 | 3300041405 | Ga0439438_000379 | Ga0439438_000379_13609_14262 | 217 |
| 515 | 3300041405 | Ga0439438_001079 | Ga0439438_001079_8015_8668 | 217 |
| 516 | 3300041405 | Ga0439438_001796 | Ga0439438_001796_127_780 | 217 |
| 517 | 3300041405 | Ga0439438_004736 | Ga0439438_004736_1223_1876 | 217 |
| 518 | 3300041405 | Ga0439438_011170 | Ga0439438_011170_811_1464 | 217 |
| 519 | 3300041407 | Ga0439447_000016 | Ga0439447_000016_36320_36973 | 217 |
| 520 | 3300041407 | Ga0439447_000054 | Ga0439447_000054_2262_2915 | 217 |
| 521 | 3300041407 | Ga0439447_000101 | Ga0439447_000101_4500_5153 | 217 |
| 522 | 3300041407 | Ga0439447_000519 | Ga0439447_000519_12137_12790 | 217 |
| 523 | 3300041407 | Ga0439447_001146 | Ga0439447_001146_2281_2934 | 217 |
| 524 | 3300041407 | Ga0439447_005206 | Ga0439447_005206_3263_3916 | 217 |
| 525 | 3300041410 | Ga0439461_0017956 | Ga0439461_0017956_53_706 | 217 |
| 526 | 3300041411 | Ga0439466_0000101 | Ga0439466_0000101_3787_4440 | 217 |
| 527 | 3300041411 | Ga0439466_0003430 | Ga0439466_0003430_1332_1985 | 217 |
| 528 | 3300041411 | Ga0439466_0008454 | Ga0439466_0008454_1238_1891 | 217 |
| 529 | 3300041411 | Ga0439466_0008895 | Ga0439466_0008895_862_1515 | 217 |
| 530 | 3300041411 | Ga0439466_0013095 | Ga0439466_0013095_2351_3004 | 217 |
| 531 | 3300041411 | Ga0439466_0051597 | Ga0439466_0051597_50_703 | 217 |
| 532 | 3300041413 | Ga0439465_0044696 | Ga0439465_0044696_214_867 | 217 |
| 533 | 3300042006 | Ga0439432_000233 | Ga0439432_000233_3105_3758 | 217 |
| 534 | 3300042006 | Ga0439432_008552 | Ga0439432_008552_1076_1729 | 217 |
| 535 | 3300042006 | Ga0439432_016390 | Ga0439432_016390_1413_2066 | 217 |
| 536 | 3300042009 | Ga0439451_000450 | Ga0439451_000450_131_784 | 217 |
| 537 | 3300042009 | Ga0439451_006682 | Ga0439451_006682_468_1121 | 217 |
| 538 | 3300042009 | Ga0439451_006802 | Ga0439451_006802_468_1121 | 217 |
| 539 | 3300042010 | Ga0439452_000287 | Ga0439452_000287_4299_4952 | 217 |
| 540 | 3300042010 | Ga0439452_000939 | Ga0439452_000939_702_1481 | 217 |
| 541 | 3300042010 | Ga0439452_001970 | Ga0439452_001970_2920_3573 | 217 |
| 542 | 3300042010 | Ga0439452_004038 | Ga0439452_004038_2627_3280 | 217 |
| 543 | 3300042010 | Ga0439452_006076 | Ga0439452_006076_853_1506 | 217 |
| 544 | 3300042013 | Ga0439456_000745 | Ga0439456_000745_5922_6575 | 217 |
| 545 | 3300042013 | Ga0439456_001138 | Ga0439456_001138_4540_5193 | 217 |
| 546 | 3300042013 | Ga0439456_001454 | Ga0439456_001454_363_1142 | 217 |
| 547 | 3300042013 | Ga0439456_008929 | Ga0439456_008929_1339_1992 | 217 |
| 548 | 3300042013 | Ga0439456_026889 | Ga0439456_026889_131_784 | 217 |
| 549 | 3300042013 | Ga0439456_058581 | Ga0439456_058581_159_812 | 217 |
| 550 | 3300042016 | Ga0439463_000007 | Ga0439463_000007_30435_31088 | 217 |
| 551 | 3300042016 | Ga0439463_004030 | Ga0439463_004030_2513_3166 | 217 |
| 552 | 3300042115 | Ga0450911_000781 | Ga0450911_000781_248_901 | 217 |
| 553 | 3300042115 | Ga0450911_001463 | Ga0450911_001463_3264_3917 | 217 |
| 554 | 3300042115 | Ga0450911_002978 | Ga0450911_002978_1326_1979 | 217 |
| 555 | 3300042121 | Ga0450919_014287 | Ga0450919_014287_130_783 | 217 |
| 556 | 3300042122 | Ga0450920_000220 | Ga0450920_000220_7033_7686 | 217 |
| 557 | 3300042124 | Ga0450922_004730 | Ga0450922_004730_109_762 | 217 |
| 558 | 3300042127 | Ga0450890_000293 | Ga0450890_000293_3826_4479 | 217 |
| 559 | 3300042130 | Ga0450892_006597 | Ga0450892_006597_147_800 | 217 |
| 560 | 3300042138 | Ga0450903_000835 | Ga0450903_000835_3404_4057 | 217 |
| 561 | 3300042138 | Ga0450903_002032 | Ga0450903_002032_2309_3088 | 217 |
| 562 | 3300042138 | Ga0450903_004133 | Ga0450903_004133_1646_2299 | 217 |
| 563 | 3300042138 | Ga0450903_004819 | Ga0450903_004819_349_1002 | 217 |
| 564 | 3300042139 | Ga0450904_000497 | Ga0450904_000497_769_1422 | 217 |
| 565 | 3300042142 | Ga0450905_009553 | Ga0450905_009553_360_1013 | 217 |
| 566 | 3300042145 | Ga0450906_000952 | Ga0450906_000952_3663_4316 | 217 |
| 567 | 3300042145 | Ga0450906_001246 | Ga0450906_001246_2798_3451 | 217 |
| 568 | 3300042146 | Ga0450907_000001 | Ga0450907_000001_200172_200825 | 217 |
| 569 | 3300042146 | Ga0450907_001863 | Ga0450907_001863_1227_1880 | 217 |
| 570 | 3300042146 | Ga0450907_007968 | Ga0450907_007968_865_1518 | 217 |
| 571 | 3300042147 | Ga0450910_000235 | Ga0450910_000235_2539_3192 | 217 |
| 572 | 3300042156 | Ga0439446_0000210 | Ga0439446_0000210_2839_3492 | 217 |
| 573 | 3300042156 | Ga0439446_0000222 | Ga0439446_0000222_2992_3645 | 217 |
| 574 | 3300042156 | Ga0439446_0003553 | Ga0439446_0003553_1278_1931 | 217 |
| 575 | 3300042184 | Ga0450908_001049 | Ga0450908_001049_2769_3422 | 217 |
| 576 | 3300042185 | Ga0450909_000158 | Ga0450909_000158_3572_4225 | 217 |
| 577 | 3300042185 | Ga0450909_000192 | Ga0450909_000192_1537_2190 | 217 |
| 578 | 3300042435 | Ga0439434_0000057 | Ga0439434_0000057_16572_17225 | 217 |
| 579 | 3300042461 | Ga0439460_0001544 | Ga0439460_0001544_529_1182 | 217 |
| 580 | 3300042461 | Ga0439460_0017057 | Ga0439460_0017057_199_948 | 217 |
| 581 | 3300042532 | Ga0450893_0014890 | Ga0450893_0014890_509_1162 | 217 |
| 582 | 3300042993 | Ga0439440_0000252 | Ga0439440_0000252_2271_2924 | 217 |
| 583 | 3300042993 | Ga0439440_0002205 | Ga0439440_0002205_28_681 | 217 |
| 584 | 3300042993 | Ga0439440_0012574 | Ga0439440_0012574_436_1089 | 217 |
| 585 | 3300044656 | Ga0466969_0013651 | Ga0466969_0013651_425_1078 | 217 |
| 586 | 3300044684 | Ga0466966_0012062 | Ga0466966_0012062_3057_3710 | 217 |
| 587 | 3300044693 | Ga0466961_0192849 | Ga0466961_0192849_331_984 | 217 |
| 588 | 3300044706 | Ga0466964_0174205 | Ga0466964_0174205_348_1001 | 217 |
| 589 | 3300044735 | Ga0466968_0013865 | Ga0466968_0013865_75_728 | 217 |
| 590 | 3300044765 | Ga0466970_0025318 | Ga0466970_0025318_2256_2909 | 217 |
| 591 | 3300044842 | Ga0466957_0037733 | Ga0466957_0037733_150_803 | 217 |
| 592 | 3300045049 | Ga0466959_0015461 | Ga0466959_0015461_3986_4639 | 217 |
| 593 | 3300045836 | Ga0466958_0018299 | Ga0466958_0018299_3064_3717 | 217 |
| 594 | 3300045836 | Ga0466958_0316142 | Ga0466958_0316142_308_961 | 217 |
| 595 | 3300046452 | Ga0495617_000204 | Ga0495617_000204_10573_11226 | 217 |
| 596 | 3300046452 | Ga0495617_001096 | Ga0495617_001096_4588_5241 | 217 |
| 597 | 3300046452 | Ga0495617_002458 | Ga0495617_002458_2792_3445 | 217 |
| 598 | 3300046452 | Ga0495617_002836 | Ga0495617_002836_3049_3702 | 217 |
| 599 | 3300046452 | Ga0495617_004958 | Ga0495617_004958_3754_4407 | 217 |
| 600 | 3300046452 | Ga0495617_005427 | Ga0495617_005427_1599_2252 | 217 |
| 601 | 3300046452 | Ga0495617_025087 | Ga0495617_025087_846_1499 | 217 |
| 602 | 3300046452 | Ga0495617_027628 | Ga0495617_027628_349_1002 | 217 |
| 603 | 3300046452 | Ga0495617_045668 | Ga0495617_045668_560_1213 | 217 |
| 604 | 3300046453 | Ga0495627_001657 | Ga0495627_001657_2126_2779 | 217 |
| 605 | 3300046453 | Ga0495627_034261 | Ga0495627_034261_113_766 | 217 |
| 606 | 3300046455 | Ga0495603_0002282 | Ga0495603_0002282_7840_8493 | 217 |
| 607 | 3300046455 | Ga0495603_0045148 | Ga0495603_0045148_1475_2128 | 217 |
| 608 | 3300046457 | Ga0495590_0000114 | Ga0495590_0000114_36163_36816 | 217 |
| 609 | 3300046457 | Ga0495590_0000628 | Ga0495590_0000628_3154_3807 | 217 |
| 610 | 3300046457 | Ga0495590_0004576 | Ga0495590_0004576_3969_4622 | 217 |
| 611 | 3300046457 | Ga0495590_0012548 | Ga0495590_0012548_2038_2691 | 217 |
| 612 | 3300046457 | Ga0495590_0044981 | Ga0495590_0044981_644_1297 | 217 |
| 613 | 3300046458 | Ga0495591_000021 | Ga0495591_000021_167127_167780 | 217 |
| 614 | 3300046458 | Ga0495591_001154 | Ga0495591_001154_5430_6083 | 217 |
| 615 | 3300046458 | Ga0495591_004409 | Ga0495591_004409_3770_4423 | 217 |
| 616 | 3300046458 | Ga0495591_009642 | Ga0495591_009642_2001_2654 | 217 |
| 617 | 3300046458 | Ga0495591_011532 | Ga0495591_011532_255_908 | 217 |
| 618 | 3300046458 | Ga0495591_017906 | Ga0495591_017906_1633_2286 | 217 |
| 619 | 3300046458 | Ga0495591_022356 | Ga0495591_022356_1340_1993 | 217 |
| 620 | 3300046460 | Ga0495638_0001071 | Ga0495638_0001071_15933_16586 | 217 |
| 621 | 3300046460 | Ga0495638_0001173 | Ga0495638_0001173_10728_11381 | 217 |
| 622 | 3300046460 | Ga0495638_0001643 | Ga0495638_0001643_7682_8335 | 217 |
| 623 | 3300046460 | Ga0495638_0001675 | Ga0495638_0001675_15158_15811 | 217 |
| 624 | 3300046460 | Ga0495638_0003795 | Ga0495638_0003795_4415_5068 | 217 |
| 625 | 3300046460 | Ga0495638_0006166 | Ga0495638_0006166_6667_7320 | 217 |
| 626 | 3300046460 | Ga0495638_0012543 | Ga0495638_0012543_4181_4834 | 217 |
| 627 | 3300046460 | Ga0495638_0020265 | Ga0495638_0020265_491_1285 | 217 |
| 628 | 3300046460 | Ga0495638_0036061 | Ga0495638_0036061_364_1017 | 217 |
| 629 | 3300046460 | Ga0495638_0040995 | Ga0495638_0040995_2126_2779 | 217 |
| 630 | 3300046460 | Ga0495638_0126384 | Ga0495638_0126384_775_1428 | 217 |
| 631 | 3300046460 | Ga0495638_0153048 | Ga0495638_0153048_70_723 | 217 |
| 632 | 3300046463 | Ga0495653_0101918 | Ga0495653_0101918_382_1035 | 217 |
| 633 | 3300046471 | Ga0495650_0001066 | Ga0495650_0001066_263_916 | 217 |
| 634 | 3300046471 | Ga0495650_0001224 | Ga0495650_0001224_24675_25328 | 217 |
| 635 | 3300046471 | Ga0495650_0001886 | Ga0495650_0001886_7116_7769 | 217 |
| 636 | 3300046471 | Ga0495650_0002534 | Ga0495650_0002534_4667_5461 | 217 |
| 637 | 3300046471 | Ga0495650_0008706 | Ga0495650_0008706_1071_1724 | 217 |
| 638 | 3300046474 | Ga0495605_0000391 | Ga0495605_0000391_26663_27316 | 217 |
| 639 | 3300046474 | Ga0495605_0000446 | Ga0495605_0000446_7708_8361 | 217 |
| 640 | 3300046474 | Ga0495605_0000751 | Ga0495605_0000751_7589_8242 | 217 |
| 641 | 3300046474 | Ga0495605_0003866 | Ga0495605_0003866_1538_2191 | 217 |
| 642 | 3300046474 | Ga0495605_0010911 | Ga0495605_0010911_3284_3937 | 217 |
| 643 | 3300046474 | Ga0495605_0043419 | Ga0495605_0043419_688_1341 | 217 |
| 644 | 3300046474 | Ga0495605_0052934 | Ga0495605_0052934_643_1296 | 217 |
| 645 | 3300046474 | Ga0495605_0103442 | Ga0495605_0103442_529_1182 | 217 |
| 646 | 3300046475 | Ga0495639_0001776 | Ga0495639_0001776_6356_7009 | 217 |
| 647 | 3300046491 | Ga0495584_0000019 | Ga0495584_0000019_81663_82316 | 217 |
| 648 | 3300046491 | Ga0495584_0000176 | Ga0495584_0000176_42621_43274 | 217 |
| 649 | 3300046491 | Ga0495584_0000296 | Ga0495584_0000296_12942_13595 | 217 |
| 650 | 3300046491 | Ga0495584_0000568 | Ga0495584_0000568_7884_8537 | 217 |
| 651 | 3300046491 | Ga0495584_0004039 | Ga0495584_0004039_5583_6236 | 217 |
| 652 | 3300046491 | Ga0495584_0005778 | Ga0495584_0005778_970_1623 | 217 |
| 653 | 3300046491 | Ga0495584_0015243 | Ga0495584_0015243_2904_3557 | 217 |
| 654 | 3300046491 | Ga0495584_0073558 | Ga0495584_0073558_281_934 | 217 |
| 655 | 3300046491 | Ga0495584_0251961 | Ga0495584_0251961_200_853 | 217 |
| 656 | 3300046492 | Ga0495585_0000165 | Ga0495585_0000165_45095_45748 | 217 |
| 657 | 3300046492 | Ga0495585_0004259 | Ga0495585_0004259_3064_3717 | 217 |
| 658 | 3300046492 | Ga0495585_0016293 | Ga0495585_0016293_3349_4002 | 217 |
| 659 | 3300046492 | Ga0495585_0041395 | Ga0495585_0041395_1761_2414 | 217 |
| 660 | 3300046492 | Ga0495585_0071007 | Ga0495585_0071007_36_689 | 217 |
| 661 | 3300046492 | Ga0495585_0077305 | Ga0495585_0077305_802_1455 | 217 |
| 662 | 3300046492 | Ga0495585_0085811 | Ga0495585_0085811_684_1337 | 217 |
| 663 | 3300046492 | Ga0495585_0194445 | Ga0495585_0194445_272_925 | 217 |
| 664 | 3300046492 | Ga0495585_0239726 | Ga0495585_0239726_197_850 | 217 |
| 665 | 3300046499 | Ga0495594_0000316 | Ga0495594_0000316_18999_19718 | 217 |
| 666 | 3300046499 | Ga0495594_0001211 | Ga0495594_0001211_7031_7684 | 217 |
| 667 | 3300046499 | Ga0495594_0042317 | Ga0495594_0042317_537_1190 | 217 |
| 668 | 3300046500 | Ga0495596_0000209 | Ga0495596_0000209_30044_30838 | 217 |
| 669 | 3300046501 | Ga0495607_0000188 | Ga0495607_0000188_15626_16279 | 217 |
| 670 | 3300046501 | Ga0495607_0000709 | Ga0495607_0000709_6628_7281 | 217 |
| 671 | 3300046501 | Ga0495607_0006930 | Ga0495607_0006930_4715_5368 | 217 |
| 672 | 3300046501 | Ga0495607_0012463 | Ga0495607_0012463_937_1590 | 217 |
| 673 | 3300046501 | Ga0495607_0049007 | Ga0495607_0049007_1238_1891 | 217 |
| 674 | 3300046501 | Ga0495607_0051036 | Ga0495607_0051036_1036_1689 | 217 |
| 675 | 3300046501 | Ga0495607_0059322 | Ga0495607_0059322_608_1261 | 217 |
| 676 | 3300046501 | Ga0495607_0113049 | Ga0495607_0113049_389_1042 | 217 |
| 677 | 3300046506 | Ga0495583_0001277 | Ga0495583_0001277_11844_12497 | 217 |
| 678 | 3300046506 | Ga0495583_0005600 | Ga0495583_0005600_4894_5547 | 217 |
| 679 | 3300046506 | Ga0495583_0010683 | Ga0495583_0010683_4222_4875 | 217 |
| 680 | 3300046506 | Ga0495583_0023101 | Ga0495583_0023101_957_1610 | 217 |
| 681 | 3300046507 | Ga0495606_0000347 | Ga0495606_0000347_9141_9905 | 217 |
| 682 | 3300046507 | Ga0495606_0004664 | Ga0495606_0004664_8143_8796 | 217 |
| 683 | 3300046507 | Ga0495606_0029004 | Ga0495606_0029004_2964_3758 | 217 |
| 684 | 3300046507 | Ga0495606_0060018 | Ga0495606_0060018_1600_2253 | 217 |
| 685 | 3300046507 | Ga0495606_0283666 | Ga0495606_0283666_80_733 | 217 |
| 686 | 3300046512 | Ga0495610_0004063 | Ga0495610_0004063_5713_6366 | 217 |
| 687 | 3300046512 | Ga0495610_0005350 | Ga0495610_0005350_951_1604 | 217 |
| 688 | 3300046512 | Ga0495610_0006965 | Ga0495610_0006965_715_1368 | 217 |
| 689 | 3300046512 | Ga0495610_0009997 | Ga0495610_0009997_2096_2749 | 217 |
| 690 | 3300046512 | Ga0495610_0022448 | Ga0495610_0022448_2025_2819 | 217 |
| 691 | 3300046512 | Ga0495610_0030486 | Ga0495610_0030486_2081_2734 | 217 |
| 692 | 3300046512 | Ga0495610_0038437 | Ga0495610_0038437_794_1447 | 217 |
| 693 | 3300046512 | Ga0495610_0044935 | Ga0495610_0044935_882_1535 | 217 |
| 694 | 3300046512 | Ga0495610_0071691 | Ga0495610_0071691_861_1514 | 217 |
| 695 | 3300046513 | Ga0495616_0001952 | Ga0495616_0001952_6488_7141 | 217 |
| 696 | 3300046513 | Ga0495616_0006371 | Ga0495616_0006371_2423_3076 | 217 |
| 697 | 3300046513 | Ga0495616_0017139 | Ga0495616_0017139_2994_3647 | 217 |
| 698 | 3300046513 | Ga0495616_0028257 | Ga0495616_0028257_903_1556 | 217 |
| 699 | 3300046513 | Ga0495616_0034385 | Ga0495616_0034385_588_1382 | 217 |
| 700 | 3300046513 | Ga0495616_0127435 | Ga0495616_0127435_154_807 | 217 |
| 701 | 3300046513 | Ga0495616_0190414 | Ga0495616_0190414_220_873 | 217 |
| 702 | 3300046513 | Ga0495616_0214611 | Ga0495616_0214611_148_801 | 217 |
| 703 | 3300046515 | Ga0495620_0000308 | Ga0495620_0000308_4658_5311 | 217 |
| 704 | 3300046515 | Ga0495620_0002940 | Ga0495620_0002940_7376_8029 | 217 |
| 705 | 3300046515 | Ga0495620_0036621 | Ga0495620_0036621_634_1428 | 217 |
| 706 | 3300046515 | Ga0495620_0103192 | Ga0495620_0103192_220_873 | 217 |
| 707 | 3300046517 | Ga0495630_0001104 | Ga0495630_0001104_6563_7216 | 217 |
| 708 | 3300046517 | Ga0495630_0400453 | Ga0495630_0400453_174_827 | 217 |
| 709 | 3300046518 | Ga0495631_0000005 | Ga0495631_0000005_91514_92167 | 217 |
| 710 | 3300046518 | Ga0495631_0002159 | Ga0495631_0002159_352_1005 | 217 |
| 711 | 3300046518 | Ga0495631_0029040 | Ga0495631_0029040_758_1411 | 217 |
| 712 | 3300046518 | Ga0495631_0042894 | Ga0495631_0042894_709_1362 | 217 |
| 713 | 3300046519 | Ga0495632_0000693 | Ga0495632_0000693_29626_30279 | 217 |
| 714 | 3300046519 | Ga0495632_0001677 | Ga0495632_0001677_8143_8796 | 217 |
| 715 | 3300046519 | Ga0495632_0003778 | Ga0495632_0003778_6111_6905 | 217 |
| 716 | 3300046519 | Ga0495632_0005075 | Ga0495632_0005075_1356_2009 | 217 |
| 717 | 3300046519 | Ga0495632_0008319 | Ga0495632_0008319_4612_5265 | 217 |
| 718 | 3300046519 | Ga0495632_0015102 | Ga0495632_0015102_1156_1809 | 217 |
| 719 | 3300046519 | Ga0495632_0015668 | Ga0495632_0015668_3435_4088 | 217 |
| 720 | 3300046519 | Ga0495632_0016160 | Ga0495632_0016160_761_1414 | 217 |
| 721 | 3300046519 | Ga0495632_0025415 | Ga0495632_0025415_1312_1965 | 217 |
| 722 | 3300046519 | Ga0495632_0066506 | Ga0495632_0066506_901_1665 | 217 |
| 723 | 3300046519 | Ga0495632_0093900 | Ga0495632_0093900_228_881 | 217 |
| 724 | 3300046520 | Ga0495637_0000499 | Ga0495637_0000499_8981_9634 | 217 |
| 725 | 3300046520 | Ga0495637_0001804 | Ga0495637_0001804_4003_4656 | 217 |
| 726 | 3300046520 | Ga0495637_0003265 | Ga0495637_0003265_5417_6070 | 217 |
| 727 | 3300046520 | Ga0495637_0010990 | Ga0495637_0010990_2802_3455 | 217 |
| 728 | 3300046520 | Ga0495637_0012856 | Ga0495637_0012856_2185_2838 | 217 |
| 729 | 3300046520 | Ga0495637_0016974 | Ga0495637_0016974_84_737 | 217 |
| 730 | 3300046520 | Ga0495637_0037619 | Ga0495637_0037619_1073_1726 | 217 |
| 731 | 3300046520 | Ga0495637_0076372 | Ga0495637_0076372_57_710 | 217 |
| 732 | 3300046522 | Ga0495643_0005530 | Ga0495643_0005530_7407_8060 | 217 |
| 733 | 3300046522 | Ga0495643_0006979 | Ga0495643_0006979_5727_6380 | 217 |
| 734 | 3300046522 | Ga0495643_0009829 | Ga0495643_0009829_629_1282 | 217 |
| 735 | 3300046522 | Ga0495643_0014019 | Ga0495643_0014019_2300_3094 | 217 |
| 736 | 3300046522 | Ga0495643_0061386 | Ga0495643_0061386_574_1227 | 217 |
| 737 | 3300046523 | Ga0495644_0000108 | Ga0495644_0000108_29637_30290 | 217 |
| 738 | 3300046523 | Ga0495644_0000143 | Ga0495644_0000143_9120_9773 | 217 |
| 739 | 3300046523 | Ga0495644_0007098 | Ga0495644_0007098_3286_3939 | 217 |
| 740 | 3300046524 | Ga0495648_0000092 | Ga0495648_0000092_11619_12272 | 217 |
| 741 | 3300046524 | Ga0495648_0003675 | Ga0495648_0003675_7663_8316 | 217 |
| 742 | 3300046524 | Ga0495648_0004541 | Ga0495648_0004541_9609_10262 | 217 |
| 743 | 3300046524 | Ga0495648_0008097 | Ga0495648_0008097_3350_4003 | 217 |
| 744 | 3300046524 | Ga0495648_0008400 | Ga0495648_0008400_316_969 | 217 |
| 745 | 3300046524 | Ga0495648_0010547 | Ga0495648_0010547_4955_5608 | 217 |
| 746 | 3300046524 | Ga0495648_0011830 | Ga0495648_0011830_2159_2812 | 217 |
| 747 | 3300046524 | Ga0495648_0135431 | Ga0495648_0135431_63_716 | 217 |
| 748 | 3300046526 | Ga0495666_0000088 | Ga0495666_0000088_29000_29653 | 217 |
| 749 | 3300046526 | Ga0495666_0014084 | Ga0495666_0014084_3043_3696 | 217 |
| 750 | 3300046526 | Ga0495666_0067413 | Ga0495666_0067413_1039_1692 | 217 |
| 751 | 3300046528 | Ga0495642_0000003 | Ga0495642_0000003_168611_169264 | 217 |
| 752 | 3300046528 | Ga0495642_0000018 | Ga0495642_0000018_10461_11114 | 217 |
| 753 | 3300046528 | Ga0495642_0000599 | Ga0495642_0000599_8143_8796 | 217 |
| 754 | 3300046530 | Ga0495654_0000088 | Ga0495654_0000088_78263_78916 | 217 |
| 755 | 3300046530 | Ga0495654_0001088 | Ga0495654_0001088_12739_13392 | 217 |
| 756 | 3300046530 | Ga0495654_0001307 | Ga0495654_0001307_2460_3113 | 217 |
| 757 | 3300046530 | Ga0495654_0004804 | Ga0495654_0004804_6030_6683 | 217 |
| 758 | 3300046530 | Ga0495654_0007459 | Ga0495654_0007459_1305_1958 | 217 |
| 759 | 3300046530 | Ga0495654_0008806 | Ga0495654_0008806_1474_2127 | 217 |
| 760 | 3300046530 | Ga0495654_0016497 | Ga0495654_0016497_2949_3743 | 217 |
| 761 | 3300046530 | Ga0495654_0018347 | Ga0495654_0018347_541_1194 | 217 |
| 762 | 3300046530 | Ga0495654_0025747 | Ga0495654_0025747_2117_2770 | 217 |
| 763 | 3300046530 | Ga0495654_0031557 | Ga0495654_0031557_321_974 | 217 |
| 764 | 3300046530 | Ga0495654_0084049 | Ga0495654_0084049_328_981 | 217 |
| 765 | 3300046530 | Ga0495654_0107052 | Ga0495654_0107052_574_1227 | 217 |
| 766 | 3300046530 | Ga0495654_0111662 | Ga0495654_0111662_327_980 | 217 |
| 767 | 3300046538 | Ga0495609_0000409 | Ga0495609_0000409_85_738 | 217 |
| 768 | 3300046538 | Ga0495609_0002918 | Ga0495609_0002918_7061_7714 | 217 |
| 769 | 3300046538 | Ga0495609_0026937 | Ga0495609_0026937_198_851 | 217 |
| 770 | 3300046538 | Ga0495609_0125128 | Ga0495609_0125128_103_756 | 217 |
| 771 | 3300046542 | Ga0495597_0003792 | Ga0495597_0003792_1089_1742 | 217 |
| 772 | 3300046542 | Ga0495597_0005486 | Ga0495597_0005486_5990_6643 | 217 |
| 773 | 3300046542 | Ga0495597_0009049 | Ga0495597_0009049_1378_2031 | 217 |
| 774 | 3300046542 | Ga0495597_0011043 | Ga0495597_0011043_2180_2833 | 217 |
| 775 | 3300046542 | Ga0495597_0096501 | Ga0495597_0096501_360_1013 | 217 |
| 776 | 3300046542 | Ga0495597_0115631 | Ga0495597_0115631_403_1056 | 217 |
| 777 | 3300046557 | Ga0495622_0000193 | Ga0495622_0000193_32615_33268 | 217 |
| 778 | 3300046557 | Ga0495622_0000347 | Ga0495622_0000347_1444_2163 | 217 |
| 779 | 3300046557 | Ga0495622_0007820 | Ga0495622_0007820_1624_2277 | 217 |
| 780 | 3300046557 | Ga0495622_0042330 | Ga0495622_0042330_20_673 | 217 |
| 781 | 3300046558 | Ga0495633_0017843 | Ga0495633_0017843_933_1586 | 217 |
| 782 | 3300046558 | Ga0495633_0096991 | Ga0495633_0096991_605_1258 | 217 |
| 783 | 3300046615 | Ga0495656_0003888 | Ga0495656_0003888_953_1606 | 217 |
| 784 | 3300046615 | Ga0495656_0007882 | Ga0495656_0007882_2253_2906 | 217 |
| 785 | 3300046615 | Ga0495656_0024651 | Ga0495656_0024651_950_1603 | 217 |
| 786 | 3300046615 | Ga0495656_0058921 | Ga0495656_0058921_391_1044 | 217 |
| 787 | 3300046616 | Ga0495668_0000467 | Ga0495668_0000467_42683_43477 | 217 |
| 788 | 3300046616 | Ga0495668_0009442 | Ga0495668_0009442_4237_4890 | 217 |
| 789 | 3300046648 | Ga0495611_0007442 | Ga0495611_0007442_2212_2865 | 217 |
| 790 | 3300046660 | Ga0495625_0001435 | Ga0495625_0001435_10095_10748 | 217 |
| 791 | 3300046660 | Ga0495625_0005691 | Ga0495625_0005691_6390_7184 | 217 |
| 792 | 3300046660 | Ga0495625_0007778 | Ga0495625_0007778_7893_8546 | 217 |
| 793 | 3300046660 | Ga0495625_0014487 | Ga0495625_0014487_3799_4452 | 217 |
| 794 | 3300046660 | Ga0495625_0015160 | Ga0495625_0015160_491_1144 | 217 |
| 795 | 3300046660 | Ga0495625_0045240 | Ga0495625_0045240_492_1145 | 217 |
| 796 | 3300046660 | Ga0495625_0089279 | Ga0495625_0089279_1277_1930 | 217 |
| 797 | 3300046664 | Ga0495659_0000002 | Ga0495659_0000002_103889_104542 | 217 |
| 798 | 3300046664 | Ga0495659_0000641 | Ga0495659_0000641_5263_5916 | 217 |
| 799 | 3300046664 | Ga0495659_0003771 | Ga0495659_0003771_716_1369 | 217 |
| 800 | 3300046665 | Ga0495661_0013350 | Ga0495661_0013350_220_873 | 217 |
| 801 | 3300046665 | Ga0495661_0031938 | Ga0495661_0031938_2354_3007 | 217 |
| 802 | 3300046665 | Ga0495661_0082342 | Ga0495661_0082342_559_1212 | 217 |
| 803 | 3300046674 | Ga0495588_0004596 | Ga0495588_0004596_3144_3797 | 217 |
| 804 | 3300046674 | Ga0495588_0019536 | Ga0495588_0019536_1362_2015 | 217 |
| 805 | 3300046674 | Ga0495588_0123428 | Ga0495588_0123428_364_1017 | 217 |
| 806 | 3300046679 | Ga0495623_0001478 | Ga0495623_0001478_11512_12168 | 217 |
| 807 | 3300046679 | Ga0495623_0002571 | Ga0495623_0002571_1637_2290 | 217 |
| 808 | 3300046684 | Ga0495669_0000279 | Ga0495669_0000279_26581_27234 | 217 |
| 809 | 3300046684 | Ga0495669_0001673 | Ga0495669_0001673_2413_3066 | 217 |
| 810 | 3300046691 | Ga0495670_0000112 | Ga0495670_0000112_2240_2893 | 217 |
| 811 | 3300046691 | Ga0495670_0000620 | Ga0495670_0000620_11279_11932 | 217 |
| 812 | 3300046691 | Ga0495670_0001315 | Ga0495670_0001315_3408_4061 | 217 |
| 813 | 3300046691 | Ga0495670_0013560 | Ga0495670_0013560_113_766 | 217 |
| 814 | 3300046691 | Ga0495670_0017942 | Ga0495670_0017942_2748_3401 | 217 |
| 815 | 3300046691 | Ga0495670_0022028 | Ga0495670_0022028_414_1067 | 217 |
| 816 | 3300046691 | Ga0495670_0032135 | Ga0495670_0032135_274_927 | 217 |
| 817 | 3300046691 | Ga0495670_0062329 | Ga0495670_0062329_686_1339 | 217 |
| 818 | 3300046691 | Ga0495670_0089262 | Ga0495670_0089262_17_670 | 217 |
| 819 | 3300046691 | Ga0495670_0108992 | Ga0495670_0108992_436_1089 | 217 |
| 820 | 3300046691 | Ga0495670_0189817 | Ga0495670_0189817_41_694 | 217 |
| 821 | 3300046692 | Ga0495671_0000066 | Ga0495671_0000066_54015_54668 | 217 |
| 822 | 3300046692 | Ga0495671_0000160 | Ga0495671_0000160_50723_51376 | 217 |
| 823 | 3300046692 | Ga0495671_0005604 | Ga0495671_0005604_6612_7265 | 217 |
| 824 | 3300046692 | Ga0495671_0019876 | Ga0495671_0019876_2520_3173 | 217 |
| 825 | 3300046692 | Ga0495671_0033611 | Ga0495671_0033611_365_1018 | 217 |
| 826 | 3300046692 | Ga0495671_0094409 | Ga0495671_0094409_160_813 | 217 |
| 827 | 3300046692 | Ga0495671_0094867 | Ga0495671_0094867_408_1061 | 217 |
| 828 | 3300046692 | Ga0495671_0121270 | Ga0495671_0121270_41_694 | 217 |
| 829 | 3300046692 | Ga0495671_0135752 | Ga0495671_0135752_436_1089 | 217 |
| 830 | 3300046692 | Ga0495671_0252794 | Ga0495671_0252794_120_773 | 217 |
| 831 | 3300046694 | Ga0495649_0000013 | Ga0495649_0000013_14222_14875 | 217 |
| 832 | 3300046694 | Ga0495649_0000814 | Ga0495649_0000814_17454_18107 | 217 |
| 833 | 3300046694 | Ga0495649_0001154 | Ga0495649_0001154_4814_5467 | 217 |
| 834 | 3300046694 | Ga0495649_0005808 | Ga0495649_0005808_4884_5537 | 217 |
| 835 | 3300046694 | Ga0495649_0006677 | Ga0495649_0006677_4583_5236 | 217 |
| 836 | 3300046694 | Ga0495649_0016472 | Ga0495649_0016472_579_1232 | 217 |
| 837 | 3300046694 | Ga0495649_0043216 | Ga0495649_0043216_851_1504 | 217 |
| 838 | 3300046694 | Ga0495649_0095279 | Ga0495649_0095279_511_1164 | 217 |
| 839 | 3300046694 | Ga0495649_0164511 | Ga0495649_0164511_32_685 | 217 |
| 840 | 3300046794 | Ga0495589_0000123 | Ga0495589_0000123_56316_56969 | 217 |
| 841 | 3300046794 | Ga0495589_0001395 | Ga0495589_0001395_12628_13281 | 217 |
| 842 | 3300046794 | Ga0495589_0003200 | Ga0495589_0003200_1813_2466 | 217 |
| 843 | 3300046794 | Ga0495589_0005346 | Ga0495589_0005346_1558_2211 | 217 |
| 844 | 3300046794 | Ga0495589_0006827 | Ga0495589_0006827_5190_5843 | 217 |
| 845 | 3300046794 | Ga0495589_0033379 | Ga0495589_0033379_191_844 | 217 |
| 846 | 3300046794 | Ga0495589_0041175 | Ga0495589_0041175_1250_2044 | 217 |
| 847 | 3300046794 | Ga0495589_0054318 | Ga0495589_0054318_841_1494 | 217 |
| 848 | 3300046794 | Ga0495589_0133423 | Ga0495589_0133423_249_902 | 217 |
| 849 | 3300046809 | Ga0495600_0025520 | Ga0495600_0025520_1905_2558 | 217 |
| 850 | 3300046810 | Ga0495660_0001517 | Ga0495660_0001517_14965_15618 | 217 |
| 851 | 3300046810 | Ga0495660_0001634 | Ga0495660_0001634_5386_6039 | 217 |
| 852 | 3300046810 | Ga0495660_0002240 | Ga0495660_0002240_10663_11316 | 217 |
| 853 | 3300046810 | Ga0495660_0013001 | Ga0495660_0013001_1475_2128 | 217 |
| 854 | 3300046810 | Ga0495660_0019231 | Ga0495660_0019231_25_678 | 217 |
| 855 | 3300046810 | Ga0495660_0020036 | Ga0495660_0020036_670_1323 | 217 |
| 856 | 3300046810 | Ga0495660_0023755 | Ga0495660_0023755_1451_2104 | 217 |
| 857 | 3300046810 | Ga0495660_0030094 | Ga0495660_0030094_1242_1895 | 217 |
| 858 | 3300046810 | Ga0495660_0030283 | Ga0495660_0030283_1027_1680 | 217 |
| 859 | 3300046810 | Ga0495660_0042483 | Ga0495660_0042483_1316_1969 | 217 |
| 860 | 3300046810 | Ga0495660_0065169 | Ga0495660_0065169_1275_1928 | 217 |
| 861 | 3300046810 | Ga0495660_0081658 | Ga0495660_0081658_216_869 | 217 |
| 862 | 3300046810 | Ga0495660_0128573 | Ga0495660_0128573_298_951 | 217 |
| 863 | 3300047317 | Ga0495604_0001925 | Ga0495604_0001925_14973_15626 | 217 |
| 864 | 3300047318 | Ga0495636_0007111 | Ga0495636_0007111_376_1029 | 217 |
| 865 | 3300047318 | Ga0495636_0066107 | Ga0495636_0066107_342_995 | 217 |
| 866 | 3300047319 | Ga0495674_0005938 | Ga0495674_0005938_1565_2218 | 217 |
| 867 | 3300047320 | Ga0495672_0000442 | Ga0495672_0000442_20016_20669 | 217 |
| 868 | 3300047320 | Ga0495672_0000773 | Ga0495672_0000773_28118_28771 | 217 |
| 869 | 3300047320 | Ga0495672_0000891 | Ga0495672_0000891_22373_23026 | 217 |
| 870 | 3300047320 | Ga0495672_0001663 | Ga0495672_0001663_8240_8893 | 217 |
| 871 | 3300047320 | Ga0495672_0001947 | Ga0495672_0001947_12017_12670 | 217 |
| 872 | 3300047320 | Ga0495672_0006676 | Ga0495672_0006676_3932_4585 | 217 |
| 873 | 3300047320 | Ga0495672_0010062 | Ga0495672_0010062_2096_2749 | 217 |
| 874 | 3300047320 | Ga0495672_0045791 | Ga0495672_0045791_1684_2337 | 217 |
| 875 | 3300047320 | Ga0495672_0101971 | Ga0495672_0101971_500_1153 | 217 |
| 876 | 3300047322 | Ga0495680_0053758 | Ga0495680_0053758_2172_2825 | 217 |
| 877 | 3300047322 | Ga0495680_0434782 | Ga0495680_0434782_138_791 | 217 |
| 878 | 3300047323 | Ga0495683_0000010 | Ga0495683_0000010_120789_121442 | 217 |
| 879 | 3300047323 | Ga0495683_0000337 | Ga0495683_0000337_25152_25805 | 217 |
| 880 | 3300047323 | Ga0495683_0002492 | Ga0495683_0002492_2973_3626 | 217 |
| 881 | 3300047323 | Ga0495683_0006146 | Ga0495683_0006146_5635_6288 | 217 |
| 882 | 3300047323 | Ga0495683_0011122 | Ga0495683_0011122_3939_4733 | 217 |
| 883 | 3300047323 | Ga0495683_0011848 | Ga0495683_0011848_3349_4002 | 217 |
| 884 | 3300047323 | Ga0495683_0014403 | Ga0495683_0014403_2967_3620 | 217 |
| 885 | 3300047323 | Ga0495683_0018156 | Ga0495683_0018156_1741_2394 | 217 |
| 886 | 3300047323 | Ga0495683_0020399 | Ga0495683_0020399_627_1280 | 217 |
| 887 | 3300047323 | Ga0495683_0038365 | Ga0495683_0038365_1089_1742 | 217 |
| 888 | 3300047443 | Ga0495687_003205 | Ga0495687_003205_4484_5137 | 217 |
| 889 | 3300047443 | Ga0495687_004845 | Ga0495687_004845_2963_3616 | 217 |
| 890 | 3300047443 | Ga0495687_007840 | Ga0495687_007840_2609_3262 | 217 |
| 891 | 3300047445 | Ga0495677_0000471 | Ga0495677_0000471_370_1023 | 217 |
| 892 | 3300047446 | Ga0495679_001961 | Ga0495679_001961_7804_8457 | 217 |
| 893 | 3300047446 | Ga0495679_009228 | Ga0495679_009228_3255_3908 | 217 |
| 894 | 3300047446 | Ga0495679_012799 | Ga0495679_012799_346_999 | 217 |
| 895 | 3300047447 | Ga0495685_012690 | Ga0495685_012690_708_1361 | 217 |
| 896 | 3300047469 | Ga0495673_0000434 | Ga0495673_0000434_35433_36086 | 217 |
| 897 | 3300047469 | Ga0495673_0000553 | Ga0495673_0000553_27652_28305 | 217 |
| 898 | 3300047469 | Ga0495673_0001485 | Ga0495673_0001485_8725_9378 | 217 |
| 899 | 3300047469 | Ga0495673_0002017 | Ga0495673_0002017_4674_5327 | 217 |
| 900 | 3300047469 | Ga0495673_0002389 | Ga0495673_0002389_6142_6795 | 217 |
| 901 | 3300047469 | Ga0495673_0005784 | Ga0495673_0005784_5316_5969 | 217 |
| 902 | 3300047469 | Ga0495673_0046284 | Ga0495673_0046284_980_1633 | 217 |
| 903 | 3300047470 | Ga0495681_0000259 | Ga0495681_0000259_40544_41197 | 217 |
| 904 | 3300047470 | Ga0495681_0000262 | Ga0495681_0000262_23955_24749 | 217 |
| 905 | 3300047470 | Ga0495681_0000419 | Ga0495681_0000419_29234_29887 | 217 |
| 906 | 3300047470 | Ga0495681_0000703 | Ga0495681_0000703_7747_8400 | 217 |
| 907 | 3300047470 | Ga0495681_0009052 | Ga0495681_0009052_88_741 | 217 |
| 908 | 3300047470 | Ga0495681_0010676 | Ga0495681_0010676_3919_4572 | 217 |
| 909 | 3300047470 | Ga0495681_0024186 | Ga0495681_0024186_794_1447 | 217 |
| 910 | 3300047470 | Ga0495681_0031963 | Ga0495681_0031963_231_884 | 217 |
| 911 | 3300047470 | Ga0495681_0039958 | Ga0495681_0039958_912_1565 | 217 |
| 912 | 3300047470 | Ga0495681_0183092 | Ga0495681_0183092_87_740 | 217 |
| 913 | 3300047471 | Ga0495684_0035906 | Ga0495684_0035906_330_983 | 217 |
| 914 | 3300047472 | Ga0495686_0008941 | Ga0495686_0008941_4469_5122 | 217 |
| 915 | 3300047472 | Ga0495686_0041603 | Ga0495686_0041603_972_1766 | 217 |
| 916 | 3300047472 | Ga0495686_0138116 | Ga0495686_0138116_42_695 | 217 |
| 917 | 3300047472 | Ga0495686_0144097 | Ga0495686_0144097_448_1101 | 217 |
| 918 | 3300047472 | Ga0495686_0150522 | Ga0495686_0150522_264_917 | 217 |
| 919 | 3300047673 | Ga0495593_0000018 | Ga0495593_0000018_42954_43607 | 217 |
| 920 | 3300047673 | Ga0495593_0000777 | Ga0495593_0000777_4906_5559 | 217 |
| 921 | 3300048090 | Ga0495615_0048847 | Ga0495615_0048847_359_1012 | 217 |
| 922 | 3300048091 | Ga0495626_0000031 | Ga0495626_0000031_116631_117284 | 217 |
| 923 | 3300048091 | Ga0495626_0000079 | Ga0495626_0000079_14229_14882 | 217 |
| 924 | 3300048091 | Ga0495626_0000242 | Ga0495626_0000242_54572_55366 | 217 |
| 925 | 3300048091 | Ga0495626_0000329 | Ga0495626_0000329_31657_32310 | 217 |
| 926 | 3300048091 | Ga0495626_0000759 | Ga0495626_0000759_9258_9911 | 217 |
| 927 | 3300048091 | Ga0495626_0001357 | Ga0495626_0001357_5514_6167 | 217 |
| 928 | 3300048091 | Ga0495626_0005157 | Ga0495626_0005157_449_1102 | 217 |
| 929 | 3300048091 | Ga0495626_0013146 | Ga0495626_0013146_2098_2751 | 217 |
| 930 | 3300048091 | Ga0495626_0014268 | Ga0495626_0014268_3360_4013 | 217 |
| 931 | 3300048905 | Ga0496102_0235272 | Ga0496102_0235272_579_1232 | 217 |
| 932 | 3300048905 | Ga0496102_0380623 | Ga0496102_0380623_530_1309 | 217 |
| 933 | 3300048909 | Ga0496106_0189660 | Ga0496106_0189660_204_857 | 217 |
| 934 | 3300048910 | Ga0496107_0177192 | Ga0496107_0177192_95_748 | 217 |
| 935 | 3300048913 | Ga0496110_0078555 | Ga0496110_0078555_2110_2763 | 217 |
| 936 | 3300048913 | Ga0496110_0099864 | Ga0496110_0099864_1463_2116 | 217 |
| 937 | 3300048913 | Ga0496110_0666980 | Ga0496110_0666980_144_923 | 217 |
| 938 | 3300048914 | Ga0496111_0188066 | Ga0496111_0188066_480_1133 | 217 |
| 939 | 3300048915 | Ga0496112_0014420 | Ga0496112_0014420_208_861 | 217 |
| 940 | 3300048916 | Ga0496113_0413008 | Ga0496113_0413008_410_1063 | 217 |
| 941 | 3300048919 | Ga0496116_0001237 | Ga0496116_0001237_10362_11015 | 217 |
| 942 | 3300048919 | Ga0496116_0002307 | Ga0496116_0002307_3566_4219 | 217 |
| 943 | 3300048920 | Ga0496117_0129555 | Ga0496117_0129555_449_1102 | 217 |
| 944 | 3300048921 | Ga0496118_0195987 | Ga0496118_0195987_91_840 | 217 |
| 945 | 3300048924 | Ga0496121_0095310 | Ga0496121_0095310_1598_2251 | 217 |
| 946 | 3300048925 | Ga0496122_0002525 | Ga0496122_0002525_13817_14470 | 217 |
| 947 | 3300048927 | Ga0496124_0002900 | Ga0496124_0002900_12761_13414 | 217 |
| 948 | 3300048927 | Ga0496124_0010024 | Ga0496124_0010024_1988_2767 | 217 |
| 949 | 3300048927 | Ga0496124_0043609 | Ga0496124_0043609_1867_2520 | 217 |
| 950 | 3300048927 | Ga0496124_0093915 | Ga0496124_0093915_828_1481 | 217 |
| 951 | 3300048928 | Ga0496125_0004944 | Ga0496125_0004944_14250_14903 | 217 |
| 952 | 3300048928 | Ga0496125_0018626 | Ga0496125_0018626_3428_4081 | 217 |
| 953 | 3300049459 | Ga0495678_000701 | Ga0495678_000701_20554_21207 | 217 |
| 954 | 3300049459 | Ga0495678_001245 | Ga0495678_001245_5481_6134 | 217 |
| 955 | 3300049459 | Ga0495678_005843 | Ga0495678_005843_4341_4994 | 217 |
| 956 | 3300049459 | Ga0495678_009163 | Ga0495678_009163_3356_4009 | 217 |
| 957 | 3300049459 | Ga0495678_022535 | Ga0495678_022535_933_1727 | 217 |
| 958 | 3300049459 | Ga0495678_024222 | Ga0495678_024222_1073_1726 | 217 |
| 959 | 3300049459 | Ga0495678_080520 | Ga0495678_080520_409_1062 | 217 |
| 960 | 3300049459 | Ga0495678_114602 | Ga0495678_114602_202_855 | 217 |
| 961 | 3300049460 | Ga0495682_0001309 | Ga0495682_0001309_4586_5239 | 217 |
| 962 | 3300049460 | Ga0495682_0003820 | Ga0495682_0003820_5487_6140 | 217 |
| 963 | 3300049460 | Ga0495682_0011988 | Ga0495682_0011988_2408_3061 | 217 |
| 964 | 3300050491 | nmdc:mga00v17_209825_c1 | nmdc:mga00v17_209825_c1_52_705 | 217 |
| 965 | 3300050491 | nmdc:mga00v17_58430_c1 | nmdc:mga00v17_58430_c1_68_721 | 217 |
| 966 | 3300050514 | nmdc:mga08x19_247988_c1 | nmdc:mga08x19_247988_c1_28_681 | 217 |
| 967 | 3300050514 | nmdc:mga08x19_26165_c1 | nmdc:mga08x19_26165_c1_1329_2108 | 217 |
| 968 | 3300050514 | nmdc:mga08x19_36808_c1 | nmdc:mga08x19_36808_c1_2078_2731 | 217 |
| 969 | 3300050516 | nmdc:mga0sz30_16921_c2 | nmdc:mga0sz30_16921_c2_1247_1900 | 217 |
| 970 | 3300050516 | nmdc:mga0sz30_75741_c1 | nmdc:mga0sz30_75741_c1_672_1325 | 217 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7kuu-assembly1.cif.gz_B | lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form | 0.9534 | 3 | 217 |
| 6p0w-assembly1.cif.gz_A-2 | lsfa from p. aeruginosa, a 1-cys prx in reduced form | 0.9519 | 2 | 217 |
| 7kuu-assembly1.cif.gz_B | lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form | 0.9488 | 3 | 217 |
| 6p0w-assembly1.cif.gz_A-2 | lsfa from p. aeruginosa, a 1-cys prx in reduced form | 0.9473 | 2 | 217 |
| 5ykj-assembly1.cif.gz_A | structural basis of the thiol resolving mechanism in yeast mitochondrial 1-cys peroxiredoxin via glutathione/thioredoxin systems | 0.9384 | 2 | 214 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P34227_199_260_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9833 | 153 | 214 | 3.30.1020.10 |
| af_Q54SE2_176_239_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9687 | 153 | 216 | 3.30.1020.10 |
| af_A0A0R0K508_6_109_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9628 | 5 | 106 | 3.40.30.10 |
| af_O08709_156_224_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9606 | 153 | 216 | 3.30.1020.10 |
| af_Q54SE2_176_239_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9543 | 153 | 216 | 3.30.1020.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2S068-F1-model_v4 | Peroxidase | 0.9908 | 1 | 106 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A659YRX5-F1-model_v4 | deleted | 0.9898 | 1 | 103 |
|
| AF-A0A2V5ZNJ6-F1-model_v4 | Peroxidase | 0.9804 | 3 | 94 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A7K0JSX1-F1-model_v4 | deleted | 0.9789 | 1 | 216 |
|
| AF-A0A2E5EKQ1-F1-model_v4 | Peroxidase | 0.9786 | 1 | 216 |
GO:0005829
GO:0045454 GO:0051920 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar