F487100

General Info

Members Datasets Scaffolds Average Seq Length
970 413 921 217

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0020265|Ga0495638_0020265_491_1285
Length 264
Sequence LRWAADRSAIVSYTESRQQQGTHFQCRRKRSPALRQRPLTITARRSNMAIRIGDEAPDFTAQTTEGTLNFHQWIGDGWAILFSHPKDFTPVCTTELGYLAKLKPEFDKRNTKILGLSIDPVSDHEKWVGDIEETQGNAVNYPLIGDENLVVAKLYDMIHPNASGGTRTAVDNATVRSVFLVGPDKKIKAMLIYPMSAGRNFDEVLRLLDSLQLNAKHTVATPVNWRPGEDVIIPTSVSDEDAKKKYPDGFKTLKPYLRTVAQPK

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231006 Pseudomonas sp. GM17 Isolate Nodule
5 2511231007 Pseudomonas sp. GM18 Isolate Nodule
6 2511231008 Pseudomonas sp. GM21 Isolate Nodule
7 2511231012 Pseudomonas sp. GM33 Isolate Nodule
8 2511231014 Pseudomonas sp. GM48 Isolate Nodule
9 2511231015 Pseudomonas sp. GM49 Isolate Nodule
10 2511231016 Pseudomonas sp. GM50 Isolate Nodule
11 2511231017 Pseudomonas sp. GM55 Isolate Nodule
12 2511231020 Pseudomonas sp. GM74 Isolate Nodule
13 2511231021 Pseudomonas sp. GM78 Isolate Nodule
14 2511231022 Pseudomonas sp. GM79 Isolate Nodule
15 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
16 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
17 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
18 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
19 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
20 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
21 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
22 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
23 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
24 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
25 2643221584 Caulobacter sp. Root656 Isolate Unclassified
26 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
27 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
28 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
29 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
30 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
31 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
32 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
33 2773857670 Pseudomonas sp. 478 Isolate Unclassified
34 2784132072 Pseudomonas sp. 460 Isolate Unclassified
35 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
36 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
37 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
38 2818991435 Caulobacter henricii 536 Isolate Unclassified
39 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
40 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
41 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
42 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
43 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
44 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
45 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
46 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
47 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
48 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
49 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
50 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
51 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
52 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
53 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
54 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
55 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
56 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
57 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
58 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
59 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
60 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
62 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
63 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
64 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
65 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
66 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
67 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
68 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
69 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
70 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
71 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
72 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
73 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
74 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
75 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
76 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
77 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
78 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
79 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
80 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
81 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
82 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
83 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
84 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
85 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
86 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
87 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
88 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
89 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
92 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
93 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
94 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
95 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
96 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
97 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
98 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
99 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
100 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
101 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
102 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
103 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
104 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
109 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
110 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
111 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
112 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
113 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
115 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
116 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
117 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
118 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
119 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
121 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
128 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
129 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
130 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
133 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
136 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
139 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
144 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
149 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
150 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
151 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
152 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
153 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
158 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
159 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
188 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
189 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
193 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
194 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
205 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
210 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
211 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
212 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
215 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
216 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
217 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
218 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
219 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
220 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
221 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
222 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
223 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
224 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
225 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
226 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
227 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
228 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
229 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
230 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
231 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
232 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
233 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
234 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
235 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
236 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
237 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
238 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
239 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
240 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
241 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
242 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
243 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
244 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
245 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
246 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
247 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
248 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
249 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
250 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
251 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
252 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
253 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
254 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
255 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
256 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
257 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
258 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
259 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
260 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
261 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
262 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
263 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
264 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
265 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
266 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
267 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
268 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
269 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
270 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
271 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
272 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
273 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
274 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
275 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
276 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
277 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
278 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
279 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
280 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
281 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
282 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
283 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
284 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
285 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
286 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
287 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
288 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
289 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
290 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
291 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
292 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
293 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
294 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
295 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
296 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
297 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
298 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
299 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
300 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
301 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
302 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
303 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
304 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
305 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
306 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
307 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
308 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
309 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
310 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
311 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
312 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
313 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
314 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
315 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
316 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
317 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
318 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
319 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
320 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
321 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
322 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
323 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
324 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
325 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
326 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
327 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
328 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
329 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
330 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
331 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
332 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
333 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
334 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
335 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
336 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
337 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
338 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
339 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
340 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
341 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
342 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
343 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
344 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
345 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
346 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
347 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
348 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
349 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
350 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
351 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
352 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
353 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
367 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
368 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
369 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
370 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
371 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
372 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
373 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
374 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
375 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
376 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
377 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
378 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
379 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
382 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
383 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
384 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
385 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
386 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
387 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
388 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
389 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
390 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
391 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
392 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
393 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
394 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
395 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
396 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
397 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
398 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
399 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
400 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
401 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
402 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
403 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
404 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
405 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
406 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
409 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
410 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
411 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
412 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
413 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.2
Metatranscriptomes 1.75
Isolates 5.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.22
Nodule 1.55
Rhizoplane 1.75
Rhizosphere 85.77
Stem 0
Stem Tuber 0
Unclassified 3.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_16 2124908027 Bacteria 42770
2 MRS2a_Contig_7135 2124908027 Bacteria 4188
3 MRS2a_Contig_9103 2124908027 Bacteria 4155
4 SwRhRL2b_contig_1791376 2162886007 Bacteria 3602
5 SwRhRL2b_contig_275942 2162886007 Bacteria 816
6 JGI25162J39368_1000045 3300002737 Bacteria 170731
7 JGI25163J39215_1000297 3300002771 Bacteria 16793
8 JGI25164J39214_1000147 3300002772 Bacteria 67564
9 JGI25151J46595_10000065 3300003187 Bacteria 145136
10 JGI25151J46595_10056448 3300003187 Bacteria 1287
11 JGI25165J46597_1000086 3300003214 Bacteria 170731
12 Ga0006562J51391_1007874 3300003578 Bacteria 1416
13 Ga0055537_1000409 3300003773 Bacteria 28111
14 Ga0055524_1021663 3300003775 Bacteria 2122
15 Ga0055536_1000028 3300003781 Bacteria 162550
16 Ga0055534_1000189 3300003784 Bacteria 45268
17 Ga0055530_10000030 3300003791 Bacteria 125301
18 Ga0055530_10014884 3300003791 Bacteria 2568
19 Ga0055540_1000262 3300003792 Bacteria 47599
20 Ga0058863_10027487 3300004799 Bacteria 1250
21 Ga0065714_10000003 3300005288 Bacteria 32061
22 Ga0065714_10004301 3300005288 Bacteria 6888
23 Ga0065714_10004791 3300005288 Bacteria 4459
24 Ga0065714_10005115 3300005288 Bacteria 9819
25 Ga0065714_10005580 3300005288 Bacteria 12212
26 Ga0065714_10066220 3300005288 Bacteria 7333
27 Ga0065714_10084673 3300005288 Bacteria 2153
28 Ga0065714_10105443 3300005288 Bacteria 1566
29 Ga0065714_10120013 3300005288 Bacteria 1342
30 Ga0065704_10079095 3300005289 Bacteria 4258
31 Ga0065704_10112878 3300005289 Bacteria 1914
32 Ga0065704_10146359 3300005289 Bacteria 1468
33 Ga0065712_10002579 3300005290 Bacteria 5346
34 Ga0065715_10101780 3300005293 Bacteria 3102
35 Ga0065707_10128004 3300005295 Bacteria 1973
36 Ga0070666_10027722 3300005335 Bacteria 3712
37 Ga0070661_100127962 3300005344 Bacteria 1906
38 Ga0070661_100181536 3300005344 Bacteria 1601
39 Ga0070668_100117988 3300005347 Bacteria 2118
40 Ga0070675_100857004 3300005354 Bacteria 832
41 Ga0070674_100116330 3300005356 Bacteria 1973
42 Ga0070674_100476319 3300005356 Bacteria 1035
43 Ga0070674_100969041 3300005356 Bacteria 745
44 Ga0070673_100306202 3300005364 Bacteria 1400
45 Ga0070713_100419852 3300005436 Bacteria 1252
46 Ga0070705_100004662 3300005440 Bacteria 6675
47 Ga0070705_100493441 3300005440 Bacteria 928
48 Ga0070694_100014594 3300005444 Bacteria 4919
49 Ga0070708_100036681 3300005445 Bacteria 4277
50 Ga0070708_100499237 3300005445 Bacteria 1148
51 Ga0070678_100039595 3300005456 Bacteria 3327
52 Ga0070678_100796008 3300005456 Bacteria 858
53 Ga0070681_10084016 3300005458 Bacteria 3136
54 Ga0070681_10502913 3300005458 Bacteria 1125
55 Ga0070706_100009094 3300005467 Bacteria 9252
56 Ga0070706_100016861 3300005467 Bacteria 6746
57 Ga0070706_100083731 3300005467 Bacteria 2955
58 Ga0070707_100650196 3300005468 Bacteria 1017
59 Ga0070698_100001874 3300005471 Bacteria 23434
60 Ga0070698_100050404 3300005471 Bacteria 4245
61 Ga0070699_100000814 3300005518 Bacteria 28861
62 Ga0070699_100002404 3300005518 Bacteria 16798
63 Ga0070699_100059013 3300005518 Bacteria 3325
64 Ga0070699_100099564 3300005518 Bacteria 2547
65 Ga0070699_100103653 3300005518 Bacteria 2495
66 Ga0070679_100137439 3300005530 Bacteria 2425
67 Ga0070679_100329000 3300005530 Bacteria 1477
68 Ga0070679_100750491 3300005530 Bacteria 919
69 Ga0068853_100008756 3300005539 Bacteria 8139
70 Ga0068853_100050648 3300005539 Bacteria 3573
71 Ga0070672_100123927 3300005543 Bacteria 2118
72 Ga0070672_100249747 3300005543 Bacteria 1494
73 Ga0070695_100114785 3300005545 Bacteria 1834
74 Ga0070696_100001106 3300005546 Bacteria 17448
75 Ga0070696_100080896 3300005546 Bacteria 2301
76 Ga0070696_100206054 3300005546 Bacteria 1470
77 Ga0070665_100053117 3300005548 Bacteria 4064
78 Ga0070665_100644904 3300005548 Bacteria 1072
79 Ga0070704_100159504 3300005549 Bacteria 1782
80 Ga0068855_100067729 3300005563 Bacteria 4158
81 Ga0068855_100192437 3300005563 Bacteria 2300
82 Ga0068856_100004119 3300005614 Bacteria 14533
83 Ga0068852_100316995 3300005616 Bacteria 1513
84 Ga0068852_101030868 3300005616 Bacteria 842
85 Ga0068859_100159859 3300005617 Bacteria 2332
86 Ga0068860_100135331 3300005843 Bacteria 2366
87 Ga0068862_100666199 3300005844 Bacteria 1005
88 Ga0081455_10183998 3300005937 Bacteria 1579
89 Ga0081455_10197492 3300005937 Bacteria 1509
90 Ga0081455_10230493 3300005937 Bacteria 1367
91 Ga0075365_10191220 3300006038 Bacteria 1432
92 Ga0075368_10027474 3300006042 Bacteria 2196
93 Ga0075368_10047722 3300006042 Bacteria 1695
94 Ga0075363_100076711 3300006048 Bacteria 1823
95 Ga0075364_10010255 3300006051 Bacteria 5653
96 Ga0075364_10015174 3300006051 Bacteria 4771
97 Ga0075364_10026491 3300006051 Bacteria 3699
98 Ga0075364_10032030 3300006051 Bacteria 3377
99 Ga0075432_10003245 3300006058 Bacteria 5488
100 Ga0075432_10003498 3300006058 Bacteria 5318
101 Ga0075432_10177981 3300006058 Bacteria 831
102 Ga0075362_10176928 3300006177 Bacteria 1033
103 Ga0075367_10006727 3300006178 Bacteria 5834
104 Ga0075369_10056579 3300006186 Bacteria 1705
105 Ga0075369_10256479 3300006186 Bacteria 813
106 Ga0075370_10019361 3300006353 Bacteria 3707
107 Ga0075370_10057075 3300006353 Bacteria 2219
108 Ga0075370_10127917 3300006353 Bacteria 1481
109 Ga0068871_100259576 3300006358 Bacteria 1515
110 Ga0068871_100446309 3300006358 Bacteria 1159
111 Ga0075428_100047960 3300006844 Bacteria 4690
112 Ga0075428_100080257 3300006844 Bacteria 3560
113 Ga0075428_100261448 3300006844 Bacteria 1863
114 Ga0075430_100267414 3300006846 Bacteria 1416
115 Ga0075431_100004080 3300006847 Bacteria 14244
116 Ga0075431_100159825 3300006847 Bacteria 2317
117 Ga0075431_100368703 3300006847 Bacteria 1441
118 Ga0075433_10519587 3300006852 Bacteria 1047
119 Ga0075434_100006602 3300006871 Bacteria 10647
120 Ga0075429_100093930 3300006880 Bacteria 2616
121 Ga0075436_100008107 3300006914 Bacteria 7191
122 Ga0075436_100024079 3300006914 Bacteria 4185
123 Ga0075436_100028764 3300006914 Bacteria 3823
124 Ga0075436_100048957 3300006914 Bacteria 2916
125 Ga0075436_100077100 3300006914 Bacteria 2309
126 Ga0097620_100159866 3300006931 Bacteria 2332
127 Ga0097620_100892470 3300006931 Bacteria 974
128 Ga0079104_1000142 3300006946 Bacteria 101403
129 Ga0075435_100708387 3300007076 Bacteria 875
130 Ga0105251_10004626 3300009011 Bacteria 9277
131 Ga0105244_10002532 3300009036 Bacteria 13729
132 Ga0105244_10063319 3300009036 Bacteria 1857
133 Ga0105240_10258621 3300009093 Bacteria 2009
134 Ga0111539_10408583 3300009094 Bacteria 1581
135 Ga0111539_10831499 3300009094 Bacteria 1074
136 Ga0105245_10022120 3300009098 Bacteria 5583
137 Ga0114129_10009271 3300009147 Bacteria 14036
138 Ga0114129_10261499 3300009147 Bacteria 2319
139 Ga0105243_10069412 3300009148 Bacteria 2843
140 Ga0105237_10139362 3300009545 Bacteria 2420
141 Ga0105249_10142451 3300009553 Bacteria 2300
142 Ga0105239_10387528 3300010375 Bacteria 1580
143 Ga0105239_10877916 3300010375 Bacteria 1029
144 Ga0105246_10045067 3300011119 Bacteria 3001
145 Ga0157373_10002776 3300013100 Bacteria 13252
146 Ga0157373_10360227 3300013100 Bacteria 1038
147 Ga0157370_10004153 3300013104 Bacteria 16762
148 Ga0157370_10042606 3300013104 Bacteria 4373
149 Ga0157370_10154518 3300013104 Bacteria 2135
150 Ga0157370_10321525 3300013104 Bacteria 1427
151 Ga0157369_10047541 3300013105 Bacteria 4657
152 Ga0157369_10086985 3300013105 Bacteria 3337
153 Ga0157369_10120305 3300013105 Bacteria 2787
154 Ga0157374_10030634 3300013296 Bacteria 4887
155 Ga0157374_10127693 3300013296 Bacteria 2458
156 Ga0157374_10301093 3300013296 Bacteria 1586
157 Ga0163162_11130794 3300013306 Bacteria 888
158 Ga0157372_10029964 3300013307 Bacteria 5947
159 Ga0157372_10628220 3300013307 Bacteria 1251
160 Ga0157375_10826208 3300013308 Bacteria 1074
161 Ga0163163_10309828 3300014325 Bacteria 1631
162 Ga0163163_11162738 3300014325 Bacteria 834
163 Ga0157380_10327161 3300014326 Bacteria 1424
164 Ga0157380_10673742 3300014326 Bacteria 1035
165 Ga0157380_10750972 3300014326 Bacteria 987
166 Ga0182008_10005589 3300014497 Bacteria 7130
167 Ga0182008_10007190 3300014497 Bacteria 6161
168 Ga0182008_10011159 3300014497 Bacteria 4791
169 Ga0182008_10023599 3300014497 Bacteria 3140
170 Ga0182008_10036263 3300014497 Bacteria 2468
171 Ga0157376_10034639 3300014969 Bacteria 4079
172 Ga0157376_10258665 3300014969 Bacteria 1630
173 Ga0157376_10324382 3300014969 Bacteria 1465
174 Ga0182006_1000083 3300015261 Bacteria 118727
175 Ga0182005_1001254 3300015265 Bacteria 10436
176 Ga0182005_1006914 3300015265 Bacteria 3433
177 Ga0182005_1023824 3300015265 Bacteria 1672
178 Ga0182005_1067993 3300015265 Bacteria 977
179 Ga0163161_10002966 3300017792 Bacteria 12023
180 Ga0163161_10039468 3300017792 Bacteria 3389
181 Ga0163161_10098276 3300017792 Bacteria 2175
182 Ga0197907_10262403 3300020069 Bacteria 829
183 Ga0197907_10324341 3300020069 Bacteria 733
184 Ga0197907_10358230 3300020069 Bacteria 1235
185 Ga0206356_11534046 3300020070 Bacteria 666
186 Ga0206355_1011593 3300020076 Bacteria 899
187 Ga0206355_1314941 3300020076 Bacteria 769
188 Ga0206355_1571517 3300020076 Bacteria 1065
189 Ga0206351_10232290 3300020077 Bacteria 764
190 Ga0206351_10699157 3300020077 Bacteria 825
191 Ga0206354_10217960 3300020081 Bacteria 872
192 Ga0206353_11403311 3300020082 Bacteria 786
193 Ga0224712_10104057 3300022467 Bacteria 1208
194 Ga0224712_10272325 3300022467 Bacteria 786
195 Ga0209760_100019 3300025207 Bacteria 170806
196 Ga0207427_100011 3300025231 Bacteria 640076
197 Ga0209437_100044 3300025233 Bacteria 430619
198 Ga0209759_1001894 3300025256 Bacteria 10298
199 Ga0209233_1000057 3300025261 Bacteria 430619
200 Ga0209565_1000109 3300025263 Bacteria 120345
201 Ga0209673_1034456 3300025273 Bacteria 1529
202 Ga0209675_1000118 3300025291 Bacteria 110507
203 Ga0209676_1000062 3300025292 Bacteria 332319
204 Ga0209025_1000159 3300025294 Bacteria 167081
205 Ga0209025_1002020 3300025294 Bacteria 23152
206 Ga0209025_1048697 3300025294 Bacteria 1715
207 Ga0209758_1010371 3300025297 Bacteria 5588
208 Ga0209050_1000150 3300025298 Bacteria 162946
209 Ga0209050_1000684 3300025298 Bacteria 50962
210 Ga0209256_1001890 3300025299 Bacteria 19210
211 Ga0209256_1014655 3300025299 Bacteria 2800
212 Ga0209051_1000162 3300025303 Bacteria 125696
213 Ga0209051_1004106 3300025303 Bacteria 9141
214 Ga0209051_1029433 3300025303 Bacteria 2150
215 Ga0207696_1021703 3300025711 Bacteria 2053
216 Ga0207655_1000481 3300025728 Bacteria 51474
217 Ga0207655_1007663 3300025728 Bacteria 6968
218 Ga0207655_1049284 3300025728 Bacteria 1721
219 Ga0207655_1057603 3300025728 Bacteria 1525
220 Ga0207713_1005276 3300025735 Bacteria 8130
221 Ga0207713_1013027 3300025735 Bacteria 4411
222 Ga0207653_10010636 3300025885 Bacteria 2872
223 Ga0207684_10031488 3300025910 Bacteria 4512
224 Ga0207707_10002069 3300025912 Bacteria 18184
225 Ga0207663_10823405 3300025916 Bacteria 740
226 Ga0207660_10077534 3300025917 Bacteria 2433
227 Ga0207657_10167548 3300025919 Bacteria 1781
228 Ga0207652_10171900 3300025921 Bacteria 1945
229 Ga0207646_10467462 3300025922 Bacteria 1137
230 Ga0207650_10333309 3300025925 Bacteria 1245
231 Ga0207659_10315634 3300025926 Bacteria 1288
232 Ga0207669_10099785 3300025937 Bacteria 1916
233 Ga0207691_10222981 3300025940 Bacteria 1634
234 Ga0207691_10629764 3300025940 Bacteria 907
235 Ga0207689_10491043 3300025942 Bacteria 1028
236 Ga0207679_10026985 3300025945 Bacteria 3966
237 Ga0207667_10045365 3300025949 Bacteria 4656
238 Ga0207651_10289560 3300025960 Bacteria 1357
239 Ga0207712_10094815 3300025961 Bacteria 2205
240 Ga0207668_10097056 3300025972 Bacteria 2180
241 Ga0207639_10088761 3300026041 Bacteria 2468
242 Ga0207639_10632024 3300026041 Bacteria 989
243 Ga0207708_10641113 3300026075 Bacteria 903
244 Ga0207675_100692499 3300026118 Bacteria 1027
245 Ga0207683_10014559 3300026121 Bacteria 6699
246 Ga0207683_10448633 3300026121 Bacteria 1189
247 Ga0209281_1000262 3300027111 Bacteria 101417
248 Ga0209813_10034384 3300027866 Bacteria 1513
249 Ga0207428_10047709 3300027907 Bacteria 3438
250 Ga0207428_10085522 3300027907 Bacteria 2456
251 Ga0207428_10130436 3300027907 Bacteria 1924
252 Ga0207428_10141121 3300027907 Bacteria 1839
253 Ga0207428_10164918 3300027907 Bacteria 1681
254 Ga0207428_10275962 3300027907 Bacteria 1249
255 Ga0207428_10323448 3300027907 Bacteria 1139
256 Ga0268266_10183856 3300028379 Bacteria 1905
257 Ga0268266_10636712 3300028379 Bacteria 1026
258 Ga0268265_10219441 3300028380 Bacteria 1663
259 Ga0268265_10658413 3300028380 Bacteria 1007
260 Ga0265323_10125744 3300028653 Bacteria 833
261 Ga0265338_10076532 3300028800 Bacteria 2834
262 Ga0265338_10209017 3300028800 Bacteria 1466
263 Ga0265327_10091961 3300031251 Bacteria 1477
264 Ga0307408_100652223 3300031548 Bacteria 941
265 Ga0307405_10373914 3300031731 Bacteria 1107
266 Ga0307413_10056041 3300031824 Bacteria 2402
267 Ga0307413_10347394 3300031824 Bacteria 1143
268 Ga0307410_10014366 3300031852 Bacteria 4657
269 Ga0307410_10066547 3300031852 Bacteria 2483
270 Ga0307406_10014079 3300031901 Bacteria 4597
271 Ga0307407_10025967 3300031903 Bacteria 3096
272 Ga0307407_10045096 3300031903 Bacteria 2489
273 Ga0307407_10461172 3300031903 Bacteria 924
274 Ga0307407_10782680 3300031903 Bacteria 724
275 Ga0307412_10667877 3300031911 Bacteria 888
276 Ga0307409_100009144 3300031995 Bacteria 6071
277 Ga0307409_100235840 3300031995 Bacteria 1662
278 Ga0307409_100293291 3300031995 Bacteria 1509
279 Ga0307416_100101103 3300032002 Bacteria 2510
280 Ga0307416_100194992 3300032002 Bacteria 1915
281 Ga0307414_10257190 3300032004 Bacteria 1455
282 Ga0307411_10029681 3300032005 Bacteria 3343
283 Ga0307411_10276555 3300032005 Bacteria 1334
284 Ga0307411_10280097 3300032005 Bacteria 1327
285 Ga0373927_0283142 3300035695 Bacteria 1091
286 Ga0373947_0059733 3300035725 Bacteria 2312
287 Ga0373925_0118821 3300037068 Bacteria 2050
288 Ga0395899_0192124 3300037312 Bacteria 1428
289 Ga0395899_0309829 3300037312 Bacteria 1066
290 Ga0395900_0358145 3300037418 Bacteria 1431
291 Ga0395898_0565308 3300037466 Bacteria 1080
292 Ga0395905_0186624 3300037471 Bacteria 1946
293 Ga0436365_0924268 3300039437 Bacteria 3116
294 Ga0436360_0011970 3300039438 Bacteria 1059
295 Ga0439436_0000762 3300041404 Bacteria 8712
296 Ga0439438_000379 3300041405 Bacteria 19968
297 Ga0439438_001079 3300041405 Bacteria 12190
298 Ga0439438_001796 3300041405 Bacteria 9418
299 Ga0439438_004736 3300041405 Bacteria 5153
300 Ga0439438_011170 3300041405 Bacteria 2807
301 Ga0439447_000016 3300041407 Bacteria 61120
302 Ga0439447_000054 3300041407 Bacteria 39346
303 Ga0439447_000101 3300041407 Bacteria 29978
304 Ga0439447_000519 3300041407 Bacteria 14291
305 Ga0439447_001146 3300041407 Bacteria 9651
306 Ga0439447_005206 3300041407 Bacteria 4349
307 Ga0439461_0017956 3300041410 Bacteria 1380
308 Ga0439466_0000101 3300041411 Bacteria 33127
309 Ga0439466_0003430 3300041411 Bacteria 6152
310 Ga0439466_0008454 3300041411 Bacteria 3879
311 Ga0439466_0008895 3300041411 Bacteria 3775
312 Ga0439466_0013095 3300041411 Bacteria 3039
313 Ga0439466_0051597 3300041411 Bacteria 1346
314 Ga0439465_0044696 3300041413 Bacteria 1439
315 Ga0451845_0227851 3300041501 Bacteria 973
316 Ga0439433_0068448 3300041999 Bacteria 853
317 Ga0439432_000233 3300042006 Bacteria 20049
318 Ga0439432_008552 3300042006 Bacteria 3592
319 Ga0439432_016390 3300042006 Bacteria 2494
320 Ga0439451_000450 3300042009 Bacteria 8019
321 Ga0439451_006682 3300042009 Bacteria 2357
322 Ga0439451_006802 3300042009 Bacteria 2339
323 Ga0439452_000287 3300042010 Bacteria 32645
324 Ga0439452_000939 3300042010 Bacteria 13100
325 Ga0439452_001970 3300042010 Bacteria 7852
326 Ga0439452_004038 3300042010 Bacteria 4992
327 Ga0439452_006076 3300042010 Bacteria 3815
328 Ga0439456_000745 3300042013 Bacteria 6624
329 Ga0439456_001138 3300042013 Bacteria 5270
330 Ga0439456_001454 3300042013 Bacteria 4767
331 Ga0439456_008929 3300042013 Bacteria 2069
332 Ga0439456_026889 3300042013 Bacteria 1225
333 Ga0439456_058581 3300042013 Bacteria 845
334 Ga0439462_0012322 3300042015 Bacteria 2183
335 Ga0439463_000007 3300042016 Bacteria 44178
336 Ga0439463_004030 3300042016 Bacteria 3694
337 Ga0450911_000781 3300042115 Bacteria 8919
338 Ga0450911_001463 3300042115 Bacteria 5418
339 Ga0450911_002978 3300042115 Bacteria 3118
340 Ga0450919_014287 3300042121 Bacteria 897
341 Ga0450920_000220 3300042122 Bacteria 8536
342 Ga0450922_004730 3300042124 Bacteria 1254
343 Ga0450890_000293 3300042127 Bacteria 7283
344 Ga0450892_006597 3300042130 Bacteria 968
345 Ga0450903_000835 3300042138 Bacteria 6009
346 Ga0450903_002032 3300042138 Bacteria 3649
347 Ga0450903_004133 3300042138 Bacteria 2488
348 Ga0450903_004819 3300042138 Bacteria 2279
349 Ga0450904_000497 3300042139 Bacteria 7723
350 Ga0450905_009553 3300042142 Bacteria 1336
351 Ga0450906_000952 3300042145 Bacteria 6331
352 Ga0450906_001246 3300042145 Bacteria 5618
353 Ga0450907_000001 3300042146 Bacteria 236562
354 Ga0450907_001863 3300042146 Bacteria 4323
355 Ga0450907_007968 3300042146 Bacteria 1764
356 Ga0450910_000235 3300042147 Bacteria 6316
357 Ga0439446_0000210 3300042156 Bacteria 10703
358 Ga0439446_0000222 3300042156 Bacteria 10452
359 Ga0439446_0003553 3300042156 Bacteria 3882
360 Ga0439446_0041583 3300042156 Bacteria 1355
361 Ga0450908_001049 3300042184 Bacteria 5355
362 Ga0450909_000158 3300042185 Bacteria 7292
363 Ga0450909_000192 3300042185 Bacteria 6991
364 Ga0439434_0000057 3300042435 Bacteria 27366
365 Ga0439460_0001544 3300042461 Bacteria 5421
366 Ga0439460_0017057 3300042461 Bacteria 1941
367 Ga0450893_0014890 3300042532 Bacteria 1308
368 Ga0451577_0279906 3300042876 Bacteria 1511
369 Ga0439440_0000252 3300042993 Bacteria 8658
370 Ga0439440_0002205 3300042993 Bacteria 3650
371 Ga0439440_0012574 3300042993 Bacteria 1801
372 Ga0466969_0013651 3300044656 Bacteria 4275
373 Ga0453683_0503235 3300044673 Bacteria 786
374 Ga0466966_0012062 3300044684 Bacteria 5726
375 Ga0466961_0192849 3300044693 Bacteria 1262
376 Ga0466964_0174205 3300044706 Bacteria 1015
377 Ga0453684_0330988 3300044712 Bacteria 1722
378 Ga0466971_0286610 3300044719 Bacteria 789
379 Ga0466968_0013865 3300044735 Bacteria 3175
380 Ga0466970_0025318 3300044765 Bacteria 3106
381 Ga0466970_0187245 3300044765 Bacteria 1149
382 Ga0466957_0037733 3300044842 Bacteria 2909
383 Ga0466959_0015461 3300045049 Bacteria 5560
384 Ga0451576_0036741 3300045051 Bacteria 5190
385 Ga0466958_0018299 3300045836 Bacteria 4064
386 Ga0466958_0316142 3300045836 Bacteria 1003
387 Ga0495617_000204 3300046452 Bacteria 37490
388 Ga0495617_001096 3300046452 Bacteria 12306
389 Ga0495617_002458 3300046452 Bacteria 7362
390 Ga0495617_002836 3300046452 Bacteria 6678
391 Ga0495617_004958 3300046452 Bacteria 4786
392 Ga0495617_005427 3300046452 Bacteria 4519
393 Ga0495617_025087 3300046452 Bacteria 2010
394 Ga0495617_027628 3300046452 Bacteria 1908
395 Ga0495617_045668 3300046452 Bacteria 1460
396 Ga0495627_000124 3300046453 Bacteria 93651
397 Ga0495627_001657 3300046453 Bacteria 12330
398 Ga0495627_034261 3300046453 Bacteria 1587
399 Ga0495603_0002282 3300046455 Bacteria 11268
400 Ga0495603_0045148 3300046455 Bacteria 2628
401 Ga0495603_0129686 3300046455 Bacteria 1469
402 Ga0495590_0000114 3300046457 Bacteria 48407
403 Ga0495590_0000628 3300046457 Bacteria 16425
404 Ga0495590_0004576 3300046457 Bacteria 5567
405 Ga0495590_0012548 3300046457 Bacteria 3142
406 Ga0495590_0044981 3300046457 Bacteria 1539
407 Ga0495591_000021 3300046458 Bacteria 203554
408 Ga0495591_001154 3300046458 Bacteria 17320
409 Ga0495591_004409 3300046458 Bacteria 6907
410 Ga0495591_009642 3300046458 Bacteria 3816
411 Ga0495591_011532 3300046458 Bacteria 3343
412 Ga0495591_017906 3300046458 Bacteria 2417
413 Ga0495591_022356 3300046458 Bacteria 2045
414 Ga0495638_0000073 3300046460 Bacteria 164378
415 Ga0495638_0001071 3300046460 Bacteria 26689
416 Ga0495638_0001173 3300046460 Bacteria 25137
417 Ga0495638_0001643 3300046460 Bacteria 19841
418 Ga0495638_0001675 3300046460 Bacteria 19601
419 Ga0495638_0003795 3300046460 Bacteria 11742
420 Ga0495638_0006166 3300046460 Bacteria 8758
421 Ga0495638_0012543 3300046460 Bacteria 5802
422 Ga0495638_0020265 3300046460 Bacteria 4393
423 Ga0495638_0036061 3300046460 Bacteria 3151
424 Ga0495638_0040995 3300046460 Bacteria 2931
425 Ga0495638_0126384 3300046460 Bacteria 1506
426 Ga0495638_0153048 3300046460 Bacteria 1336
427 Ga0495653_0101918 3300046463 Bacteria 2078
428 Ga0495650_0000822 3300046471 Bacteria 37641
429 Ga0495650_0001066 3300046471 Bacteria 30414
430 Ga0495650_0001224 3300046471 Bacteria 26826
431 Ga0495650_0001886 3300046471 Bacteria 18639
432 Ga0495650_0002534 3300046471 Bacteria 14579
433 Ga0495650_0008706 3300046471 Bacteria 5876
434 Ga0495605_0000391 3300046474 Bacteria 40370
435 Ga0495605_0000446 3300046474 Bacteria 37125
436 Ga0495605_0000751 3300046474 Bacteria 23782
437 Ga0495605_0003866 3300046474 Bacteria 8887
438 Ga0495605_0010911 3300046474 Bacteria 5076
439 Ga0495605_0043419 3300046474 Bacteria 2229
440 Ga0495605_0052934 3300046474 Bacteria 1971
441 Ga0495605_0103442 3300046474 Bacteria 1306
442 Ga0495639_0001776 3300046475 Bacteria 9555
443 Ga0495584_0000019 3300046491 Bacteria 140608
444 Ga0495584_0000176 3300046491 Bacteria 45031
445 Ga0495584_0000296 3300046491 Bacteria 35158
446 Ga0495584_0000568 3300046491 Bacteria 24896
447 Ga0495584_0004039 3300046491 Bacteria 7917
448 Ga0495584_0005778 3300046491 Bacteria 6525
449 Ga0495584_0015243 3300046491 Bacteria 3915
450 Ga0495584_0073558 3300046491 Bacteria 1717
451 Ga0495584_0251961 3300046491 Bacteria 897
452 Ga0495585_0000165 3300046492 Bacteria 71444
453 Ga0495585_0004259 3300046492 Bacteria 9320
454 Ga0495585_0016293 3300046492 Bacteria 4306
455 Ga0495585_0041395 3300046492 Bacteria 2583
456 Ga0495585_0071007 3300046492 Bacteria 1898
457 Ga0495585_0077305 3300046492 Bacteria 1807
458 Ga0495585_0085811 3300046492 Bacteria 1701
459 Ga0495585_0194445 3300046492 Bacteria 1036
460 Ga0495585_0239726 3300046492 Bacteria 908
461 Ga0495594_0000316 3300046499 Bacteria 23873
462 Ga0495594_0001211 3300046499 Bacteria 13483
463 Ga0495594_0042317 3300046499 Bacteria 2494
464 Ga0495596_0000209 3300046500 Bacteria 40288
465 Ga0495607_0000188 3300046501 Bacteria 66018
466 Ga0495607_0000709 3300046501 Bacteria 32137
467 Ga0495607_0006930 3300046501 Bacteria 7903
468 Ga0495607_0012463 3300046501 Bacteria 5612
469 Ga0495607_0049007 3300046501 Bacteria 2466
470 Ga0495607_0051036 3300046501 Bacteria 2404
471 Ga0495607_0059322 3300046501 Bacteria 2183
472 Ga0495607_0113049 3300046501 Bacteria 1436
473 Ga0495583_0001277 3300046506 Bacteria 26327
474 Ga0495583_0005600 3300046506 Bacteria 8465
475 Ga0495583_0010683 3300046506 Bacteria 5334
476 Ga0495583_0023101 3300046506 Bacteria 3152
477 Ga0495606_0000347 3300046507 Bacteria 79388
478 Ga0495606_0004664 3300046507 Bacteria 13547
479 Ga0495606_0029004 3300046507 Bacteria 3892
480 Ga0495606_0060018 3300046507 Bacteria 2437
481 Ga0495606_0283666 3300046507 Bacteria 904
482 Ga0495610_0004063 3300046512 Bacteria 10982
483 Ga0495610_0005350 3300046512 Bacteria 9158
484 Ga0495610_0006965 3300046512 Bacteria 7654
485 Ga0495610_0009997 3300046512 Bacteria 5930
486 Ga0495610_0022448 3300046512 Bacteria 3452
487 Ga0495610_0030486 3300046512 Bacteria 2826
488 Ga0495610_0038437 3300046512 Bacteria 2429
489 Ga0495610_0044935 3300046512 Bacteria 2188
490 Ga0495610_0071691 3300046512 Bacteria 1614
491 Ga0495616_0001952 3300046513 Bacteria 13876
492 Ga0495616_0006371 3300046513 Bacteria 7149
493 Ga0495616_0017139 3300046513 Bacteria 3997
494 Ga0495616_0028257 3300046513 Bacteria 2969
495 Ga0495616_0034385 3300046513 Bacteria 2632
496 Ga0495616_0127435 3300046513 Bacteria 1169
497 Ga0495616_0190414 3300046513 Bacteria 907
498 Ga0495616_0214611 3300046513 Bacteria 840
499 Ga0495620_0000308 3300046515 Bacteria 34889
500 Ga0495620_0002940 3300046515 Bacteria 9796
501 Ga0495620_0035239 3300046515 Bacteria 2252
502 Ga0495620_0036621 3300046515 Bacteria 2193
503 Ga0495620_0103192 3300046515 Bacteria 1135
504 Ga0495630_0001104 3300046517 Bacteria 18552
505 Ga0495630_0195039 3300046517 Bacteria 1545
506 Ga0495630_0400453 3300046517 Bacteria 1051
507 Ga0495631_0000005 3300046518 Bacteria 159179
508 Ga0495631_0002159 3300046518 Bacteria 11362
509 Ga0495631_0029040 3300046518 Bacteria 2519
510 Ga0495631_0042894 3300046518 Bacteria 1997
511 Ga0495631_0102238 3300046518 Bacteria 1233
512 Ga0495632_0000270 3300046519 Bacteria 51498
513 Ga0495632_0000533 3300046519 Bacteria 35890
514 Ga0495632_0000693 3300046519 Bacteria 30620
515 Ga0495632_0001677 3300046519 Bacteria 18117
516 Ga0495632_0003778 3300046519 Bacteria 10579
517 Ga0495632_0005075 3300046519 Bacteria 8805
518 Ga0495632_0008319 3300046519 Bacteria 6386
519 Ga0495632_0015102 3300046519 Bacteria 4341
520 Ga0495632_0015668 3300046519 Bacteria 4239
521 Ga0495632_0016160 3300046519 Bacteria 4160
522 Ga0495632_0025415 3300046519 Bacteria 3132
523 Ga0495632_0066506 3300046519 Bacteria 1739
524 Ga0495632_0093900 3300046519 Bacteria 1419
525 Ga0495637_0000499 3300046520 Bacteria 28432
526 Ga0495637_0001804 3300046520 Bacteria 12251
527 Ga0495637_0003265 3300046520 Bacteria 8626
528 Ga0495637_0010990 3300046520 Bacteria 4361
529 Ga0495637_0012856 3300046520 Bacteria 3992
530 Ga0495637_0016974 3300046520 Bacteria 3399
531 Ga0495637_0037619 3300046520 Bacteria 2099
532 Ga0495637_0076372 3300046520 Bacteria 1342
533 Ga0495643_0005530 3300046522 Bacteria 8521
534 Ga0495643_0006979 3300046522 Bacteria 7340
535 Ga0495643_0007123 3300046522 Bacteria 7256
536 Ga0495643_0009829 3300046522 Bacteria 5916
537 Ga0495643_0014019 3300046522 Bacteria 4779
538 Ga0495643_0061386 3300046522 Bacteria 1994
539 Ga0495644_0000108 3300046523 Bacteria 39503
540 Ga0495644_0000143 3300046523 Bacteria 34300
541 Ga0495644_0007098 3300046523 Bacteria 4333
542 Ga0495648_0000049 3300046524 Bacteria 164366
543 Ga0495648_0000092 3300046524 Bacteria 111529
544 Ga0495648_0003675 3300046524 Bacteria 13411
545 Ga0495648_0004541 3300046524 Bacteria 11829
546 Ga0495648_0008097 3300046524 Bacteria 8310
547 Ga0495648_0008400 3300046524 Bacteria 8134
548 Ga0495648_0010547 3300046524 Bacteria 7027
549 Ga0495648_0011830 3300046524 Bacteria 6547
550 Ga0495648_0135431 3300046524 Bacteria 1303
551 Ga0495666_0000088 3300046526 Bacteria 37174
552 Ga0495666_0014084 3300046526 Bacteria 3987
553 Ga0495666_0067413 3300046526 Bacteria 1705
554 Ga0495642_0000003 3300046528 Bacteria 185425
555 Ga0495642_0000018 3300046528 Bacteria 108992
556 Ga0495642_0000599 3300046528 Bacteria 18124
557 Ga0495654_0000088 3300046530 Bacteria 104763
558 Ga0495654_0001088 3300046530 Bacteria 19751
559 Ga0495654_0001307 3300046530 Bacteria 17424
560 Ga0495654_0004804 3300046530 Bacteria 7947
561 Ga0495654_0007459 3300046530 Bacteria 6107
562 Ga0495654_0008806 3300046530 Bacteria 5553
563 Ga0495654_0016497 3300046530 Bacteria 3903
564 Ga0495654_0018347 3300046530 Bacteria 3668
565 Ga0495654_0025747 3300046530 Bacteria 3029
566 Ga0495654_0031557 3300046530 Bacteria 2689
567 Ga0495654_0084049 3300046530 Bacteria 1487
568 Ga0495654_0107052 3300046530 Bacteria 1279
569 Ga0495654_0111662 3300046530 Bacteria 1246
570 Ga0495609_0000409 3300046538 Bacteria 35874
571 Ga0495609_0002918 3300046538 Bacteria 10176
572 Ga0495609_0026937 3300046538 Bacteria 2628
573 Ga0495609_0125128 3300046538 Bacteria 1103
574 Ga0495597_0003792 3300046542 Bacteria 8600
575 Ga0495597_0005486 3300046542 Bacteria 6708
576 Ga0495597_0009049 3300046542 Bacteria 4946
577 Ga0495597_0011043 3300046542 Bacteria 4389
578 Ga0495597_0096501 3300046542 Bacteria 1250
579 Ga0495597_0115631 3300046542 Bacteria 1121
580 Ga0495622_0000193 3300046557 Bacteria 48480
581 Ga0495622_0000347 3300046557 Bacteria 33186
582 Ga0495622_0007820 3300046557 Bacteria 4964
583 Ga0495622_0042330 3300046557 Bacteria 2117
584 Ga0495633_0017843 3300046558 Bacteria 3615
585 Ga0495633_0096991 3300046558 Bacteria 1369
586 Ga0495656_0003888 3300046615 Bacteria 5079
587 Ga0495656_0007882 3300046615 Bacteria 3785
588 Ga0495656_0024651 3300046615 Bacteria 2378
589 Ga0495656_0058921 3300046615 Bacteria 1668
590 Ga0495656_0179777 3300046615 Bacteria 1039
591 Ga0495668_0000467 3300046616 Bacteria 51372
592 Ga0495668_0009442 3300046616 Bacteria 5992
593 Ga0495611_0007442 3300046648 Bacteria 4649
594 Ga0495625_0000397 3300046660 Bacteria 66539
595 Ga0495625_0001435 3300046660 Bacteria 29011
596 Ga0495625_0005691 3300046660 Bacteria 11288
597 Ga0495625_0007778 3300046660 Bacteria 9254
598 Ga0495625_0014487 3300046660 Bacteria 6288
599 Ga0495625_0015160 3300046660 Bacteria 6116
600 Ga0495625_0045240 3300046660 Bacteria 3183
601 Ga0495625_0089279 3300046660 Bacteria 2133
602 Ga0495659_0000002 3300046664 Bacteria 176698
603 Ga0495659_0000641 3300046664 Bacteria 12731
604 Ga0495659_0003771 3300046664 Bacteria 4815
605 Ga0495661_0013350 3300046665 Bacteria 5521
606 Ga0495661_0031938 3300046665 Bacteria 3333
607 Ga0495661_0082342 3300046665 Bacteria 1852
608 Ga0495588_0004596 3300046674 Bacteria 6098
609 Ga0495588_0019536 3300046674 Bacteria 3319
610 Ga0495588_0123428 3300046674 Bacteria 1365
611 Ga0495623_0001478 3300046679 Bacteria 15908
612 Ga0495623_0002571 3300046679 Bacteria 11991
613 Ga0495658_0155476 3300046683 Bacteria 1407
614 Ga0495669_0000279 3300046684 Bacteria 29265
615 Ga0495669_0001673 3300046684 Bacteria 9091
616 Ga0495669_0009985 3300046684 Bacteria 4014
617 Ga0495613_0045217 3300046689 Bacteria 3257
618 Ga0495624_0089391 3300046690 Bacteria 1901
619 Ga0495670_0000112 3300046691 Bacteria 36057
620 Ga0495670_0000620 3300046691 Bacteria 16990
621 Ga0495670_0001315 3300046691 Bacteria 12114
622 Ga0495670_0013560 3300046691 Bacteria 4008
623 Ga0495670_0017942 3300046691 Bacteria 3485
624 Ga0495670_0022028 3300046691 Bacteria 3146
625 Ga0495670_0032135 3300046691 Bacteria 2609
626 Ga0495670_0062329 3300046691 Bacteria 1876
627 Ga0495670_0089262 3300046691 Bacteria 1576
628 Ga0495670_0108992 3300046691 Bacteria 1431
629 Ga0495670_0189817 3300046691 Bacteria 1086
630 Ga0495671_0000066 3300046692 Bacteria 105167
631 Ga0495671_0000160 3300046692 Bacteria 59259
632 Ga0495671_0005604 3300046692 Bacteria 7327
633 Ga0495671_0019876 3300046692 Bacteria 3544
634 Ga0495671_0033611 3300046692 Bacteria 2611
635 Ga0495671_0094409 3300046692 Bacteria 1463
636 Ga0495671_0094867 3300046692 Bacteria 1459
637 Ga0495671_0121270 3300046692 Bacteria 1275
638 Ga0495671_0135752 3300046692 Bacteria 1199
639 Ga0495671_0252794 3300046692 Bacteria 850
640 Ga0495649_0000013 3300046694 Bacteria 316013
641 Ga0495649_0000814 3300046694 Bacteria 25112
642 Ga0495649_0001154 3300046694 Bacteria 20537
643 Ga0495649_0005808 3300046694 Bacteria 7771
644 Ga0495649_0006677 3300046694 Bacteria 7160
645 Ga0495649_0016472 3300046694 Bacteria 4188
646 Ga0495649_0043216 3300046694 Bacteria 2460
647 Ga0495649_0095279 3300046694 Bacteria 1584
648 Ga0495649_0164511 3300046694 Bacteria 1162
649 Ga0495589_0000123 3300046794 Bacteria 72582
650 Ga0495589_0001395 3300046794 Bacteria 14016
651 Ga0495589_0003200 3300046794 Bacteria 8940
652 Ga0495589_0005346 3300046794 Bacteria 6776
653 Ga0495589_0006827 3300046794 Bacteria 6002
654 Ga0495589_0033379 3300046794 Bacteria 2585
655 Ga0495589_0041175 3300046794 Bacteria 2305
656 Ga0495589_0054318 3300046794 Bacteria 1975
657 Ga0495589_0133423 3300046794 Bacteria 1191
658 Ga0495600_0025520 3300046809 Bacteria 3809
659 Ga0495660_0001517 3300046810 Bacteria 15674
660 Ga0495660_0001634 3300046810 Bacteria 15043
661 Ga0495660_0002240 3300046810 Bacteria 12445
662 Ga0495660_0013001 3300046810 Bacteria 4825
663 Ga0495660_0019231 3300046810 Bacteria 3921
664 Ga0495660_0020036 3300046810 Bacteria 3836
665 Ga0495660_0023755 3300046810 Bacteria 3496
666 Ga0495660_0030094 3300046810 Bacteria 3060
667 Ga0495660_0030283 3300046810 Bacteria 3049
668 Ga0495660_0042483 3300046810 Bacteria 2512
669 Ga0495660_0065169 3300046810 Bacteria 1945
670 Ga0495660_0081658 3300046810 Bacteria 1694
671 Ga0495660_0128573 3300046810 Bacteria 1273
672 Ga0495581_0088882 3300047315 Bacteria 1792
673 Ga0495604_0001925 3300047317 Bacteria 16807
674 Ga0495636_0007111 3300047318 Bacteria 4404
675 Ga0495636_0066107 3300047318 Bacteria 1536
676 Ga0495674_0005938 3300047319 Bacteria 11717
677 Ga0495672_0000442 3300047320 Bacteria 49513
678 Ga0495672_0000773 3300047320 Bacteria 34808
679 Ga0495672_0000891 3300047320 Bacteria 31355
680 Ga0495672_0001663 3300047320 Bacteria 21577
681 Ga0495672_0001947 3300047320 Bacteria 19521
682 Ga0495672_0006676 3300047320 Bacteria 8864
683 Ga0495672_0010062 3300047320 Bacteria 6771
684 Ga0495672_0045791 3300047320 Bacteria 2614
685 Ga0495672_0101971 3300047320 Bacteria 1554
686 Ga0495676_0229954 3300047321 Bacteria 1274
687 Ga0495680_0053758 3300047322 Bacteria 3131
688 Ga0495680_0434782 3300047322 Bacteria 900
689 Ga0495683_0000010 3300047323 Bacteria 223494
690 Ga0495683_0000337 3300047323 Bacteria 38955
691 Ga0495683_0002492 3300047323 Bacteria 11095
692 Ga0495683_0006146 3300047323 Bacteria 6582
693 Ga0495683_0011122 3300047323 Bacteria 4743
694 Ga0495683_0011848 3300047323 Bacteria 4583
695 Ga0495683_0014403 3300047323 Bacteria 4119
696 Ga0495683_0018156 3300047323 Bacteria 3639
697 Ga0495683_0020399 3300047323 Bacteria 3418
698 Ga0495683_0038365 3300047323 Bacteria 2426
699 Ga0495687_003205 3300047443 Bacteria 12125
700 Ga0495687_004845 3300047443 Bacteria 8848
701 Ga0495687_007840 3300047443 Bacteria 6211
702 Ga0495687_020289 3300047443 Bacteria 3240
703 Ga0495677_0000471 3300047445 Bacteria 17236
704 Ga0495679_001961 3300047446 Bacteria 10972
705 Ga0495679_009228 3300047446 Bacteria 3962
706 Ga0495679_012799 3300047446 Bacteria 3176
707 Ga0495685_012690 3300047447 Bacteria 2854
708 Ga0495673_0000434 3300047469 Bacteria 46894
709 Ga0495673_0000553 3300047469 Bacteria 38181
710 Ga0495673_0001485 3300047469 Bacteria 18547
711 Ga0495673_0002017 3300047469 Bacteria 14933
712 Ga0495673_0002389 3300047469 Bacteria 13263
713 Ga0495673_0005784 3300047469 Bacteria 7405
714 Ga0495673_0046284 3300047469 Bacteria 1928
715 Ga0495681_0000010 3300047470 Bacteria 203548
716 Ga0495681_0000259 3300047470 Bacteria 43196
717 Ga0495681_0000262 3300047470 Bacteria 42740
718 Ga0495681_0000419 3300047470 Bacteria 32654
719 Ga0495681_0000703 3300047470 Bacteria 25565
720 Ga0495681_0009052 3300047470 Bacteria 6172
721 Ga0495681_0010676 3300047470 Bacteria 5540
722 Ga0495681_0024186 3300047470 Bacteria 3207
723 Ga0495681_0031963 3300047470 Bacteria 2654
724 Ga0495681_0039958 3300047470 Bacteria 2287
725 Ga0495681_0183092 3300047470 Bacteria 859
726 Ga0495684_0035906 3300047471 Bacteria 3800
727 Ga0495686_0008941 3300047472 Bacteria 7279
728 Ga0495686_0041603 3300047472 Bacteria 2925
729 Ga0495686_0138116 3300047472 Bacteria 1440
730 Ga0495686_0144097 3300047472 Bacteria 1404
731 Ga0495686_0150522 3300047472 Bacteria 1366
732 Ga0495593_0000018 3300047673 Bacteria 74926
733 Ga0495593_0000777 3300047673 Bacteria 18553
734 Ga0495615_0000105 3300048090 Bacteria 23071
735 Ga0495615_0048847 3300048090 Bacteria 1083
736 Ga0495626_0000031 3300048091 Bacteria 197930
737 Ga0495626_0000079 3300048091 Bacteria 129922
738 Ga0495626_0000242 3300048091 Bacteria 63298
739 Ga0495626_0000329 3300048091 Bacteria 50091
740 Ga0495626_0000759 3300048091 Bacteria 29787
741 Ga0495626_0001357 3300048091 Bacteria 19791
742 Ga0495626_0005157 3300048091 Bacteria 7746
743 Ga0495626_0013146 3300048091 Bacteria 4312
744 Ga0495626_0014268 3300048091 Bacteria 4103
745 Ga0496100_0590620 3300048903 Bacteria 862
746 Ga0496102_0235272 3300048905 Bacteria 1727
747 Ga0496102_0380623 3300048905 Bacteria 1328
748 Ga0496105_0049697 3300048908 Bacteria 3463
749 Ga0496106_0189660 3300048909 Bacteria 1634
750 Ga0496107_0177192 3300048910 Bacteria 1583
751 Ga0496110_0078555 3300048913 Bacteria 2938
752 Ga0496110_0099864 3300048913 Bacteria 2601
753 Ga0496110_0666980 3300048913 Bacteria 940
754 Ga0496111_0188066 3300048914 Bacteria 1535
755 Ga0496112_0014420 3300048915 Bacteria 7331
756 Ga0496112_0020807 3300048915 Bacteria 6227
757 Ga0496113_0062287 3300048916 Bacteria 2817
758 Ga0496113_0413008 3300048916 Bacteria 1084
759 Ga0496116_0001237 3300048919 Bacteria 29731
760 Ga0496116_0002307 3300048919 Bacteria 20229
761 Ga0496117_0129555 3300048920 Bacteria 1532
762 Ga0496118_0195987 3300048921 Bacteria 1202
763 Ga0496121_0095310 3300048924 Bacteria 2313
764 Ga0496122_0002525 3300048925 Bacteria 25773
765 Ga0496122_0002963 3300048925 Bacteria 23155
766 Ga0496123_0002451 3300048926 Bacteria 22992
767 Ga0496124_0002900 3300048927 Bacteria 21631
768 Ga0496124_0010024 3300048927 Bacteria 9668
769 Ga0496124_0043609 3300048927 Bacteria 3855
770 Ga0496124_0093915 3300048927 Bacteria 2441
771 Ga0496124_0123802 3300048927 Bacteria 2062
772 Ga0496125_0004944 3300048928 Bacteria 15081
773 Ga0496125_0018626 3300048928 Bacteria 6590
774 Ga0496126_0087602 3300048929 Bacteria 2744
775 Ga0495678_000701 3300049459 Bacteria 30500
776 Ga0495678_001245 3300049459 Bacteria 20717
777 Ga0495678_005843 3300049459 Bacteria 6667
778 Ga0495678_009163 3300049459 Bacteria 4925
779 Ga0495678_022535 3300049459 Bacteria 2751
780 Ga0495678_024222 3300049459 Bacteria 2624
781 Ga0495678_080520 3300049459 Bacteria 1170
782 Ga0495678_114602 3300049459 Bacteria 914
783 Ga0495682_0001309 3300049460 Bacteria 13842
784 Ga0495682_0003820 3300049460 Bacteria 6617
785 Ga0495682_0011988 3300049460 Bacteria 3331
786 Ga0501031_0030749 3300049568 Bacteria 3503
787 Ga0501031_0033103 3300049568 Bacteria 3370
788 Ga0501031_0167040 3300049568 Bacteria 1438
789 Ga0501031_0597796 3300049568 Bacteria 710
790 Ga0501033_0007048 3300049570 Bacteria 8777
791 Ga0501034_0100599 3300049571 Bacteria 2885
792 Ga0501036_0001193 3300049572 Bacteria 19803
793 Ga0501036_0024335 3300049572 Bacteria 5105
794 Ga0501036_0045902 3300049572 Bacteria 3700
795 Ga0501036_0097970 3300049572 Bacteria 2479
796 Ga0501038_0212540 3300049574 Bacteria 1547
797 Ga0501038_0432642 3300049574 Bacteria 1014
798 Ga0501039_0033563 3300049575 Bacteria 3957
799 Ga0501039_0044040 3300049575 Bacteria 3447
800 Ga0501039_0101858 3300049575 Bacteria 2241
801 Ga0501039_0279936 3300049575 Bacteria 1311
802 Ga0501040_0001724 3300049576 Bacteria 14028
803 Ga0501040_0065708 3300049576 Bacteria 2499
804 Ga0501040_0079561 3300049576 Bacteria 2269
805 Ga0501041_0011140 3300049577 Bacteria 5310
806 Ga0501041_0018736 3300049577 Bacteria 4123
807 Ga0501041_0059613 3300049577 Bacteria 2336
808 Ga0501041_0076801 3300049577 Bacteria 2055
809 Ga0501042_0005577 3300049578 Bacteria 8108
810 Ga0501042_0126712 3300049578 Bacteria 1839
811 Ga0501043_0092185 3300049579 Bacteria 2382
812 Ga0501043_0543683 3300049579 Bacteria 864
813 Ga0501046_0107619 3300049580 Bacteria 2133
814 Ga0501047_0186360 3300049581 Bacteria 1940
815 Ga0501047_0459801 3300049581 Bacteria 1102
816 Ga0501048_0050547 3300049582 Bacteria 2960
817 Ga0501068_0005672 3300049584 Bacteria 6837
818 Ga0501068_0141862 3300049584 Bacteria 1506
819 Ga0501069_0294780 3300049585 Bacteria 950
820 Ga0501070_0198410 3300049586 Bacteria 1648
821 Ga0501071_0007936 3300049587 Bacteria 7002
822 Ga0501071_0009804 3300049587 Bacteria 6393
823 Ga0501071_0135125 3300049587 Bacteria 1835
824 Ga0501072_0005608 3300049588 Bacteria 9551
825 Ga0501072_0011565 3300049588 Bacteria 6744
826 Ga0501072_0095836 3300049588 Bacteria 2358
827 Ga0501072_0253513 3300049588 Bacteria 1401
828 Ga0501072_0262375 3300049588 Bacteria 1375
829 Ga0501073_0042142 3300049589 Bacteria 3223
830 Ga0501073_0071178 3300049589 Bacteria 2424
831 Ga0501074_0062661 3300049590 Bacteria 2679
832 Ga0501074_0100816 3300049590 Bacteria 2067
833 Ga0501074_0109025 3300049590 Bacteria 1981
834 Ga0501074_0173184 3300049590 Bacteria 1540
835 Ga0501074_0220991 3300049590 Bacteria 1349
836 Ga0501074_0289274 3300049590 Bacteria 1165
837 Ga0501075_0011542 3300049591 Bacteria 6253
838 Ga0501075_0023427 3300049591 Bacteria 4521
839 Ga0501075_0025157 3300049591 Bacteria 4373
840 Ga0501075_0034455 3300049591 Bacteria 3770
841 Ga0501075_0116664 3300049591 Bacteria 2030
842 Ga0501076_0022693 3300049592 Bacteria 4825
843 Ga0501076_0023798 3300049592 Bacteria 4725
844 Ga0501076_0043988 3300049592 Bacteria 3521
845 Ga0501077_0031361 3300049593 Bacteria 3381
846 Ga0501077_0120177 3300049593 Bacteria 1665
847 Ga0501079_0038714 3300049741 Bacteria 3677
848 Ga0501079_0100709 3300049741 Bacteria 2240
849 Ga0501079_0139474 3300049741 Bacteria 1888
850 Ga0501079_0595572 3300049741 Bacteria 870
851 Ga0501080_0644458 3300049742 Bacteria 938
852 Ga0501081_0011107 3300049743 Bacteria 5890
853 Ga0501081_0064537 3300049743 Bacteria 2543
854 Ga0501081_0104547 3300049743 Bacteria 2005
855 Ga0501035_0026432 3300049822 Bacteria 5310
856 Ga0501035_0735758 3300049822 Bacteria 793
857 Ga0501044_0043020 3300049823 Bacteria 4694
858 Ga0501045_0012473 3300049824 Bacteria 5985
859 Ga0501045_0016327 3300049824 Bacteria 5272
860 Ga0501045_0025200 3300049824 Bacteria 4274
861 nmdc:mga00v17_209825_c1 3300050491 Bacteria 1260
862 nmdc:mga00v17_209969_c1 3300050491 Bacteria 1260
863 nmdc:mga00v17_26563_c1 3300050491 Bacteria 3375
864 nmdc:mga00v17_58430_c1 3300050491 Bacteria 1301
865 nmdc:mga00v17_88236_c1 3300050491 Bacteria 1945
866 nmdc:mga06z11_35824_c1 3300050494 Bacteria 2445
867 nmdc:mga04h51_13771_c1 3300050495 Bacteria 2297
868 nmdc:mga07m45_123412_c1 3300050496 Bacteria 1497
869 nmdc:mga07m45_8603_c1 3300050496 Bacteria 5256
870 nmdc:mga07m45_90954_c1 3300050496 Bacteria 1748
871 nmdc:mga05p37_20057_c1 3300050507 Bacteria 8089
872 nmdc:mga05p37_200676_c1 3300050507 Bacteria 2416
873 nmdc:mga05p37_610024_c1 3300050507 Bacteria 1230
874 nmdc:mga05p37_682271_c1 3300050507 Bacteria 1145
875 nmdc:mga09592_20431_c1 3300050508 Bacteria 5444
876 nmdc:mga09592_266351_c1 3300050508 Bacteria 1486
877 nmdc:mga09592_459552_c1 3300050508 Bacteria 1098
878 nmdc:mga0qj67_121249_c1 3300050509 Bacteria 2115
879 nmdc:mga0qj67_447253_c1 3300050509 Bacteria 1041
880 nmdc:mga0qj67_98346_c1 3300050509 Bacteria 2357
881 nmdc:mga06r32_1070187_c1 3300050510 Bacteria 757
882 nmdc:mga06r32_148916_c1 3300050510 Bacteria 2318
883 nmdc:mga06r32_258614_c1 3300050510 Bacteria 1729
884 nmdc:mga08y16_320082_c1 3300050511 Bacteria 1597
885 nmdc:mga0n895_179639_c1 3300050512 Bacteria 2148
886 nmdc:mga0rr50_102939_c1 3300050513 Bacteria 2246
887 nmdc:mga0rr50_671860_c1 3300050513 Bacteria 884
888 nmdc:mga0rr50_6947_c1 3300050513 Bacteria 6940
889 nmdc:mga08x19_156712_c1 3300050514 Bacteria 1545
890 nmdc:mga08x19_247988_c1 3300050514 Bacteria 1229
891 nmdc:mga08x19_26165_c1 3300050514 Bacteria 3639
892 nmdc:mga08x19_36808_c1 3300050514 Bacteria 3101
893 nmdc:mga08x19_5919_c1 3300050514 Bacteria 7233
894 nmdc:mga0a205_14835_c1 3300050515 Bacteria 7272
895 nmdc:mga0sz30_16921_c2 3300050516 Bacteria 2130
896 nmdc:mga0sz30_75741_c1 3300050516 Bacteria 1452
897 Ga0495612_0231950 3300053078 Bacteria 819
898 Ga0500566_0000044 3300053094 Bacteria 61711
899 Ga0500641_0060647 3300053096 Bacteria 1574
900 Ga0500555_005902 3300053103 Bacteria 3474
901 Ga0500593_000006 3300053117 Bacteria 88644
902 Ga0500559_0004626 3300053136 Bacteria 6495
903 Ga0500568_0000005 3300053139 Bacteria 614296
904 Ga0500568_0022253 3300053139 Bacteria 2716
905 Ga0500577_0001370 3300053142 Bacteria 6224
906 Ga0500577_0092089 3300053142 Bacteria 1227
907 Ga0500616_0020681 3300053153 Bacteria 3696
908 Ga0501084_0045923 3300054114 Bacteria 3657
909 Ga0501084_0103954 3300054114 Bacteria 2386
910 Ga0587073_0098291 3300059492 Bacteria 756
911 Ga0587091_075971 3300059511 Bacteria 744
912 Ga0501082_0045823 3300060353 Bacteria 3770
913 Ga0501082_0099541 3300060353 Bacteria 2514
914 Ga0501082_0197956 3300060353 Bacteria 1748
915 Ga0501082_0224692 3300060353 Bacteria 1634
916 Ga0501082_0237481 3300060353 Bacteria 1586
917 Ga0530510_0012041 3300061734 Bacteria 6066
918 Ga0530510_0013473 3300061734 Bacteria 5748
919 Ga0530510_0014529 3300061734 Bacteria 5554
920 Ga0530510_0021620 3300061734 Bacteria 4577
921 Ga0530510_0079955 3300061734 Bacteria 2378

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300022467 Ga0224712_10272325 Ga0224712_102723252 177
2 3300046684 Ga0495669_0009985 Ga0495669_0009985_1784_2389 187
3 3300049741 Ga0501079_0100709 Ga0501079_0100709_20_625 198
4 3300050491 nmdc:mga00v17_26563_c1 nmdc:mga00v17_26563_c1_1036_1665 202
5 3300050491 nmdc:mga00v17_88236_c1 nmdc:mga00v17_88236_c1_755_1384 202
6 3300050494 nmdc:mga06z11_35824_c1 nmdc:mga06z11_35824_c1_489_1118 202
7 3300050495 nmdc:mga04h51_13771_c1 nmdc:mga04h51_13771_c1_869_1498 202
8 3300050496 nmdc:mga07m45_123412_c1 nmdc:mga07m45_123412_c1_548_1177 202
9 3300050496 nmdc:mga07m45_90954_c1 nmdc:mga07m45_90954_c1_303_932 202
10 iso_pu_bacteria 2513237087 2513592536 206
11 iso_pu_bacteria 2582581280 2585153353 206
12 iso_pu_bacteria 2582581293 2585196714 206
13 iso_pu_bacteria 2643221552 2643781844 206
14 iso_pu_bacteria 2643221584 2643930433 206
15 iso_pu_bacteria 2818991435 2819537829 206
16 iso_pu_bacteria 2818991454 2819647607 206
17 iso_pu_bacteria 2828305725 2828306528 206
18 iso_pu_bacteria 2939669807 2939674401 206
19 3300006914 Ga0075436_100008107 Ga0075436_1000081071 208
20 3300014326 Ga0157380_10750972 Ga0157380_107509722 208
21 3300050514 nmdc:mga08x19_156712_c1 nmdc:mga08x19_156712_c1_843_1469 208
22 3300050514 nmdc:mga08x19_5919_c1 nmdc:mga08x19_5919_c1_1926_2552 208
23 3300005295 Ga0065707_10128004 Ga0065707_101280042 209
24 3300005347 Ga0070668_100117988 Ga0070668_1001179882 209
25 3300005471 Ga0070698_100001874 Ga0070698_10000187425 209
26 3300005518 Ga0070699_100002404 Ga0070699_1000024042 209
27 3300005530 Ga0070679_100750491 Ga0070679_1007504911 209
28 3300005543 Ga0070672_100249747 Ga0070672_1002497472 209
29 3300005546 Ga0070696_100080896 Ga0070696_1000808961 209
30 3300005548 Ga0070665_100053117 Ga0070665_1000531173 209
31 3300005844 Ga0068862_100666199 Ga0068862_1006661991 209
32 3300005937 Ga0081455_10230493 Ga0081455_102304932 209
33 3300006042 Ga0075368_10027474 Ga0075368_100274743 209
34 3300006042 Ga0075368_10047722 Ga0075368_100477223 209
35 3300006048 Ga0075363_100076711 Ga0075363_1000767112 209
36 3300006051 Ga0075364_10010255 Ga0075364_100102553 209
37 3300006051 Ga0075364_10026491 Ga0075364_100264913 209
38 3300006178 Ga0075367_10006727 Ga0075367_100067272 209
39 3300006353 Ga0075370_10057075 Ga0075370_100570753 209
40 3300006353 Ga0075370_10127917 Ga0075370_101279173 209
41 3300006844 Ga0075428_100080257 Ga0075428_1000802572 209
42 3300009147 Ga0114129_10009271 Ga0114129_100092713 209
43 3300014325 Ga0163163_11162738 Ga0163163_111627381 209
44 3300025919 Ga0207657_10167548 Ga0207657_101675481 209
45 3300025940 Ga0207691_10222981 Ga0207691_102229812 209
46 3300025942 Ga0207689_10491043 Ga0207689_104910432 209
47 3300025972 Ga0207668_10097056 Ga0207668_100970562 209
48 3300027866 Ga0209813_10034384 Ga0209813_100343841 209
49 3300028379 Ga0268266_10183856 Ga0268266_101838562 209
50 3300028380 Ga0268265_10219441 Ga0268265_102194412 209
51 3300028380 Ga0268265_10658413 Ga0268265_106584131 209
52 3300028653 Ga0265323_10125744 Ga0265323_101257442 209
53 3300031824 Ga0307413_10347394 Ga0307413_103473942 209
54 3300031852 Ga0307410_10014366 Ga0307410_100143663 209
55 3300031903 Ga0307407_10025967 Ga0307407_100259672 209
56 3300031903 Ga0307407_10461172 Ga0307407_104611721 209
57 3300031995 Ga0307409_100009144 Ga0307409_1000091449 209
58 3300032002 Ga0307416_100101103 Ga0307416_1001011032 209
59 3300032004 Ga0307414_10257190 Ga0307414_102571902 209
60 3300032005 Ga0307411_10029681 Ga0307411_100296812 209
61 3300032005 Ga0307411_10280097 Ga0307411_102800972 209
62 3300037312 Ga0395899_0309829 Ga0395899_0309829_230_859 209
63 3300037466 Ga0395898_0565308 Ga0395898_0565308_16_645 209
64 3300037471 Ga0395905_0186624 Ga0395905_0186624_1159_1788 209
65 3300046522 Ga0495643_0007123 Ga0495643_0007123_907_1548 209
66 3300046615 Ga0495656_0179777 Ga0495656_0179777_90_737 209
67 3300046683 Ga0495658_0155476 Ga0495658_0155476_51_686 209
68 3300046690 Ga0495624_0089391 Ga0495624_0089391_570_1202 209
69 3300047443 Ga0495687_020289 Ga0495687_020289_1237_1872 209
70 3300048929 Ga0496126_0087602 Ga0496126_0087602_1296_1943 209
71 3300049568 Ga0501031_0030749 Ga0501031_0030749_1137_1784 209
72 3300049572 Ga0501036_0045902 Ga0501036_0045902_103_750 209
73 3300049575 Ga0501039_0101858 Ga0501039_0101858_1542_2189 209
74 3300049577 Ga0501041_0059613 Ga0501041_0059613_1594_2241 209
75 3300049578 Ga0501042_0126712 Ga0501042_0126712_604_1251 209
76 3300049585 Ga0501069_0294780 Ga0501069_0294780_215_844 209
77 3300049587 Ga0501071_0135125 Ga0501071_0135125_271_918 209
78 3300049588 Ga0501072_0253513 Ga0501072_0253513_588_1235 209
79 3300049590 Ga0501074_0173184 Ga0501074_0173184_201_848 209
80 3300049590 Ga0501074_0220991 Ga0501074_0220991_562_1221 209
81 3300049591 Ga0501075_0023427 Ga0501075_0023427_1020_1667 209
82 3300049593 Ga0501077_0120177 Ga0501077_0120177_354_1013 209
83 3300049741 Ga0501079_0038714 Ga0501079_0038714_511_1158 209
84 3300049822 Ga0501035_0735758 Ga0501035_0735758_104_751 209
85 3300049824 Ga0501045_0012473 Ga0501045_0012473_1530_2177 209
86 3300050507 nmdc:mga05p37_20057_c1 nmdc:mga05p37_20057_c1_3906_4538 209
87 3300053078 Ga0495612_0231950 Ga0495612_0231950_49_690 209
88 3300053136 Ga0500559_0004626 Ga0500559_0004626_5831_6466 209
89 3300054114 Ga0501084_0045923 Ga0501084_0045923_2937_3584 209
90 3300054114 Ga0501084_0103954 Ga0501084_0103954_106_765 209
91 3300060353 Ga0501082_0099541 Ga0501082_0099541_1769_2416 209
92 3300060353 Ga0501082_0197956 Ga0501082_0197956_106_765 209
93 3300061734 Ga0530510_0012041 Ga0530510_0012041_2884_3528 209
94 3300061734 Ga0530510_0079955 Ga0530510_0079955_283_930 209
95 3300004799 Ga0058863_10027487 Ga0058863_100274872 210
96 3300005344 Ga0070661_100127962 Ga0070661_1001279622 210
97 3300005344 Ga0070661_100181536 Ga0070661_1001815362 210
98 3300005354 Ga0070675_100857004 Ga0070675_1008570041 210
99 3300005356 Ga0070674_100116330 Ga0070674_1001163301 210
100 3300005356 Ga0070674_100476319 Ga0070674_1004763191 210
101 3300005364 Ga0070673_100306202 Ga0070673_1003062021 210
102 3300005436 Ga0070713_100419852 Ga0070713_1004198522 210
103 3300005440 Ga0070705_100004662 Ga0070705_1000046624 210
104 3300005440 Ga0070705_100493441 Ga0070705_1004934411 210
105 3300005444 Ga0070694_100014594 Ga0070694_1000145942 210
106 3300005445 Ga0070708_100036681 Ga0070708_1000366812 210
107 3300005445 Ga0070708_100499237 Ga0070708_1004992372 210
108 3300005456 Ga0070678_100039595 Ga0070678_1000395954 210
109 3300005456 Ga0070678_100796008 Ga0070678_1007960082 210
110 3300005458 Ga0070681_10084016 Ga0070681_100840164 210
111 3300005458 Ga0070681_10502913 Ga0070681_105029132 210
112 3300005467 Ga0070706_100009094 Ga0070706_1000090947 210
113 3300005467 Ga0070706_100016861 Ga0070706_1000168617 210
114 3300005467 Ga0070706_100083731 Ga0070706_1000837312 210
115 3300005468 Ga0070707_100650196 Ga0070707_1006501961 210
116 3300005471 Ga0070698_100050404 Ga0070698_1000504043 210
117 3300005518 Ga0070699_100000814 Ga0070699_1000008149 210
118 3300005518 Ga0070699_100059013 Ga0070699_1000590135 210
119 3300005518 Ga0070699_100099564 Ga0070699_1000995643 210
120 3300005518 Ga0070699_100103653 Ga0070699_1001036531 210
121 3300005530 Ga0070679_100137439 Ga0070679_1001374392 210
122 3300005530 Ga0070679_100329000 Ga0070679_1003290002 210
123 3300005539 Ga0068853_100008756 Ga0068853_1000087564 210
124 3300005539 Ga0068853_100050648 Ga0068853_1000506483 210
125 3300005543 Ga0070672_100123927 Ga0070672_1001239272 210
126 3300005545 Ga0070695_100114785 Ga0070695_1001147852 210
127 3300005546 Ga0070696_100001106 Ga0070696_1000011068 210
128 3300005546 Ga0070696_100206054 Ga0070696_1002060542 210
129 3300005548 Ga0070665_100644904 Ga0070665_1006449042 210
130 3300005549 Ga0070704_100159504 Ga0070704_1001595041 210
131 3300005563 Ga0068855_100067729 Ga0068855_1000677294 210
132 3300005563 Ga0068855_100192437 Ga0068855_1001924372 210
133 3300005614 Ga0068856_100004119 Ga0068856_10000411911 210
134 3300005616 Ga0068852_100316995 Ga0068852_1003169952 210
135 3300005616 Ga0068852_101030868 Ga0068852_1010308681 210
136 3300005617 Ga0068859_100159859 Ga0068859_1001598592 210
137 3300005937 Ga0081455_10183998 Ga0081455_101839982 210
138 3300005937 Ga0081455_10197492 Ga0081455_101974923 210
139 3300006038 Ga0075365_10191220 Ga0075365_101912203 210
140 3300006051 Ga0075364_10015174 Ga0075364_100151742 210
141 3300006177 Ga0075362_10176928 Ga0075362_101769282 210
142 3300006353 Ga0075370_10019361 Ga0075370_100193613 210
143 3300006844 Ga0075428_100047960 Ga0075428_1000479603 210
144 3300006844 Ga0075428_100261448 Ga0075428_1002614482 210
145 3300006846 Ga0075430_100267414 Ga0075430_1002674142 210
146 3300006847 Ga0075431_100004080 Ga0075431_10000408013 210
147 3300006847 Ga0075431_100159825 Ga0075431_1001598254 210
148 3300006847 Ga0075431_100368703 Ga0075431_1003687032 210
149 3300006852 Ga0075433_10519587 Ga0075433_105195871 210
150 3300006871 Ga0075434_100006602 Ga0075434_1000066026 210
151 3300006880 Ga0075429_100093930 Ga0075429_1000939305 210
152 3300006914 Ga0075436_100024079 Ga0075436_1000240795 210
153 3300006914 Ga0075436_100028764 Ga0075436_1000287643 210
154 3300006931 Ga0097620_100159866 Ga0097620_1001598662 210
155 3300006931 Ga0097620_100892470 Ga0097620_1008924702 210
156 3300007076 Ga0075435_100708387 Ga0075435_1007083871 210
157 3300009093 Ga0105240_10258621 Ga0105240_102586212 210
158 3300009094 Ga0111539_10408583 Ga0111539_104085832 210
159 3300009094 Ga0111539_10831499 Ga0111539_108314991 210
160 3300009147 Ga0114129_10261499 Ga0114129_102614992 210
161 3300009553 Ga0105249_10142451 Ga0105249_101424514 210
162 3300010375 Ga0105239_10387528 Ga0105239_103875282 210
163 3300010375 Ga0105239_10877916 Ga0105239_108779161 210
164 3300013104 Ga0157370_10321525 Ga0157370_103215252 210
165 3300013105 Ga0157369_10047541 Ga0157369_100475413 210
166 3300013105 Ga0157369_10086985 Ga0157369_100869852 210
167 3300013296 Ga0157374_10030634 Ga0157374_100306343 210
168 3300013296 Ga0157374_10127693 Ga0157374_101276933 210
169 3300013307 Ga0157372_10029964 Ga0157372_100299644 210
170 3300013307 Ga0157372_10628220 Ga0157372_106282201 210
171 3300013308 Ga0157375_10826208 Ga0157375_108262081 210
172 3300014325 Ga0163163_10309828 Ga0163163_103098281 210
173 3300014326 Ga0157380_10673742 Ga0157380_106737421 210
174 3300014969 Ga0157376_10034639 Ga0157376_100346392 210
175 3300014969 Ga0157376_10258665 Ga0157376_102586652 210
176 3300014969 Ga0157376_10324382 Ga0157376_103243822 210
177 3300015265 Ga0182005_1006914 Ga0182005_10069143 210
178 3300017792 Ga0163161_10098276 Ga0163161_100982762 210
179 3300020069 Ga0197907_10262403 Ga0197907_102624031 210
180 3300020069 Ga0197907_10324341 Ga0197907_103243412 210
181 3300020069 Ga0197907_10358230 Ga0197907_103582302 210
182 3300020070 Ga0206356_11534046 Ga0206356_115340461 210
183 3300020076 Ga0206355_1011593 Ga0206355_10115932 210
184 3300020076 Ga0206355_1314941 Ga0206355_13149411 210
185 3300020076 Ga0206355_1571517 Ga0206355_15715171 210
186 3300020077 Ga0206351_10232290 Ga0206351_102322901 210
187 3300020077 Ga0206351_10699157 Ga0206351_106991571 210
188 3300020081 Ga0206354_10217960 Ga0206354_102179601 210
189 3300020082 Ga0206353_11403311 Ga0206353_114033111 210
190 3300022467 Ga0224712_10104057 Ga0224712_101040572 210
191 3300025299 Ga0209256_1014655 Ga0209256_10146552 210
192 3300025885 Ga0207653_10010636 Ga0207653_100106363 210
193 3300025910 Ga0207684_10031488 Ga0207684_100314884 210
194 3300025912 Ga0207707_10002069 Ga0207707_1000206910 210
195 3300025916 Ga0207663_10823405 Ga0207663_108234051 210
196 3300025917 Ga0207660_10077534 Ga0207660_100775342 210
197 3300025921 Ga0207652_10171900 Ga0207652_101719002 210
198 3300025922 Ga0207646_10467462 Ga0207646_104674622 210
199 3300025925 Ga0207650_10333309 Ga0207650_103333091 210
200 3300025926 Ga0207659_10315634 Ga0207659_103156341 210
201 3300025937 Ga0207669_10099785 Ga0207669_100997852 210
202 3300025940 Ga0207691_10629764 Ga0207691_106297641 210
203 3300025945 Ga0207679_10026985 Ga0207679_100269854 210
204 3300025949 Ga0207667_10045365 Ga0207667_100453652 210
205 3300025960 Ga0207651_10289560 Ga0207651_102895601 210
206 3300025961 Ga0207712_10094815 Ga0207712_100948151 210
207 3300026041 Ga0207639_10088761 Ga0207639_100887612 210
208 3300026041 Ga0207639_10632024 Ga0207639_106320241 210
209 3300026075 Ga0207708_10641113 Ga0207708_106411131 210
210 3300026118 Ga0207675_100692499 Ga0207675_1006924991 210
211 3300026121 Ga0207683_10014559 Ga0207683_100145594 210
212 3300026121 Ga0207683_10448633 Ga0207683_104486332 210
213 3300028379 Ga0268266_10636712 Ga0268266_106367122 210
214 3300028800 Ga0265338_10076532 Ga0265338_100765323 210
215 3300028800 Ga0265338_10209017 Ga0265338_102090172 210
216 3300031251 Ga0265327_10091961 Ga0265327_100919612 210
217 3300031548 Ga0307408_100652223 Ga0307408_1006522231 210
218 3300031731 Ga0307405_10373914 Ga0307405_103739142 210
219 3300031824 Ga0307413_10056041 Ga0307413_100560412 210
220 3300031852 Ga0307410_10066547 Ga0307410_100665472 210
221 3300031901 Ga0307406_10014079 Ga0307406_100140794 210
222 3300031903 Ga0307407_10045096 Ga0307407_100450962 210
223 3300031903 Ga0307407_10782680 Ga0307407_107826801 210
224 3300031911 Ga0307412_10667877 Ga0307412_106678771 210
225 3300031995 Ga0307409_100235840 Ga0307409_1002358402 210
226 3300031995 Ga0307409_100293291 Ga0307409_1002932912 210
227 3300032002 Ga0307416_100194992 Ga0307416_1001949922 210
228 3300032005 Ga0307411_10276555 Ga0307411_102765552 210
229 3300035695 Ga0373927_0283142 Ga0373927_0283142_185_892 210
230 3300035725 Ga0373947_0059733 Ga0373947_0059733_143_778 210
231 3300037068 Ga0373925_0118821 Ga0373925_0118821_179_814 210
232 3300039437 Ga0436365_0924268 Ga0436365_0924268_258_893 210
233 3300039438 Ga0436360_0011970 Ga0436360_0011970_95_730 210
234 3300041501 Ga0451845_0227851 Ga0451845_0227851_29_664 210
235 3300041999 Ga0439433_0068448 Ga0439433_0068448_189_824 210
236 3300042015 Ga0439462_0012322 Ga0439462_0012322_224_859 210
237 3300042156 Ga0439446_0041583 Ga0439446_0041583_132_767 210
238 3300042876 Ga0451577_0279906 Ga0451577_0279906_361_1017 210
239 3300044673 Ga0453683_0503235 Ga0453683_0503235_60_716 210
240 3300044712 Ga0453684_0330988 Ga0453684_0330988_472_1128 210
241 3300044719 Ga0466971_0286610 Ga0466971_0286610_12_644 210
242 3300044765 Ga0466970_0187245 Ga0466970_0187245_384_1022 210
243 3300045051 Ga0451576_0036741 Ga0451576_0036741_833_1489 210
244 3300046453 Ga0495627_000124 Ga0495627_000124_78978_79631 210
245 3300046455 Ga0495603_0129686 Ga0495603_0129686_674_1309 210
246 3300046460 Ga0495638_0000073 Ga0495638_0000073_117614_118267 210
247 3300046471 Ga0495650_0000822 Ga0495650_0000822_22843_23496 210
248 3300046515 Ga0495620_0035239 Ga0495620_0035239_1193_1846 210
249 3300046517 Ga0495630_0195039 Ga0495630_0195039_622_1257 210
250 3300046518 Ga0495631_0102238 Ga0495631_0102238_365_1018 210
251 3300046519 Ga0495632_0000270 Ga0495632_0000270_4040_4693 210
252 3300046519 Ga0495632_0000533 Ga0495632_0000533_19785_20438 210
253 3300046524 Ga0495648_0000049 Ga0495648_0000049_117614_118267 210
254 3300046660 Ga0495625_0000397 Ga0495625_0000397_35204_35845 210
255 3300046689 Ga0495613_0045217 Ga0495613_0045217_729_1364 210
256 3300047315 Ga0495581_0088882 Ga0495581_0088882_1130_1765 210
257 3300047321 Ga0495676_0229954 Ga0495676_0229954_11_646 210
258 3300047470 Ga0495681_0000010 Ga0495681_0000010_26096_26749 210
259 3300048090 Ga0495615_0000105 Ga0495615_0000105_10588_11220 210
260 3300048903 Ga0496100_0590620 Ga0496100_0590620_189_824 210
261 3300048908 Ga0496105_0049697 Ga0496105_0049697_964_1599 210
262 3300048915 Ga0496112_0020807 Ga0496112_0020807_2536_3171 210
263 3300048916 Ga0496113_0062287 Ga0496113_0062287_355_990 210
264 3300048925 Ga0496122_0002963 Ga0496122_0002963_10611_11243 210
265 3300048926 Ga0496123_0002451 Ga0496123_0002451_11863_12495 210
266 3300048927 Ga0496124_0123802 Ga0496124_0123802_304_936 210
267 3300049568 Ga0501031_0033103 Ga0501031_0033103_788_1447 210
268 3300049568 Ga0501031_0167040 Ga0501031_0167040_62_721 210
269 3300049568 Ga0501031_0597796 Ga0501031_0597796_47_697 210
270 3300049570 Ga0501033_0007048 Ga0501033_0007048_2491_3126 210
271 3300049571 Ga0501034_0100599 Ga0501034_0100599_970_1605 210
272 3300049572 Ga0501036_0001193 Ga0501036_0001193_3459_4118 210
273 3300049572 Ga0501036_0024335 Ga0501036_0024335_1586_2236 210
274 3300049572 Ga0501036_0097970 Ga0501036_0097970_207_866 210
275 3300049574 Ga0501038_0212540 Ga0501038_0212540_133_768 210
276 3300049574 Ga0501038_0432642 Ga0501038_0432642_142_816 210
277 3300049575 Ga0501039_0033563 Ga0501039_0033563_1161_1820 210
278 3300049575 Ga0501039_0044040 Ga0501039_0044040_1898_2548 210
279 3300049575 Ga0501039_0279936 Ga0501039_0279936_469_1119 210
280 3300049576 Ga0501040_0001724 Ga0501040_0001724_10100_10759 210
281 3300049576 Ga0501040_0065708 Ga0501040_0065708_1177_1827 210
282 3300049576 Ga0501040_0079561 Ga0501040_0079561_826_1485 210
283 3300049577 Ga0501041_0011140 Ga0501041_0011140_3311_3970 210
284 3300049577 Ga0501041_0018736 Ga0501041_0018736_325_975 210
285 3300049577 Ga0501041_0076801 Ga0501041_0076801_146_805 210
286 3300049578 Ga0501042_0005577 Ga0501042_0005577_4628_5287 210
287 3300049579 Ga0501043_0092185 Ga0501043_0092185_1218_1877 210
288 3300049579 Ga0501043_0543683 Ga0501043_0543683_32_682 210
289 3300049580 Ga0501046_0107619 Ga0501046_0107619_1018_1677 210
290 3300049581 Ga0501047_0186360 Ga0501047_0186360_124_756 210
291 3300049581 Ga0501047_0459801 Ga0501047_0459801_131_766 210
292 3300049582 Ga0501048_0050547 Ga0501048_0050547_1256_1915 210
293 3300049584 Ga0501068_0005672 Ga0501068_0005672_5274_5933 210
294 3300049584 Ga0501068_0141862 Ga0501068_0141862_31_702 210
295 3300049586 Ga0501070_0198410 Ga0501070_0198410_722_1354 210
296 3300049587 Ga0501071_0007936 Ga0501071_0007936_2610_3269 210
297 3300049587 Ga0501071_0009804 Ga0501071_0009804_5551_6210 210
298 3300049588 Ga0501072_0005608 Ga0501072_0005608_249_908 210
299 3300049588 Ga0501072_0011565 Ga0501072_0011565_1362_2021 210
300 3300049588 Ga0501072_0095836 Ga0501072_0095836_747_1397 210
301 3300049588 Ga0501072_0262375 Ga0501072_0262375_79_792 210
302 3300049589 Ga0501073_0042142 Ga0501073_0042142_1317_1952 210
303 3300049589 Ga0501073_0071178 Ga0501073_0071178_1560_2192 210
304 3300049590 Ga0501074_0062661 Ga0501074_0062661_1970_2629 210
305 3300049590 Ga0501074_0100816 Ga0501074_0100816_474_1124 210
306 3300049590 Ga0501074_0109025 Ga0501074_0109025_1294_1926 210
307 3300049590 Ga0501074_0289274 Ga0501074_0289274_317_967 210
308 3300049591 Ga0501075_0011542 Ga0501075_0011542_1006_1665 210
309 3300049591 Ga0501075_0025157 Ga0501075_0025157_3549_4208 210
310 3300049591 Ga0501075_0034455 Ga0501075_0034455_1065_1715 210
311 3300049591 Ga0501075_0116664 Ga0501075_0116664_142_801 210
312 3300049592 Ga0501076_0022693 Ga0501076_0022693_449_1108 210
313 3300049592 Ga0501076_0023798 Ga0501076_0023798_589_1248 210
314 3300049592 Ga0501076_0043988 Ga0501076_0043988_256_906 210
315 3300049593 Ga0501077_0031361 Ga0501077_0031361_1478_2137 210
316 3300049741 Ga0501079_0139474 Ga0501079_0139474_1220_1870 210
317 3300049741 Ga0501079_0595572 Ga0501079_0595572_35_694 210
318 3300049742 Ga0501080_0644458 Ga0501080_0644458_259_909 210
319 3300049743 Ga0501081_0011107 Ga0501081_0011107_2131_2790 210
320 3300049743 Ga0501081_0064537 Ga0501081_0064537_956_1615 210
321 3300049743 Ga0501081_0104547 Ga0501081_0104547_1102_1752 210
322 3300049822 Ga0501035_0026432 Ga0501035_0026432_4195_4854 210
323 3300049823 Ga0501044_0043020 Ga0501044_0043020_2467_3102 210
324 3300049824 Ga0501045_0016327 Ga0501045_0016327_1321_1971 210
325 3300049824 Ga0501045_0025200 Ga0501045_0025200_1837_2496 210
326 3300050491 nmdc:mga00v17_209969_c1 nmdc:mga00v17_209969_c1_342_977 210
327 3300050496 nmdc:mga07m45_8603_c1 nmdc:mga07m45_8603_c1_2215_2868 210
328 3300050507 nmdc:mga05p37_200676_c1 nmdc:mga05p37_200676_c1_319_951 210
329 3300050507 nmdc:mga05p37_610024_c1 nmdc:mga05p37_610024_c1_178_813 210
330 3300050507 nmdc:mga05p37_682271_c1 nmdc:mga05p37_682271_c1_220_855 210
331 3300050508 nmdc:mga09592_20431_c1 nmdc:mga09592_20431_c1_3127_3762 210
332 3300050508 nmdc:mga09592_266351_c1 nmdc:mga09592_266351_c1_357_992 210
333 3300050508 nmdc:mga09592_459552_c1 nmdc:mga09592_459552_c1_384_1055 210
334 3300050509 nmdc:mga0qj67_121249_c1 nmdc:mga0qj67_121249_c1_1308_1943 210
335 3300050509 nmdc:mga0qj67_447253_c1 nmdc:mga0qj67_447253_c1_202_837 210
336 3300050509 nmdc:mga0qj67_98346_c1 nmdc:mga0qj67_98346_c1_322_957 210
337 3300050510 nmdc:mga06r32_1070187_c1 nmdc:mga06r32_1070187_c1_57_692 210
338 3300050510 nmdc:mga06r32_148916_c1 nmdc:mga06r32_148916_c1_275_946 210
339 3300050510 nmdc:mga06r32_258614_c1 nmdc:mga06r32_258614_c1_740_1375 210
340 3300050511 nmdc:mga08y16_320082_c1 nmdc:mga08y16_320082_c1_212_847 210
341 3300050512 nmdc:mga0n895_179639_c1 nmdc:mga0n895_179639_c1_577_1212 210
342 3300050513 nmdc:mga0rr50_102939_c1 nmdc:mga0rr50_102939_c1_671_1306 210
343 3300050513 nmdc:mga0rr50_671860_c1 nmdc:mga0rr50_671860_c1_134_793 210
344 3300050513 nmdc:mga0rr50_6947_c1 nmdc:mga0rr50_6947_c1_6101_6736 210
345 3300050515 nmdc:mga0a205_14835_c1 nmdc:mga0a205_14835_c1_2231_2866 210
346 3300053094 Ga0500566_0000044 Ga0500566_0000044_28258_28893 210
347 3300053096 Ga0500641_0060647 Ga0500641_0060647_239_880 210
348 3300053103 Ga0500555_005902 Ga0500555_005902_602_1399 210
349 3300053117 Ga0500593_000006 Ga0500593_000006_57837_58472 210
350 3300053139 Ga0500568_0000005 Ga0500568_0000005_369230_369865 210
351 3300053139 Ga0500568_0022253 Ga0500568_0022253_1437_2078 210
352 3300053142 Ga0500577_0001370 Ga0500577_0001370_127_762 210
353 3300053142 Ga0500577_0092089 Ga0500577_0092089_425_1057 210
354 3300053153 Ga0500616_0020681 Ga0500616_0020681_259_900 210
355 3300059492 Ga0587073_0098291 Ga0587073_0098291_63_698 210
356 3300059511 Ga0587091_075971 Ga0587091_075971_13_648 210
357 3300060353 Ga0501082_0045823 Ga0501082_0045823_1522_2181 210
358 3300060353 Ga0501082_0224692 Ga0501082_0224692_513_1163 210
359 3300060353 Ga0501082_0237481 Ga0501082_0237481_894_1544 210
360 3300061734 Ga0530510_0013473 Ga0530510_0013473_2873_3523 210
361 3300061734 Ga0530510_0014529 Ga0530510_0014529_2758_3417 210
362 3300061734 Ga0530510_0021620 Ga0530510_0021620_2665_3324 210
363 iso_pu_bacteria 2511231004 2511257125 213
364 iso_pu_bacteria 2511231006 2511264323 213
365 iso_pu_bacteria 2511231007 2511270396 213
366 iso_pu_bacteria 2511231008 2511275481 213
367 iso_pu_bacteria 2511231012 2511302077 213
368 iso_pu_bacteria 2511231014 2511313773 213
369 iso_pu_bacteria 2511231015 2511323157 213
370 iso_pu_bacteria 2511231016 2511325567 213
371 iso_pu_bacteria 2511231017 2511333339 213
372 iso_pu_bacteria 2511231020 2511350151 213
373 iso_pu_bacteria 2511231021 2511357440 213
374 iso_pu_bacteria 2511231022 2511361151 213
375 iso_pu_bacteria 2512047018 2512329181 213
376 iso_pu_bacteria 2582580891 2583793317 213
377 iso_pu_bacteria 2597489887 2597857289 213
378 iso_pu_bacteria 2599185185 2599484776 213
379 iso_pu_bacteria 2599185257 2599801960 213
380 iso_pu_bacteria 2643221565 2643842236 213
381 iso_pu_bacteria 2643221589 2643956692 213
382 iso_pu_bacteria 2643221602 2644021915 213
383 iso_pu_bacteria 2643221633 2644188269 213
384 iso_pu_bacteria 2671180172 2671768908 213
385 iso_pu_bacteria 2738543004 2739197784 213
386 iso_pu_bacteria 2738543015 2739262237 213
387 iso_pu_bacteria 2740892503 2743736712 213
388 iso_pu_bacteria 2773857670 2774118805 213
389 iso_pu_bacteria 2784132072 2784312443 213
390 iso_pu_bacteria 2808606377 2808933193 213
391 iso_pu_bacteria 2808606381 2808955300 213
392 iso_pu_bacteria 2808606445 2809214685 213
393 iso_pu_bacteria 2858688981 2858693607 213
394 iso_pu_bacteria 2904550169 2904551848 213
395 iso_pu_bacteria 2919456309 2919459136 213
396 iso_pu_bacteria 2923153595 2923155730 213
397 iso_pu_bacteria 2939636861 2939639985 213
398 iso_pu_bacteria 2984286254 2984290295 213
399 iso_pu_bacteria 8015687852 8015689982 213
400 iso_pu_bacteria 8055770955 8055773085 213
401 iso_pu_bacteria 8056125926 8056129470 213
402 iso_pu_bacteria 8056177738 8056178640 213
403 3300009098 Ga0105245_10022120 Ga0105245_100221207 215
404 3300013296 Ga0157374_10301093 Ga0157374_103010932 215
405 3300005843 Ga0068860_100135331 Ga0068860_1001353312 216
406 3300006358 Ga0068871_100259576 Ga0068871_1002595763 216
407 2124908027 MRS2a_Contig_16 MRS2a_00059450 217
408 2124908027 MRS2a_Contig_7135 MRS2a_00035740 217
409 2124908027 MRS2a_Contig_9103 MRS2a_00006130 217
410 2162886007 SwRhRL2b_contig_1791376 SwRhRL2b_0662.00000540 217
411 2162886007 SwRhRL2b_contig_275942 SwRhRL2b_0885.00008400 217
412 3300002737 JGI25162J39368_1000045 JGI25162J39368_100004541 217
413 3300002771 JGI25163J39215_1000297 JGI25163J39215_100029717 217
414 3300002772 JGI25164J39214_1000147 JGI25164J39214_100014730 217
415 3300003187 JGI25151J46595_10000065 JGI25151J46595_1000006537 217
416 3300003187 JGI25151J46595_10056448 JGI25151J46595_100564481 217
417 3300003214 JGI25165J46597_1000086 JGI25165J46597_100008641 217
418 3300003578 Ga0006562J51391_1007874 Ga0006562J51391_10078741 217
419 3300003773 Ga0055537_1000409 Ga0055537_10004091 217
420 3300003775 Ga0055524_1021663 Ga0055524_10216631 217
421 3300003781 Ga0055536_1000028 Ga0055536_1000028101 217
422 3300003784 Ga0055534_1000189 Ga0055534_100018942 217
423 3300003791 Ga0055530_10000030 Ga0055530_1000003064 217
424 3300003791 Ga0055530_10014884 Ga0055530_100148842 217
425 3300003792 Ga0055540_1000262 Ga0055540_100026229 217
426 3300005288 Ga0065714_10000003 Ga0065714_1000000326 217
427 3300005288 Ga0065714_10004301 Ga0065714_100043014 217
428 3300005288 Ga0065714_10004791 Ga0065714_100047913 217
429 3300005288 Ga0065714_10005115 Ga0065714_100051155 217
430 3300005288 Ga0065714_10005580 Ga0065714_1000558013 217
431 3300005288 Ga0065714_10066220 Ga0065714_100662207 217
432 3300005288 Ga0065714_10084673 Ga0065714_100846732 217
433 3300005288 Ga0065714_10105443 Ga0065714_101054432 217
434 3300005288 Ga0065714_10120013 Ga0065714_101200132 217
435 3300005289 Ga0065704_10079095 Ga0065704_100790955 217
436 3300005289 Ga0065704_10112878 Ga0065704_101128782 217
437 3300005289 Ga0065704_10146359 Ga0065704_101463593 217
438 3300005290 Ga0065712_10002579 Ga0065712_100025795 217
439 3300005293 Ga0065715_10101780 Ga0065715_101017802 217
440 3300005335 Ga0070666_10027722 Ga0070666_100277221 217
441 3300005356 Ga0070674_100969041 Ga0070674_1009690411 217
442 3300006051 Ga0075364_10032030 Ga0075364_100320303 217
443 3300006058 Ga0075432_10003245 Ga0075432_100032454 217
444 3300006058 Ga0075432_10003498 Ga0075432_100034985 217
445 3300006058 Ga0075432_10177981 Ga0075432_101779812 217
446 3300006186 Ga0075369_10056579 Ga0075369_100565792 217
447 3300006186 Ga0075369_10256479 Ga0075369_102564791 217
448 3300006358 Ga0068871_100446309 Ga0068871_1004463091 217
449 3300006914 Ga0075436_100048957 Ga0075436_1000489571 217
450 3300006914 Ga0075436_100077100 Ga0075436_1000771003 217
451 3300006946 Ga0079104_1000142 Ga0079104_100014291 217
452 3300009011 Ga0105251_10004626 Ga0105251_100046266 217
453 3300009036 Ga0105244_10002532 Ga0105244_1000253214 217
454 3300009036 Ga0105244_10063319 Ga0105244_100633192 217
455 3300009148 Ga0105243_10069412 Ga0105243_100694123 217
456 3300009545 Ga0105237_10139362 Ga0105237_101393621 217
457 3300011119 Ga0105246_10045067 Ga0105246_100450674 217
458 3300013100 Ga0157373_10002776 Ga0157373_1000277611 217
459 3300013100 Ga0157373_10360227 Ga0157373_103602272 217
460 3300013104 Ga0157370_10004153 Ga0157370_1000415316 217
461 3300013104 Ga0157370_10042606 Ga0157370_100426066 217
462 3300013104 Ga0157370_10154518 Ga0157370_101545182 217
463 3300013105 Ga0157369_10120305 Ga0157369_101203052 217
464 3300013306 Ga0163162_11130794 Ga0163162_111307942 217
465 3300014326 Ga0157380_10327161 Ga0157380_103271612 217
466 3300014497 Ga0182008_10005589 Ga0182008_100055896 217
467 3300014497 Ga0182008_10007190 Ga0182008_100071906 217
468 3300014497 Ga0182008_10011159 Ga0182008_100111596 217
469 3300014497 Ga0182008_10023599 Ga0182008_100235993 217
470 3300014497 Ga0182008_10036263 Ga0182008_100362633 217
471 3300015261 Ga0182006_1000083 Ga0182006_100008348 217
472 3300015265 Ga0182005_1001254 Ga0182005_100125412 217
473 3300015265 Ga0182005_1023824 Ga0182005_10238242 217
474 3300015265 Ga0182005_1067993 Ga0182005_10679932 217
475 3300017792 Ga0163161_10002966 Ga0163161_100029665 217
476 3300017792 Ga0163161_10039468 Ga0163161_100394683 217
477 3300025207 Ga0209760_100019 Ga0209760_100019128 217
478 3300025231 Ga0207427_100011 Ga0207427_100011128 217
479 3300025233 Ga0209437_100044 Ga0209437_100044128 217
480 3300025256 Ga0209759_1001894 Ga0209759_100189411 217
481 3300025261 Ga0209233_1000057 Ga0209233_1000057128 217
482 3300025263 Ga0209565_1000109 Ga0209565_1000109112 217
483 3300025273 Ga0209673_1034456 Ga0209673_10344562 217
484 3300025291 Ga0209675_1000118 Ga0209675_10001181 217
485 3300025292 Ga0209676_1000062 Ga0209676_1000062257 217
486 3300025294 Ga0209025_1000159 Ga0209025_100015946 217
487 3300025294 Ga0209025_1002020 Ga0209025_100202014 217
488 3300025294 Ga0209025_1048697 Ga0209025_10486972 217
489 3300025297 Ga0209758_1010371 Ga0209758_10103713 217
490 3300025298 Ga0209050_1000150 Ga0209050_100015097 217
491 3300025298 Ga0209050_1000684 Ga0209050_100068412 217
492 3300025299 Ga0209256_1001890 Ga0209256_100189018 217
493 3300025303 Ga0209051_1000162 Ga0209051_100016265 217
494 3300025303 Ga0209051_1004106 Ga0209051_10041061 217
495 3300025303 Ga0209051_1029433 Ga0209051_10294332 217
496 3300025711 Ga0207696_1021703 Ga0207696_10217032 217
497 3300025728 Ga0207655_1000481 Ga0207655_100048150 217
498 3300025728 Ga0207655_1007663 Ga0207655_10076634 217
499 3300025728 Ga0207655_1049284 Ga0207655_10492842 217
500 3300025728 Ga0207655_1057603 Ga0207655_10576031 217
501 3300025735 Ga0207713_1005276 Ga0207713_10052766 217
502 3300025735 Ga0207713_1013027 Ga0207713_10130275 217
503 3300027111 Ga0209281_1000262 Ga0209281_100026214 217
504 3300027907 Ga0207428_10047709 Ga0207428_100477094 217
505 3300027907 Ga0207428_10085522 Ga0207428_100855222 217
506 3300027907 Ga0207428_10130436 Ga0207428_101304361 217
507 3300027907 Ga0207428_10141121 Ga0207428_101411212 217
508 3300027907 Ga0207428_10164918 Ga0207428_101649182 217
509 3300027907 Ga0207428_10275962 Ga0207428_102759622 217
510 3300027907 Ga0207428_10323448 Ga0207428_103234482 217
511 3300037312 Ga0395899_0192124 Ga0395899_0192124_598_1251 217
512 3300037418 Ga0395900_0358145 Ga0395900_0358145_499_1152 217
513 3300041404 Ga0439436_0000762 Ga0439436_0000762_1339_1992 217
514 3300041405 Ga0439438_000379 Ga0439438_000379_13609_14262 217
515 3300041405 Ga0439438_001079 Ga0439438_001079_8015_8668 217
516 3300041405 Ga0439438_001796 Ga0439438_001796_127_780 217
517 3300041405 Ga0439438_004736 Ga0439438_004736_1223_1876 217
518 3300041405 Ga0439438_011170 Ga0439438_011170_811_1464 217
519 3300041407 Ga0439447_000016 Ga0439447_000016_36320_36973 217
520 3300041407 Ga0439447_000054 Ga0439447_000054_2262_2915 217
521 3300041407 Ga0439447_000101 Ga0439447_000101_4500_5153 217
522 3300041407 Ga0439447_000519 Ga0439447_000519_12137_12790 217
523 3300041407 Ga0439447_001146 Ga0439447_001146_2281_2934 217
524 3300041407 Ga0439447_005206 Ga0439447_005206_3263_3916 217
525 3300041410 Ga0439461_0017956 Ga0439461_0017956_53_706 217
526 3300041411 Ga0439466_0000101 Ga0439466_0000101_3787_4440 217
527 3300041411 Ga0439466_0003430 Ga0439466_0003430_1332_1985 217
528 3300041411 Ga0439466_0008454 Ga0439466_0008454_1238_1891 217
529 3300041411 Ga0439466_0008895 Ga0439466_0008895_862_1515 217
530 3300041411 Ga0439466_0013095 Ga0439466_0013095_2351_3004 217
531 3300041411 Ga0439466_0051597 Ga0439466_0051597_50_703 217
532 3300041413 Ga0439465_0044696 Ga0439465_0044696_214_867 217
533 3300042006 Ga0439432_000233 Ga0439432_000233_3105_3758 217
534 3300042006 Ga0439432_008552 Ga0439432_008552_1076_1729 217
535 3300042006 Ga0439432_016390 Ga0439432_016390_1413_2066 217
536 3300042009 Ga0439451_000450 Ga0439451_000450_131_784 217
537 3300042009 Ga0439451_006682 Ga0439451_006682_468_1121 217
538 3300042009 Ga0439451_006802 Ga0439451_006802_468_1121 217
539 3300042010 Ga0439452_000287 Ga0439452_000287_4299_4952 217
540 3300042010 Ga0439452_000939 Ga0439452_000939_702_1481 217
541 3300042010 Ga0439452_001970 Ga0439452_001970_2920_3573 217
542 3300042010 Ga0439452_004038 Ga0439452_004038_2627_3280 217
543 3300042010 Ga0439452_006076 Ga0439452_006076_853_1506 217
544 3300042013 Ga0439456_000745 Ga0439456_000745_5922_6575 217
545 3300042013 Ga0439456_001138 Ga0439456_001138_4540_5193 217
546 3300042013 Ga0439456_001454 Ga0439456_001454_363_1142 217
547 3300042013 Ga0439456_008929 Ga0439456_008929_1339_1992 217
548 3300042013 Ga0439456_026889 Ga0439456_026889_131_784 217
549 3300042013 Ga0439456_058581 Ga0439456_058581_159_812 217
550 3300042016 Ga0439463_000007 Ga0439463_000007_30435_31088 217
551 3300042016 Ga0439463_004030 Ga0439463_004030_2513_3166 217
552 3300042115 Ga0450911_000781 Ga0450911_000781_248_901 217
553 3300042115 Ga0450911_001463 Ga0450911_001463_3264_3917 217
554 3300042115 Ga0450911_002978 Ga0450911_002978_1326_1979 217
555 3300042121 Ga0450919_014287 Ga0450919_014287_130_783 217
556 3300042122 Ga0450920_000220 Ga0450920_000220_7033_7686 217
557 3300042124 Ga0450922_004730 Ga0450922_004730_109_762 217
558 3300042127 Ga0450890_000293 Ga0450890_000293_3826_4479 217
559 3300042130 Ga0450892_006597 Ga0450892_006597_147_800 217
560 3300042138 Ga0450903_000835 Ga0450903_000835_3404_4057 217
561 3300042138 Ga0450903_002032 Ga0450903_002032_2309_3088 217
562 3300042138 Ga0450903_004133 Ga0450903_004133_1646_2299 217
563 3300042138 Ga0450903_004819 Ga0450903_004819_349_1002 217
564 3300042139 Ga0450904_000497 Ga0450904_000497_769_1422 217
565 3300042142 Ga0450905_009553 Ga0450905_009553_360_1013 217
566 3300042145 Ga0450906_000952 Ga0450906_000952_3663_4316 217
567 3300042145 Ga0450906_001246 Ga0450906_001246_2798_3451 217
568 3300042146 Ga0450907_000001 Ga0450907_000001_200172_200825 217
569 3300042146 Ga0450907_001863 Ga0450907_001863_1227_1880 217
570 3300042146 Ga0450907_007968 Ga0450907_007968_865_1518 217
571 3300042147 Ga0450910_000235 Ga0450910_000235_2539_3192 217
572 3300042156 Ga0439446_0000210 Ga0439446_0000210_2839_3492 217
573 3300042156 Ga0439446_0000222 Ga0439446_0000222_2992_3645 217
574 3300042156 Ga0439446_0003553 Ga0439446_0003553_1278_1931 217
575 3300042184 Ga0450908_001049 Ga0450908_001049_2769_3422 217
576 3300042185 Ga0450909_000158 Ga0450909_000158_3572_4225 217
577 3300042185 Ga0450909_000192 Ga0450909_000192_1537_2190 217
578 3300042435 Ga0439434_0000057 Ga0439434_0000057_16572_17225 217
579 3300042461 Ga0439460_0001544 Ga0439460_0001544_529_1182 217
580 3300042461 Ga0439460_0017057 Ga0439460_0017057_199_948 217
581 3300042532 Ga0450893_0014890 Ga0450893_0014890_509_1162 217
582 3300042993 Ga0439440_0000252 Ga0439440_0000252_2271_2924 217
583 3300042993 Ga0439440_0002205 Ga0439440_0002205_28_681 217
584 3300042993 Ga0439440_0012574 Ga0439440_0012574_436_1089 217
585 3300044656 Ga0466969_0013651 Ga0466969_0013651_425_1078 217
586 3300044684 Ga0466966_0012062 Ga0466966_0012062_3057_3710 217
587 3300044693 Ga0466961_0192849 Ga0466961_0192849_331_984 217
588 3300044706 Ga0466964_0174205 Ga0466964_0174205_348_1001 217
589 3300044735 Ga0466968_0013865 Ga0466968_0013865_75_728 217
590 3300044765 Ga0466970_0025318 Ga0466970_0025318_2256_2909 217
591 3300044842 Ga0466957_0037733 Ga0466957_0037733_150_803 217
592 3300045049 Ga0466959_0015461 Ga0466959_0015461_3986_4639 217
593 3300045836 Ga0466958_0018299 Ga0466958_0018299_3064_3717 217
594 3300045836 Ga0466958_0316142 Ga0466958_0316142_308_961 217
595 3300046452 Ga0495617_000204 Ga0495617_000204_10573_11226 217
596 3300046452 Ga0495617_001096 Ga0495617_001096_4588_5241 217
597 3300046452 Ga0495617_002458 Ga0495617_002458_2792_3445 217
598 3300046452 Ga0495617_002836 Ga0495617_002836_3049_3702 217
599 3300046452 Ga0495617_004958 Ga0495617_004958_3754_4407 217
600 3300046452 Ga0495617_005427 Ga0495617_005427_1599_2252 217
601 3300046452 Ga0495617_025087 Ga0495617_025087_846_1499 217
602 3300046452 Ga0495617_027628 Ga0495617_027628_349_1002 217
603 3300046452 Ga0495617_045668 Ga0495617_045668_560_1213 217
604 3300046453 Ga0495627_001657 Ga0495627_001657_2126_2779 217
605 3300046453 Ga0495627_034261 Ga0495627_034261_113_766 217
606 3300046455 Ga0495603_0002282 Ga0495603_0002282_7840_8493 217
607 3300046455 Ga0495603_0045148 Ga0495603_0045148_1475_2128 217
608 3300046457 Ga0495590_0000114 Ga0495590_0000114_36163_36816 217
609 3300046457 Ga0495590_0000628 Ga0495590_0000628_3154_3807 217
610 3300046457 Ga0495590_0004576 Ga0495590_0004576_3969_4622 217
611 3300046457 Ga0495590_0012548 Ga0495590_0012548_2038_2691 217
612 3300046457 Ga0495590_0044981 Ga0495590_0044981_644_1297 217
613 3300046458 Ga0495591_000021 Ga0495591_000021_167127_167780 217
614 3300046458 Ga0495591_001154 Ga0495591_001154_5430_6083 217
615 3300046458 Ga0495591_004409 Ga0495591_004409_3770_4423 217
616 3300046458 Ga0495591_009642 Ga0495591_009642_2001_2654 217
617 3300046458 Ga0495591_011532 Ga0495591_011532_255_908 217
618 3300046458 Ga0495591_017906 Ga0495591_017906_1633_2286 217
619 3300046458 Ga0495591_022356 Ga0495591_022356_1340_1993 217
620 3300046460 Ga0495638_0001071 Ga0495638_0001071_15933_16586 217
621 3300046460 Ga0495638_0001173 Ga0495638_0001173_10728_11381 217
622 3300046460 Ga0495638_0001643 Ga0495638_0001643_7682_8335 217
623 3300046460 Ga0495638_0001675 Ga0495638_0001675_15158_15811 217
624 3300046460 Ga0495638_0003795 Ga0495638_0003795_4415_5068 217
625 3300046460 Ga0495638_0006166 Ga0495638_0006166_6667_7320 217
626 3300046460 Ga0495638_0012543 Ga0495638_0012543_4181_4834 217
627 3300046460 Ga0495638_0020265 Ga0495638_0020265_491_1285 217
628 3300046460 Ga0495638_0036061 Ga0495638_0036061_364_1017 217
629 3300046460 Ga0495638_0040995 Ga0495638_0040995_2126_2779 217
630 3300046460 Ga0495638_0126384 Ga0495638_0126384_775_1428 217
631 3300046460 Ga0495638_0153048 Ga0495638_0153048_70_723 217
632 3300046463 Ga0495653_0101918 Ga0495653_0101918_382_1035 217
633 3300046471 Ga0495650_0001066 Ga0495650_0001066_263_916 217
634 3300046471 Ga0495650_0001224 Ga0495650_0001224_24675_25328 217
635 3300046471 Ga0495650_0001886 Ga0495650_0001886_7116_7769 217
636 3300046471 Ga0495650_0002534 Ga0495650_0002534_4667_5461 217
637 3300046471 Ga0495650_0008706 Ga0495650_0008706_1071_1724 217
638 3300046474 Ga0495605_0000391 Ga0495605_0000391_26663_27316 217
639 3300046474 Ga0495605_0000446 Ga0495605_0000446_7708_8361 217
640 3300046474 Ga0495605_0000751 Ga0495605_0000751_7589_8242 217
641 3300046474 Ga0495605_0003866 Ga0495605_0003866_1538_2191 217
642 3300046474 Ga0495605_0010911 Ga0495605_0010911_3284_3937 217
643 3300046474 Ga0495605_0043419 Ga0495605_0043419_688_1341 217
644 3300046474 Ga0495605_0052934 Ga0495605_0052934_643_1296 217
645 3300046474 Ga0495605_0103442 Ga0495605_0103442_529_1182 217
646 3300046475 Ga0495639_0001776 Ga0495639_0001776_6356_7009 217
647 3300046491 Ga0495584_0000019 Ga0495584_0000019_81663_82316 217
648 3300046491 Ga0495584_0000176 Ga0495584_0000176_42621_43274 217
649 3300046491 Ga0495584_0000296 Ga0495584_0000296_12942_13595 217
650 3300046491 Ga0495584_0000568 Ga0495584_0000568_7884_8537 217
651 3300046491 Ga0495584_0004039 Ga0495584_0004039_5583_6236 217
652 3300046491 Ga0495584_0005778 Ga0495584_0005778_970_1623 217
653 3300046491 Ga0495584_0015243 Ga0495584_0015243_2904_3557 217
654 3300046491 Ga0495584_0073558 Ga0495584_0073558_281_934 217
655 3300046491 Ga0495584_0251961 Ga0495584_0251961_200_853 217
656 3300046492 Ga0495585_0000165 Ga0495585_0000165_45095_45748 217
657 3300046492 Ga0495585_0004259 Ga0495585_0004259_3064_3717 217
658 3300046492 Ga0495585_0016293 Ga0495585_0016293_3349_4002 217
659 3300046492 Ga0495585_0041395 Ga0495585_0041395_1761_2414 217
660 3300046492 Ga0495585_0071007 Ga0495585_0071007_36_689 217
661 3300046492 Ga0495585_0077305 Ga0495585_0077305_802_1455 217
662 3300046492 Ga0495585_0085811 Ga0495585_0085811_684_1337 217
663 3300046492 Ga0495585_0194445 Ga0495585_0194445_272_925 217
664 3300046492 Ga0495585_0239726 Ga0495585_0239726_197_850 217
665 3300046499 Ga0495594_0000316 Ga0495594_0000316_18999_19718 217
666 3300046499 Ga0495594_0001211 Ga0495594_0001211_7031_7684 217
667 3300046499 Ga0495594_0042317 Ga0495594_0042317_537_1190 217
668 3300046500 Ga0495596_0000209 Ga0495596_0000209_30044_30838 217
669 3300046501 Ga0495607_0000188 Ga0495607_0000188_15626_16279 217
670 3300046501 Ga0495607_0000709 Ga0495607_0000709_6628_7281 217
671 3300046501 Ga0495607_0006930 Ga0495607_0006930_4715_5368 217
672 3300046501 Ga0495607_0012463 Ga0495607_0012463_937_1590 217
673 3300046501 Ga0495607_0049007 Ga0495607_0049007_1238_1891 217
674 3300046501 Ga0495607_0051036 Ga0495607_0051036_1036_1689 217
675 3300046501 Ga0495607_0059322 Ga0495607_0059322_608_1261 217
676 3300046501 Ga0495607_0113049 Ga0495607_0113049_389_1042 217
677 3300046506 Ga0495583_0001277 Ga0495583_0001277_11844_12497 217
678 3300046506 Ga0495583_0005600 Ga0495583_0005600_4894_5547 217
679 3300046506 Ga0495583_0010683 Ga0495583_0010683_4222_4875 217
680 3300046506 Ga0495583_0023101 Ga0495583_0023101_957_1610 217
681 3300046507 Ga0495606_0000347 Ga0495606_0000347_9141_9905 217
682 3300046507 Ga0495606_0004664 Ga0495606_0004664_8143_8796 217
683 3300046507 Ga0495606_0029004 Ga0495606_0029004_2964_3758 217
684 3300046507 Ga0495606_0060018 Ga0495606_0060018_1600_2253 217
685 3300046507 Ga0495606_0283666 Ga0495606_0283666_80_733 217
686 3300046512 Ga0495610_0004063 Ga0495610_0004063_5713_6366 217
687 3300046512 Ga0495610_0005350 Ga0495610_0005350_951_1604 217
688 3300046512 Ga0495610_0006965 Ga0495610_0006965_715_1368 217
689 3300046512 Ga0495610_0009997 Ga0495610_0009997_2096_2749 217
690 3300046512 Ga0495610_0022448 Ga0495610_0022448_2025_2819 217
691 3300046512 Ga0495610_0030486 Ga0495610_0030486_2081_2734 217
692 3300046512 Ga0495610_0038437 Ga0495610_0038437_794_1447 217
693 3300046512 Ga0495610_0044935 Ga0495610_0044935_882_1535 217
694 3300046512 Ga0495610_0071691 Ga0495610_0071691_861_1514 217
695 3300046513 Ga0495616_0001952 Ga0495616_0001952_6488_7141 217
696 3300046513 Ga0495616_0006371 Ga0495616_0006371_2423_3076 217
697 3300046513 Ga0495616_0017139 Ga0495616_0017139_2994_3647 217
698 3300046513 Ga0495616_0028257 Ga0495616_0028257_903_1556 217
699 3300046513 Ga0495616_0034385 Ga0495616_0034385_588_1382 217
700 3300046513 Ga0495616_0127435 Ga0495616_0127435_154_807 217
701 3300046513 Ga0495616_0190414 Ga0495616_0190414_220_873 217
702 3300046513 Ga0495616_0214611 Ga0495616_0214611_148_801 217
703 3300046515 Ga0495620_0000308 Ga0495620_0000308_4658_5311 217
704 3300046515 Ga0495620_0002940 Ga0495620_0002940_7376_8029 217
705 3300046515 Ga0495620_0036621 Ga0495620_0036621_634_1428 217
706 3300046515 Ga0495620_0103192 Ga0495620_0103192_220_873 217
707 3300046517 Ga0495630_0001104 Ga0495630_0001104_6563_7216 217
708 3300046517 Ga0495630_0400453 Ga0495630_0400453_174_827 217
709 3300046518 Ga0495631_0000005 Ga0495631_0000005_91514_92167 217
710 3300046518 Ga0495631_0002159 Ga0495631_0002159_352_1005 217
711 3300046518 Ga0495631_0029040 Ga0495631_0029040_758_1411 217
712 3300046518 Ga0495631_0042894 Ga0495631_0042894_709_1362 217
713 3300046519 Ga0495632_0000693 Ga0495632_0000693_29626_30279 217
714 3300046519 Ga0495632_0001677 Ga0495632_0001677_8143_8796 217
715 3300046519 Ga0495632_0003778 Ga0495632_0003778_6111_6905 217
716 3300046519 Ga0495632_0005075 Ga0495632_0005075_1356_2009 217
717 3300046519 Ga0495632_0008319 Ga0495632_0008319_4612_5265 217
718 3300046519 Ga0495632_0015102 Ga0495632_0015102_1156_1809 217
719 3300046519 Ga0495632_0015668 Ga0495632_0015668_3435_4088 217
720 3300046519 Ga0495632_0016160 Ga0495632_0016160_761_1414 217
721 3300046519 Ga0495632_0025415 Ga0495632_0025415_1312_1965 217
722 3300046519 Ga0495632_0066506 Ga0495632_0066506_901_1665 217
723 3300046519 Ga0495632_0093900 Ga0495632_0093900_228_881 217
724 3300046520 Ga0495637_0000499 Ga0495637_0000499_8981_9634 217
725 3300046520 Ga0495637_0001804 Ga0495637_0001804_4003_4656 217
726 3300046520 Ga0495637_0003265 Ga0495637_0003265_5417_6070 217
727 3300046520 Ga0495637_0010990 Ga0495637_0010990_2802_3455 217
728 3300046520 Ga0495637_0012856 Ga0495637_0012856_2185_2838 217
729 3300046520 Ga0495637_0016974 Ga0495637_0016974_84_737 217
730 3300046520 Ga0495637_0037619 Ga0495637_0037619_1073_1726 217
731 3300046520 Ga0495637_0076372 Ga0495637_0076372_57_710 217
732 3300046522 Ga0495643_0005530 Ga0495643_0005530_7407_8060 217
733 3300046522 Ga0495643_0006979 Ga0495643_0006979_5727_6380 217
734 3300046522 Ga0495643_0009829 Ga0495643_0009829_629_1282 217
735 3300046522 Ga0495643_0014019 Ga0495643_0014019_2300_3094 217
736 3300046522 Ga0495643_0061386 Ga0495643_0061386_574_1227 217
737 3300046523 Ga0495644_0000108 Ga0495644_0000108_29637_30290 217
738 3300046523 Ga0495644_0000143 Ga0495644_0000143_9120_9773 217
739 3300046523 Ga0495644_0007098 Ga0495644_0007098_3286_3939 217
740 3300046524 Ga0495648_0000092 Ga0495648_0000092_11619_12272 217
741 3300046524 Ga0495648_0003675 Ga0495648_0003675_7663_8316 217
742 3300046524 Ga0495648_0004541 Ga0495648_0004541_9609_10262 217
743 3300046524 Ga0495648_0008097 Ga0495648_0008097_3350_4003 217
744 3300046524 Ga0495648_0008400 Ga0495648_0008400_316_969 217
745 3300046524 Ga0495648_0010547 Ga0495648_0010547_4955_5608 217
746 3300046524 Ga0495648_0011830 Ga0495648_0011830_2159_2812 217
747 3300046524 Ga0495648_0135431 Ga0495648_0135431_63_716 217
748 3300046526 Ga0495666_0000088 Ga0495666_0000088_29000_29653 217
749 3300046526 Ga0495666_0014084 Ga0495666_0014084_3043_3696 217
750 3300046526 Ga0495666_0067413 Ga0495666_0067413_1039_1692 217
751 3300046528 Ga0495642_0000003 Ga0495642_0000003_168611_169264 217
752 3300046528 Ga0495642_0000018 Ga0495642_0000018_10461_11114 217
753 3300046528 Ga0495642_0000599 Ga0495642_0000599_8143_8796 217
754 3300046530 Ga0495654_0000088 Ga0495654_0000088_78263_78916 217
755 3300046530 Ga0495654_0001088 Ga0495654_0001088_12739_13392 217
756 3300046530 Ga0495654_0001307 Ga0495654_0001307_2460_3113 217
757 3300046530 Ga0495654_0004804 Ga0495654_0004804_6030_6683 217
758 3300046530 Ga0495654_0007459 Ga0495654_0007459_1305_1958 217
759 3300046530 Ga0495654_0008806 Ga0495654_0008806_1474_2127 217
760 3300046530 Ga0495654_0016497 Ga0495654_0016497_2949_3743 217
761 3300046530 Ga0495654_0018347 Ga0495654_0018347_541_1194 217
762 3300046530 Ga0495654_0025747 Ga0495654_0025747_2117_2770 217
763 3300046530 Ga0495654_0031557 Ga0495654_0031557_321_974 217
764 3300046530 Ga0495654_0084049 Ga0495654_0084049_328_981 217
765 3300046530 Ga0495654_0107052 Ga0495654_0107052_574_1227 217
766 3300046530 Ga0495654_0111662 Ga0495654_0111662_327_980 217
767 3300046538 Ga0495609_0000409 Ga0495609_0000409_85_738 217
768 3300046538 Ga0495609_0002918 Ga0495609_0002918_7061_7714 217
769 3300046538 Ga0495609_0026937 Ga0495609_0026937_198_851 217
770 3300046538 Ga0495609_0125128 Ga0495609_0125128_103_756 217
771 3300046542 Ga0495597_0003792 Ga0495597_0003792_1089_1742 217
772 3300046542 Ga0495597_0005486 Ga0495597_0005486_5990_6643 217
773 3300046542 Ga0495597_0009049 Ga0495597_0009049_1378_2031 217
774 3300046542 Ga0495597_0011043 Ga0495597_0011043_2180_2833 217
775 3300046542 Ga0495597_0096501 Ga0495597_0096501_360_1013 217
776 3300046542 Ga0495597_0115631 Ga0495597_0115631_403_1056 217
777 3300046557 Ga0495622_0000193 Ga0495622_0000193_32615_33268 217
778 3300046557 Ga0495622_0000347 Ga0495622_0000347_1444_2163 217
779 3300046557 Ga0495622_0007820 Ga0495622_0007820_1624_2277 217
780 3300046557 Ga0495622_0042330 Ga0495622_0042330_20_673 217
781 3300046558 Ga0495633_0017843 Ga0495633_0017843_933_1586 217
782 3300046558 Ga0495633_0096991 Ga0495633_0096991_605_1258 217
783 3300046615 Ga0495656_0003888 Ga0495656_0003888_953_1606 217
784 3300046615 Ga0495656_0007882 Ga0495656_0007882_2253_2906 217
785 3300046615 Ga0495656_0024651 Ga0495656_0024651_950_1603 217
786 3300046615 Ga0495656_0058921 Ga0495656_0058921_391_1044 217
787 3300046616 Ga0495668_0000467 Ga0495668_0000467_42683_43477 217
788 3300046616 Ga0495668_0009442 Ga0495668_0009442_4237_4890 217
789 3300046648 Ga0495611_0007442 Ga0495611_0007442_2212_2865 217
790 3300046660 Ga0495625_0001435 Ga0495625_0001435_10095_10748 217
791 3300046660 Ga0495625_0005691 Ga0495625_0005691_6390_7184 217
792 3300046660 Ga0495625_0007778 Ga0495625_0007778_7893_8546 217
793 3300046660 Ga0495625_0014487 Ga0495625_0014487_3799_4452 217
794 3300046660 Ga0495625_0015160 Ga0495625_0015160_491_1144 217
795 3300046660 Ga0495625_0045240 Ga0495625_0045240_492_1145 217
796 3300046660 Ga0495625_0089279 Ga0495625_0089279_1277_1930 217
797 3300046664 Ga0495659_0000002 Ga0495659_0000002_103889_104542 217
798 3300046664 Ga0495659_0000641 Ga0495659_0000641_5263_5916 217
799 3300046664 Ga0495659_0003771 Ga0495659_0003771_716_1369 217
800 3300046665 Ga0495661_0013350 Ga0495661_0013350_220_873 217
801 3300046665 Ga0495661_0031938 Ga0495661_0031938_2354_3007 217
802 3300046665 Ga0495661_0082342 Ga0495661_0082342_559_1212 217
803 3300046674 Ga0495588_0004596 Ga0495588_0004596_3144_3797 217
804 3300046674 Ga0495588_0019536 Ga0495588_0019536_1362_2015 217
805 3300046674 Ga0495588_0123428 Ga0495588_0123428_364_1017 217
806 3300046679 Ga0495623_0001478 Ga0495623_0001478_11512_12168 217
807 3300046679 Ga0495623_0002571 Ga0495623_0002571_1637_2290 217
808 3300046684 Ga0495669_0000279 Ga0495669_0000279_26581_27234 217
809 3300046684 Ga0495669_0001673 Ga0495669_0001673_2413_3066 217
810 3300046691 Ga0495670_0000112 Ga0495670_0000112_2240_2893 217
811 3300046691 Ga0495670_0000620 Ga0495670_0000620_11279_11932 217
812 3300046691 Ga0495670_0001315 Ga0495670_0001315_3408_4061 217
813 3300046691 Ga0495670_0013560 Ga0495670_0013560_113_766 217
814 3300046691 Ga0495670_0017942 Ga0495670_0017942_2748_3401 217
815 3300046691 Ga0495670_0022028 Ga0495670_0022028_414_1067 217
816 3300046691 Ga0495670_0032135 Ga0495670_0032135_274_927 217
817 3300046691 Ga0495670_0062329 Ga0495670_0062329_686_1339 217
818 3300046691 Ga0495670_0089262 Ga0495670_0089262_17_670 217
819 3300046691 Ga0495670_0108992 Ga0495670_0108992_436_1089 217
820 3300046691 Ga0495670_0189817 Ga0495670_0189817_41_694 217
821 3300046692 Ga0495671_0000066 Ga0495671_0000066_54015_54668 217
822 3300046692 Ga0495671_0000160 Ga0495671_0000160_50723_51376 217
823 3300046692 Ga0495671_0005604 Ga0495671_0005604_6612_7265 217
824 3300046692 Ga0495671_0019876 Ga0495671_0019876_2520_3173 217
825 3300046692 Ga0495671_0033611 Ga0495671_0033611_365_1018 217
826 3300046692 Ga0495671_0094409 Ga0495671_0094409_160_813 217
827 3300046692 Ga0495671_0094867 Ga0495671_0094867_408_1061 217
828 3300046692 Ga0495671_0121270 Ga0495671_0121270_41_694 217
829 3300046692 Ga0495671_0135752 Ga0495671_0135752_436_1089 217
830 3300046692 Ga0495671_0252794 Ga0495671_0252794_120_773 217
831 3300046694 Ga0495649_0000013 Ga0495649_0000013_14222_14875 217
832 3300046694 Ga0495649_0000814 Ga0495649_0000814_17454_18107 217
833 3300046694 Ga0495649_0001154 Ga0495649_0001154_4814_5467 217
834 3300046694 Ga0495649_0005808 Ga0495649_0005808_4884_5537 217
835 3300046694 Ga0495649_0006677 Ga0495649_0006677_4583_5236 217
836 3300046694 Ga0495649_0016472 Ga0495649_0016472_579_1232 217
837 3300046694 Ga0495649_0043216 Ga0495649_0043216_851_1504 217
838 3300046694 Ga0495649_0095279 Ga0495649_0095279_511_1164 217
839 3300046694 Ga0495649_0164511 Ga0495649_0164511_32_685 217
840 3300046794 Ga0495589_0000123 Ga0495589_0000123_56316_56969 217
841 3300046794 Ga0495589_0001395 Ga0495589_0001395_12628_13281 217
842 3300046794 Ga0495589_0003200 Ga0495589_0003200_1813_2466 217
843 3300046794 Ga0495589_0005346 Ga0495589_0005346_1558_2211 217
844 3300046794 Ga0495589_0006827 Ga0495589_0006827_5190_5843 217
845 3300046794 Ga0495589_0033379 Ga0495589_0033379_191_844 217
846 3300046794 Ga0495589_0041175 Ga0495589_0041175_1250_2044 217
847 3300046794 Ga0495589_0054318 Ga0495589_0054318_841_1494 217
848 3300046794 Ga0495589_0133423 Ga0495589_0133423_249_902 217
849 3300046809 Ga0495600_0025520 Ga0495600_0025520_1905_2558 217
850 3300046810 Ga0495660_0001517 Ga0495660_0001517_14965_15618 217
851 3300046810 Ga0495660_0001634 Ga0495660_0001634_5386_6039 217
852 3300046810 Ga0495660_0002240 Ga0495660_0002240_10663_11316 217
853 3300046810 Ga0495660_0013001 Ga0495660_0013001_1475_2128 217
854 3300046810 Ga0495660_0019231 Ga0495660_0019231_25_678 217
855 3300046810 Ga0495660_0020036 Ga0495660_0020036_670_1323 217
856 3300046810 Ga0495660_0023755 Ga0495660_0023755_1451_2104 217
857 3300046810 Ga0495660_0030094 Ga0495660_0030094_1242_1895 217
858 3300046810 Ga0495660_0030283 Ga0495660_0030283_1027_1680 217
859 3300046810 Ga0495660_0042483 Ga0495660_0042483_1316_1969 217
860 3300046810 Ga0495660_0065169 Ga0495660_0065169_1275_1928 217
861 3300046810 Ga0495660_0081658 Ga0495660_0081658_216_869 217
862 3300046810 Ga0495660_0128573 Ga0495660_0128573_298_951 217
863 3300047317 Ga0495604_0001925 Ga0495604_0001925_14973_15626 217
864 3300047318 Ga0495636_0007111 Ga0495636_0007111_376_1029 217
865 3300047318 Ga0495636_0066107 Ga0495636_0066107_342_995 217
866 3300047319 Ga0495674_0005938 Ga0495674_0005938_1565_2218 217
867 3300047320 Ga0495672_0000442 Ga0495672_0000442_20016_20669 217
868 3300047320 Ga0495672_0000773 Ga0495672_0000773_28118_28771 217
869 3300047320 Ga0495672_0000891 Ga0495672_0000891_22373_23026 217
870 3300047320 Ga0495672_0001663 Ga0495672_0001663_8240_8893 217
871 3300047320 Ga0495672_0001947 Ga0495672_0001947_12017_12670 217
872 3300047320 Ga0495672_0006676 Ga0495672_0006676_3932_4585 217
873 3300047320 Ga0495672_0010062 Ga0495672_0010062_2096_2749 217
874 3300047320 Ga0495672_0045791 Ga0495672_0045791_1684_2337 217
875 3300047320 Ga0495672_0101971 Ga0495672_0101971_500_1153 217
876 3300047322 Ga0495680_0053758 Ga0495680_0053758_2172_2825 217
877 3300047322 Ga0495680_0434782 Ga0495680_0434782_138_791 217
878 3300047323 Ga0495683_0000010 Ga0495683_0000010_120789_121442 217
879 3300047323 Ga0495683_0000337 Ga0495683_0000337_25152_25805 217
880 3300047323 Ga0495683_0002492 Ga0495683_0002492_2973_3626 217
881 3300047323 Ga0495683_0006146 Ga0495683_0006146_5635_6288 217
882 3300047323 Ga0495683_0011122 Ga0495683_0011122_3939_4733 217
883 3300047323 Ga0495683_0011848 Ga0495683_0011848_3349_4002 217
884 3300047323 Ga0495683_0014403 Ga0495683_0014403_2967_3620 217
885 3300047323 Ga0495683_0018156 Ga0495683_0018156_1741_2394 217
886 3300047323 Ga0495683_0020399 Ga0495683_0020399_627_1280 217
887 3300047323 Ga0495683_0038365 Ga0495683_0038365_1089_1742 217
888 3300047443 Ga0495687_003205 Ga0495687_003205_4484_5137 217
889 3300047443 Ga0495687_004845 Ga0495687_004845_2963_3616 217
890 3300047443 Ga0495687_007840 Ga0495687_007840_2609_3262 217
891 3300047445 Ga0495677_0000471 Ga0495677_0000471_370_1023 217
892 3300047446 Ga0495679_001961 Ga0495679_001961_7804_8457 217
893 3300047446 Ga0495679_009228 Ga0495679_009228_3255_3908 217
894 3300047446 Ga0495679_012799 Ga0495679_012799_346_999 217
895 3300047447 Ga0495685_012690 Ga0495685_012690_708_1361 217
896 3300047469 Ga0495673_0000434 Ga0495673_0000434_35433_36086 217
897 3300047469 Ga0495673_0000553 Ga0495673_0000553_27652_28305 217
898 3300047469 Ga0495673_0001485 Ga0495673_0001485_8725_9378 217
899 3300047469 Ga0495673_0002017 Ga0495673_0002017_4674_5327 217
900 3300047469 Ga0495673_0002389 Ga0495673_0002389_6142_6795 217
901 3300047469 Ga0495673_0005784 Ga0495673_0005784_5316_5969 217
902 3300047469 Ga0495673_0046284 Ga0495673_0046284_980_1633 217
903 3300047470 Ga0495681_0000259 Ga0495681_0000259_40544_41197 217
904 3300047470 Ga0495681_0000262 Ga0495681_0000262_23955_24749 217
905 3300047470 Ga0495681_0000419 Ga0495681_0000419_29234_29887 217
906 3300047470 Ga0495681_0000703 Ga0495681_0000703_7747_8400 217
907 3300047470 Ga0495681_0009052 Ga0495681_0009052_88_741 217
908 3300047470 Ga0495681_0010676 Ga0495681_0010676_3919_4572 217
909 3300047470 Ga0495681_0024186 Ga0495681_0024186_794_1447 217
910 3300047470 Ga0495681_0031963 Ga0495681_0031963_231_884 217
911 3300047470 Ga0495681_0039958 Ga0495681_0039958_912_1565 217
912 3300047470 Ga0495681_0183092 Ga0495681_0183092_87_740 217
913 3300047471 Ga0495684_0035906 Ga0495684_0035906_330_983 217
914 3300047472 Ga0495686_0008941 Ga0495686_0008941_4469_5122 217
915 3300047472 Ga0495686_0041603 Ga0495686_0041603_972_1766 217
916 3300047472 Ga0495686_0138116 Ga0495686_0138116_42_695 217
917 3300047472 Ga0495686_0144097 Ga0495686_0144097_448_1101 217
918 3300047472 Ga0495686_0150522 Ga0495686_0150522_264_917 217
919 3300047673 Ga0495593_0000018 Ga0495593_0000018_42954_43607 217
920 3300047673 Ga0495593_0000777 Ga0495593_0000777_4906_5559 217
921 3300048090 Ga0495615_0048847 Ga0495615_0048847_359_1012 217
922 3300048091 Ga0495626_0000031 Ga0495626_0000031_116631_117284 217
923 3300048091 Ga0495626_0000079 Ga0495626_0000079_14229_14882 217
924 3300048091 Ga0495626_0000242 Ga0495626_0000242_54572_55366 217
925 3300048091 Ga0495626_0000329 Ga0495626_0000329_31657_32310 217
926 3300048091 Ga0495626_0000759 Ga0495626_0000759_9258_9911 217
927 3300048091 Ga0495626_0001357 Ga0495626_0001357_5514_6167 217
928 3300048091 Ga0495626_0005157 Ga0495626_0005157_449_1102 217
929 3300048091 Ga0495626_0013146 Ga0495626_0013146_2098_2751 217
930 3300048091 Ga0495626_0014268 Ga0495626_0014268_3360_4013 217
931 3300048905 Ga0496102_0235272 Ga0496102_0235272_579_1232 217
932 3300048905 Ga0496102_0380623 Ga0496102_0380623_530_1309 217
933 3300048909 Ga0496106_0189660 Ga0496106_0189660_204_857 217
934 3300048910 Ga0496107_0177192 Ga0496107_0177192_95_748 217
935 3300048913 Ga0496110_0078555 Ga0496110_0078555_2110_2763 217
936 3300048913 Ga0496110_0099864 Ga0496110_0099864_1463_2116 217
937 3300048913 Ga0496110_0666980 Ga0496110_0666980_144_923 217
938 3300048914 Ga0496111_0188066 Ga0496111_0188066_480_1133 217
939 3300048915 Ga0496112_0014420 Ga0496112_0014420_208_861 217
940 3300048916 Ga0496113_0413008 Ga0496113_0413008_410_1063 217
941 3300048919 Ga0496116_0001237 Ga0496116_0001237_10362_11015 217
942 3300048919 Ga0496116_0002307 Ga0496116_0002307_3566_4219 217
943 3300048920 Ga0496117_0129555 Ga0496117_0129555_449_1102 217
944 3300048921 Ga0496118_0195987 Ga0496118_0195987_91_840 217
945 3300048924 Ga0496121_0095310 Ga0496121_0095310_1598_2251 217
946 3300048925 Ga0496122_0002525 Ga0496122_0002525_13817_14470 217
947 3300048927 Ga0496124_0002900 Ga0496124_0002900_12761_13414 217
948 3300048927 Ga0496124_0010024 Ga0496124_0010024_1988_2767 217
949 3300048927 Ga0496124_0043609 Ga0496124_0043609_1867_2520 217
950 3300048927 Ga0496124_0093915 Ga0496124_0093915_828_1481 217
951 3300048928 Ga0496125_0004944 Ga0496125_0004944_14250_14903 217
952 3300048928 Ga0496125_0018626 Ga0496125_0018626_3428_4081 217
953 3300049459 Ga0495678_000701 Ga0495678_000701_20554_21207 217
954 3300049459 Ga0495678_001245 Ga0495678_001245_5481_6134 217
955 3300049459 Ga0495678_005843 Ga0495678_005843_4341_4994 217
956 3300049459 Ga0495678_009163 Ga0495678_009163_3356_4009 217
957 3300049459 Ga0495678_022535 Ga0495678_022535_933_1727 217
958 3300049459 Ga0495678_024222 Ga0495678_024222_1073_1726 217
959 3300049459 Ga0495678_080520 Ga0495678_080520_409_1062 217
960 3300049459 Ga0495678_114602 Ga0495678_114602_202_855 217
961 3300049460 Ga0495682_0001309 Ga0495682_0001309_4586_5239 217
962 3300049460 Ga0495682_0003820 Ga0495682_0003820_5487_6140 217
963 3300049460 Ga0495682_0011988 Ga0495682_0011988_2408_3061 217
964 3300050491 nmdc:mga00v17_209825_c1 nmdc:mga00v17_209825_c1_52_705 217
965 3300050491 nmdc:mga00v17_58430_c1 nmdc:mga00v17_58430_c1_68_721 217
966 3300050514 nmdc:mga08x19_247988_c1 nmdc:mga08x19_247988_c1_28_681 217
967 3300050514 nmdc:mga08x19_26165_c1 nmdc:mga08x19_26165_c1_1329_2108 217
968 3300050514 nmdc:mga08x19_36808_c1 nmdc:mga08x19_36808_c1_2078_2731 217
969 3300050516 nmdc:mga0sz30_16921_c2 nmdc:mga0sz30_16921_c2_1247_1900 217
970 3300050516 nmdc:mga0sz30_75741_c1 nmdc:mga0sz30_75741_c1_672_1325 217

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

52

190

0.97

PF10417

1-cysPrx_C

C-terminal domain of 1-Cys peroxiredoxin

210

249

0.96

PF08534

Redoxin

Redoxin

51

208

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9534 3 217
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9519 2 217
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9488 3 217
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9473 2 217
5ykj-assembly1.cif.gz_A structural basis of the thiol resolving mechanism in yeast mitochondrial 1-cys peroxiredoxin via glutathione/thioredoxin systems 0.9384 2 214
ID Description Score Start End Superfamily
af_P34227_199_260_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9833 153 214 3.30.1020.10
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9687 153 216 3.30.1020.10
af_A0A0R0K508_6_109_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9628 5 106 3.40.30.10
af_O08709_156_224_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9606 153 216 3.30.1020.10
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9543 153 216 3.30.1020.10

Feature Viewer

pLDDT pTM Quality
91.41 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map