F487062
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 969 | 423 | 1938 | 254 |
Family's Representative Sequence
| Representative Sequence | 3300005458|Ga0070681_10043022|Ga0070681_100430223 |
| Length | 297 |
| Sequence | MEASKPRAGLPSGSCADSRIVHRWPIWYSAIQDSPGLLTMPLRALLYRRPSEPQTIQVVFDQAIYPVRVRHHRQARRYTLRIHAVTREVILTMPPRGSVREAKAFAQKHGGWIAARLRRLPEATPFIDGAIVPLRGVDHRIVHRPDARGTVWCDIGDGGEALLCVAGQRPHIDRRVSDFLRREALRDLDVASRAAAARLGVAIRRISVRDQASRWGSCSTTGVLSYSWRLILAPPFVLDYLAVHEVAHLVEMNHSSRFWRLVNDVCADTQRAKTWLDSHGADLHRYGAPRGDTQRRD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 8 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 9 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 10 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 13 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 14 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 15 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 16 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 17 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 88 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 90 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 91 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 92 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 93 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 97 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 98 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 99 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 100 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 102 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 103 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 104 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 105 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 106 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 107 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 108 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 109 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 110 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 112 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 113 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 127 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 148 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 217 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 219 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 224 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 225 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 226 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 227 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 228 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 229 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 230 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 231 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 232 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 233 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 234 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 235 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 236 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 237 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 238 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 240 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 241 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 244 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 247 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 248 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 249 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 251 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 252 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 253 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 254 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 255 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 256 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 257 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 258 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 260 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 261 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 262 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 263 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 264 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 265 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 266 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 267 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 270 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 271 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 272 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 273 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 274 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 275 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 276 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 277 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 278 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 279 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 280 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 281 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 282 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 283 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 284 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 356 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 357 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 358 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 359 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 360 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 361 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 364 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 365 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 366 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 367 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 368 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 369 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 370 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 371 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 401 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 402 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 403 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 404 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 405 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 406 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 420 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 422 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 423 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.48 |
| Metatranscriptomes | 0.31 |
| Isolates | 0.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.68 |
| Nodule | 0 |
| Rhizoplane | 8.15 |
| Rhizosphere | 88.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070681_10043022 | 3300005458 | Bacteria | 4525 |
| 2 | JGI24752J21851_1007370 | 3300001976 | Bacteria | 1434 |
| 3 | JGI24746J21847_1001303 | 3300001977 | Bacteria | 3984 |
| 4 | JGI24747J21853_1002926 | 3300001978 | Bacteria | 1440 |
| 5 | JGI24739J22299_10008549 | 3300001989 | Bacteria | 3822 |
| 6 | JGI24737J22298_10007957 | 3300001990 | Bacteria | 3563 |
| 7 | JGI24743J22301_10013113 | 3300001991 | Bacteria | 1516 |
| 8 | JGI24750J21931_1000131 | 3300002070 | Bacteria | 12000 |
| 9 | JGI24745J21846_1000345 | 3300002073 | Bacteria | 4027 |
| 10 | JGI24748J21848_1000453 | 3300002074 | Bacteria | 4556 |
| 11 | JGI24738J21930_10001862 | 3300002075 | Bacteria | 5707 |
| 12 | JGI24749J21850_1000396 | 3300002076 | Bacteria | 6488 |
| 13 | JGI24744J21845_10001151 | 3300002077 | Bacteria | 5146 |
| 14 | JGI24034J26672_10007089 | 3300002239 | Bacteria | 1625 |
| 15 | JGI24742J22300_10002797 | 3300002244 | Bacteria | 2816 |
| 16 | JGI25405J52794_10006392 | 3300003911 | Bacteria | 2153 |
| 17 | Ga0065715_10096672 | 3300005293 | Bacteria | 3828 |
| 18 | Ga0070676_10000453 | 3300005328 | Bacteria | 19576 |
| 19 | Ga0070683_100001364 | 3300005329 | Bacteria | 18687 |
| 20 | Ga0070690_100001804 | 3300005330 | Bacteria | 11329 |
| 21 | Ga0070690_100057455 | 3300005330 | Bacteria | 2497 |
| 22 | Ga0070670_100002480 | 3300005331 | Bacteria | 15214 |
| 23 | Ga0070670_100168389 | 3300005331 | Bacteria | 1900 |
| 24 | Ga0070677_10009496 | 3300005333 | Bacteria | 3300 |
| 25 | Ga0070677_10066993 | 3300005333 | Bacteria | 1499 |
| 26 | Ga0068869_100000405 | 3300005334 | Bacteria | 23497 |
| 27 | Ga0070666_10160023 | 3300005335 | Bacteria | 1573 |
| 28 | Ga0070680_100001735 | 3300005336 | Bacteria | 16008 |
| 29 | Ga0070680_100027948 | 3300005336 | Bacteria | 4521 |
| 30 | Ga0070680_100291189 | 3300005336 | Bacteria | 1384 |
| 31 | Ga0070682_100002414 | 3300005337 | Bacteria | 10344 |
| 32 | Ga0070682_100154193 | 3300005337 | Bacteria | 1579 |
| 33 | Ga0070682_100176982 | 3300005337 | Bacteria | 1487 |
| 34 | Ga0070682_100424359 | 3300005337 | Bacteria | 1011 |
| 35 | Ga0068868_100000515 | 3300005338 | Bacteria | 25838 |
| 36 | Ga0068868_100185549 | 3300005338 | Bacteria | 1728 |
| 37 | Ga0070660_100000183 | 3300005339 | Bacteria | 41529 |
| 38 | Ga0070660_100068495 | 3300005339 | Bacteria | 2766 |
| 39 | Ga0070660_100114899 | 3300005339 | Bacteria | 2145 |
| 40 | Ga0070689_100009233 | 3300005340 | Bacteria | 6984 |
| 41 | Ga0070689_100097368 | 3300005340 | Bacteria | 2326 |
| 42 | Ga0070687_100000164 | 3300005343 | Bacteria | 22998 |
| 43 | Ga0070687_100125341 | 3300005343 | Bacteria | 1475 |
| 44 | Ga0070661_100000411 | 3300005344 | Bacteria | 33139 |
| 45 | Ga0070661_100382866 | 3300005344 | Bacteria | 1109 |
| 46 | Ga0070692_10001516 | 3300005345 | Bacteria | 8503 |
| 47 | Ga0070668_100010802 | 3300005347 | Bacteria | 6792 |
| 48 | Ga0070669_100000114 | 3300005353 | Bacteria | 77340 |
| 49 | Ga0070675_100000148 | 3300005354 | Bacteria | 42270 |
| 50 | Ga0070671_100000070 | 3300005355 | Bacteria | 66294 |
| 51 | Ga0070671_100062159 | 3300005355 | Bacteria | 3110 |
| 52 | Ga0070671_100116149 | 3300005355 | Bacteria | 2250 |
| 53 | Ga0070671_100122683 | 3300005355 | Bacteria | 2187 |
| 54 | Ga0070674_100046877 | 3300005356 | Bacteria | 2959 |
| 55 | Ga0070673_100000214 | 3300005364 | Bacteria | 28832 |
| 56 | Ga0070673_100186245 | 3300005364 | Bacteria | 1780 |
| 57 | Ga0070688_100004754 | 3300005365 | Bacteria | 7096 |
| 58 | Ga0070688_100016083 | 3300005365 | Bacteria | 4270 |
| 59 | Ga0070688_100018545 | 3300005365 | Bacteria | 4018 |
| 60 | Ga0070659_100001224 | 3300005366 | Bacteria | 18647 |
| 61 | Ga0070667_100002018 | 3300005367 | Bacteria | 17982 |
| 62 | Ga0070667_100059896 | 3300005367 | Bacteria | 3221 |
| 63 | Ga0070667_100117137 | 3300005367 | Bacteria | 2314 |
| 64 | Ga0070667_100227143 | 3300005367 | Bacteria | 1663 |
| 65 | Ga0070667_100233289 | 3300005367 | Bacteria | 1641 |
| 66 | Ga0070703_10002903 | 3300005406 | Bacteria | 4906 |
| 67 | Ga0070709_10155741 | 3300005434 | Bacteria | 1584 |
| 68 | Ga0070709_10584571 | 3300005434 | Bacteria | 858 |
| 69 | Ga0070714_100020071 | 3300005435 | Bacteria | 5452 |
| 70 | Ga0070714_100027411 | 3300005435 | Bacteria | 4718 |
| 71 | Ga0070714_100056962 | 3300005435 | Bacteria | 3344 |
| 72 | Ga0070714_100179209 | 3300005435 | Bacteria | 1927 |
| 73 | Ga0070714_100352782 | 3300005435 | Bacteria | 1382 |
| 74 | Ga0070713_100000680 | 3300005436 | Bacteria | 21808 |
| 75 | Ga0070710_10006183 | 3300005437 | Bacteria | 5731 |
| 76 | Ga0070710_10057261 | 3300005437 | Bacteria | 2208 |
| 77 | Ga0070710_10151277 | 3300005437 | Bacteria | 1431 |
| 78 | Ga0070710_10234095 | 3300005437 | Bacteria | 1174 |
| 79 | Ga0070701_10000210 | 3300005438 | Bacteria | 18350 |
| 80 | Ga0070711_100179997 | 3300005439 | Bacteria | 1618 |
| 81 | Ga0070705_100000549 | 3300005440 | Bacteria | 21834 |
| 82 | Ga0070700_100000328 | 3300005441 | Bacteria | 24792 |
| 83 | Ga0070700_100165140 | 3300005441 | Bacteria | 1528 |
| 84 | Ga0070694_100013627 | 3300005444 | Bacteria | 5080 |
| 85 | Ga0070694_100401859 | 3300005444 | Bacteria | 1073 |
| 86 | Ga0070663_100000100 | 3300005455 | Bacteria | 39199 |
| 87 | Ga0070678_100001000 | 3300005456 | Bacteria | 14668 |
| 88 | Ga0070678_100288226 | 3300005456 | Bacteria | 1391 |
| 89 | Ga0070678_100488674 | 3300005456 | Bacteria | 1084 |
| 90 | Ga0070662_100008274 | 3300005457 | Bacteria | 6775 |
| 91 | Ga0070662_100085123 | 3300005457 | Bacteria | 2362 |
| 92 | Ga0070662_100111198 | 3300005457 | Bacteria | 2087 |
| 93 | Ga0070681_10001377 | 3300005458 | Bacteria | 21307 |
| 94 | Ga0070681_10068303 | 3300005458 | Bacteria | 3521 |
| 95 | Ga0070681_10156752 | 3300005458 | Bacteria | 2201 |
| 96 | Ga0070681_10225201 | 3300005458 | Bacteria | 1790 |
| 97 | Ga0070681_10254386 | 3300005458 | Bacteria | 1669 |
| 98 | Ga0068867_100001032 | 3300005459 | Bacteria | 19040 |
| 99 | Ga0068867_100078797 | 3300005459 | Bacteria | 2479 |
| 100 | Ga0070685_10010286 | 3300005466 | Bacteria | 4856 |
| 101 | Ga0070685_10024528 | 3300005466 | Bacteria | 3313 |
| 102 | Ga0070707_100054108 | 3300005468 | Bacteria | 3848 |
| 103 | Ga0070679_100002182 | 3300005530 | Bacteria | 17664 |
| 104 | Ga0070679_100023170 | 3300005530 | Bacteria | 6076 |
| 105 | Ga0070679_100107097 | 3300005530 | Bacteria | 2781 |
| 106 | Ga0070679_100138301 | 3300005530 | Bacteria | 2416 |
| 107 | Ga0070679_100277664 | 3300005530 | Bacteria | 1628 |
| 108 | Ga0070684_100000306 | 3300005535 | Bacteria | 33761 |
| 109 | Ga0070684_100086339 | 3300005535 | Bacteria | 2784 |
| 110 | Ga0070697_100172353 | 3300005536 | Bacteria | 1832 |
| 111 | Ga0068853_100006837 | 3300005539 | Bacteria | 9096 |
| 112 | Ga0070672_100000289 | 3300005543 | Bacteria | 28530 |
| 113 | Ga0070686_100000261 | 3300005544 | Bacteria | 36069 |
| 114 | Ga0070686_100003064 | 3300005544 | Bacteria | 9153 |
| 115 | Ga0070686_100230764 | 3300005544 | Bacteria | 1343 |
| 116 | Ga0070695_100012184 | 3300005545 | Bacteria | 5158 |
| 117 | Ga0070696_100005594 | 3300005546 | Bacteria | 8391 |
| 118 | Ga0070696_100048885 | 3300005546 | Bacteria | 2936 |
| 119 | Ga0070693_100000204 | 3300005547 | Bacteria | 27537 |
| 120 | Ga0070665_100046336 | 3300005548 | Bacteria | 4368 |
| 121 | Ga0070665_100425310 | 3300005548 | Bacteria | 1337 |
| 122 | Ga0070665_100522504 | 3300005548 | Bacteria | 1198 |
| 123 | Ga0070704_100000297 | 3300005549 | Bacteria | 21940 |
| 124 | Ga0070704_100149095 | 3300005549 | Bacteria | 1837 |
| 125 | Ga0068855_100004961 | 3300005563 | Bacteria | 16232 |
| 126 | Ga0070664_100002983 | 3300005564 | Bacteria | 13692 |
| 127 | Ga0070664_100313569 | 3300005564 | Bacteria | 1420 |
| 128 | Ga0068857_100001434 | 3300005577 | Bacteria | 18891 |
| 129 | Ga0068854_100005280 | 3300005578 | Bacteria | 8154 |
| 130 | Ga0068854_100127923 | 3300005578 | Bacteria | 1937 |
| 131 | Ga0068856_100009252 | 3300005614 | Bacteria | 9575 |
| 132 | Ga0068856_100072815 | 3300005614 | Bacteria | 3402 |
| 133 | Ga0070702_100000592 | 3300005615 | Bacteria | 13283 |
| 134 | Ga0068852_100000836 | 3300005616 | Bacteria | 20392 |
| 135 | Ga0068852_100045255 | 3300005616 | Bacteria | 3742 |
| 136 | Ga0068852_100080459 | 3300005616 | Bacteria | 2889 |
| 137 | Ga0068852_100208432 | 3300005616 | Bacteria | 1853 |
| 138 | Ga0068859_100002494 | 3300005617 | Bacteria | 18713 |
| 139 | Ga0068859_100472481 | 3300005617 | Bacteria | 1349 |
| 140 | Ga0068864_100000172 | 3300005618 | Bacteria | 59525 |
| 141 | Ga0068864_100380453 | 3300005618 | Bacteria | 1337 |
| 142 | Ga0068866_10000325 | 3300005718 | Bacteria | 22629 |
| 143 | Ga0068861_100002528 | 3300005719 | Bacteria | 11947 |
| 144 | Ga0068851_10026967 | 3300005834 | Bacteria | 2828 |
| 145 | Ga0068870_10000846 | 3300005840 | Bacteria | 11938 |
| 146 | Ga0068863_100002553 | 3300005841 | Bacteria | 18073 |
| 147 | Ga0068863_100088116 | 3300005841 | Bacteria | 2941 |
| 148 | Ga0068863_100193261 | 3300005841 | Bacteria | 1956 |
| 149 | Ga0068863_100545351 | 3300005841 | Bacteria | 1145 |
| 150 | Ga0068858_100001665 | 3300005842 | Bacteria | 22713 |
| 151 | Ga0068858_100155864 | 3300005842 | Bacteria | 2149 |
| 152 | Ga0068858_100480997 | 3300005842 | Bacteria | 1198 |
| 153 | Ga0068860_100001131 | 3300005843 | Bacteria | 29328 |
| 154 | Ga0068860_100282013 | 3300005843 | Bacteria | 1624 |
| 155 | Ga0068860_100341322 | 3300005843 | Bacteria | 1473 |
| 156 | Ga0068860_100346870 | 3300005843 | Bacteria | 1460 |
| 157 | Ga0068862_100185101 | 3300005844 | Bacteria | 1871 |
| 158 | Ga0081455_10000002 | 3300005937 | Bacteria | 460472 |
| 159 | Ga0081455_10002251 | 3300005937 | Bacteria | 22976 |
| 160 | Ga0081455_10162888 | 3300005937 | Bacteria | 1707 |
| 161 | Ga0081540_1000241 | 3300005983 | Bacteria | 57441 |
| 162 | Ga0070717_10006536 | 3300006028 | Bacteria | 8582 |
| 163 | Ga0070717_10021129 | 3300006028 | Bacteria | 5128 |
| 164 | Ga0070717_10100147 | 3300006028 | Bacteria | 2460 |
| 165 | Ga0070717_10309000 | 3300006028 | Bacteria | 1407 |
| 166 | Ga0070717_10320569 | 3300006028 | Bacteria | 1381 |
| 167 | Ga0075365_10317151 | 3300006038 | Bacteria | 1098 |
| 168 | Ga0075368_10019635 | 3300006042 | Bacteria | 2552 |
| 169 | Ga0075368_10126126 | 3300006042 | Bacteria | 1062 |
| 170 | Ga0075363_100081414 | 3300006048 | Unclassified | 1771 |
| 171 | Ga0075432_10002460 | 3300006058 | Bacteria | 6165 |
| 172 | Ga0070715_10011831 | 3300006163 | Bacteria | 3154 |
| 173 | Ga0070716_100000480 | 3300006173 | Bacteria | 16522 |
| 174 | Ga0070712_100104322 | 3300006175 | Bacteria | 2104 |
| 175 | Ga0075362_10022910 | 3300006177 | Bacteria | 2636 |
| 176 | Ga0075362_10086701 | 3300006177 | Bacteria | 1449 |
| 177 | Ga0075367_10011069 | 3300006178 | Bacteria | 4757 |
| 178 | Ga0075367_10040107 | 3300006178 | Bacteria | 2733 |
| 179 | Ga0075367_10182975 | 3300006178 | Bacteria | 1307 |
| 180 | Ga0075427_10000802 | 3300006194 | Bacteria | 3822 |
| 181 | Ga0075366_10000286 | 3300006195 | Bacteria | 22606 |
| 182 | Ga0075366_10054089 | 3300006195 | Bacteria | 2385 |
| 183 | Ga0097621_100000006 | 3300006237 | Bacteria | 134536 |
| 184 | Ga0097621_100028909 | 3300006237 | Bacteria | 4374 |
| 185 | Ga0075370_10011720 | 3300006353 | Bacteria | 4614 |
| 186 | Ga0075370_10097285 | 3300006353 | Bacteria | 1702 |
| 187 | Ga0068871_100001147 | 3300006358 | Bacteria | 17768 |
| 188 | Ga0068871_100038474 | 3300006358 | Bacteria | 3821 |
| 189 | Ga0075430_100000125 | 3300006846 | Bacteria | 48131 |
| 190 | Ga0075430_100328593 | 3300006846 | Bacteria | 1264 |
| 191 | Ga0075431_100007030 | 3300006847 | Bacteria | 11179 |
| 192 | Ga0075433_10000008 | 3300006852 | Bacteria | 75573 |
| 193 | Ga0075433_10021731 | 3300006852 | Bacteria | 5382 |
| 194 | Ga0075433_10078338 | 3300006852 | Bacteria | 2912 |
| 195 | Ga0075433_10175674 | 3300006852 | Bacteria | 1906 |
| 196 | Ga0075434_100000152 | 3300006871 | Bacteria | 42821 |
| 197 | Ga0075434_100003460 | 3300006871 | Bacteria | 14109 |
| 198 | Ga0075434_100059084 | 3300006871 | Bacteria | 3812 |
| 199 | Ga0075434_100098201 | 3300006871 | Bacteria | 2934 |
| 200 | Ga0075434_100104129 | 3300006871 | Bacteria | 2847 |
| 201 | Ga0075429_100000083 | 3300006880 | Bacteria | 49131 |
| 202 | Ga0068865_100000114 | 3300006881 | Bacteria | 40505 |
| 203 | Ga0075436_100006953 | 3300006914 | Bacteria | 7743 |
| 204 | Ga0075436_100076225 | 3300006914 | Bacteria | 2322 |
| 205 | Ga0097620_100002494 | 3300006931 | Bacteria | 18713 |
| 206 | Ga0097620_100472468 | 3300006931 | Bacteria | 1349 |
| 207 | Ga0075435_100012469 | 3300007076 | Bacteria | 6297 |
| 208 | Ga0075435_100057374 | 3300007076 | Bacteria | 3150 |
| 209 | Ga0075435_100243070 | 3300007076 | Bacteria | 1531 |
| 210 | Ga0075435_100269209 | 3300007076 | Bacteria | 1453 |
| 211 | Ga0099795_10000504 | 3300007788 | Bacteria | 7360 |
| 212 | Ga0099795_10049589 | 3300007788 | Bacteria | 1524 |
| 213 | Ga0105250_10054276 | 3300009092 | Bacteria | 1607 |
| 214 | Ga0105250_10069427 | 3300009092 | Bacteria | 1423 |
| 215 | Ga0105240_10012009 | 3300009093 | Bacteria | 12005 |
| 216 | Ga0105240_10015529 | 3300009093 | Bacteria | 10351 |
| 217 | Ga0111539_10001699 | 3300009094 | Bacteria | 29331 |
| 218 | Ga0111539_10019539 | 3300009094 | Bacteria | 8358 |
| 219 | Ga0111539_10145718 | 3300009094 | Bacteria | 2773 |
| 220 | Ga0111539_10315296 | 3300009094 | Bacteria | 1820 |
| 221 | Ga0105245_10000175 | 3300009098 | Bacteria | 61149 |
| 222 | Ga0105245_10278549 | 3300009098 | Bacteria | 1634 |
| 223 | Ga0105245_10477674 | 3300009098 | Bacteria | 1259 |
| 224 | Ga0105247_10001094 | 3300009101 | Bacteria | 20209 |
| 225 | Ga0105247_10018151 | 3300009101 | Bacteria | 4219 |
| 226 | Ga0105247_10093383 | 3300009101 | Bacteria | 1913 |
| 227 | Ga0114129_10000533 | 3300009147 | Bacteria | 46605 |
| 228 | Ga0114129_10010322 | 3300009147 | Bacteria | 13325 |
| 229 | Ga0105243_10000315 | 3300009148 | Bacteria | 53296 |
| 230 | Ga0105243_10106218 | 3300009148 | Bacteria | 2340 |
| 231 | Ga0105243_10157847 | 3300009148 | Bacteria | 1953 |
| 232 | Ga0105243_10434267 | 3300009148 | Bacteria | 1228 |
| 233 | Ga0105241_10000316 | 3300009174 | Bacteria | 36435 |
| 234 | Ga0105241_10107771 | 3300009174 | Bacteria | 2226 |
| 235 | Ga0105242_10000356 | 3300009176 | Bacteria | 36542 |
| 236 | Ga0105242_10015913 | 3300009176 | Bacteria | 5844 |
| 237 | Ga0105248_10001326 | 3300009177 | Bacteria | 27556 |
| 238 | Ga0105248_10007327 | 3300009177 | Bacteria | 12106 |
| 239 | Ga0105248_10010783 | 3300009177 | Bacteria | 10090 |
| 240 | Ga0105248_10224439 | 3300009177 | Bacteria | 2115 |
| 241 | Ga0105248_10416120 | 3300009177 | Bacteria | 1514 |
| 242 | Ga0105237_10019485 | 3300009545 | Bacteria | 7007 |
| 243 | Ga0105238_10214253 | 3300009551 | Bacteria | 1902 |
| 244 | Ga0105238_10667556 | 3300009551 | Bacteria | 1050 |
| 245 | Ga0105249_10000289 | 3300009553 | Bacteria | 51753 |
| 246 | Ga0099796_10000185 | 3300010159 | Bacteria | 9463 |
| 247 | Ga0105239_10008446 | 3300010375 | Bacteria | 11713 |
| 248 | Ga0105239_10331986 | 3300010375 | Bacteria | 1715 |
| 249 | Ga0105239_10756988 | 3300010375 | Bacteria | 1112 |
| 250 | Ga0105246_10000070 | 3300011119 | Bacteria | 42277 |
| 251 | Ga0105246_10093244 | 3300011119 | Bacteria | 2175 |
| 252 | Ga0157373_10029598 | 3300013100 | Bacteria | 3944 |
| 253 | Ga0157371_10005008 | 3300013102 | Bacteria | 11355 |
| 254 | Ga0157370_10054315 | 3300013104 | Bacteria | 3818 |
| 255 | Ga0157370_10129286 | 3300013104 | Bacteria | 2357 |
| 256 | Ga0157369_10563197 | 3300013105 | Bacteria | 1177 |
| 257 | Ga0157369_10688454 | 3300013105 | Bacteria | 1053 |
| 258 | Ga0157369_10797836 | 3300013105 | Bacteria | 970 |
| 259 | Ga0157374_10001589 | 3300013296 | Bacteria | 19065 |
| 260 | Ga0157374_10304567 | 3300013296 | Bacteria | 1577 |
| 261 | Ga0157378_10000713 | 3300013297 | Bacteria | 31078 |
| 262 | Ga0157378_10096812 | 3300013297 | Bacteria | 2689 |
| 263 | Ga0157378_10559268 | 3300013297 | Bacteria | 1150 |
| 264 | Ga0163162_10000202 | 3300013306 | Bacteria | 55109 |
| 265 | Ga0163162_10448753 | 3300013306 | Bacteria | 1422 |
| 266 | Ga0157372_10036396 | 3300013307 | Bacteria | 5425 |
| 267 | Ga0157372_10293784 | 3300013307 | Bacteria | 1890 |
| 268 | Ga0157375_10000507 | 3300013308 | Bacteria | 35186 |
| 269 | Ga0157375_10281621 | 3300013308 | Bacteria | 1826 |
| 270 | Ga0163163_10001140 | 3300014325 | Bacteria | 22613 |
| 271 | Ga0163163_10002989 | 3300014325 | Bacteria | 14308 |
| 272 | Ga0163163_10012390 | 3300014325 | Bacteria | 7768 |
| 273 | Ga0157380_10000823 | 3300014326 | Bacteria | 19424 |
| 274 | Ga0157380_10328959 | 3300014326 | Bacteria | 1420 |
| 275 | Ga0157377_10000109 | 3300014745 | Bacteria | 56306 |
| 276 | Ga0157379_10008739 | 3300014968 | Bacteria | 8829 |
| 277 | Ga0157379_10026034 | 3300014968 | Bacteria | 5203 |
| 278 | Ga0157379_10170556 | 3300014968 | Bacteria | 1964 |
| 279 | Ga0157376_10000211 | 3300014969 | Bacteria | 40316 |
| 280 | Ga0157376_10186479 | 3300014969 | Bacteria | 1899 |
| 281 | Ga0163161_10000132 | 3300017792 | Bacteria | 70304 |
| 282 | Ga0163161_10034783 | 3300017792 | Bacteria | 3605 |
| 283 | Ga0163161_10154211 | 3300017792 | Bacteria | 1747 |
| 284 | Ga0163161_10232307 | 3300017792 | Bacteria | 1432 |
| 285 | Ga0206356_10802032 | 3300020070 | Bacteria | 2155 |
| 286 | Ga0206354_10645964 | 3300020081 | Bacteria | 2259 |
| 287 | Ga0206353_11534553 | 3300020082 | Bacteria | 4022 |
| 288 | Ga0213875_10000031 | 3300021388 | Bacteria | 176367 |
| 289 | Ga0207666_1000018 | 3300025271 | Bacteria | 39246 |
| 290 | Ga0207673_1000004 | 3300025290 | Bacteria | 17765 |
| 291 | Ga0207697_10000078 | 3300025315 | Bacteria | 42249 |
| 292 | Ga0207653_10012978 | 3300025885 | Bacteria | 2606 |
| 293 | Ga0207682_10000001 | 3300025893 | Bacteria | 152713 |
| 294 | Ga0207682_10028194 | 3300025893 | Bacteria | 2240 |
| 295 | Ga0207692_10012572 | 3300025898 | Bacteria | 3639 |
| 296 | Ga0207692_10031234 | 3300025898 | Bacteria | 2549 |
| 297 | Ga0207642_10003965 | 3300025899 | Bacteria | 4719 |
| 298 | Ga0207710_10003351 | 3300025900 | Bacteria | 7162 |
| 299 | Ga0207710_10016933 | 3300025900 | Bacteria | 3087 |
| 300 | Ga0207710_10131797 | 3300025900 | Bacteria | 1201 |
| 301 | Ga0207688_10000132 | 3300025901 | Bacteria | 31579 |
| 302 | Ga0207680_10019790 | 3300025903 | Bacteria | 3608 |
| 303 | Ga0207680_10227346 | 3300025903 | Bacteria | 1281 |
| 304 | Ga0207647_10000678 | 3300025904 | Bacteria | 26728 |
| 305 | Ga0207685_10014445 | 3300025905 | Bacteria | 2473 |
| 306 | Ga0207699_10000206 | 3300025906 | Bacteria | 35327 |
| 307 | Ga0207699_10131806 | 3300025906 | Bacteria | 1631 |
| 308 | Ga0207645_10000110 | 3300025907 | Bacteria | 61329 |
| 309 | Ga0207645_10009349 | 3300025907 | Bacteria | 6786 |
| 310 | Ga0207643_10001892 | 3300025908 | Bacteria | 11570 |
| 311 | Ga0207705_10105091 | 3300025909 | Bacteria | 2081 |
| 312 | Ga0207707_10000922 | 3300025912 | Bacteria | 28562 |
| 313 | Ga0207707_10040591 | 3300025912 | Bacteria | 4064 |
| 314 | Ga0207707_10192038 | 3300025912 | Bacteria | 1781 |
| 315 | Ga0207707_10214877 | 3300025912 | Bacteria | 1674 |
| 316 | Ga0207695_10051521 | 3300025913 | Bacteria | 4322 |
| 317 | Ga0207695_10065916 | 3300025913 | Bacteria | 3721 |
| 318 | Ga0207671_10009327 | 3300025914 | Bacteria | 8213 |
| 319 | Ga0207671_10212223 | 3300025914 | Bacteria | 1515 |
| 320 | Ga0207693_10018725 | 3300025915 | Bacteria | 5511 |
| 321 | Ga0207693_10076094 | 3300025915 | Bacteria | 2629 |
| 322 | Ga0207693_10081896 | 3300025915 | Bacteria | 2527 |
| 323 | Ga0207693_10240367 | 3300025915 | Bacteria | 1422 |
| 324 | Ga0207663_10044876 | 3300025916 | Bacteria | 2716 |
| 325 | Ga0207663_10175681 | 3300025916 | Bacteria | 1525 |
| 326 | Ga0207660_10000063 | 3300025917 | Bacteria | 56039 |
| 327 | Ga0207660_10051692 | 3300025917 | Bacteria | 2922 |
| 328 | Ga0207660_10400895 | 3300025917 | Bacteria | 1105 |
| 329 | Ga0207660_10562389 | 3300025917 | Unclassified | 928 |
| 330 | Ga0207662_10000581 | 3300025918 | Bacteria | 16282 |
| 331 | Ga0207662_10040307 | 3300025918 | Bacteria | 2745 |
| 332 | Ga0207662_10139265 | 3300025918 | Bacteria | 1536 |
| 333 | Ga0207657_10002831 | 3300025919 | Bacteria | 18637 |
| 334 | Ga0207657_10012668 | 3300025919 | Bacteria | 8312 |
| 335 | Ga0207657_10113413 | 3300025919 | Bacteria | 2236 |
| 336 | Ga0207649_10000064 | 3300025920 | Bacteria | 96018 |
| 337 | Ga0207652_10000128 | 3300025921 | Bacteria | 82012 |
| 338 | Ga0207652_10010954 | 3300025921 | Bacteria | 7311 |
| 339 | Ga0207652_10091116 | 3300025921 | Bacteria | 2680 |
| 340 | Ga0207652_10137597 | 3300025921 | Bacteria | 2182 |
| 341 | Ga0207652_10224347 | 3300025921 | Bacteria | 1693 |
| 342 | Ga0207681_10000024 | 3300025923 | Bacteria | 206607 |
| 343 | Ga0207650_10008086 | 3300025925 | Bacteria | 7167 |
| 344 | Ga0207659_10000034 | 3300025926 | Bacteria | 108227 |
| 345 | Ga0207687_10000069 | 3300025927 | Bacteria | 78213 |
| 346 | Ga0207687_10243721 | 3300025927 | Bacteria | 1426 |
| 347 | Ga0207700_10007400 | 3300025928 | Bacteria | 6705 |
| 348 | Ga0207700_10215459 | 3300025928 | Bacteria | 1625 |
| 349 | Ga0207664_10002775 | 3300025929 | Bacteria | 11628 |
| 350 | Ga0207664_10080701 | 3300025929 | Bacteria | 2645 |
| 351 | Ga0207644_10000342 | 3300025931 | Bacteria | 30260 |
| 352 | Ga0207644_10011935 | 3300025931 | Bacteria | 5760 |
| 353 | Ga0207644_10084704 | 3300025931 | Bacteria | 2350 |
| 354 | Ga0207644_10121974 | 3300025931 | Bacteria | 1985 |
| 355 | Ga0207690_10000068 | 3300025932 | Bacteria | 90571 |
| 356 | Ga0207706_10002299 | 3300025933 | Bacteria | 18637 |
| 357 | Ga0207706_10019674 | 3300025933 | Bacteria | 6074 |
| 358 | Ga0207706_10268243 | 3300025933 | Bacteria | 1490 |
| 359 | Ga0207686_10000875 | 3300025934 | Bacteria | 18197 |
| 360 | Ga0207686_10021413 | 3300025934 | Bacteria | 3710 |
| 361 | Ga0207686_10180423 | 3300025934 | Bacteria | 1497 |
| 362 | Ga0207709_10003412 | 3300025935 | Bacteria | 9490 |
| 363 | Ga0207709_10042441 | 3300025935 | Bacteria | 2736 |
| 364 | Ga0207709_10296110 | 3300025935 | Bacteria | 1201 |
| 365 | Ga0207670_10000057 | 3300025936 | Bacteria | 83573 |
| 366 | Ga0207670_10018002 | 3300025936 | Bacteria | 4283 |
| 367 | Ga0207669_10000005 | 3300025937 | Bacteria | 185218 |
| 368 | Ga0207669_10037640 | 3300025937 | Bacteria | 2778 |
| 369 | Ga0207669_10060777 | 3300025937 | Bacteria | 2318 |
| 370 | Ga0207704_10000346 | 3300025938 | Bacteria | 21567 |
| 371 | Ga0207704_10030499 | 3300025938 | Bacteria | 3023 |
| 372 | Ga0207704_10078408 | 3300025938 | Bacteria | 2125 |
| 373 | Ga0207704_10344965 | 3300025938 | Bacteria | 1157 |
| 374 | Ga0207665_10001878 | 3300025939 | Bacteria | 14153 |
| 375 | Ga0207665_10080548 | 3300025939 | Bacteria | 2240 |
| 376 | Ga0207665_10104954 | 3300025939 | Bacteria | 1978 |
| 377 | Ga0207691_10000543 | 3300025940 | Bacteria | 37760 |
| 378 | Ga0207691_10114853 | 3300025940 | Bacteria | 2391 |
| 379 | Ga0207711_10004328 | 3300025941 | Bacteria | 12124 |
| 380 | Ga0207711_10014202 | 3300025941 | Bacteria | 6614 |
| 381 | Ga0207711_10017864 | 3300025941 | Bacteria | 5893 |
| 382 | Ga0207711_10141341 | 3300025941 | Bacteria | 2166 |
| 383 | Ga0207689_10000055 | 3300025942 | Bacteria | 86715 |
| 384 | Ga0207661_10000036 | 3300025944 | Bacteria | 149720 |
| 385 | Ga0207679_10000025 | 3300025945 | Bacteria | 203699 |
| 386 | Ga0207679_10124182 | 3300025945 | Bacteria | 2060 |
| 387 | Ga0207679_10250043 | 3300025945 | Bacteria | 1507 |
| 388 | Ga0207667_10003352 | 3300025949 | Bacteria | 19767 |
| 389 | Ga0207667_10038158 | 3300025949 | Bacteria | 5132 |
| 390 | Ga0207667_10283313 | 3300025949 | Bacteria | 1693 |
| 391 | Ga0207667_10549537 | 3300025949 | Bacteria | 1168 |
| 392 | Ga0207651_10000014 | 3300025960 | Bacteria | 166931 |
| 393 | Ga0207651_10114883 | 3300025960 | Bacteria | 2029 |
| 394 | Ga0207712_10000523 | 3300025961 | Bacteria | 31525 |
| 395 | Ga0207668_10000352 | 3300025972 | Bacteria | 29941 |
| 396 | Ga0207640_10000779 | 3300025981 | Bacteria | 18117 |
| 397 | Ga0207658_10001275 | 3300025986 | Bacteria | 19922 |
| 398 | Ga0207658_10050110 | 3300025986 | Bacteria | 3071 |
| 399 | Ga0207677_10000382 | 3300026023 | Bacteria | 30569 |
| 400 | Ga0207703_10001504 | 3300026035 | Bacteria | 21278 |
| 401 | Ga0207703_10018104 | 3300026035 | Bacteria | 5503 |
| 402 | Ga0207639_10000288 | 3300026041 | Bacteria | 35910 |
| 403 | Ga0207678_10000292 | 3300026067 | Bacteria | 45164 |
| 404 | Ga0207708_10001276 | 3300026075 | Bacteria | 18923 |
| 405 | Ga0207702_10084727 | 3300026078 | Bacteria | 2760 |
| 406 | Ga0207702_10113025 | 3300026078 | Bacteria | 2418 |
| 407 | Ga0207702_10302023 | 3300026078 | Bacteria | 1519 |
| 408 | Ga0207702_10610678 | 3300026078 | Bacteria | 1071 |
| 409 | Ga0207641_10058613 | 3300026088 | Bacteria | 3277 |
| 410 | Ga0207641_10111390 | 3300026088 | Bacteria | 2427 |
| 411 | Ga0207641_10259708 | 3300026088 | Bacteria | 1626 |
| 412 | Ga0207641_10404270 | 3300026088 | Bacteria | 1312 |
| 413 | Ga0207648_10003100 | 3300026089 | Bacteria | 17553 |
| 414 | Ga0207648_10012111 | 3300026089 | Bacteria | 8088 |
| 415 | Ga0207648_10048827 | 3300026089 | Bacteria | 3705 |
| 416 | Ga0207648_10314393 | 3300026089 | Bacteria | 1406 |
| 417 | Ga0207676_10000826 | 3300026095 | Bacteria | 24195 |
| 418 | Ga0207676_10022901 | 3300026095 | Bacteria | 4599 |
| 419 | Ga0207674_10000376 | 3300026116 | Bacteria | 58065 |
| 420 | Ga0207675_100002377 | 3300026118 | Bacteria | 18637 |
| 421 | Ga0207675_100088084 | 3300026118 | Bacteria | 2916 |
| 422 | Ga0207675_100515779 | 3300026118 | Bacteria | 1191 |
| 423 | Ga0207683_10000001 | 3300026121 | Bacteria | 352047 |
| 424 | Ga0207683_10021116 | 3300026121 | Bacteria | 5573 |
| 425 | Ga0207683_10026710 | 3300026121 | Bacteria | 4986 |
| 426 | Ga0207683_10046152 | 3300026121 | Bacteria | 3811 |
| 427 | Ga0207698_10000231 | 3300026142 | Bacteria | 34934 |
| 428 | Ga0207698_10043243 | 3300026142 | Bacteria | 3373 |
| 429 | Ga0207698_10419771 | 3300026142 | Bacteria | 1283 |
| 430 | Ga0209982_1022040 | 3300027552 | Bacteria | 982 |
| 431 | Ga0209966_1008239 | 3300027695 | Bacteria | 1846 |
| 432 | Ga0209966_1015555 | 3300027695 | Bacteria | 1429 |
| 433 | Ga0209998_10003278 | 3300027717 | Bacteria | 3563 |
| 434 | Ga0209998_10003574 | 3300027717 | Bacteria | 3389 |
| 435 | Ga0209813_10033268 | 3300027866 | Bacteria | 1532 |
| 436 | Ga0209974_10001490 | 3300027876 | Bacteria | 8505 |
| 437 | Ga0207428_10000162 | 3300027907 | Bacteria | 92143 |
| 438 | Ga0207428_10000233 | 3300027907 | Bacteria | 76679 |
| 439 | Ga0268266_10033132 | 3300028379 | Bacteria | 4393 |
| 440 | Ga0268265_10000477 | 3300028380 | Bacteria | 42056 |
| 441 | Ga0268265_10650194 | 3300028380 | Bacteria | 1013 |
| 442 | Ga0268264_10000309 | 3300028381 | Bacteria | 78332 |
| 443 | Ga0268264_10027832 | 3300028381 | Bacteria | 4621 |
| 444 | Ga0268264_10539584 | 3300028381 | Bacteria | 1142 |
| 445 | Ga0265338_10076248 | 3300028800 | Bacteria | 2841 |
| 446 | Ga0265325_10000056 | 3300031241 | Bacteria | 77353 |
| 447 | Ga0265325_10001378 | 3300031241 | Bacteria | 17169 |
| 448 | Ga0265325_10003842 | 3300031241 | Bacteria | 9657 |
| 449 | Ga0265325_10032699 | 3300031241 | Bacteria | 2775 |
| 450 | Ga0265325_10096896 | 3300031241 | Bacteria | 1449 |
| 451 | Ga0265340_10019704 | 3300031247 | Bacteria | 3473 |
| 452 | Ga0265340_10054702 | 3300031247 | Bacteria | 1924 |
| 453 | Ga0265339_10001310 | 3300031249 | Bacteria | 18656 |
| 454 | Ga0265339_10003844 | 3300031249 | Bacteria | 10421 |
| 455 | Ga0265331_10100646 | 3300031250 | Bacteria | 1330 |
| 456 | Ga0265316_10218287 | 3300031344 | Bacteria | 1408 |
| 457 | Ga0265313_10014436 | 3300031595 | Bacteria | 4666 |
| 458 | Ga0265313_10062195 | 3300031595 | Bacteria | 1744 |
| 459 | Ga0265342_10000193 | 3300031712 | Bacteria | 67856 |
| 460 | Ga0307409_100323287 | 3300031995 | Bacteria | 1445 |
| 461 | Ga0373948_0000932 | 3300034817 | Bacteria | 3917 |
| 462 | Ga0373948_0013231 | 3300034817 | Bacteria | 1486 |
| 463 | Ga0373950_0008480 | 3300034818 | Bacteria | 1619 |
| 464 | Ga0373958_0003525 | 3300034819 | Bacteria | 2261 |
| 465 | Ga0373958_0049748 | 3300034819 | Bacteria | 882 |
| 466 | Ga0373938_0001151 | 3300034957 | Bacteria | 4255 |
| 467 | Ga0373938_0001291 | 3300034957 | Bacteria | 4022 |
| 468 | Ga0373926_0027019 | 3300035083 | Bacteria | 2009 |
| 469 | Ga0373928_0002146 | 3300035084 | Bacteria | 3849 |
| 470 | Ga0373928_0002836 | 3300035084 | Bacteria | 3339 |
| 471 | Ga0373929_0000675 | 3300035085 | Bacteria | 6580 |
| 472 | Ga0373929_0016152 | 3300035085 | Bacteria | 1460 |
| 473 | Ga0373934_0059023 | 3300035086 | Bacteria | 1527 |
| 474 | Ga0373940_0003452 | 3300035088 | Bacteria | 3230 |
| 475 | Ga0373940_0025916 | 3300035088 | Bacteria | 1531 |
| 476 | Ga0373944_0009606 | 3300035089 | Bacteria | 2626 |
| 477 | Ga0373944_0046664 | 3300035089 | Bacteria | 1355 |
| 478 | Ga0373949_0001862 | 3300035090 | Bacteria | 5729 |
| 479 | Ga0373949_0004195 | 3300035090 | Bacteria | 3328 |
| 480 | Ga0373949_0024626 | 3300035090 | Bacteria | 1400 |
| 481 | Ga0373951_0000710 | 3300035091 | Bacteria | 9141 |
| 482 | Ga0373952_0001834 | 3300035092 | Bacteria | 3857 |
| 483 | Ga0373952_0014692 | 3300035092 | Bacteria | 1570 |
| 484 | Ga0373952_0030118 | 3300035092 | Bacteria | 1200 |
| 485 | Ga0373923_0054229 | 3300035111 | Bacteria | 1687 |
| 486 | Ga0373923_0144358 | 3300035111 | Bacteria | 1077 |
| 487 | Ga0373932_0000674 | 3300035112 | Bacteria | 10362 |
| 488 | Ga0373932_0001584 | 3300035112 | Bacteria | 6265 |
| 489 | Ga0373936_0019109 | 3300035113 | Bacteria | 2653 |
| 490 | Ga0373939_0001761 | 3300035114 | Bacteria | 5208 |
| 491 | Ga0373939_0008814 | 3300035114 | Bacteria | 2484 |
| 492 | Ga0373939_0028672 | 3300035114 | Bacteria | 1586 |
| 493 | Ga0373939_0029902 | 3300035114 | Bacteria | 1563 |
| 494 | Ga0373941_0000367 | 3300035115 | Bacteria | 8966 |
| 495 | Ga0373941_0002074 | 3300035115 | Bacteria | 4350 |
| 496 | Ga0373941_0023011 | 3300035115 | Bacteria | 1775 |
| 497 | Ga0373945_0073968 | 3300035116 | Bacteria | 1294 |
| 498 | Ga0373953_0014468 | 3300035117 | Bacteria | 2838 |
| 499 | Ga0373954_0000573 | 3300035118 | Bacteria | 13888 |
| 500 | Ga0373954_0060119 | 3300035118 | Bacteria | 1792 |
| 501 | Ga0373956_0053271 | 3300035119 | Bacteria | 1821 |
| 502 | Ga0373956_0142068 | 3300035119 | Bacteria | 1127 |
| 503 | Ga0373957_0003946 | 3300035120 | Bacteria | 4454 |
| 504 | Ga0373957_0050729 | 3300035120 | Bacteria | 1586 |
| 505 | Ga0373957_0141048 | 3300035120 | Bacteria | 985 |
| 506 | Ga0373960_0001805 | 3300035121 | Bacteria | 4794 |
| 507 | Ga0373960_0001871 | 3300035121 | Bacteria | 4711 |
| 508 | Ga0373943_0184496 | 3300035170 | Bacteria | 1148 |
| 509 | Ga0373946_0010861 | 3300035171 | Bacteria | 3383 |
| 510 | Ga0373946_0052312 | 3300035171 | Bacteria | 1712 |
| 511 | Ga0373946_0058594 | 3300035171 | Bacteria | 1632 |
| 512 | Ga0373955_0001431 | 3300035172 | Bacteria | 10161 |
| 513 | Ga0373955_0055606 | 3300035172 | Bacteria | 2168 |
| 514 | Ga0373955_0210753 | 3300035172 | Bacteria | 1158 |
| 515 | Ga0373942_0010607 | 3300035207 | Bacteria | 2170 |
| 516 | Ga0373942_0042160 | 3300035207 | Bacteria | 1250 |
| 517 | Ga0373961_0005475 | 3300035241 | Bacteria | 3049 |
| 518 | Ga0373962_0000104 | 3300035242 | Bacteria | 18507 |
| 519 | Ga0373924_0065198 | 3300035410 | Bacteria | 1529 |
| 520 | Ga0373924_0082007 | 3300035410 | Bacteria | 1372 |
| 521 | Ga0373924_0101656 | 3300035410 | Bacteria | 1237 |
| 522 | Ga0373931_0000072 | 3300035691 | Bacteria | 49094 |
| 523 | Ga0373931_0000682 | 3300035691 | Bacteria | 14097 |
| 524 | Ga0373931_0004121 | 3300035691 | Bacteria | 6594 |
| 525 | Ga0373931_0033427 | 3300035691 | Bacteria | 2665 |
| 526 | Ga0373931_0113623 | 3300035691 | Bacteria | 1539 |
| 527 | Ga0373935_0006366 | 3300035692 | Bacteria | 7043 |
| 528 | Ga0373935_0019659 | 3300035692 | Bacteria | 4117 |
| 529 | Ga0373935_0044119 | 3300035692 | Bacteria | 2809 |
| 530 | Ga0373935_0131532 | 3300035692 | Bacteria | 1682 |
| 531 | Ga0373935_0204413 | 3300035692 | Bacteria | 1366 |
| 532 | Ga0373927_0014307 | 3300035695 | Bacteria | 5256 |
| 533 | Ga0373927_0410553 | 3300035695 | Bacteria | 893 |
| 534 | Ga0373927_0458203 | 3300035695 | Bacteria | 842 |
| 535 | Ga0373933_0002471 | 3300035724 | Bacteria | 10402 |
| 536 | Ga0373933_0003704 | 3300035724 | Bacteria | 8453 |
| 537 | Ga0373933_0025249 | 3300035724 | Bacteria | 3406 |
| 538 | Ga0373947_0017662 | 3300035725 | Bacteria | 4105 |
| 539 | Ga0373947_0020325 | 3300035725 | Bacteria | 3832 |
| 540 | Ga0373947_0315305 | 3300035725 | Bacteria | 1045 |
| 541 | Ga0373937_0014028 | 3300036401 | Bacteria | 7066 |
| 542 | Ga0373937_0029548 | 3300036401 | Bacteria | 4964 |
| 543 | Ga0373937_0081967 | 3300036401 | Bacteria | 2984 |
| 544 | Ga0373937_0109242 | 3300036401 | Bacteria | 2572 |
| 545 | Ga0373937_0114232 | 3300036401 | Bacteria | 2513 |
| 546 | Ga0373937_0148464 | 3300036401 | Bacteria | 2195 |
| 547 | Ga0373937_0474620 | 3300036401 | Bacteria | 1188 |
| 548 | Ga0373925_0007613 | 3300037068 | Bacteria | 7887 |
| 549 | Ga0373925_0060370 | 3300037068 | Bacteria | 2847 |
| 550 | Ga0373925_0074537 | 3300037068 | Bacteria | 2570 |
| 551 | Ga0373925_0165617 | 3300037068 | Bacteria | 1743 |
| 552 | Ga0436364_0793438 | 3300037853 | Bacteria | 64960 |
| 553 | Ga0395901_0009364 | 3300038443 | Bacteria | 9934 |
| 554 | Ga0395901_0688008 | 3300038443 | Bacteria | 1022 |
| 555 | Ga0436365_1569042 | 3300039437 | Bacteria | 7848 |
| 556 | Ga0436363_0254747 | 3300039450 | Bacteria | 2495 |
| 557 | Ga0439453_0020816 | 3300041408 | Bacteria | 1178 |
| 558 | Ga0439448_0012112 | 3300042005 | Bacteria | 2576 |
| 559 | Ga0439450_004592 | 3300042008 | Bacteria | 2370 |
| 560 | Ga0439455_0009610 | 3300042012 | Bacteria | 2105 |
| 561 | Ga0439463_011971 | 3300042016 | Bacteria | 2131 |
| 562 | Ga0439434_0090258 | 3300042435 | Bacteria | 979 |
| 563 | Ga0439464_0089070 | 3300042439 | Bacteria | 928 |
| 564 | Ga0466963_0083735 | 3300044694 | Bacteria | 2163 |
| 565 | Ga0466963_0136663 | 3300044694 | Bacteria | 1696 |
| 566 | Ga0466957_0011624 | 3300044842 | Bacteria | 5086 |
| 567 | Ga0466957_0053856 | 3300044842 | Bacteria | 2454 |
| 568 | Ga0466959_0015280 | 3300045049 | Bacteria | 5590 |
| 569 | Ga0466958_0032332 | 3300045836 | Bacteria | 3112 |
| 570 | Ga0495617_021410 | 3300046452 | Bacteria | 2183 |
| 571 | Ga0495592_0011976 | 3300046454 | Bacteria | 6574 |
| 572 | Ga0495592_0014877 | 3300046454 | Bacteria | 5906 |
| 573 | Ga0495592_0169073 | 3300046454 | Bacteria | 1498 |
| 574 | Ga0495603_0015018 | 3300046455 | Bacteria | 4681 |
| 575 | Ga0495603_0030359 | 3300046455 | Bacteria | 3255 |
| 576 | Ga0495590_0114743 | 3300046457 | Bacteria | 963 |
| 577 | Ga0495629_0000301 | 3300046459 | Bacteria | 42369 |
| 578 | Ga0495629_0138563 | 3300046459 | Bacteria | 1693 |
| 579 | Ga0495641_0012536 | 3300046461 | Bacteria | 4731 |
| 580 | Ga0495651_0000931 | 3300046462 | Bacteria | 22653 |
| 581 | Ga0495651_0002045 | 3300046462 | Bacteria | 15589 |
| 582 | Ga0495651_0008299 | 3300046462 | Bacteria | 7958 |
| 583 | Ga0495651_0072527 | 3300046462 | Bacteria | 2615 |
| 584 | Ga0495653_0007314 | 3300046463 | Bacteria | 9045 |
| 585 | Ga0495653_0026303 | 3300046463 | Bacteria | 4667 |
| 586 | Ga0495653_0133035 | 3300046463 | Bacteria | 1758 |
| 587 | Ga0495580_0010672 | 3300046472 | Bacteria | 7135 |
| 588 | Ga0495580_0096909 | 3300046472 | Bacteria | 2051 |
| 589 | Ga0495582_0000165 | 3300046473 | Bacteria | 35625 |
| 590 | Ga0495582_0062824 | 3300046473 | Bacteria | 2051 |
| 591 | Ga0495582_0173353 | 3300046473 | Bacteria | 1228 |
| 592 | Ga0495605_0107640 | 3300046474 | Bacteria | 1275 |
| 593 | Ga0495639_0001251 | 3300046475 | Bacteria | 11450 |
| 594 | Ga0495639_0021907 | 3300046475 | Bacteria | 2800 |
| 595 | Ga0495662_0007950 | 3300046476 | Bacteria | 5222 |
| 596 | Ga0495662_0032820 | 3300046476 | Bacteria | 2508 |
| 597 | Ga0495662_0074838 | 3300046476 | Bacteria | 1643 |
| 598 | Ga0495662_0208957 | 3300046476 | Bacteria | 962 |
| 599 | Ga0495664_0025708 | 3300046477 | Bacteria | 3427 |
| 600 | Ga0495664_0217281 | 3300046477 | Bacteria | 1157 |
| 601 | Ga0495664_0335571 | 3300046477 | Bacteria | 911 |
| 602 | Ga0495584_0027415 | 3300046491 | Bacteria | 2887 |
| 603 | Ga0495585_0001207 | 3300046492 | Bacteria | 20945 |
| 604 | Ga0495594_0023233 | 3300046499 | Bacteria | 3321 |
| 605 | Ga0495594_0037055 | 3300046499 | Bacteria | 2661 |
| 606 | Ga0495607_0004923 | 3300046501 | Bacteria | 9713 |
| 607 | Ga0495608_0015277 | 3300046511 | Bacteria | 5327 |
| 608 | Ga0495608_0107960 | 3300046511 | Bacteria | 1790 |
| 609 | Ga0495608_0132380 | 3300046511 | Bacteria | 1595 |
| 610 | Ga0495608_0235631 | 3300046511 | Bacteria | 1145 |
| 611 | Ga0495616_0146103 | 3300046513 | Bacteria | 1073 |
| 612 | Ga0495618_0036630 | 3300046514 | Bacteria | 3078 |
| 613 | Ga0495628_0086094 | 3300046516 | Bacteria | 2437 |
| 614 | Ga0495628_0110422 | 3300046516 | Bacteria | 2115 |
| 615 | Ga0495628_0155343 | 3300046516 | Bacteria | 1741 |
| 616 | Ga0495628_0170949 | 3300046516 | Bacteria | 1648 |
| 617 | Ga0495628_0263973 | 3300046516 | Bacteria | 1282 |
| 618 | Ga0495628_0289909 | 3300046516 | Bacteria | 1213 |
| 619 | Ga0495630_0021325 | 3300046517 | Bacteria | 4783 |
| 620 | Ga0495630_0508072 | 3300046517 | Bacteria | 924 |
| 621 | Ga0495631_0021408 | 3300046518 | Bacteria | 3012 |
| 622 | Ga0495637_0097569 | 3300046520 | Bacteria | 1152 |
| 623 | Ga0495644_0000571 | 3300046523 | Bacteria | 15453 |
| 624 | Ga0495663_0014599 | 3300046525 | Bacteria | 2203 |
| 625 | Ga0495666_0030723 | 3300046526 | Bacteria | 2634 |
| 626 | Ga0495652_0018029 | 3300046529 | Bacteria | 6297 |
| 627 | Ga0495652_0024574 | 3300046529 | Bacteria | 5332 |
| 628 | Ga0495652_0276128 | 3300046529 | Bacteria | 1233 |
| 629 | Ga0495640_0221699 | 3300046533 | Bacteria | 1192 |
| 630 | Ga0495586_0010183 | 3300046535 | Bacteria | 5003 |
| 631 | Ga0495586_0063899 | 3300046535 | Bacteria | 2005 |
| 632 | Ga0495587_0006331 | 3300046536 | Bacteria | 7720 |
| 633 | Ga0495587_0030470 | 3300046536 | Bacteria | 3271 |
| 634 | Ga0495598_0001757 | 3300046537 | Bacteria | 4351 |
| 635 | Ga0495609_0012501 | 3300046538 | Bacteria | 4027 |
| 636 | Ga0495621_0082389 | 3300046539 | Bacteria | 1201 |
| 637 | Ga0495645_0000223 | 3300046543 | Bacteria | 40729 |
| 638 | Ga0495645_0033789 | 3300046543 | Bacteria | 3731 |
| 639 | Ga0495645_0239972 | 3300046543 | Bacteria | 1210 |
| 640 | Ga0495645_0274605 | 3300046543 | Bacteria | 1111 |
| 641 | Ga0495622_0005532 | 3300046557 | Bacteria | 5857 |
| 642 | Ga0495622_0027314 | 3300046557 | Bacteria | 2664 |
| 643 | Ga0495622_0108057 | 3300046557 | Bacteria | 1274 |
| 644 | Ga0495633_0001185 | 3300046558 | Bacteria | 20944 |
| 645 | Ga0495667_0031790 | 3300046559 | Bacteria | 3539 |
| 646 | Ga0495667_0033059 | 3300046559 | Bacteria | 3461 |
| 647 | Ga0495667_0051584 | 3300046559 | Bacteria | 2713 |
| 648 | Ga0495667_0076909 | 3300046559 | Bacteria | 2171 |
| 649 | Ga0495656_0001164 | 3300046615 | Bacteria | 8549 |
| 650 | Ga0495634_0034266 | 3300046642 | Bacteria | 3485 |
| 651 | Ga0495634_0181103 | 3300046642 | Bacteria | 1319 |
| 652 | Ga0495611_0007125 | 3300046648 | Bacteria | 4750 |
| 653 | Ga0495635_0000999 | 3300046663 | Bacteria | 18684 |
| 654 | Ga0495635_0017785 | 3300046663 | Bacteria | 4966 |
| 655 | Ga0495635_0089731 | 3300046663 | Bacteria | 2103 |
| 656 | Ga0495635_0378365 | 3300046663 | Bacteria | 942 |
| 657 | Ga0495659_0000975 | 3300046664 | Bacteria | 10042 |
| 658 | Ga0495659_0029381 | 3300046664 | Bacteria | 1908 |
| 659 | Ga0495659_0029982 | 3300046664 | Bacteria | 1891 |
| 660 | Ga0495659_0132780 | 3300046664 | Bacteria | 988 |
| 661 | Ga0495661_0025793 | 3300046665 | Bacteria | 3792 |
| 662 | Ga0495588_0171359 | 3300046674 | Bacteria | 1147 |
| 663 | Ga0495657_0002536 | 3300046675 | Bacteria | 15313 |
| 664 | Ga0495657_0016458 | 3300046675 | Bacteria | 5388 |
| 665 | Ga0495657_0018493 | 3300046675 | Bacteria | 5041 |
| 666 | Ga0495599_0001964 | 3300046678 | Bacteria | 11912 |
| 667 | Ga0495599_0010860 | 3300046678 | Bacteria | 5581 |
| 668 | Ga0495599_0044219 | 3300046678 | Bacteria | 2793 |
| 669 | Ga0495623_0000454 | 3300046679 | Bacteria | 26961 |
| 670 | Ga0495623_0004056 | 3300046679 | Bacteria | 9643 |
| 671 | Ga0495646_0006696 | 3300046680 | Bacteria | 7305 |
| 672 | Ga0495646_0027070 | 3300046680 | Bacteria | 3598 |
| 673 | Ga0495658_0001694 | 3300046683 | Bacteria | 11454 |
| 674 | Ga0495658_0004617 | 3300046683 | Bacteria | 6774 |
| 675 | Ga0495658_0028677 | 3300046683 | Bacteria | 3007 |
| 676 | Ga0495658_0077116 | 3300046683 | Bacteria | 1948 |
| 677 | Ga0495658_0290972 | 3300046683 | Bacteria | 1032 |
| 678 | Ga0495669_0038709 | 3300046684 | Bacteria | 2112 |
| 679 | Ga0495613_0001324 | 3300046689 | Bacteria | 18944 |
| 680 | Ga0495613_0056789 | 3300046689 | Bacteria | 2874 |
| 681 | Ga0495613_0079146 | 3300046689 | Bacteria | 2390 |
| 682 | Ga0495624_0009215 | 3300046690 | Bacteria | 6840 |
| 683 | Ga0495670_0000747 | 3300046691 | Bacteria | 15565 |
| 684 | Ga0495671_0173976 | 3300046692 | Bacteria | 1046 |
| 685 | Ga0495589_0065258 | 3300046794 | Bacteria | 1785 |
| 686 | Ga0495600_0026812 | 3300046809 | Bacteria | 3721 |
| 687 | Ga0495600_0056640 | 3300046809 | Bacteria | 2561 |
| 688 | Ga0495600_0140451 | 3300046809 | Bacteria | 1567 |
| 689 | Ga0495600_0216991 | 3300046809 | Bacteria | 1224 |
| 690 | Ga0495604_0022921 | 3300047317 | Bacteria | 4983 |
| 691 | Ga0495604_0037287 | 3300047317 | Bacteria | 3829 |
| 692 | Ga0495604_0054164 | 3300047317 | Bacteria | 3097 |
| 693 | Ga0495674_0024659 | 3300047319 | Bacteria | 5521 |
| 694 | Ga0495676_0202244 | 3300047321 | Bacteria | 1379 |
| 695 | Ga0495680_0001680 | 3300047322 | Bacteria | 23534 |
| 696 | Ga0495680_0009135 | 3300047322 | Bacteria | 8947 |
| 697 | Ga0495680_0010402 | 3300047322 | Bacteria | 8302 |
| 698 | Ga0495680_0014617 | 3300047322 | Bacteria | 6794 |
| 699 | Ga0495680_0028181 | 3300047322 | Bacteria | 4607 |
| 700 | Ga0495683_0142503 | 3300047323 | Bacteria | 1122 |
| 701 | Ga0495675_0001429 | 3300047444 | Bacteria | 14470 |
| 702 | Ga0495675_0066407 | 3300047444 | Bacteria | 2280 |
| 703 | Ga0495679_007873 | 3300047446 | Bacteria | 4390 |
| 704 | Ga0495684_0004283 | 3300047471 | Bacteria | 11135 |
| 705 | Ga0495593_0032912 | 3300047673 | Bacteria | 2824 |
| 706 | Ga0495593_0081571 | 3300047673 | Bacteria | 1672 |
| 707 | Ga0495593_0116075 | 3300047673 | Bacteria | 1364 |
| 708 | Ga0495602_0013952 | 3300048088 | Bacteria | 8184 |
| 709 | Ga0495602_0041284 | 3300048088 | Bacteria | 4216 |
| 710 | Ga0495602_0071245 | 3300048088 | Bacteria | 2969 |
| 711 | Ga0495602_0130857 | 3300048088 | Bacteria | 2002 |
| 712 | Ga0495614_0013643 | 3300048089 | Bacteria | 3563 |
| 713 | Ga0496100_0000161 | 3300048903 | Bacteria | 37028 |
| 714 | Ga0496100_0002282 | 3300048903 | Bacteria | 9690 |
| 715 | Ga0496100_0016513 | 3300048903 | Bacteria | 4336 |
| 716 | Ga0496100_0042406 | 3300048903 | Bacteria | 2906 |
| 717 | Ga0496101_0000869 | 3300048904 | Bacteria | 17794 |
| 718 | Ga0496101_0021875 | 3300048904 | Bacteria | 4395 |
| 719 | Ga0496101_0047296 | 3300048904 | Bacteria | 3088 |
| 720 | Ga0496101_0256776 | 3300048904 | Bacteria | 1362 |
| 721 | Ga0496101_0528848 | 3300048904 | Bacteria | 932 |
| 722 | Ga0496102_0002837 | 3300048905 | Bacteria | 14721 |
| 723 | Ga0496102_0005211 | 3300048905 | Bacteria | 11035 |
| 724 | Ga0496102_0005523 | 3300048905 | Bacteria | 10736 |
| 725 | Ga0496102_0015550 | 3300048905 | Bacteria | 6632 |
| 726 | Ga0496102_0077239 | 3300048905 | Bacteria | 3064 |
| 727 | Ga0496103_0000499 | 3300048906 | Bacteria | 32387 |
| 728 | Ga0496103_0002698 | 3300048906 | Bacteria | 11071 |
| 729 | Ga0496103_0092286 | 3300048906 | Bacteria | 1911 |
| 730 | Ga0496103_0312243 | 3300048906 | Bacteria | 1011 |
| 731 | Ga0496104_0000370 | 3300048907 | Bacteria | 39760 |
| 732 | Ga0496104_0001967 | 3300048907 | Bacteria | 17802 |
| 733 | Ga0496104_0005269 | 3300048907 | Bacteria | 11300 |
| 734 | Ga0496104_0019317 | 3300048907 | Bacteria | 6231 |
| 735 | Ga0496104_0023038 | 3300048907 | Bacteria | 5723 |
| 736 | Ga0496104_0025999 | 3300048907 | Bacteria | 5399 |
| 737 | Ga0496104_0096700 | 3300048907 | Bacteria | 2825 |
| 738 | Ga0496105_0005159 | 3300048908 | Bacteria | 9905 |
| 739 | Ga0496105_0021982 | 3300048908 | Bacteria | 5164 |
| 740 | Ga0496105_0026435 | 3300048908 | Bacteria | 4733 |
| 741 | Ga0496105_0039433 | 3300048908 | Bacteria | 3893 |
| 742 | Ga0496105_0249719 | 3300048908 | Bacteria | 1437 |
| 743 | Ga0496106_0000357 | 3300048909 | Bacteria | 32374 |
| 744 | Ga0496106_0013549 | 3300048909 | Bacteria | 6020 |
| 745 | Ga0496106_0022564 | 3300048909 | Bacteria | 4678 |
| 746 | Ga0496106_0258367 | 3300048909 | Bacteria | 1393 |
| 747 | Ga0496107_0000206 | 3300048910 | Bacteria | 31059 |
| 748 | Ga0496107_0001825 | 3300048910 | Bacteria | 13436 |
| 749 | Ga0496107_0007544 | 3300048910 | Bacteria | 7504 |
| 750 | Ga0496107_0047489 | 3300048910 | Bacteria | 3092 |
| 751 | Ga0496107_0050511 | 3300048910 | Bacteria | 2997 |
| 752 | Ga0496107_0163807 | 3300048910 | Unclassified | 1649 |
| 753 | Ga0496108_0007040 | 3300048911 | Bacteria | 9107 |
| 754 | Ga0496108_0012661 | 3300048911 | Bacteria | 6873 |
| 755 | Ga0496108_0017975 | 3300048911 | Bacteria | 5784 |
| 756 | Ga0496108_0030762 | 3300048911 | Bacteria | 4449 |
| 757 | Ga0496108_0037549 | 3300048911 | Bacteria | 4035 |
| 758 | Ga0496108_0064702 | 3300048911 | Bacteria | 3081 |
| 759 | Ga0496108_0182907 | 3300048911 | Bacteria | 1815 |
| 760 | Ga0496109_0001922 | 3300048912 | Bacteria | 17256 |
| 761 | Ga0496109_0001930 | 3300048912 | Bacteria | 17226 |
| 762 | Ga0496109_0027546 | 3300048912 | Bacteria | 5075 |
| 763 | Ga0496109_0281086 | 3300048912 | Bacteria | 1568 |
| 764 | Ga0496109_0538594 | 3300048912 | Bacteria | 1101 |
| 765 | Ga0496110_0005694 | 3300048913 | Bacteria | 9785 |
| 766 | Ga0496110_0011922 | 3300048913 | Bacteria | 7141 |
| 767 | Ga0496110_0029162 | 3300048913 | Bacteria | 4746 |
| 768 | Ga0496110_0113541 | 3300048913 | Bacteria | 2436 |
| 769 | Ga0496111_0008628 | 3300048914 | Bacteria | 6757 |
| 770 | Ga0496111_0046671 | 3300048914 | Bacteria | 3119 |
| 771 | Ga0496112_0003333 | 3300048915 | Bacteria | 13256 |
| 772 | Ga0496112_0093856 | 3300048915 | Bacteria | 2971 |
| 773 | Ga0496112_0125195 | 3300048915 | Bacteria | 2541 |
| 774 | Ga0496112_0244975 | 3300048915 | Bacteria | 1744 |
| 775 | Ga0496112_0265779 | 3300048915 | Bacteria | 1664 |
| 776 | Ga0496113_0002587 | 3300048916 | Bacteria | 10567 |
| 777 | Ga0496113_0003762 | 3300048916 | Bacteria | 9156 |
| 778 | Ga0496113_0007424 | 3300048916 | Bacteria | 7053 |
| 779 | Ga0496113_0013972 | 3300048916 | Bacteria | 5462 |
| 780 | Ga0496113_0016330 | 3300048916 | Bacteria | 5126 |
| 781 | Ga0496113_0036620 | 3300048916 | Bacteria | 3596 |
| 782 | Ga0496114_0008819 | 3300048917 | Bacteria | 7994 |
| 783 | Ga0496114_0011210 | 3300048917 | Bacteria | 7158 |
| 784 | Ga0496114_0215058 | 3300048917 | Bacteria | 1686 |
| 785 | Ga0496115_0001252 | 3300048918 | Bacteria | 18231 |
| 786 | Ga0496115_0032161 | 3300048918 | Bacteria | 4138 |
| 787 | Ga0496115_0058158 | 3300048918 | Bacteria | 3110 |
| 788 | Ga0496115_0092042 | 3300048918 | Bacteria | 2479 |
| 789 | Ga0496115_0099734 | 3300048918 | Bacteria | 2380 |
| 790 | Ga0496115_0242170 | 3300048918 | Bacteria | 1486 |
| 791 | Ga0496115_0306600 | 3300048918 | Bacteria | 1300 |
| 792 | Ga0496121_0013535 | 3300048924 | Bacteria | 8750 |
| 793 | Ga0496126_0003241 | 3300048929 | Bacteria | 20805 |
| 794 | Ga0496126_0330957 | 3300048929 | Bacteria | 1250 |
| 795 | Ga0501031_0036019 | 3300049568 | Bacteria | 3227 |
| 796 | Ga0501032_0022653 | 3300049569 | Bacteria | 4352 |
| 797 | Ga0501032_0041157 | 3300049569 | Bacteria | 3139 |
| 798 | Ga0501032_0095686 | 3300049569 | Bacteria | 1969 |
| 799 | Ga0501032_0130328 | 3300049569 | Bacteria | 1659 |
| 800 | Ga0501032_0207272 | 3300049569 | Bacteria | 1279 |
| 801 | Ga0501033_0014941 | 3300049570 | Bacteria | 5893 |
| 802 | Ga0501033_0018414 | 3300049570 | Bacteria | 5275 |
| 803 | Ga0501033_0029299 | 3300049570 | Bacteria | 4137 |
| 804 | Ga0501033_0032178 | 3300049570 | Bacteria | 3938 |
| 805 | Ga0501033_0166808 | 3300049570 | Bacteria | 1583 |
| 806 | Ga0501033_0561564 | 3300049570 | Bacteria | 785 |
| 807 | Ga0501034_0000726 | 3300049571 | Bacteria | 49878 |
| 808 | Ga0501034_0002620 | 3300049571 | Bacteria | 21334 |
| 809 | Ga0501034_0020502 | 3300049571 | Bacteria | 6750 |
| 810 | Ga0501034_0042133 | 3300049571 | Bacteria | 4621 |
| 811 | Ga0501034_0046563 | 3300049571 | Bacteria | 4381 |
| 812 | Ga0501034_0062912 | 3300049571 | Bacteria | 3725 |
| 813 | Ga0501034_0073842 | 3300049571 | Bacteria | 3419 |
| 814 | Ga0501034_0103509 | 3300049571 | Bacteria | 2840 |
| 815 | Ga0501036_0000751 | 3300049572 | Bacteria | 24046 |
| 816 | Ga0501036_0038127 | 3300049572 | Bacteria | 4066 |
| 817 | Ga0501036_0154804 | 3300049572 | Bacteria | 1933 |
| 818 | Ga0501036_0155816 | 3300049572 | Bacteria | 1926 |
| 819 | Ga0501036_0199175 | 3300049572 | Bacteria | 1684 |
| 820 | Ga0501037_0018610 | 3300049573 | Bacteria | 5118 |
| 821 | Ga0501037_0040837 | 3300049573 | Bacteria | 3413 |
| 822 | Ga0501038_0021116 | 3300049574 | Bacteria | 5849 |
| 823 | Ga0501038_0103581 | 3300049574 | Bacteria | 2366 |
| 824 | Ga0501038_0108575 | 3300049574 | Bacteria | 2300 |
| 825 | Ga0501039_0080147 | 3300049575 | Bacteria | 2540 |
| 826 | Ga0501040_0483788 | 3300049576 | Bacteria | 892 |
| 827 | Ga0501042_0084262 | 3300049578 | Bacteria | 2279 |
| 828 | Ga0501043_0002856 | 3300049579 | Bacteria | 14425 |
| 829 | Ga0501043_0020569 | 3300049579 | Bacteria | 5177 |
| 830 | Ga0501043_0044466 | 3300049579 | Bacteria | 3492 |
| 831 | Ga0501043_0059057 | 3300049579 | Bacteria | 3009 |
| 832 | Ga0501043_0063655 | 3300049579 | Bacteria | 2896 |
| 833 | Ga0501043_0242589 | 3300049579 | Bacteria | 1389 |
| 834 | Ga0501046_0045486 | 3300049580 | Bacteria | 3487 |
| 835 | Ga0501046_0094590 | 3300049580 | Bacteria | 2296 |
| 836 | Ga0501046_0147582 | 3300049580 | Bacteria | 1775 |
| 837 | Ga0501047_0000306 | 3300049581 | Bacteria | 56352 |
| 838 | Ga0501047_0020132 | 3300049581 | Bacteria | 6405 |
| 839 | Ga0501047_0050681 | 3300049581 | Bacteria | 4009 |
| 840 | Ga0501047_0067244 | 3300049581 | Bacteria | 3454 |
| 841 | Ga0501047_0122834 | 3300049581 | Bacteria | 2477 |
| 842 | Ga0501047_0278134 | 3300049581 | Bacteria | 1519 |
| 843 | Ga0501047_0487580 | 3300049581 | Bacteria | 1060 |
| 844 | Ga0501048_0000137 | 3300049582 | Bacteria | 44038 |
| 845 | Ga0501048_0021042 | 3300049582 | Bacteria | 4779 |
| 846 | Ga0501048_0052355 | 3300049582 | Bacteria | 2905 |
| 847 | Ga0501067_0039584 | 3300049583 | Bacteria | 2617 |
| 848 | Ga0501068_0036641 | 3300049584 | Bacteria | 2934 |
| 849 | Ga0501068_0358875 | 3300049584 | Bacteria | 937 |
| 850 | Ga0501069_0013966 | 3300049585 | Bacteria | 4289 |
| 851 | Ga0501069_0018134 | 3300049585 | Bacteria | 3796 |
| 852 | Ga0501069_0292818 | 3300049585 | Bacteria | 954 |
| 853 | Ga0501070_0001636 | 3300049586 | Bacteria | 19852 |
| 854 | Ga0501070_0012886 | 3300049586 | Bacteria | 7045 |
| 855 | Ga0501070_0014023 | 3300049586 | Bacteria | 6746 |
| 856 | Ga0501070_0029633 | 3300049586 | Bacteria | 4587 |
| 857 | Ga0501070_0044279 | 3300049586 | Bacteria | 3704 |
| 858 | Ga0501070_0056080 | 3300049586 | Bacteria | 3266 |
| 859 | Ga0501070_0111398 | 3300049586 | Bacteria | 2262 |
| 860 | Ga0501070_0115556 | 3300049586 | Bacteria | 2216 |
| 861 | Ga0501070_0143310 | 3300049586 | Bacteria | 1972 |
| 862 | Ga0501070_0238250 | 3300049586 | Bacteria | 1489 |
| 863 | Ga0501070_0428286 | 3300049586 | Bacteria | 1068 |
| 864 | Ga0501070_0524901 | 3300049586 | Bacteria | 950 |
| 865 | Ga0501071_0078716 | 3300049587 | Bacteria | 2409 |
| 866 | Ga0501071_0204927 | 3300049587 | Bacteria | 1482 |
| 867 | Ga0501071_0254009 | 3300049587 | Bacteria | 1327 |
| 868 | Ga0501072_0006141 | 3300049588 | Bacteria | 9157 |
| 869 | Ga0501072_0330020 | 3300049588 | Bacteria | 1212 |
| 870 | Ga0501072_0412200 | 3300049588 | Bacteria | 1071 |
| 871 | Ga0501073_0023532 | 3300049589 | Bacteria | 4423 |
| 872 | Ga0501073_0168667 | 3300049589 | Bacteria | 1515 |
| 873 | Ga0501073_0190366 | 3300049589 | Bacteria | 1420 |
| 874 | Ga0501073_0227585 | 3300049589 | Bacteria | 1288 |
| 875 | Ga0501073_0482583 | 3300049589 | Unclassified | 857 |
| 876 | Ga0501074_0006141 | 3300049590 | Bacteria | 8675 |
| 877 | Ga0501074_0039640 | 3300049590 | Bacteria | 3411 |
| 878 | Ga0501074_0051064 | 3300049590 | Bacteria | 2984 |
| 879 | Ga0501075_0394041 | 3300049591 | Bacteria | 1056 |
| 880 | Ga0501079_0083671 | 3300049741 | Bacteria | 2468 |
| 881 | Ga0501079_0162711 | 3300049741 | Bacteria | 1740 |
| 882 | Ga0501079_0253480 | 3300049741 | Bacteria | 1375 |
| 883 | Ga0501080_0000574 | 3300049742 | Bacteria | 29100 |
| 884 | Ga0501080_0085483 | 3300049742 | Bacteria | 2931 |
| 885 | Ga0501080_0087653 | 3300049742 | Bacteria | 2891 |
| 886 | Ga0501080_0132108 | 3300049742 | Bacteria | 2311 |
| 887 | Ga0501080_0328308 | 3300049742 | Bacteria | 1384 |
| 888 | Ga0501080_0416193 | 3300049742 | Bacteria | 1208 |
| 889 | Ga0501081_0157659 | 3300049743 | Bacteria | 1634 |
| 890 | Ga0501083_0001509 | 3300049744 | Bacteria | 15904 |
| 891 | Ga0501083_0017130 | 3300049744 | Bacteria | 5055 |
| 892 | Ga0501083_0093288 | 3300049744 | Bacteria | 1987 |
| 893 | Ga0501083_0178892 | 3300049744 | Bacteria | 1385 |
| 894 | Ga0501083_0225597 | 3300049744 | Bacteria | 1220 |
| 895 | Ga0501035_0000253 | 3300049822 | Bacteria | 64326 |
| 896 | Ga0501035_0060470 | 3300049822 | Bacteria | 3372 |
| 897 | Ga0501035_0094247 | 3300049822 | Bacteria | 2633 |
| 898 | Ga0501035_0112609 | 3300049822 | Bacteria | 2384 |
| 899 | Ga0501035_0206909 | 3300049822 | Bacteria | 1680 |
| 900 | Ga0501044_0000815 | 3300049823 | Bacteria | 37466 |
| 901 | Ga0501044_0003892 | 3300049823 | Bacteria | 16730 |
| 902 | Ga0501044_0015393 | 3300049823 | Bacteria | 8237 |
| 903 | Ga0501044_0022228 | 3300049823 | Bacteria | 6759 |
| 904 | Ga0501044_0142897 | 3300049823 | Bacteria | 2381 |
| 905 | Ga0501044_0178658 | 3300049823 | Bacteria | 2090 |
| 906 | Ga0501044_0334848 | 3300049823 | Bacteria | 1435 |
| 907 | Ga0501044_0480871 | 3300049823 | Bacteria | 1145 |
| 908 | nmdc:mga03683_72812_c1 | 3300050489 | Bacteria | 1472 |
| 909 | nmdc:mga03n38_58029_c1 | 3300050490 | Bacteria | 1752 |
| 910 | nmdc:mga0k408_2232_c1 | 3300050493 | Bacteria | 10364 |
| 911 | nmdc:mga06z11_21901_c1 | 3300050494 | Bacteria | 2976 |
| 912 | nmdc:mga06z11_8599_c1 | 3300050494 | Bacteria | 4267 |
| 913 | nmdc:mga04h51_156034_c1 | 3300050495 | Bacteria | 875 |
| 914 | nmdc:mga04h51_157960_c1 | 3300050495 | Bacteria | 871 |
| 915 | nmdc:mga07m45_166364_c1 | 3300050496 | Bacteria | 1281 |
| 916 | nmdc:mga07m45_223644_c1 | 3300050496 | Bacteria | 1095 |
| 917 | nmdc:mga07m45_36431_c1 | 3300050496 | Bacteria | 2740 |
| 918 | nmdc:mga05p37_15391_c1 | 3300050507 | Bacteria | 9189 |
| 919 | nmdc:mga05p37_155918_c1 | 3300050507 | Bacteria | 2790 |
| 920 | nmdc:mga05p37_58_c1 | 3300050507 | Bacteria | 95765 |
| 921 | nmdc:mga09592_246_c1 | 3300050508 | Bacteria | 39321 |
| 922 | nmdc:mga0qj67_420_c1 | 3300050509 | Bacteria | 29051 |
| 923 | nmdc:mga06r32_1189_c1 | 3300050510 | Bacteria | 23415 |
| 924 | nmdc:mga06r32_350347_c1 | 3300050510 | Bacteria | 1461 |
| 925 | nmdc:mga08y16_1095_c1 | 3300050511 | Bacteria | 26715 |
| 926 | nmdc:mga08y16_408_c1 | 3300050511 | Bacteria | 29565 |
| 927 | nmdc:mga08y16_426886_c1 | 3300050511 | Bacteria | 1354 |
| 928 | nmdc:mga0n895_111650_c1 | 3300050512 | Bacteria | 2750 |
| 929 | nmdc:mga0n895_136041_c1 | 3300050512 | Bacteria | 2484 |
| 930 | nmdc:mga0n895_1786_c1 | 3300050512 | Bacteria | 16331 |
| 931 | nmdc:mga0n895_210_c1 | 3300050512 | Bacteria | 36466 |
| 932 | nmdc:mga0n895_29295_c1 | 3300050512 | Bacteria | 5249 |
| 933 | nmdc:mga0n895_31739_c1 | 3300050512 | Bacteria | 5061 |
| 934 | nmdc:mga0rr50_15101_c1 | 3300050513 | Bacteria | 5090 |
| 935 | nmdc:mga0rr50_18046_c1 | 3300050513 | Bacteria | 4730 |
| 936 | nmdc:mga0rr50_551_c1 | 3300050513 | Bacteria | 20118 |
| 937 | nmdc:mga0rr50_554633_c1 | 3300050513 | Bacteria | 978 |
| 938 | nmdc:mga08x19_332304_c1 | 3300050514 | Bacteria | 1059 |
| 939 | nmdc:mga08x19_61867_c1 | 3300050514 | Bacteria | 2426 |
| 940 | nmdc:mga08x19_70997_c1 | 3300050514 | Bacteria | 2270 |
| 941 | nmdc:mga0a205_1998_c1 | 3300050515 | Bacteria | 17770 |
| 942 | nmdc:mga0a205_6459_c3 | 3300050515 | Bacteria | 5099 |
| 943 | Ga0495601_0000048 | 3300053077 | Bacteria | 69310 |
| 944 | Ga0495601_0001704 | 3300053077 | Bacteria | 12143 |
| 945 | Ga0495601_0004933 | 3300053077 | Bacteria | 7740 |
| 946 | Ga0495601_0004989 | 3300053077 | Bacteria | 7703 |
| 947 | Ga0495612_0001352 | 3300053078 | Bacteria | 10110 |
| 948 | Ga0495612_0004252 | 3300053078 | Bacteria | 5945 |
| 949 | Ga0495595_0001723 | 3300053084 | Bacteria | 8561 |
| 950 | Ga0495595_0003173 | 3300053084 | Bacteria | 6519 |
| 951 | Ga0495595_0004063 | 3300053084 | Bacteria | 5857 |
| 952 | Ga0495595_0006739 | 3300053084 | Bacteria | 4686 |
| 953 | Ga0495595_0011229 | 3300053084 | Bacteria | 3740 |
| 954 | Ga0495595_0194127 | 3300053084 | Bacteria | 1009 |
| 955 | Ga0495619_0000142 | 3300053085 | Bacteria | 53495 |
| 956 | Ga0495619_0000348 | 3300053085 | Bacteria | 32235 |
| 957 | Ga0495619_0000760 | 3300053085 | Bacteria | 21033 |
| 958 | Ga0495619_0001740 | 3300053085 | Bacteria | 14448 |
| 959 | Ga0495619_0073860 | 3300053085 | Bacteria | 2286 |
| 960 | Ga0495619_0140689 | 3300053085 | Bacteria | 1661 |
| 961 | Ga0495619_0225931 | 3300053085 | Bacteria | 1297 |
| 962 | Ga0495619_0372070 | 3300053085 | Bacteria | 987 |
| 963 | Ga0500641_0005256 | 3300053096 | Bacteria | 4587 |
| 964 | Ga0500641_0027727 | 3300053096 | Bacteria | 2207 |
| 965 | Ga0501084_0182134 | 3300054114 | Bacteria | 1773 |
| 966 | Ga0501082_0251497 | 3300060353 | Bacteria | 1538 |
| 967 | Ga0501082_0751270 | 3300060353 | Bacteria | 853 |
| 968 | 2738746795 | 2738541281 | Bacteria | 5112672 |
| 969 | 2739356025 | 2738543032 | Bacteria | 5115625 |
| 970 | Ga0070681_10043022 | |||
| 971 | JGI24752J21851_1007370 | |||
| 972 | JGI24746J21847_1001303 | |||
| 973 | JGI24747J21853_1002926 | |||
| 974 | JGI24739J22299_10008549 | |||
| 975 | JGI24737J22298_10007957 | |||
| 976 | JGI24743J22301_10013113 | |||
| 977 | JGI24750J21931_1000131 | |||
| 978 | JGI24745J21846_1000345 | |||
| 979 | JGI24748J21848_1000453 | |||
| 980 | JGI24738J21930_10001862 | |||
| 981 | JGI24749J21850_1000396 | |||
| 982 | JGI24744J21845_10001151 | |||
| 983 | JGI24034J26672_10007089 | |||
| 984 | JGI24742J22300_10002797 | |||
| 985 | JGI25405J52794_10006392 | |||
| 986 | Ga0065715_10096672 | |||
| 987 | Ga0070676_10000453 | |||
| 988 | Ga0070683_100001364 | |||
| 989 | Ga0070690_100001804 | |||
| 990 | Ga0070690_100057455 | |||
| 991 | Ga0070670_100002480 | |||
| 992 | Ga0070670_100168389 | |||
| 993 | Ga0070677_10009496 | |||
| 994 | Ga0070677_10066993 | |||
| 995 | Ga0068869_100000405 | |||
| 996 | Ga0070666_10160023 | |||
| 997 | Ga0070680_100001735 | |||
| 998 | Ga0070680_100027948 | |||
| 999 | Ga0070680_100291189 | |||
| 1000 | Ga0070682_100002414 | |||
| 1001 | Ga0070682_100154193 | |||
| 1002 | Ga0070682_100176982 | |||
| 1003 | Ga0070682_100424359 | |||
| 1004 | Ga0068868_100000515 | |||
| 1005 | Ga0068868_100185549 | |||
| 1006 | Ga0070660_100000183 | |||
| 1007 | Ga0070660_100068495 | |||
| 1008 | Ga0070660_100114899 | |||
| 1009 | Ga0070689_100009233 | |||
| 1010 | Ga0070689_100097368 | |||
| 1011 | Ga0070687_100000164 | |||
| 1012 | Ga0070687_100125341 | |||
| 1013 | Ga0070661_100000411 | |||
| 1014 | Ga0070661_100382866 | |||
| 1015 | Ga0070692_10001516 | |||
| 1016 | Ga0070668_100010802 | |||
| 1017 | Ga0070669_100000114 | |||
| 1018 | Ga0070675_100000148 | |||
| 1019 | Ga0070671_100000070 | |||
| 1020 | Ga0070671_100062159 | |||
| 1021 | Ga0070671_100116149 | |||
| 1022 | Ga0070671_100122683 | |||
| 1023 | Ga0070674_100046877 | |||
| 1024 | Ga0070673_100000214 | |||
| 1025 | Ga0070673_100186245 | |||
| 1026 | Ga0070688_100004754 | |||
| 1027 | Ga0070688_100016083 | |||
| 1028 | Ga0070688_100018545 | |||
| 1029 | Ga0070659_100001224 | |||
| 1030 | Ga0070667_100002018 | |||
| 1031 | Ga0070667_100059896 | |||
| 1032 | Ga0070667_100117137 | |||
| 1033 | Ga0070667_100227143 | |||
| 1034 | Ga0070667_100233289 | |||
| 1035 | Ga0070703_10002903 | |||
| 1036 | Ga0070709_10155741 | |||
| 1037 | Ga0070709_10584571 | |||
| 1038 | Ga0070714_100020071 | |||
| 1039 | Ga0070714_100027411 | |||
| 1040 | Ga0070714_100056962 | |||
| 1041 | Ga0070714_100179209 | |||
| 1042 | Ga0070714_100352782 | |||
| 1043 | Ga0070713_100000680 | |||
| 1044 | Ga0070710_10006183 | |||
| 1045 | Ga0070710_10057261 | |||
| 1046 | Ga0070710_10151277 | |||
| 1047 | Ga0070710_10234095 | |||
| 1048 | Ga0070701_10000210 | |||
| 1049 | Ga0070711_100179997 | |||
| 1050 | Ga0070705_100000549 | |||
| 1051 | Ga0070700_100000328 | |||
| 1052 | Ga0070700_100165140 | |||
| 1053 | Ga0070694_100013627 | |||
| 1054 | Ga0070694_100401859 | |||
| 1055 | Ga0070663_100000100 | |||
| 1056 | Ga0070678_100001000 | |||
| 1057 | Ga0070678_100288226 | |||
| 1058 | Ga0070678_100488674 | |||
| 1059 | Ga0070662_100008274 | |||
| 1060 | Ga0070662_100085123 | |||
| 1061 | Ga0070662_100111198 | |||
| 1062 | Ga0070681_10001377 | |||
| 1063 | Ga0070681_10068303 | |||
| 1064 | Ga0070681_10156752 | |||
| 1065 | Ga0070681_10225201 | |||
| 1066 | Ga0070681_10254386 | |||
| 1067 | Ga0068867_100001032 | |||
| 1068 | Ga0068867_100078797 | |||
| 1069 | Ga0070685_10010286 | |||
| 1070 | Ga0070685_10024528 | |||
| 1071 | Ga0070707_100054108 | |||
| 1072 | Ga0070679_100002182 | |||
| 1073 | Ga0070679_100023170 | |||
| 1074 | Ga0070679_100107097 | |||
| 1075 | Ga0070679_100138301 | |||
| 1076 | Ga0070679_100277664 | |||
| 1077 | Ga0070684_100000306 | |||
| 1078 | Ga0070684_100086339 | |||
| 1079 | Ga0070697_100172353 | |||
| 1080 | Ga0068853_100006837 | |||
| 1081 | Ga0070672_100000289 | |||
| 1082 | Ga0070686_100000261 | |||
| 1083 | Ga0070686_100003064 | |||
| 1084 | Ga0070686_100230764 | |||
| 1085 | Ga0070695_100012184 | |||
| 1086 | Ga0070696_100005594 | |||
| 1087 | Ga0070696_100048885 | |||
| 1088 | Ga0070693_100000204 | |||
| 1089 | Ga0070665_100046336 | |||
| 1090 | Ga0070665_100425310 | |||
| 1091 | Ga0070665_100522504 | |||
| 1092 | Ga0070704_100000297 | |||
| 1093 | Ga0070704_100149095 | |||
| 1094 | Ga0068855_100004961 | |||
| 1095 | Ga0070664_100002983 | |||
| 1096 | Ga0070664_100313569 | |||
| 1097 | Ga0068857_100001434 | |||
| 1098 | Ga0068854_100005280 | |||
| 1099 | Ga0068854_100127923 | |||
| 1100 | Ga0068856_100009252 | |||
| 1101 | Ga0068856_100072815 | |||
| 1102 | Ga0070702_100000592 | |||
| 1103 | Ga0068852_100000836 | |||
| 1104 | Ga0068852_100045255 | |||
| 1105 | Ga0068852_100080459 | |||
| 1106 | Ga0068852_100208432 | |||
| 1107 | Ga0068859_100002494 | |||
| 1108 | Ga0068859_100472481 | |||
| 1109 | Ga0068864_100000172 | |||
| 1110 | Ga0068864_100380453 | |||
| 1111 | Ga0068866_10000325 | |||
| 1112 | Ga0068861_100002528 | |||
| 1113 | Ga0068851_10026967 | |||
| 1114 | Ga0068870_10000846 | |||
| 1115 | Ga0068863_100002553 | |||
| 1116 | Ga0068863_100088116 | |||
| 1117 | Ga0068863_100193261 | |||
| 1118 | Ga0068863_100545351 | |||
| 1119 | Ga0068858_100001665 | |||
| 1120 | Ga0068858_100155864 | |||
| 1121 | Ga0068858_100480997 | |||
| 1122 | Ga0068860_100001131 | |||
| 1123 | Ga0068860_100282013 | |||
| 1124 | Ga0068860_100341322 | |||
| 1125 | Ga0068860_100346870 | |||
| 1126 | Ga0068862_100185101 | |||
| 1127 | Ga0081455_10000002 | |||
| 1128 | Ga0081455_10002251 | |||
| 1129 | Ga0081455_10162888 | |||
| 1130 | Ga0081540_1000241 | |||
| 1131 | Ga0070717_10006536 | |||
| 1132 | Ga0070717_10021129 | |||
| 1133 | Ga0070717_10100147 | |||
| 1134 | Ga0070717_10309000 | |||
| 1135 | Ga0070717_10320569 | |||
| 1136 | Ga0075365_10317151 | |||
| 1137 | Ga0075368_10019635 | |||
| 1138 | Ga0075368_10126126 | |||
| 1139 | Ga0075363_100081414 | |||
| 1140 | Ga0075432_10002460 | |||
| 1141 | Ga0070715_10011831 | |||
| 1142 | Ga0070716_100000480 | |||
| 1143 | Ga0070712_100104322 | |||
| 1144 | Ga0075362_10022910 | |||
| 1145 | Ga0075362_10086701 | |||
| 1146 | Ga0075367_10011069 | |||
| 1147 | Ga0075367_10040107 | |||
| 1148 | Ga0075367_10182975 | |||
| 1149 | Ga0075427_10000802 | |||
| 1150 | Ga0075366_10000286 | |||
| 1151 | Ga0075366_10054089 | |||
| 1152 | Ga0097621_100000006 | |||
| 1153 | Ga0097621_100028909 | |||
| 1154 | Ga0075370_10011720 | |||
| 1155 | Ga0075370_10097285 | |||
| 1156 | Ga0068871_100001147 | |||
| 1157 | Ga0068871_100038474 | |||
| 1158 | Ga0075430_100000125 | |||
| 1159 | Ga0075430_100328593 | |||
| 1160 | Ga0075431_100007030 | |||
| 1161 | Ga0075433_10000008 | |||
| 1162 | Ga0075433_10021731 | |||
| 1163 | Ga0075433_10078338 | |||
| 1164 | Ga0075433_10175674 | |||
| 1165 | Ga0075434_100000152 | |||
| 1166 | Ga0075434_100003460 | |||
| 1167 | Ga0075434_100059084 | |||
| 1168 | Ga0075434_100098201 | |||
| 1169 | Ga0075434_100104129 | |||
| 1170 | Ga0075429_100000083 | |||
| 1171 | Ga0068865_100000114 | |||
| 1172 | Ga0075436_100006953 | |||
| 1173 | Ga0075436_100076225 | |||
| 1174 | Ga0097620_100002494 | |||
| 1175 | Ga0097620_100472468 | |||
| 1176 | Ga0075435_100012469 | |||
| 1177 | Ga0075435_100057374 | |||
| 1178 | Ga0075435_100243070 | |||
| 1179 | Ga0075435_100269209 | |||
| 1180 | Ga0099795_10000504 | |||
| 1181 | Ga0099795_10049589 | |||
| 1182 | Ga0105250_10054276 | |||
| 1183 | Ga0105250_10069427 | |||
| 1184 | Ga0105240_10012009 | |||
| 1185 | Ga0105240_10015529 | |||
| 1186 | Ga0111539_10001699 | |||
| 1187 | Ga0111539_10019539 | |||
| 1188 | Ga0111539_10145718 | |||
| 1189 | Ga0111539_10315296 | |||
| 1190 | Ga0105245_10000175 | |||
| 1191 | Ga0105245_10278549 | |||
| 1192 | Ga0105245_10477674 | |||
| 1193 | Ga0105247_10001094 | |||
| 1194 | Ga0105247_10018151 | |||
| 1195 | Ga0105247_10093383 | |||
| 1196 | Ga0114129_10000533 | |||
| 1197 | Ga0114129_10010322 | |||
| 1198 | Ga0105243_10000315 | |||
| 1199 | Ga0105243_10106218 | |||
| 1200 | Ga0105243_10157847 | |||
| 1201 | Ga0105243_10434267 | |||
| 1202 | Ga0105241_10000316 | |||
| 1203 | Ga0105241_10107771 | |||
| 1204 | Ga0105242_10000356 | |||
| 1205 | Ga0105242_10015913 | |||
| 1206 | Ga0105248_10001326 | |||
| 1207 | Ga0105248_10007327 | |||
| 1208 | Ga0105248_10010783 | |||
| 1209 | Ga0105248_10224439 | |||
| 1210 | Ga0105248_10416120 | |||
| 1211 | Ga0105237_10019485 | |||
| 1212 | Ga0105238_10214253 | |||
| 1213 | Ga0105238_10667556 | |||
| 1214 | Ga0105249_10000289 | |||
| 1215 | Ga0099796_10000185 | |||
| 1216 | Ga0105239_10008446 | |||
| 1217 | Ga0105239_10331986 | |||
| 1218 | Ga0105239_10756988 | |||
| 1219 | Ga0105246_10000070 | |||
| 1220 | Ga0105246_10093244 | |||
| 1221 | Ga0157373_10029598 | |||
| 1222 | Ga0157371_10005008 | |||
| 1223 | Ga0157370_10054315 | |||
| 1224 | Ga0157370_10129286 | |||
| 1225 | Ga0157369_10563197 | |||
| 1226 | Ga0157369_10688454 | |||
| 1227 | Ga0157369_10797836 | |||
| 1228 | Ga0157374_10001589 | |||
| 1229 | Ga0157374_10304567 | |||
| 1230 | Ga0157378_10000713 | |||
| 1231 | Ga0157378_10096812 | |||
| 1232 | Ga0157378_10559268 | |||
| 1233 | Ga0163162_10000202 | |||
| 1234 | Ga0163162_10448753 | |||
| 1235 | Ga0157372_10036396 | |||
| 1236 | Ga0157372_10293784 | |||
| 1237 | Ga0157375_10000507 | |||
| 1238 | Ga0157375_10281621 | |||
| 1239 | Ga0163163_10001140 | |||
| 1240 | Ga0163163_10002989 | |||
| 1241 | Ga0163163_10012390 | |||
| 1242 | Ga0157380_10000823 | |||
| 1243 | Ga0157380_10328959 | |||
| 1244 | Ga0157377_10000109 | |||
| 1245 | Ga0157379_10008739 | |||
| 1246 | Ga0157379_10026034 | |||
| 1247 | Ga0157379_10170556 | |||
| 1248 | Ga0157376_10000211 | |||
| 1249 | Ga0157376_10186479 | |||
| 1250 | Ga0163161_10000132 | |||
| 1251 | Ga0163161_10034783 | |||
| 1252 | Ga0163161_10154211 | |||
| 1253 | Ga0163161_10232307 | |||
| 1254 | Ga0206356_10802032 | |||
| 1255 | Ga0206354_10645964 | |||
| 1256 | Ga0206353_11534553 | |||
| 1257 | Ga0213875_10000031 | |||
| 1258 | Ga0207666_1000018 | |||
| 1259 | Ga0207673_1000004 | |||
| 1260 | Ga0207697_10000078 | |||
| 1261 | Ga0207653_10012978 | |||
| 1262 | Ga0207682_10000001 | |||
| 1263 | Ga0207682_10028194 | |||
| 1264 | Ga0207692_10012572 | |||
| 1265 | Ga0207692_10031234 | |||
| 1266 | Ga0207642_10003965 | |||
| 1267 | Ga0207710_10003351 | |||
| 1268 | Ga0207710_10016933 | |||
| 1269 | Ga0207710_10131797 | |||
| 1270 | Ga0207688_10000132 | |||
| 1271 | Ga0207680_10019790 | |||
| 1272 | Ga0207680_10227346 | |||
| 1273 | Ga0207647_10000678 | |||
| 1274 | Ga0207685_10014445 | |||
| 1275 | Ga0207699_10000206 | |||
| 1276 | Ga0207699_10131806 | |||
| 1277 | Ga0207645_10000110 | |||
| 1278 | Ga0207645_10009349 | |||
| 1279 | Ga0207643_10001892 | |||
| 1280 | Ga0207705_10105091 | |||
| 1281 | Ga0207707_10000922 | |||
| 1282 | Ga0207707_10040591 | |||
| 1283 | Ga0207707_10192038 | |||
| 1284 | Ga0207707_10214877 | |||
| 1285 | Ga0207695_10051521 | |||
| 1286 | Ga0207695_10065916 | |||
| 1287 | Ga0207671_10009327 | |||
| 1288 | Ga0207671_10212223 | |||
| 1289 | Ga0207693_10018725 | |||
| 1290 | Ga0207693_10076094 | |||
| 1291 | Ga0207693_10081896 | |||
| 1292 | Ga0207693_10240367 | |||
| 1293 | Ga0207663_10044876 | |||
| 1294 | Ga0207663_10175681 | |||
| 1295 | Ga0207660_10000063 | |||
| 1296 | Ga0207660_10051692 | |||
| 1297 | Ga0207660_10400895 | |||
| 1298 | Ga0207660_10562389 | |||
| 1299 | Ga0207662_10000581 | |||
| 1300 | Ga0207662_10040307 | |||
| 1301 | Ga0207662_10139265 | |||
| 1302 | Ga0207657_10002831 | |||
| 1303 | Ga0207657_10012668 | |||
| 1304 | Ga0207657_10113413 | |||
| 1305 | Ga0207649_10000064 | |||
| 1306 | Ga0207652_10000128 | |||
| 1307 | Ga0207652_10010954 | |||
| 1308 | Ga0207652_10091116 | |||
| 1309 | Ga0207652_10137597 | |||
| 1310 | Ga0207652_10224347 | |||
| 1311 | Ga0207681_10000024 | |||
| 1312 | Ga0207650_10008086 | |||
| 1313 | Ga0207659_10000034 | |||
| 1314 | Ga0207687_10000069 | |||
| 1315 | Ga0207687_10243721 | |||
| 1316 | Ga0207700_10007400 | |||
| 1317 | Ga0207700_10215459 | |||
| 1318 | Ga0207664_10002775 | |||
| 1319 | Ga0207664_10080701 | |||
| 1320 | Ga0207644_10000342 | |||
| 1321 | Ga0207644_10011935 | |||
| 1322 | Ga0207644_10084704 | |||
| 1323 | Ga0207644_10121974 | |||
| 1324 | Ga0207690_10000068 | |||
| 1325 | Ga0207706_10002299 | |||
| 1326 | Ga0207706_10019674 | |||
| 1327 | Ga0207706_10268243 | |||
| 1328 | Ga0207686_10000875 | |||
| 1329 | Ga0207686_10021413 | |||
| 1330 | Ga0207686_10180423 | |||
| 1331 | Ga0207709_10003412 | |||
| 1332 | Ga0207709_10042441 | |||
| 1333 | Ga0207709_10296110 | |||
| 1334 | Ga0207670_10000057 | |||
| 1335 | Ga0207670_10018002 | |||
| 1336 | Ga0207669_10000005 | |||
| 1337 | Ga0207669_10037640 | |||
| 1338 | Ga0207669_10060777 | |||
| 1339 | Ga0207704_10000346 | |||
| 1340 | Ga0207704_10030499 | |||
| 1341 | Ga0207704_10078408 | |||
| 1342 | Ga0207704_10344965 | |||
| 1343 | Ga0207665_10001878 | |||
| 1344 | Ga0207665_10080548 | |||
| 1345 | Ga0207665_10104954 | |||
| 1346 | Ga0207691_10000543 | |||
| 1347 | Ga0207691_10114853 | |||
| 1348 | Ga0207711_10004328 | |||
| 1349 | Ga0207711_10014202 | |||
| 1350 | Ga0207711_10017864 | |||
| 1351 | Ga0207711_10141341 | |||
| 1352 | Ga0207689_10000055 | |||
| 1353 | Ga0207661_10000036 | |||
| 1354 | Ga0207679_10000025 | |||
| 1355 | Ga0207679_10124182 | |||
| 1356 | Ga0207679_10250043 | |||
| 1357 | Ga0207667_10003352 | |||
| 1358 | Ga0207667_10038158 | |||
| 1359 | Ga0207667_10283313 | |||
| 1360 | Ga0207667_10549537 | |||
| 1361 | Ga0207651_10000014 | |||
| 1362 | Ga0207651_10114883 | |||
| 1363 | Ga0207712_10000523 | |||
| 1364 | Ga0207668_10000352 | |||
| 1365 | Ga0207640_10000779 | |||
| 1366 | Ga0207658_10001275 | |||
| 1367 | Ga0207658_10050110 | |||
| 1368 | Ga0207677_10000382 | |||
| 1369 | Ga0207703_10001504 | |||
| 1370 | Ga0207703_10018104 | |||
| 1371 | Ga0207639_10000288 | |||
| 1372 | Ga0207678_10000292 | |||
| 1373 | Ga0207708_10001276 | |||
| 1374 | Ga0207702_10084727 | |||
| 1375 | Ga0207702_10113025 | |||
| 1376 | Ga0207702_10302023 | |||
| 1377 | Ga0207702_10610678 | |||
| 1378 | Ga0207641_10058613 | |||
| 1379 | Ga0207641_10111390 | |||
| 1380 | Ga0207641_10259708 | |||
| 1381 | Ga0207641_10404270 | |||
| 1382 | Ga0207648_10003100 | |||
| 1383 | Ga0207648_10012111 | |||
| 1384 | Ga0207648_10048827 | |||
| 1385 | Ga0207648_10314393 | |||
| 1386 | Ga0207676_10000826 | |||
| 1387 | Ga0207676_10022901 | |||
| 1388 | Ga0207674_10000376 | |||
| 1389 | Ga0207675_100002377 | |||
| 1390 | Ga0207675_100088084 | |||
| 1391 | Ga0207675_100515779 | |||
| 1392 | Ga0207683_10000001 | |||
| 1393 | Ga0207683_10021116 | |||
| 1394 | Ga0207683_10026710 | |||
| 1395 | Ga0207683_10046152 | |||
| 1396 | Ga0207698_10000231 | |||
| 1397 | Ga0207698_10043243 | |||
| 1398 | Ga0207698_10419771 | |||
| 1399 | Ga0209982_1022040 | |||
| 1400 | Ga0209966_1008239 | |||
| 1401 | Ga0209966_1015555 | |||
| 1402 | Ga0209998_10003278 | |||
| 1403 | Ga0209998_10003574 | |||
| 1404 | Ga0209813_10033268 | |||
| 1405 | Ga0209974_10001490 | |||
| 1406 | Ga0207428_10000162 | |||
| 1407 | Ga0207428_10000233 | |||
| 1408 | Ga0268266_10033132 | |||
| 1409 | Ga0268265_10000477 | |||
| 1410 | Ga0268265_10650194 | |||
| 1411 | Ga0268264_10000309 | |||
| 1412 | Ga0268264_10027832 | |||
| 1413 | Ga0268264_10539584 | |||
| 1414 | Ga0265338_10076248 | |||
| 1415 | Ga0265325_10000056 | |||
| 1416 | Ga0265325_10001378 | |||
| 1417 | Ga0265325_10003842 | |||
| 1418 | Ga0265325_10032699 | |||
| 1419 | Ga0265325_10096896 | |||
| 1420 | Ga0265340_10019704 | |||
| 1421 | Ga0265340_10054702 | |||
| 1422 | Ga0265339_10001310 | |||
| 1423 | Ga0265339_10003844 | |||
| 1424 | Ga0265331_10100646 | |||
| 1425 | Ga0265316_10218287 | |||
| 1426 | Ga0265313_10014436 | |||
| 1427 | Ga0265313_10062195 | |||
| 1428 | Ga0265342_10000193 | |||
| 1429 | Ga0307409_100323287 | |||
| 1430 | Ga0373948_0000932 | |||
| 1431 | Ga0373948_0013231 | |||
| 1432 | Ga0373950_0008480 | |||
| 1433 | Ga0373958_0003525 | |||
| 1434 | Ga0373958_0049748 | |||
| 1435 | Ga0373938_0001151 | |||
| 1436 | Ga0373938_0001291 | |||
| 1437 | Ga0373926_0027019 | |||
| 1438 | Ga0373928_0002146 | |||
| 1439 | Ga0373928_0002836 | |||
| 1440 | Ga0373929_0000675 | |||
| 1441 | Ga0373929_0016152 | |||
| 1442 | Ga0373934_0059023 | |||
| 1443 | Ga0373940_0003452 | |||
| 1444 | Ga0373940_0025916 | |||
| 1445 | Ga0373944_0009606 | |||
| 1446 | Ga0373944_0046664 | |||
| 1447 | Ga0373949_0001862 | |||
| 1448 | Ga0373949_0004195 | |||
| 1449 | Ga0373949_0024626 | |||
| 1450 | Ga0373951_0000710 | |||
| 1451 | Ga0373952_0001834 | |||
| 1452 | Ga0373952_0014692 | |||
| 1453 | Ga0373952_0030118 | |||
| 1454 | Ga0373923_0054229 | |||
| 1455 | Ga0373923_0144358 | |||
| 1456 | Ga0373932_0000674 | |||
| 1457 | Ga0373932_0001584 | |||
| 1458 | Ga0373936_0019109 | |||
| 1459 | Ga0373939_0001761 | |||
| 1460 | Ga0373939_0008814 | |||
| 1461 | Ga0373939_0028672 | |||
| 1462 | Ga0373939_0029902 | |||
| 1463 | Ga0373941_0000367 | |||
| 1464 | Ga0373941_0002074 | |||
| 1465 | Ga0373941_0023011 | |||
| 1466 | Ga0373945_0073968 | |||
| 1467 | Ga0373953_0014468 | |||
| 1468 | Ga0373954_0000573 | |||
| 1469 | Ga0373954_0060119 | |||
| 1470 | Ga0373956_0053271 | |||
| 1471 | Ga0373956_0142068 | |||
| 1472 | Ga0373957_0003946 | |||
| 1473 | Ga0373957_0050729 | |||
| 1474 | Ga0373957_0141048 | |||
| 1475 | Ga0373960_0001805 | |||
| 1476 | Ga0373960_0001871 | |||
| 1477 | Ga0373943_0184496 | |||
| 1478 | Ga0373946_0010861 | |||
| 1479 | Ga0373946_0052312 | |||
| 1480 | Ga0373946_0058594 | |||
| 1481 | Ga0373955_0001431 | |||
| 1482 | Ga0373955_0055606 | |||
| 1483 | Ga0373955_0210753 | |||
| 1484 | Ga0373942_0010607 | |||
| 1485 | Ga0373942_0042160 | |||
| 1486 | Ga0373961_0005475 | |||
| 1487 | Ga0373962_0000104 | |||
| 1488 | Ga0373924_0065198 | |||
| 1489 | Ga0373924_0082007 | |||
| 1490 | Ga0373924_0101656 | |||
| 1491 | Ga0373931_0000072 | |||
| 1492 | Ga0373931_0000682 | |||
| 1493 | Ga0373931_0004121 | |||
| 1494 | Ga0373931_0033427 | |||
| 1495 | Ga0373931_0113623 | |||
| 1496 | Ga0373935_0006366 | |||
| 1497 | Ga0373935_0019659 | |||
| 1498 | Ga0373935_0044119 | |||
| 1499 | Ga0373935_0131532 | |||
| 1500 | Ga0373935_0204413 | |||
| 1501 | Ga0373927_0014307 | |||
| 1502 | Ga0373927_0410553 | |||
| 1503 | Ga0373927_0458203 | |||
| 1504 | Ga0373933_0002471 | |||
| 1505 | Ga0373933_0003704 | |||
| 1506 | Ga0373933_0025249 | |||
| 1507 | Ga0373947_0017662 | |||
| 1508 | Ga0373947_0020325 | |||
| 1509 | Ga0373947_0315305 | |||
| 1510 | Ga0373937_0014028 | |||
| 1511 | Ga0373937_0029548 | |||
| 1512 | Ga0373937_0081967 | |||
| 1513 | Ga0373937_0109242 | |||
| 1514 | Ga0373937_0114232 | |||
| 1515 | Ga0373937_0148464 | |||
| 1516 | Ga0373937_0474620 | |||
| 1517 | Ga0373925_0007613 | |||
| 1518 | Ga0373925_0060370 | |||
| 1519 | Ga0373925_0074537 | |||
| 1520 | Ga0373925_0165617 | |||
| 1521 | Ga0436364_0793438 | |||
| 1522 | Ga0395901_0009364 | |||
| 1523 | Ga0395901_0688008 | |||
| 1524 | Ga0436365_1569042 | |||
| 1525 | Ga0436363_0254747 | |||
| 1526 | Ga0439453_0020816 | |||
| 1527 | Ga0439448_0012112 | |||
| 1528 | Ga0439450_004592 | |||
| 1529 | Ga0439455_0009610 | |||
| 1530 | Ga0439463_011971 | |||
| 1531 | Ga0439434_0090258 | |||
| 1532 | Ga0439464_0089070 | |||
| 1533 | Ga0466963_0083735 | |||
| 1534 | Ga0466963_0136663 | |||
| 1535 | Ga0466957_0011624 | |||
| 1536 | Ga0466957_0053856 | |||
| 1537 | Ga0466959_0015280 | |||
| 1538 | Ga0466958_0032332 | |||
| 1539 | Ga0495617_021410 | |||
| 1540 | Ga0495592_0011976 | |||
| 1541 | Ga0495592_0014877 | |||
| 1542 | Ga0495592_0169073 | |||
| 1543 | Ga0495603_0015018 | |||
| 1544 | Ga0495603_0030359 | |||
| 1545 | Ga0495590_0114743 | |||
| 1546 | Ga0495629_0000301 | |||
| 1547 | Ga0495629_0138563 | |||
| 1548 | Ga0495641_0012536 | |||
| 1549 | Ga0495651_0000931 | |||
| 1550 | Ga0495651_0002045 | |||
| 1551 | Ga0495651_0008299 | |||
| 1552 | Ga0495651_0072527 | |||
| 1553 | Ga0495653_0007314 | |||
| 1554 | Ga0495653_0026303 | |||
| 1555 | Ga0495653_0133035 | |||
| 1556 | Ga0495580_0010672 | |||
| 1557 | Ga0495580_0096909 | |||
| 1558 | Ga0495582_0000165 | |||
| 1559 | Ga0495582_0062824 | |||
| 1560 | Ga0495582_0173353 | |||
| 1561 | Ga0495605_0107640 | |||
| 1562 | Ga0495639_0001251 | |||
| 1563 | Ga0495639_0021907 | |||
| 1564 | Ga0495662_0007950 | |||
| 1565 | Ga0495662_0032820 | |||
| 1566 | Ga0495662_0074838 | |||
| 1567 | Ga0495662_0208957 | |||
| 1568 | Ga0495664_0025708 | |||
| 1569 | Ga0495664_0217281 | |||
| 1570 | Ga0495664_0335571 | |||
| 1571 | Ga0495584_0027415 | |||
| 1572 | Ga0495585_0001207 | |||
| 1573 | Ga0495594_0023233 | |||
| 1574 | Ga0495594_0037055 | |||
| 1575 | Ga0495607_0004923 | |||
| 1576 | Ga0495608_0015277 | |||
| 1577 | Ga0495608_0107960 | |||
| 1578 | Ga0495608_0132380 | |||
| 1579 | Ga0495608_0235631 | |||
| 1580 | Ga0495616_0146103 | |||
| 1581 | Ga0495618_0036630 | |||
| 1582 | Ga0495628_0086094 | |||
| 1583 | Ga0495628_0110422 | |||
| 1584 | Ga0495628_0155343 | |||
| 1585 | Ga0495628_0170949 | |||
| 1586 | Ga0495628_0263973 | |||
| 1587 | Ga0495628_0289909 | |||
| 1588 | Ga0495630_0021325 | |||
| 1589 | Ga0495630_0508072 | |||
| 1590 | Ga0495631_0021408 | |||
| 1591 | Ga0495637_0097569 | |||
| 1592 | Ga0495644_0000571 | |||
| 1593 | Ga0495663_0014599 | |||
| 1594 | Ga0495666_0030723 | |||
| 1595 | Ga0495652_0018029 | |||
| 1596 | Ga0495652_0024574 | |||
| 1597 | Ga0495652_0276128 | |||
| 1598 | Ga0495640_0221699 | |||
| 1599 | Ga0495586_0010183 | |||
| 1600 | Ga0495586_0063899 | |||
| 1601 | Ga0495587_0006331 | |||
| 1602 | Ga0495587_0030470 | |||
| 1603 | Ga0495598_0001757 | |||
| 1604 | Ga0495609_0012501 | |||
| 1605 | Ga0495621_0082389 | |||
| 1606 | Ga0495645_0000223 | |||
| 1607 | Ga0495645_0033789 | |||
| 1608 | Ga0495645_0239972 | |||
| 1609 | Ga0495645_0274605 | |||
| 1610 | Ga0495622_0005532 | |||
| 1611 | Ga0495622_0027314 | |||
| 1612 | Ga0495622_0108057 | |||
| 1613 | Ga0495633_0001185 | |||
| 1614 | Ga0495667_0031790 | |||
| 1615 | Ga0495667_0033059 | |||
| 1616 | Ga0495667_0051584 | |||
| 1617 | Ga0495667_0076909 | |||
| 1618 | Ga0495656_0001164 | |||
| 1619 | Ga0495634_0034266 | |||
| 1620 | Ga0495634_0181103 | |||
| 1621 | Ga0495611_0007125 | |||
| 1622 | Ga0495635_0000999 | |||
| 1623 | Ga0495635_0017785 | |||
| 1624 | Ga0495635_0089731 | |||
| 1625 | Ga0495635_0378365 | |||
| 1626 | Ga0495659_0000975 | |||
| 1627 | Ga0495659_0029381 | |||
| 1628 | Ga0495659_0029982 | |||
| 1629 | Ga0495659_0132780 | |||
| 1630 | Ga0495661_0025793 | |||
| 1631 | Ga0495588_0171359 | |||
| 1632 | Ga0495657_0002536 | |||
| 1633 | Ga0495657_0016458 | |||
| 1634 | Ga0495657_0018493 | |||
| 1635 | Ga0495599_0001964 | |||
| 1636 | Ga0495599_0010860 | |||
| 1637 | Ga0495599_0044219 | |||
| 1638 | Ga0495623_0000454 | |||
| 1639 | Ga0495623_0004056 | |||
| 1640 | Ga0495646_0006696 | |||
| 1641 | Ga0495646_0027070 | |||
| 1642 | Ga0495658_0001694 | |||
| 1643 | Ga0495658_0004617 | |||
| 1644 | Ga0495658_0028677 | |||
| 1645 | Ga0495658_0077116 | |||
| 1646 | Ga0495658_0290972 | |||
| 1647 | Ga0495669_0038709 | |||
| 1648 | Ga0495613_0001324 | |||
| 1649 | Ga0495613_0056789 | |||
| 1650 | Ga0495613_0079146 | |||
| 1651 | Ga0495624_0009215 | |||
| 1652 | Ga0495670_0000747 | |||
| 1653 | Ga0495671_0173976 | |||
| 1654 | Ga0495589_0065258 | |||
| 1655 | Ga0495600_0026812 | |||
| 1656 | Ga0495600_0056640 | |||
| 1657 | Ga0495600_0140451 | |||
| 1658 | Ga0495600_0216991 | |||
| 1659 | Ga0495604_0022921 | |||
| 1660 | Ga0495604_0037287 | |||
| 1661 | Ga0495604_0054164 | |||
| 1662 | Ga0495674_0024659 | |||
| 1663 | Ga0495676_0202244 | |||
| 1664 | Ga0495680_0001680 | |||
| 1665 | Ga0495680_0009135 | |||
| 1666 | Ga0495680_0010402 | |||
| 1667 | Ga0495680_0014617 | |||
| 1668 | Ga0495680_0028181 | |||
| 1669 | Ga0495683_0142503 | |||
| 1670 | Ga0495675_0001429 | |||
| 1671 | Ga0495675_0066407 | |||
| 1672 | Ga0495679_007873 | |||
| 1673 | Ga0495684_0004283 | |||
| 1674 | Ga0495593_0032912 | |||
| 1675 | Ga0495593_0081571 | |||
| 1676 | Ga0495593_0116075 | |||
| 1677 | Ga0495602_0013952 | |||
| 1678 | Ga0495602_0041284 | |||
| 1679 | Ga0495602_0071245 | |||
| 1680 | Ga0495602_0130857 | |||
| 1681 | Ga0495614_0013643 | |||
| 1682 | Ga0496100_0000161 | |||
| 1683 | Ga0496100_0002282 | |||
| 1684 | Ga0496100_0016513 | |||
| 1685 | Ga0496100_0042406 | |||
| 1686 | Ga0496101_0000869 | |||
| 1687 | Ga0496101_0021875 | |||
| 1688 | Ga0496101_0047296 | |||
| 1689 | Ga0496101_0256776 | |||
| 1690 | Ga0496101_0528848 | |||
| 1691 | Ga0496102_0002837 | |||
| 1692 | Ga0496102_0005211 | |||
| 1693 | Ga0496102_0005523 | |||
| 1694 | Ga0496102_0015550 | |||
| 1695 | Ga0496102_0077239 | |||
| 1696 | Ga0496103_0000499 | |||
| 1697 | Ga0496103_0002698 | |||
| 1698 | Ga0496103_0092286 | |||
| 1699 | Ga0496103_0312243 | |||
| 1700 | Ga0496104_0000370 | |||
| 1701 | Ga0496104_0001967 | |||
| 1702 | Ga0496104_0005269 | |||
| 1703 | Ga0496104_0019317 | |||
| 1704 | Ga0496104_0023038 | |||
| 1705 | Ga0496104_0025999 | |||
| 1706 | Ga0496104_0096700 | |||
| 1707 | Ga0496105_0005159 | |||
| 1708 | Ga0496105_0021982 | |||
| 1709 | Ga0496105_0026435 | |||
| 1710 | Ga0496105_0039433 | |||
| 1711 | Ga0496105_0249719 | |||
| 1712 | Ga0496106_0000357 | |||
| 1713 | Ga0496106_0013549 | |||
| 1714 | Ga0496106_0022564 | |||
| 1715 | Ga0496106_0258367 | |||
| 1716 | Ga0496107_0000206 | |||
| 1717 | Ga0496107_0001825 | |||
| 1718 | Ga0496107_0007544 | |||
| 1719 | Ga0496107_0047489 | |||
| 1720 | Ga0496107_0050511 | |||
| 1721 | Ga0496107_0163807 | |||
| 1722 | Ga0496108_0007040 | |||
| 1723 | Ga0496108_0012661 | |||
| 1724 | Ga0496108_0017975 | |||
| 1725 | Ga0496108_0030762 | |||
| 1726 | Ga0496108_0037549 | |||
| 1727 | Ga0496108_0064702 | |||
| 1728 | Ga0496108_0182907 | |||
| 1729 | Ga0496109_0001922 | |||
| 1730 | Ga0496109_0001930 | |||
| 1731 | Ga0496109_0027546 | |||
| 1732 | Ga0496109_0281086 | |||
| 1733 | Ga0496109_0538594 | |||
| 1734 | Ga0496110_0005694 | |||
| 1735 | Ga0496110_0011922 | |||
| 1736 | Ga0496110_0029162 | |||
| 1737 | Ga0496110_0113541 | |||
| 1738 | Ga0496111_0008628 | |||
| 1739 | Ga0496111_0046671 | |||
| 1740 | Ga0496112_0003333 | |||
| 1741 | Ga0496112_0093856 | |||
| 1742 | Ga0496112_0125195 | |||
| 1743 | Ga0496112_0244975 | |||
| 1744 | Ga0496112_0265779 | |||
| 1745 | Ga0496113_0002587 | |||
| 1746 | Ga0496113_0003762 | |||
| 1747 | Ga0496113_0007424 | |||
| 1748 | Ga0496113_0013972 | |||
| 1749 | Ga0496113_0016330 | |||
| 1750 | Ga0496113_0036620 | |||
| 1751 | Ga0496114_0008819 | |||
| 1752 | Ga0496114_0011210 | |||
| 1753 | Ga0496114_0215058 | |||
| 1754 | Ga0496115_0001252 | |||
| 1755 | Ga0496115_0032161 | |||
| 1756 | Ga0496115_0058158 | |||
| 1757 | Ga0496115_0092042 | |||
| 1758 | Ga0496115_0099734 | |||
| 1759 | Ga0496115_0242170 | |||
| 1760 | Ga0496115_0306600 | |||
| 1761 | Ga0496121_0013535 | |||
| 1762 | Ga0496126_0003241 | |||
| 1763 | Ga0496126_0330957 | |||
| 1764 | Ga0501031_0036019 | |||
| 1765 | Ga0501032_0022653 | |||
| 1766 | Ga0501032_0041157 | |||
| 1767 | Ga0501032_0095686 | |||
| 1768 | Ga0501032_0130328 | |||
| 1769 | Ga0501032_0207272 | |||
| 1770 | Ga0501033_0014941 | |||
| 1771 | Ga0501033_0018414 | |||
| 1772 | Ga0501033_0029299 | |||
| 1773 | Ga0501033_0032178 | |||
| 1774 | Ga0501033_0166808 | |||
| 1775 | Ga0501033_0561564 | |||
| 1776 | Ga0501034_0000726 | |||
| 1777 | Ga0501034_0002620 | |||
| 1778 | Ga0501034_0020502 | |||
| 1779 | Ga0501034_0042133 | |||
| 1780 | Ga0501034_0046563 | |||
| 1781 | Ga0501034_0062912 | |||
| 1782 | Ga0501034_0073842 | |||
| 1783 | Ga0501034_0103509 | |||
| 1784 | Ga0501036_0000751 | |||
| 1785 | Ga0501036_0038127 | |||
| 1786 | Ga0501036_0154804 | |||
| 1787 | Ga0501036_0155816 | |||
| 1788 | Ga0501036_0199175 | |||
| 1789 | Ga0501037_0018610 | |||
| 1790 | Ga0501037_0040837 | |||
| 1791 | Ga0501038_0021116 | |||
| 1792 | Ga0501038_0103581 | |||
| 1793 | Ga0501038_0108575 | |||
| 1794 | Ga0501039_0080147 | |||
| 1795 | Ga0501040_0483788 | |||
| 1796 | Ga0501042_0084262 | |||
| 1797 | Ga0501043_0002856 | |||
| 1798 | Ga0501043_0020569 | |||
| 1799 | Ga0501043_0044466 | |||
| 1800 | Ga0501043_0059057 | |||
| 1801 | Ga0501043_0063655 | |||
| 1802 | Ga0501043_0242589 | |||
| 1803 | Ga0501046_0045486 | |||
| 1804 | Ga0501046_0094590 | |||
| 1805 | Ga0501046_0147582 | |||
| 1806 | Ga0501047_0000306 | |||
| 1807 | Ga0501047_0020132 | |||
| 1808 | Ga0501047_0050681 | |||
| 1809 | Ga0501047_0067244 | |||
| 1810 | Ga0501047_0122834 | |||
| 1811 | Ga0501047_0278134 | |||
| 1812 | Ga0501047_0487580 | |||
| 1813 | Ga0501048_0000137 | |||
| 1814 | Ga0501048_0021042 | |||
| 1815 | Ga0501048_0052355 | |||
| 1816 | Ga0501067_0039584 | |||
| 1817 | Ga0501068_0036641 | |||
| 1818 | Ga0501068_0358875 | |||
| 1819 | Ga0501069_0013966 | |||
| 1820 | Ga0501069_0018134 | |||
| 1821 | Ga0501069_0292818 | |||
| 1822 | Ga0501070_0001636 | |||
| 1823 | Ga0501070_0012886 | |||
| 1824 | Ga0501070_0014023 | |||
| 1825 | Ga0501070_0029633 | |||
| 1826 | Ga0501070_0044279 | |||
| 1827 | Ga0501070_0056080 | |||
| 1828 | Ga0501070_0111398 | |||
| 1829 | Ga0501070_0115556 | |||
| 1830 | Ga0501070_0143310 | |||
| 1831 | Ga0501070_0238250 | |||
| 1832 | Ga0501070_0428286 | |||
| 1833 | Ga0501070_0524901 | |||
| 1834 | Ga0501071_0078716 | |||
| 1835 | Ga0501071_0204927 | |||
| 1836 | Ga0501071_0254009 | |||
| 1837 | Ga0501072_0006141 | |||
| 1838 | Ga0501072_0330020 | |||
| 1839 | Ga0501072_0412200 | |||
| 1840 | Ga0501073_0023532 | |||
| 1841 | Ga0501073_0168667 | |||
| 1842 | Ga0501073_0190366 | |||
| 1843 | Ga0501073_0227585 | |||
| 1844 | Ga0501073_0482583 | |||
| 1845 | Ga0501074_0006141 | |||
| 1846 | Ga0501074_0039640 | |||
| 1847 | Ga0501074_0051064 | |||
| 1848 | Ga0501075_0394041 | |||
| 1849 | Ga0501079_0083671 | |||
| 1850 | Ga0501079_0162711 | |||
| 1851 | Ga0501079_0253480 | |||
| 1852 | Ga0501080_0000574 | |||
| 1853 | Ga0501080_0085483 | |||
| 1854 | Ga0501080_0087653 | |||
| 1855 | Ga0501080_0132108 | |||
| 1856 | Ga0501080_0328308 | |||
| 1857 | Ga0501080_0416193 | |||
| 1858 | Ga0501081_0157659 | |||
| 1859 | Ga0501083_0001509 | |||
| 1860 | Ga0501083_0017130 | |||
| 1861 | Ga0501083_0093288 | |||
| 1862 | Ga0501083_0178892 | |||
| 1863 | Ga0501083_0225597 | |||
| 1864 | Ga0501035_0000253 | |||
| 1865 | Ga0501035_0060470 | |||
| 1866 | Ga0501035_0094247 | |||
| 1867 | Ga0501035_0112609 | |||
| 1868 | Ga0501035_0206909 | |||
| 1869 | Ga0501044_0000815 | |||
| 1870 | Ga0501044_0003892 | |||
| 1871 | Ga0501044_0015393 | |||
| 1872 | Ga0501044_0022228 | |||
| 1873 | Ga0501044_0142897 | |||
| 1874 | Ga0501044_0178658 | |||
| 1875 | Ga0501044_0334848 | |||
| 1876 | Ga0501044_0480871 | |||
| 1877 | nmdc:mga03683_72812_c1 | |||
| 1878 | nmdc:mga03n38_58029_c1 | |||
| 1879 | nmdc:mga0k408_2232_c1 | |||
| 1880 | nmdc:mga06z11_21901_c1 | |||
| 1881 | nmdc:mga06z11_8599_c1 | |||
| 1882 | nmdc:mga04h51_156034_c1 | |||
| 1883 | nmdc:mga04h51_157960_c1 | |||
| 1884 | nmdc:mga07m45_166364_c1 | |||
| 1885 | nmdc:mga07m45_223644_c1 | |||
| 1886 | nmdc:mga07m45_36431_c1 | |||
| 1887 | nmdc:mga05p37_15391_c1 | |||
| 1888 | nmdc:mga05p37_155918_c1 | |||
| 1889 | nmdc:mga05p37_58_c1 | |||
| 1890 | nmdc:mga09592_246_c1 | |||
| 1891 | nmdc:mga0qj67_420_c1 | |||
| 1892 | nmdc:mga06r32_1189_c1 | |||
| 1893 | nmdc:mga06r32_350347_c1 | |||
| 1894 | nmdc:mga08y16_1095_c1 | |||
| 1895 | nmdc:mga08y16_408_c1 | |||
| 1896 | nmdc:mga08y16_426886_c1 | |||
| 1897 | nmdc:mga0n895_111650_c1 | |||
| 1898 | nmdc:mga0n895_136041_c1 | |||
| 1899 | nmdc:mga0n895_1786_c1 | |||
| 1900 | nmdc:mga0n895_210_c1 | |||
| 1901 | nmdc:mga0n895_29295_c1 | |||
| 1902 | nmdc:mga0n895_31739_c1 | |||
| 1903 | nmdc:mga0rr50_15101_c1 | |||
| 1904 | nmdc:mga0rr50_18046_c1 | |||
| 1905 | nmdc:mga0rr50_551_c1 | |||
| 1906 | nmdc:mga0rr50_554633_c1 | |||
| 1907 | nmdc:mga08x19_332304_c1 | |||
| 1908 | nmdc:mga08x19_61867_c1 | |||
| 1909 | nmdc:mga08x19_70997_c1 | |||
| 1910 | nmdc:mga0a205_1998_c1 | |||
| 1911 | nmdc:mga0a205_6459_c3 | |||
| 1912 | Ga0495601_0000048 | |||
| 1913 | Ga0495601_0001704 | |||
| 1914 | Ga0495601_0004933 | |||
| 1915 | Ga0495601_0004989 | |||
| 1916 | Ga0495612_0001352 | |||
| 1917 | Ga0495612_0004252 | |||
| 1918 | Ga0495595_0001723 | |||
| 1919 | Ga0495595_0003173 | |||
| 1920 | Ga0495595_0004063 | |||
| 1921 | Ga0495595_0006739 | |||
| 1922 | Ga0495595_0011229 | |||
| 1923 | Ga0495595_0194127 | |||
| 1924 | Ga0495619_0000142 | |||
| 1925 | Ga0495619_0000348 | |||
| 1926 | Ga0495619_0000760 | |||
| 1927 | Ga0495619_0001740 | |||
| 1928 | Ga0495619_0073860 | |||
| 1929 | Ga0495619_0140689 | |||
| 1930 | Ga0495619_0225931 | |||
| 1931 | Ga0495619_0372070 | |||
| 1932 | Ga0500641_0005256 | |||
| 1933 | Ga0500641_0027727 | |||
| 1934 | Ga0501084_0182134 | |||
| 1935 | Ga0501082_0251497 | |||
| 1936 | Ga0501082_0751270 | |||
| 1937 | 2738746795 | |||
| 1938 | 2739356025 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4qhi-assembly2.cif.gz_C | crystal structure of methanocaldococcus jannaschii selecase mutant r36w | 0.8572 | 146 | 242 |
| 4jix-assembly1.cif.gz_B | crystal structure of the metallopeptidase zymogen of methanocaldococcus jannaschii jannalysin | 0.8437 | 148 | 238 |
| 4jiu-assembly1.cif.gz_A | crystal structure of the metallopeptidase zymogen of pyrococcus abyssi abylysin | 0.7989 | 148 | 248 |
| 4jix-assembly1.cif.gz_A | crystal structure of the metallopeptidase zymogen of methanocaldococcus jannaschii jannalysin | 0.7885 | 147 | 240 |
| 4qhj-assembly1.cif.gz_B | crystal structure of methanocaldococcus jannaschii selecase mutant i100f+h107f | 0.7866 | 146 | 241 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4qhiC00 | "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" | 0.8572 | 146 | 242 | 3.30.2010.10 |
| 4jixB00 | "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" | 0.8437 | 148 | 238 | 3.30.2010.10 |
| af_P42597_68_160_3.30.2010.10 | "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" | 0.8142 | 167 | 242 | 3.30.2010.10 |
| 4jiuA00 | "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" | 0.8131 | 148 | 246 | 3.30.2010.10 |
| 4qhiC00 | "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" | 0.7859 | 146 | 242 | 3.30.2010.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R8FCZ9-F1-model_v4 | deleted | 0.9896 | 125 | 245 |
|
| AF-J8W449-F1-model_v4 | deleted | 0.9738 | 150 | 243 |
|
| AF-A0A7X2TI66-F1-model_v4 | deleted | 0.9716 | 151 | 244 |
|
| AF-A0A4Q6BPD8-F1-model_v4 | M48 family peptidase | 0.9705 | 162 | 243 |
|
| AF-A0A529Q2S7-F1-model_v4 | M48 family metallopeptidase | 0.9685 | 160 | 244 |
|