F487062

General Info

Members Datasets Scaffolds Average Seq Length
969 423 1938 254

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10043022|Ga0070681_100430223
Length 297
Sequence MEASKPRAGLPSGSCADSRIVHRWPIWYSAIQDSPGLLTMPLRALLYRRPSEPQTIQVVFDQAIYPVRVRHHRQARRYTLRIHAVTREVILTMPPRGSVREAKAFAQKHGGWIAARLRRLPEATPFIDGAIVPLRGVDHRIVHRPDARGTVWCDIGDGGEALLCVAGQRPHIDRRVSDFLRREALRDLDVASRAAAARLGVAIRRISVRDQASRWGSCSTTGVLSYSWRLILAPPFVLDYLAVHEVAHLVEMNHSSRFWRLVNDVCADTQRAKTWLDSHGADLHRYGAPRGDTQRRD

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
15 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
16 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
47 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
87 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
91 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
92 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
93 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
94 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
99 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
102 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
103 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
104 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
105 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
106 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
107 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
108 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
109 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
112 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
113 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
144 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
148 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
150 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
217 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
219 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
223 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
224 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
225 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
226 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
227 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
228 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
229 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
230 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
231 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
232 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
233 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
234 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
235 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
236 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
237 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
238 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
239 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
240 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
241 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
242 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
243 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
244 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
245 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
246 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
247 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
248 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
249 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
250 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
251 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
252 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
253 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
254 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
255 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
256 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
257 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
258 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
259 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
260 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
261 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
262 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
263 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
264 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
265 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
266 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
267 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
270 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
271 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
272 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
273 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
274 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
275 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
276 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
277 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
278 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
279 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
280 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
281 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
282 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
283 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
284 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
285 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
286 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
287 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
288 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
289 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
290 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
291 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
292 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
293 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
294 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
295 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
296 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
297 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
298 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
299 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
300 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
301 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
302 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
303 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
304 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
305 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
306 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
307 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
308 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
309 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
310 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
311 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
312 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
313 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
314 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
315 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
316 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
317 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
318 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
319 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
320 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
321 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
322 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
323 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
324 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
325 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
326 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
327 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
328 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
329 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
330 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
331 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
332 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
333 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
334 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
335 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
336 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
337 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
338 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
339 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
340 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
341 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
342 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
343 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
344 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
345 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
346 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
347 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
348 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
349 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
350 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
351 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
352 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
353 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
354 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
355 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
356 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
357 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
358 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
359 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
360 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
361 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
362 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
363 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
364 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
365 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
366 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
367 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
368 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
369 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
370 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
371 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
386 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
387 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
388 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
389 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
390 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
391 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
392 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
393 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
394 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
395 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
396 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
397 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
398 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
400 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
401 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
402 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
403 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
404 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
405 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
406 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
407 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
408 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
409 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
410 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
411 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
412 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
413 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
414 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
415 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
416 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
417 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
418 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
419 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
420 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
421 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
422 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
423 2738543032 Methylobacterium sp. GV104 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0.31
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.68
Nodule 0
Rhizoplane 8.15
Rhizosphere 88.24
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10043022 3300005458 Bacteria 4525
2 JGI24752J21851_1007370 3300001976 Bacteria 1434
3 JGI24746J21847_1001303 3300001977 Bacteria 3984
4 JGI24747J21853_1002926 3300001978 Bacteria 1440
5 JGI24739J22299_10008549 3300001989 Bacteria 3822
6 JGI24737J22298_10007957 3300001990 Bacteria 3563
7 JGI24743J22301_10013113 3300001991 Bacteria 1516
8 JGI24750J21931_1000131 3300002070 Bacteria 12000
9 JGI24745J21846_1000345 3300002073 Bacteria 4027
10 JGI24748J21848_1000453 3300002074 Bacteria 4556
11 JGI24738J21930_10001862 3300002075 Bacteria 5707
12 JGI24749J21850_1000396 3300002076 Bacteria 6488
13 JGI24744J21845_10001151 3300002077 Bacteria 5146
14 JGI24034J26672_10007089 3300002239 Bacteria 1625
15 JGI24742J22300_10002797 3300002244 Bacteria 2816
16 JGI25405J52794_10006392 3300003911 Bacteria 2153
17 Ga0065715_10096672 3300005293 Bacteria 3828
18 Ga0070676_10000453 3300005328 Bacteria 19576
19 Ga0070683_100001364 3300005329 Bacteria 18687
20 Ga0070690_100001804 3300005330 Bacteria 11329
21 Ga0070690_100057455 3300005330 Bacteria 2497
22 Ga0070670_100002480 3300005331 Bacteria 15214
23 Ga0070670_100168389 3300005331 Bacteria 1900
24 Ga0070677_10009496 3300005333 Bacteria 3300
25 Ga0070677_10066993 3300005333 Bacteria 1499
26 Ga0068869_100000405 3300005334 Bacteria 23497
27 Ga0070666_10160023 3300005335 Bacteria 1573
28 Ga0070680_100001735 3300005336 Bacteria 16008
29 Ga0070680_100027948 3300005336 Bacteria 4521
30 Ga0070680_100291189 3300005336 Bacteria 1384
31 Ga0070682_100002414 3300005337 Bacteria 10344
32 Ga0070682_100154193 3300005337 Bacteria 1579
33 Ga0070682_100176982 3300005337 Bacteria 1487
34 Ga0070682_100424359 3300005337 Bacteria 1011
35 Ga0068868_100000515 3300005338 Bacteria 25838
36 Ga0068868_100185549 3300005338 Bacteria 1728
37 Ga0070660_100000183 3300005339 Bacteria 41529
38 Ga0070660_100068495 3300005339 Bacteria 2766
39 Ga0070660_100114899 3300005339 Bacteria 2145
40 Ga0070689_100009233 3300005340 Bacteria 6984
41 Ga0070689_100097368 3300005340 Bacteria 2326
42 Ga0070687_100000164 3300005343 Bacteria 22998
43 Ga0070687_100125341 3300005343 Bacteria 1475
44 Ga0070661_100000411 3300005344 Bacteria 33139
45 Ga0070661_100382866 3300005344 Bacteria 1109
46 Ga0070692_10001516 3300005345 Bacteria 8503
47 Ga0070668_100010802 3300005347 Bacteria 6792
48 Ga0070669_100000114 3300005353 Bacteria 77340
49 Ga0070675_100000148 3300005354 Bacteria 42270
50 Ga0070671_100000070 3300005355 Bacteria 66294
51 Ga0070671_100062159 3300005355 Bacteria 3110
52 Ga0070671_100116149 3300005355 Bacteria 2250
53 Ga0070671_100122683 3300005355 Bacteria 2187
54 Ga0070674_100046877 3300005356 Bacteria 2959
55 Ga0070673_100000214 3300005364 Bacteria 28832
56 Ga0070673_100186245 3300005364 Bacteria 1780
57 Ga0070688_100004754 3300005365 Bacteria 7096
58 Ga0070688_100016083 3300005365 Bacteria 4270
59 Ga0070688_100018545 3300005365 Bacteria 4018
60 Ga0070659_100001224 3300005366 Bacteria 18647
61 Ga0070667_100002018 3300005367 Bacteria 17982
62 Ga0070667_100059896 3300005367 Bacteria 3221
63 Ga0070667_100117137 3300005367 Bacteria 2314
64 Ga0070667_100227143 3300005367 Bacteria 1663
65 Ga0070667_100233289 3300005367 Bacteria 1641
66 Ga0070703_10002903 3300005406 Bacteria 4906
67 Ga0070709_10155741 3300005434 Bacteria 1584
68 Ga0070709_10584571 3300005434 Bacteria 858
69 Ga0070714_100020071 3300005435 Bacteria 5452
70 Ga0070714_100027411 3300005435 Bacteria 4718
71 Ga0070714_100056962 3300005435 Bacteria 3344
72 Ga0070714_100179209 3300005435 Bacteria 1927
73 Ga0070714_100352782 3300005435 Bacteria 1382
74 Ga0070713_100000680 3300005436 Bacteria 21808
75 Ga0070710_10006183 3300005437 Bacteria 5731
76 Ga0070710_10057261 3300005437 Bacteria 2208
77 Ga0070710_10151277 3300005437 Bacteria 1431
78 Ga0070710_10234095 3300005437 Bacteria 1174
79 Ga0070701_10000210 3300005438 Bacteria 18350
80 Ga0070711_100179997 3300005439 Bacteria 1618
81 Ga0070705_100000549 3300005440 Bacteria 21834
82 Ga0070700_100000328 3300005441 Bacteria 24792
83 Ga0070700_100165140 3300005441 Bacteria 1528
84 Ga0070694_100013627 3300005444 Bacteria 5080
85 Ga0070694_100401859 3300005444 Bacteria 1073
86 Ga0070663_100000100 3300005455 Bacteria 39199
87 Ga0070678_100001000 3300005456 Bacteria 14668
88 Ga0070678_100288226 3300005456 Bacteria 1391
89 Ga0070678_100488674 3300005456 Bacteria 1084
90 Ga0070662_100008274 3300005457 Bacteria 6775
91 Ga0070662_100085123 3300005457 Bacteria 2362
92 Ga0070662_100111198 3300005457 Bacteria 2087
93 Ga0070681_10001377 3300005458 Bacteria 21307
94 Ga0070681_10068303 3300005458 Bacteria 3521
95 Ga0070681_10156752 3300005458 Bacteria 2201
96 Ga0070681_10225201 3300005458 Bacteria 1790
97 Ga0070681_10254386 3300005458 Bacteria 1669
98 Ga0068867_100001032 3300005459 Bacteria 19040
99 Ga0068867_100078797 3300005459 Bacteria 2479
100 Ga0070685_10010286 3300005466 Bacteria 4856
101 Ga0070685_10024528 3300005466 Bacteria 3313
102 Ga0070707_100054108 3300005468 Bacteria 3848
103 Ga0070679_100002182 3300005530 Bacteria 17664
104 Ga0070679_100023170 3300005530 Bacteria 6076
105 Ga0070679_100107097 3300005530 Bacteria 2781
106 Ga0070679_100138301 3300005530 Bacteria 2416
107 Ga0070679_100277664 3300005530 Bacteria 1628
108 Ga0070684_100000306 3300005535 Bacteria 33761
109 Ga0070684_100086339 3300005535 Bacteria 2784
110 Ga0070697_100172353 3300005536 Bacteria 1832
111 Ga0068853_100006837 3300005539 Bacteria 9096
112 Ga0070672_100000289 3300005543 Bacteria 28530
113 Ga0070686_100000261 3300005544 Bacteria 36069
114 Ga0070686_100003064 3300005544 Bacteria 9153
115 Ga0070686_100230764 3300005544 Bacteria 1343
116 Ga0070695_100012184 3300005545 Bacteria 5158
117 Ga0070696_100005594 3300005546 Bacteria 8391
118 Ga0070696_100048885 3300005546 Bacteria 2936
119 Ga0070693_100000204 3300005547 Bacteria 27537
120 Ga0070665_100046336 3300005548 Bacteria 4368
121 Ga0070665_100425310 3300005548 Bacteria 1337
122 Ga0070665_100522504 3300005548 Bacteria 1198
123 Ga0070704_100000297 3300005549 Bacteria 21940
124 Ga0070704_100149095 3300005549 Bacteria 1837
125 Ga0068855_100004961 3300005563 Bacteria 16232
126 Ga0070664_100002983 3300005564 Bacteria 13692
127 Ga0070664_100313569 3300005564 Bacteria 1420
128 Ga0068857_100001434 3300005577 Bacteria 18891
129 Ga0068854_100005280 3300005578 Bacteria 8154
130 Ga0068854_100127923 3300005578 Bacteria 1937
131 Ga0068856_100009252 3300005614 Bacteria 9575
132 Ga0068856_100072815 3300005614 Bacteria 3402
133 Ga0070702_100000592 3300005615 Bacteria 13283
134 Ga0068852_100000836 3300005616 Bacteria 20392
135 Ga0068852_100045255 3300005616 Bacteria 3742
136 Ga0068852_100080459 3300005616 Bacteria 2889
137 Ga0068852_100208432 3300005616 Bacteria 1853
138 Ga0068859_100002494 3300005617 Bacteria 18713
139 Ga0068859_100472481 3300005617 Bacteria 1349
140 Ga0068864_100000172 3300005618 Bacteria 59525
141 Ga0068864_100380453 3300005618 Bacteria 1337
142 Ga0068866_10000325 3300005718 Bacteria 22629
143 Ga0068861_100002528 3300005719 Bacteria 11947
144 Ga0068851_10026967 3300005834 Bacteria 2828
145 Ga0068870_10000846 3300005840 Bacteria 11938
146 Ga0068863_100002553 3300005841 Bacteria 18073
147 Ga0068863_100088116 3300005841 Bacteria 2941
148 Ga0068863_100193261 3300005841 Bacteria 1956
149 Ga0068863_100545351 3300005841 Bacteria 1145
150 Ga0068858_100001665 3300005842 Bacteria 22713
151 Ga0068858_100155864 3300005842 Bacteria 2149
152 Ga0068858_100480997 3300005842 Bacteria 1198
153 Ga0068860_100001131 3300005843 Bacteria 29328
154 Ga0068860_100282013 3300005843 Bacteria 1624
155 Ga0068860_100341322 3300005843 Bacteria 1473
156 Ga0068860_100346870 3300005843 Bacteria 1460
157 Ga0068862_100185101 3300005844 Bacteria 1871
158 Ga0081455_10000002 3300005937 Bacteria 460472
159 Ga0081455_10002251 3300005937 Bacteria 22976
160 Ga0081455_10162888 3300005937 Bacteria 1707
161 Ga0081540_1000241 3300005983 Bacteria 57441
162 Ga0070717_10006536 3300006028 Bacteria 8582
163 Ga0070717_10021129 3300006028 Bacteria 5128
164 Ga0070717_10100147 3300006028 Bacteria 2460
165 Ga0070717_10309000 3300006028 Bacteria 1407
166 Ga0070717_10320569 3300006028 Bacteria 1381
167 Ga0075365_10317151 3300006038 Bacteria 1098
168 Ga0075368_10019635 3300006042 Bacteria 2552
169 Ga0075368_10126126 3300006042 Bacteria 1062
170 Ga0075363_100081414 3300006048 Unclassified 1771
171 Ga0075432_10002460 3300006058 Bacteria 6165
172 Ga0070715_10011831 3300006163 Bacteria 3154
173 Ga0070716_100000480 3300006173 Bacteria 16522
174 Ga0070712_100104322 3300006175 Bacteria 2104
175 Ga0075362_10022910 3300006177 Bacteria 2636
176 Ga0075362_10086701 3300006177 Bacteria 1449
177 Ga0075367_10011069 3300006178 Bacteria 4757
178 Ga0075367_10040107 3300006178 Bacteria 2733
179 Ga0075367_10182975 3300006178 Bacteria 1307
180 Ga0075427_10000802 3300006194 Bacteria 3822
181 Ga0075366_10000286 3300006195 Bacteria 22606
182 Ga0075366_10054089 3300006195 Bacteria 2385
183 Ga0097621_100000006 3300006237 Bacteria 134536
184 Ga0097621_100028909 3300006237 Bacteria 4374
185 Ga0075370_10011720 3300006353 Bacteria 4614
186 Ga0075370_10097285 3300006353 Bacteria 1702
187 Ga0068871_100001147 3300006358 Bacteria 17768
188 Ga0068871_100038474 3300006358 Bacteria 3821
189 Ga0075430_100000125 3300006846 Bacteria 48131
190 Ga0075430_100328593 3300006846 Bacteria 1264
191 Ga0075431_100007030 3300006847 Bacteria 11179
192 Ga0075433_10000008 3300006852 Bacteria 75573
193 Ga0075433_10021731 3300006852 Bacteria 5382
194 Ga0075433_10078338 3300006852 Bacteria 2912
195 Ga0075433_10175674 3300006852 Bacteria 1906
196 Ga0075434_100000152 3300006871 Bacteria 42821
197 Ga0075434_100003460 3300006871 Bacteria 14109
198 Ga0075434_100059084 3300006871 Bacteria 3812
199 Ga0075434_100098201 3300006871 Bacteria 2934
200 Ga0075434_100104129 3300006871 Bacteria 2847
201 Ga0075429_100000083 3300006880 Bacteria 49131
202 Ga0068865_100000114 3300006881 Bacteria 40505
203 Ga0075436_100006953 3300006914 Bacteria 7743
204 Ga0075436_100076225 3300006914 Bacteria 2322
205 Ga0097620_100002494 3300006931 Bacteria 18713
206 Ga0097620_100472468 3300006931 Bacteria 1349
207 Ga0075435_100012469 3300007076 Bacteria 6297
208 Ga0075435_100057374 3300007076 Bacteria 3150
209 Ga0075435_100243070 3300007076 Bacteria 1531
210 Ga0075435_100269209 3300007076 Bacteria 1453
211 Ga0099795_10000504 3300007788 Bacteria 7360
212 Ga0099795_10049589 3300007788 Bacteria 1524
213 Ga0105250_10054276 3300009092 Bacteria 1607
214 Ga0105250_10069427 3300009092 Bacteria 1423
215 Ga0105240_10012009 3300009093 Bacteria 12005
216 Ga0105240_10015529 3300009093 Bacteria 10351
217 Ga0111539_10001699 3300009094 Bacteria 29331
218 Ga0111539_10019539 3300009094 Bacteria 8358
219 Ga0111539_10145718 3300009094 Bacteria 2773
220 Ga0111539_10315296 3300009094 Bacteria 1820
221 Ga0105245_10000175 3300009098 Bacteria 61149
222 Ga0105245_10278549 3300009098 Bacteria 1634
223 Ga0105245_10477674 3300009098 Bacteria 1259
224 Ga0105247_10001094 3300009101 Bacteria 20209
225 Ga0105247_10018151 3300009101 Bacteria 4219
226 Ga0105247_10093383 3300009101 Bacteria 1913
227 Ga0114129_10000533 3300009147 Bacteria 46605
228 Ga0114129_10010322 3300009147 Bacteria 13325
229 Ga0105243_10000315 3300009148 Bacteria 53296
230 Ga0105243_10106218 3300009148 Bacteria 2340
231 Ga0105243_10157847 3300009148 Bacteria 1953
232 Ga0105243_10434267 3300009148 Bacteria 1228
233 Ga0105241_10000316 3300009174 Bacteria 36435
234 Ga0105241_10107771 3300009174 Bacteria 2226
235 Ga0105242_10000356 3300009176 Bacteria 36542
236 Ga0105242_10015913 3300009176 Bacteria 5844
237 Ga0105248_10001326 3300009177 Bacteria 27556
238 Ga0105248_10007327 3300009177 Bacteria 12106
239 Ga0105248_10010783 3300009177 Bacteria 10090
240 Ga0105248_10224439 3300009177 Bacteria 2115
241 Ga0105248_10416120 3300009177 Bacteria 1514
242 Ga0105237_10019485 3300009545 Bacteria 7007
243 Ga0105238_10214253 3300009551 Bacteria 1902
244 Ga0105238_10667556 3300009551 Bacteria 1050
245 Ga0105249_10000289 3300009553 Bacteria 51753
246 Ga0099796_10000185 3300010159 Bacteria 9463
247 Ga0105239_10008446 3300010375 Bacteria 11713
248 Ga0105239_10331986 3300010375 Bacteria 1715
249 Ga0105239_10756988 3300010375 Bacteria 1112
250 Ga0105246_10000070 3300011119 Bacteria 42277
251 Ga0105246_10093244 3300011119 Bacteria 2175
252 Ga0157373_10029598 3300013100 Bacteria 3944
253 Ga0157371_10005008 3300013102 Bacteria 11355
254 Ga0157370_10054315 3300013104 Bacteria 3818
255 Ga0157370_10129286 3300013104 Bacteria 2357
256 Ga0157369_10563197 3300013105 Bacteria 1177
257 Ga0157369_10688454 3300013105 Bacteria 1053
258 Ga0157369_10797836 3300013105 Bacteria 970
259 Ga0157374_10001589 3300013296 Bacteria 19065
260 Ga0157374_10304567 3300013296 Bacteria 1577
261 Ga0157378_10000713 3300013297 Bacteria 31078
262 Ga0157378_10096812 3300013297 Bacteria 2689
263 Ga0157378_10559268 3300013297 Bacteria 1150
264 Ga0163162_10000202 3300013306 Bacteria 55109
265 Ga0163162_10448753 3300013306 Bacteria 1422
266 Ga0157372_10036396 3300013307 Bacteria 5425
267 Ga0157372_10293784 3300013307 Bacteria 1890
268 Ga0157375_10000507 3300013308 Bacteria 35186
269 Ga0157375_10281621 3300013308 Bacteria 1826
270 Ga0163163_10001140 3300014325 Bacteria 22613
271 Ga0163163_10002989 3300014325 Bacteria 14308
272 Ga0163163_10012390 3300014325 Bacteria 7768
273 Ga0157380_10000823 3300014326 Bacteria 19424
274 Ga0157380_10328959 3300014326 Bacteria 1420
275 Ga0157377_10000109 3300014745 Bacteria 56306
276 Ga0157379_10008739 3300014968 Bacteria 8829
277 Ga0157379_10026034 3300014968 Bacteria 5203
278 Ga0157379_10170556 3300014968 Bacteria 1964
279 Ga0157376_10000211 3300014969 Bacteria 40316
280 Ga0157376_10186479 3300014969 Bacteria 1899
281 Ga0163161_10000132 3300017792 Bacteria 70304
282 Ga0163161_10034783 3300017792 Bacteria 3605
283 Ga0163161_10154211 3300017792 Bacteria 1747
284 Ga0163161_10232307 3300017792 Bacteria 1432
285 Ga0206356_10802032 3300020070 Bacteria 2155
286 Ga0206354_10645964 3300020081 Bacteria 2259
287 Ga0206353_11534553 3300020082 Bacteria 4022
288 Ga0213875_10000031 3300021388 Bacteria 176367
289 Ga0207666_1000018 3300025271 Bacteria 39246
290 Ga0207673_1000004 3300025290 Bacteria 17765
291 Ga0207697_10000078 3300025315 Bacteria 42249
292 Ga0207653_10012978 3300025885 Bacteria 2606
293 Ga0207682_10000001 3300025893 Bacteria 152713
294 Ga0207682_10028194 3300025893 Bacteria 2240
295 Ga0207692_10012572 3300025898 Bacteria 3639
296 Ga0207692_10031234 3300025898 Bacteria 2549
297 Ga0207642_10003965 3300025899 Bacteria 4719
298 Ga0207710_10003351 3300025900 Bacteria 7162
299 Ga0207710_10016933 3300025900 Bacteria 3087
300 Ga0207710_10131797 3300025900 Bacteria 1201
301 Ga0207688_10000132 3300025901 Bacteria 31579
302 Ga0207680_10019790 3300025903 Bacteria 3608
303 Ga0207680_10227346 3300025903 Bacteria 1281
304 Ga0207647_10000678 3300025904 Bacteria 26728
305 Ga0207685_10014445 3300025905 Bacteria 2473
306 Ga0207699_10000206 3300025906 Bacteria 35327
307 Ga0207699_10131806 3300025906 Bacteria 1631
308 Ga0207645_10000110 3300025907 Bacteria 61329
309 Ga0207645_10009349 3300025907 Bacteria 6786
310 Ga0207643_10001892 3300025908 Bacteria 11570
311 Ga0207705_10105091 3300025909 Bacteria 2081
312 Ga0207707_10000922 3300025912 Bacteria 28562
313 Ga0207707_10040591 3300025912 Bacteria 4064
314 Ga0207707_10192038 3300025912 Bacteria 1781
315 Ga0207707_10214877 3300025912 Bacteria 1674
316 Ga0207695_10051521 3300025913 Bacteria 4322
317 Ga0207695_10065916 3300025913 Bacteria 3721
318 Ga0207671_10009327 3300025914 Bacteria 8213
319 Ga0207671_10212223 3300025914 Bacteria 1515
320 Ga0207693_10018725 3300025915 Bacteria 5511
321 Ga0207693_10076094 3300025915 Bacteria 2629
322 Ga0207693_10081896 3300025915 Bacteria 2527
323 Ga0207693_10240367 3300025915 Bacteria 1422
324 Ga0207663_10044876 3300025916 Bacteria 2716
325 Ga0207663_10175681 3300025916 Bacteria 1525
326 Ga0207660_10000063 3300025917 Bacteria 56039
327 Ga0207660_10051692 3300025917 Bacteria 2922
328 Ga0207660_10400895 3300025917 Bacteria 1105
329 Ga0207660_10562389 3300025917 Unclassified 928
330 Ga0207662_10000581 3300025918 Bacteria 16282
331 Ga0207662_10040307 3300025918 Bacteria 2745
332 Ga0207662_10139265 3300025918 Bacteria 1536
333 Ga0207657_10002831 3300025919 Bacteria 18637
334 Ga0207657_10012668 3300025919 Bacteria 8312
335 Ga0207657_10113413 3300025919 Bacteria 2236
336 Ga0207649_10000064 3300025920 Bacteria 96018
337 Ga0207652_10000128 3300025921 Bacteria 82012
338 Ga0207652_10010954 3300025921 Bacteria 7311
339 Ga0207652_10091116 3300025921 Bacteria 2680
340 Ga0207652_10137597 3300025921 Bacteria 2182
341 Ga0207652_10224347 3300025921 Bacteria 1693
342 Ga0207681_10000024 3300025923 Bacteria 206607
343 Ga0207650_10008086 3300025925 Bacteria 7167
344 Ga0207659_10000034 3300025926 Bacteria 108227
345 Ga0207687_10000069 3300025927 Bacteria 78213
346 Ga0207687_10243721 3300025927 Bacteria 1426
347 Ga0207700_10007400 3300025928 Bacteria 6705
348 Ga0207700_10215459 3300025928 Bacteria 1625
349 Ga0207664_10002775 3300025929 Bacteria 11628
350 Ga0207664_10080701 3300025929 Bacteria 2645
351 Ga0207644_10000342 3300025931 Bacteria 30260
352 Ga0207644_10011935 3300025931 Bacteria 5760
353 Ga0207644_10084704 3300025931 Bacteria 2350
354 Ga0207644_10121974 3300025931 Bacteria 1985
355 Ga0207690_10000068 3300025932 Bacteria 90571
356 Ga0207706_10002299 3300025933 Bacteria 18637
357 Ga0207706_10019674 3300025933 Bacteria 6074
358 Ga0207706_10268243 3300025933 Bacteria 1490
359 Ga0207686_10000875 3300025934 Bacteria 18197
360 Ga0207686_10021413 3300025934 Bacteria 3710
361 Ga0207686_10180423 3300025934 Bacteria 1497
362 Ga0207709_10003412 3300025935 Bacteria 9490
363 Ga0207709_10042441 3300025935 Bacteria 2736
364 Ga0207709_10296110 3300025935 Bacteria 1201
365 Ga0207670_10000057 3300025936 Bacteria 83573
366 Ga0207670_10018002 3300025936 Bacteria 4283
367 Ga0207669_10000005 3300025937 Bacteria 185218
368 Ga0207669_10037640 3300025937 Bacteria 2778
369 Ga0207669_10060777 3300025937 Bacteria 2318
370 Ga0207704_10000346 3300025938 Bacteria 21567
371 Ga0207704_10030499 3300025938 Bacteria 3023
372 Ga0207704_10078408 3300025938 Bacteria 2125
373 Ga0207704_10344965 3300025938 Bacteria 1157
374 Ga0207665_10001878 3300025939 Bacteria 14153
375 Ga0207665_10080548 3300025939 Bacteria 2240
376 Ga0207665_10104954 3300025939 Bacteria 1978
377 Ga0207691_10000543 3300025940 Bacteria 37760
378 Ga0207691_10114853 3300025940 Bacteria 2391
379 Ga0207711_10004328 3300025941 Bacteria 12124
380 Ga0207711_10014202 3300025941 Bacteria 6614
381 Ga0207711_10017864 3300025941 Bacteria 5893
382 Ga0207711_10141341 3300025941 Bacteria 2166
383 Ga0207689_10000055 3300025942 Bacteria 86715
384 Ga0207661_10000036 3300025944 Bacteria 149720
385 Ga0207679_10000025 3300025945 Bacteria 203699
386 Ga0207679_10124182 3300025945 Bacteria 2060
387 Ga0207679_10250043 3300025945 Bacteria 1507
388 Ga0207667_10003352 3300025949 Bacteria 19767
389 Ga0207667_10038158 3300025949 Bacteria 5132
390 Ga0207667_10283313 3300025949 Bacteria 1693
391 Ga0207667_10549537 3300025949 Bacteria 1168
392 Ga0207651_10000014 3300025960 Bacteria 166931
393 Ga0207651_10114883 3300025960 Bacteria 2029
394 Ga0207712_10000523 3300025961 Bacteria 31525
395 Ga0207668_10000352 3300025972 Bacteria 29941
396 Ga0207640_10000779 3300025981 Bacteria 18117
397 Ga0207658_10001275 3300025986 Bacteria 19922
398 Ga0207658_10050110 3300025986 Bacteria 3071
399 Ga0207677_10000382 3300026023 Bacteria 30569
400 Ga0207703_10001504 3300026035 Bacteria 21278
401 Ga0207703_10018104 3300026035 Bacteria 5503
402 Ga0207639_10000288 3300026041 Bacteria 35910
403 Ga0207678_10000292 3300026067 Bacteria 45164
404 Ga0207708_10001276 3300026075 Bacteria 18923
405 Ga0207702_10084727 3300026078 Bacteria 2760
406 Ga0207702_10113025 3300026078 Bacteria 2418
407 Ga0207702_10302023 3300026078 Bacteria 1519
408 Ga0207702_10610678 3300026078 Bacteria 1071
409 Ga0207641_10058613 3300026088 Bacteria 3277
410 Ga0207641_10111390 3300026088 Bacteria 2427
411 Ga0207641_10259708 3300026088 Bacteria 1626
412 Ga0207641_10404270 3300026088 Bacteria 1312
413 Ga0207648_10003100 3300026089 Bacteria 17553
414 Ga0207648_10012111 3300026089 Bacteria 8088
415 Ga0207648_10048827 3300026089 Bacteria 3705
416 Ga0207648_10314393 3300026089 Bacteria 1406
417 Ga0207676_10000826 3300026095 Bacteria 24195
418 Ga0207676_10022901 3300026095 Bacteria 4599
419 Ga0207674_10000376 3300026116 Bacteria 58065
420 Ga0207675_100002377 3300026118 Bacteria 18637
421 Ga0207675_100088084 3300026118 Bacteria 2916
422 Ga0207675_100515779 3300026118 Bacteria 1191
423 Ga0207683_10000001 3300026121 Bacteria 352047
424 Ga0207683_10021116 3300026121 Bacteria 5573
425 Ga0207683_10026710 3300026121 Bacteria 4986
426 Ga0207683_10046152 3300026121 Bacteria 3811
427 Ga0207698_10000231 3300026142 Bacteria 34934
428 Ga0207698_10043243 3300026142 Bacteria 3373
429 Ga0207698_10419771 3300026142 Bacteria 1283
430 Ga0209982_1022040 3300027552 Bacteria 982
431 Ga0209966_1008239 3300027695 Bacteria 1846
432 Ga0209966_1015555 3300027695 Bacteria 1429
433 Ga0209998_10003278 3300027717 Bacteria 3563
434 Ga0209998_10003574 3300027717 Bacteria 3389
435 Ga0209813_10033268 3300027866 Bacteria 1532
436 Ga0209974_10001490 3300027876 Bacteria 8505
437 Ga0207428_10000162 3300027907 Bacteria 92143
438 Ga0207428_10000233 3300027907 Bacteria 76679
439 Ga0268266_10033132 3300028379 Bacteria 4393
440 Ga0268265_10000477 3300028380 Bacteria 42056
441 Ga0268265_10650194 3300028380 Bacteria 1013
442 Ga0268264_10000309 3300028381 Bacteria 78332
443 Ga0268264_10027832 3300028381 Bacteria 4621
444 Ga0268264_10539584 3300028381 Bacteria 1142
445 Ga0265338_10076248 3300028800 Bacteria 2841
446 Ga0265325_10000056 3300031241 Bacteria 77353
447 Ga0265325_10001378 3300031241 Bacteria 17169
448 Ga0265325_10003842 3300031241 Bacteria 9657
449 Ga0265325_10032699 3300031241 Bacteria 2775
450 Ga0265325_10096896 3300031241 Bacteria 1449
451 Ga0265340_10019704 3300031247 Bacteria 3473
452 Ga0265340_10054702 3300031247 Bacteria 1924
453 Ga0265339_10001310 3300031249 Bacteria 18656
454 Ga0265339_10003844 3300031249 Bacteria 10421
455 Ga0265331_10100646 3300031250 Bacteria 1330
456 Ga0265316_10218287 3300031344 Bacteria 1408
457 Ga0265313_10014436 3300031595 Bacteria 4666
458 Ga0265313_10062195 3300031595 Bacteria 1744
459 Ga0265342_10000193 3300031712 Bacteria 67856
460 Ga0307409_100323287 3300031995 Bacteria 1445
461 Ga0373948_0000932 3300034817 Bacteria 3917
462 Ga0373948_0013231 3300034817 Bacteria 1486
463 Ga0373950_0008480 3300034818 Bacteria 1619
464 Ga0373958_0003525 3300034819 Bacteria 2261
465 Ga0373958_0049748 3300034819 Bacteria 882
466 Ga0373938_0001151 3300034957 Bacteria 4255
467 Ga0373938_0001291 3300034957 Bacteria 4022
468 Ga0373926_0027019 3300035083 Bacteria 2009
469 Ga0373928_0002146 3300035084 Bacteria 3849
470 Ga0373928_0002836 3300035084 Bacteria 3339
471 Ga0373929_0000675 3300035085 Bacteria 6580
472 Ga0373929_0016152 3300035085 Bacteria 1460
473 Ga0373934_0059023 3300035086 Bacteria 1527
474 Ga0373940_0003452 3300035088 Bacteria 3230
475 Ga0373940_0025916 3300035088 Bacteria 1531
476 Ga0373944_0009606 3300035089 Bacteria 2626
477 Ga0373944_0046664 3300035089 Bacteria 1355
478 Ga0373949_0001862 3300035090 Bacteria 5729
479 Ga0373949_0004195 3300035090 Bacteria 3328
480 Ga0373949_0024626 3300035090 Bacteria 1400
481 Ga0373951_0000710 3300035091 Bacteria 9141
482 Ga0373952_0001834 3300035092 Bacteria 3857
483 Ga0373952_0014692 3300035092 Bacteria 1570
484 Ga0373952_0030118 3300035092 Bacteria 1200
485 Ga0373923_0054229 3300035111 Bacteria 1687
486 Ga0373923_0144358 3300035111 Bacteria 1077
487 Ga0373932_0000674 3300035112 Bacteria 10362
488 Ga0373932_0001584 3300035112 Bacteria 6265
489 Ga0373936_0019109 3300035113 Bacteria 2653
490 Ga0373939_0001761 3300035114 Bacteria 5208
491 Ga0373939_0008814 3300035114 Bacteria 2484
492 Ga0373939_0028672 3300035114 Bacteria 1586
493 Ga0373939_0029902 3300035114 Bacteria 1563
494 Ga0373941_0000367 3300035115 Bacteria 8966
495 Ga0373941_0002074 3300035115 Bacteria 4350
496 Ga0373941_0023011 3300035115 Bacteria 1775
497 Ga0373945_0073968 3300035116 Bacteria 1294
498 Ga0373953_0014468 3300035117 Bacteria 2838
499 Ga0373954_0000573 3300035118 Bacteria 13888
500 Ga0373954_0060119 3300035118 Bacteria 1792
501 Ga0373956_0053271 3300035119 Bacteria 1821
502 Ga0373956_0142068 3300035119 Bacteria 1127
503 Ga0373957_0003946 3300035120 Bacteria 4454
504 Ga0373957_0050729 3300035120 Bacteria 1586
505 Ga0373957_0141048 3300035120 Bacteria 985
506 Ga0373960_0001805 3300035121 Bacteria 4794
507 Ga0373960_0001871 3300035121 Bacteria 4711
508 Ga0373943_0184496 3300035170 Bacteria 1148
509 Ga0373946_0010861 3300035171 Bacteria 3383
510 Ga0373946_0052312 3300035171 Bacteria 1712
511 Ga0373946_0058594 3300035171 Bacteria 1632
512 Ga0373955_0001431 3300035172 Bacteria 10161
513 Ga0373955_0055606 3300035172 Bacteria 2168
514 Ga0373955_0210753 3300035172 Bacteria 1158
515 Ga0373942_0010607 3300035207 Bacteria 2170
516 Ga0373942_0042160 3300035207 Bacteria 1250
517 Ga0373961_0005475 3300035241 Bacteria 3049
518 Ga0373962_0000104 3300035242 Bacteria 18507
519 Ga0373924_0065198 3300035410 Bacteria 1529
520 Ga0373924_0082007 3300035410 Bacteria 1372
521 Ga0373924_0101656 3300035410 Bacteria 1237
522 Ga0373931_0000072 3300035691 Bacteria 49094
523 Ga0373931_0000682 3300035691 Bacteria 14097
524 Ga0373931_0004121 3300035691 Bacteria 6594
525 Ga0373931_0033427 3300035691 Bacteria 2665
526 Ga0373931_0113623 3300035691 Bacteria 1539
527 Ga0373935_0006366 3300035692 Bacteria 7043
528 Ga0373935_0019659 3300035692 Bacteria 4117
529 Ga0373935_0044119 3300035692 Bacteria 2809
530 Ga0373935_0131532 3300035692 Bacteria 1682
531 Ga0373935_0204413 3300035692 Bacteria 1366
532 Ga0373927_0014307 3300035695 Bacteria 5256
533 Ga0373927_0410553 3300035695 Bacteria 893
534 Ga0373927_0458203 3300035695 Bacteria 842
535 Ga0373933_0002471 3300035724 Bacteria 10402
536 Ga0373933_0003704 3300035724 Bacteria 8453
537 Ga0373933_0025249 3300035724 Bacteria 3406
538 Ga0373947_0017662 3300035725 Bacteria 4105
539 Ga0373947_0020325 3300035725 Bacteria 3832
540 Ga0373947_0315305 3300035725 Bacteria 1045
541 Ga0373937_0014028 3300036401 Bacteria 7066
542 Ga0373937_0029548 3300036401 Bacteria 4964
543 Ga0373937_0081967 3300036401 Bacteria 2984
544 Ga0373937_0109242 3300036401 Bacteria 2572
545 Ga0373937_0114232 3300036401 Bacteria 2513
546 Ga0373937_0148464 3300036401 Bacteria 2195
547 Ga0373937_0474620 3300036401 Bacteria 1188
548 Ga0373925_0007613 3300037068 Bacteria 7887
549 Ga0373925_0060370 3300037068 Bacteria 2847
550 Ga0373925_0074537 3300037068 Bacteria 2570
551 Ga0373925_0165617 3300037068 Bacteria 1743
552 Ga0436364_0793438 3300037853 Bacteria 64960
553 Ga0395901_0009364 3300038443 Bacteria 9934
554 Ga0395901_0688008 3300038443 Bacteria 1022
555 Ga0436365_1569042 3300039437 Bacteria 7848
556 Ga0436363_0254747 3300039450 Bacteria 2495
557 Ga0439453_0020816 3300041408 Bacteria 1178
558 Ga0439448_0012112 3300042005 Bacteria 2576
559 Ga0439450_004592 3300042008 Bacteria 2370
560 Ga0439455_0009610 3300042012 Bacteria 2105
561 Ga0439463_011971 3300042016 Bacteria 2131
562 Ga0439434_0090258 3300042435 Bacteria 979
563 Ga0439464_0089070 3300042439 Bacteria 928
564 Ga0466963_0083735 3300044694 Bacteria 2163
565 Ga0466963_0136663 3300044694 Bacteria 1696
566 Ga0466957_0011624 3300044842 Bacteria 5086
567 Ga0466957_0053856 3300044842 Bacteria 2454
568 Ga0466959_0015280 3300045049 Bacteria 5590
569 Ga0466958_0032332 3300045836 Bacteria 3112
570 Ga0495617_021410 3300046452 Bacteria 2183
571 Ga0495592_0011976 3300046454 Bacteria 6574
572 Ga0495592_0014877 3300046454 Bacteria 5906
573 Ga0495592_0169073 3300046454 Bacteria 1498
574 Ga0495603_0015018 3300046455 Bacteria 4681
575 Ga0495603_0030359 3300046455 Bacteria 3255
576 Ga0495590_0114743 3300046457 Bacteria 963
577 Ga0495629_0000301 3300046459 Bacteria 42369
578 Ga0495629_0138563 3300046459 Bacteria 1693
579 Ga0495641_0012536 3300046461 Bacteria 4731
580 Ga0495651_0000931 3300046462 Bacteria 22653
581 Ga0495651_0002045 3300046462 Bacteria 15589
582 Ga0495651_0008299 3300046462 Bacteria 7958
583 Ga0495651_0072527 3300046462 Bacteria 2615
584 Ga0495653_0007314 3300046463 Bacteria 9045
585 Ga0495653_0026303 3300046463 Bacteria 4667
586 Ga0495653_0133035 3300046463 Bacteria 1758
587 Ga0495580_0010672 3300046472 Bacteria 7135
588 Ga0495580_0096909 3300046472 Bacteria 2051
589 Ga0495582_0000165 3300046473 Bacteria 35625
590 Ga0495582_0062824 3300046473 Bacteria 2051
591 Ga0495582_0173353 3300046473 Bacteria 1228
592 Ga0495605_0107640 3300046474 Bacteria 1275
593 Ga0495639_0001251 3300046475 Bacteria 11450
594 Ga0495639_0021907 3300046475 Bacteria 2800
595 Ga0495662_0007950 3300046476 Bacteria 5222
596 Ga0495662_0032820 3300046476 Bacteria 2508
597 Ga0495662_0074838 3300046476 Bacteria 1643
598 Ga0495662_0208957 3300046476 Bacteria 962
599 Ga0495664_0025708 3300046477 Bacteria 3427
600 Ga0495664_0217281 3300046477 Bacteria 1157
601 Ga0495664_0335571 3300046477 Bacteria 911
602 Ga0495584_0027415 3300046491 Bacteria 2887
603 Ga0495585_0001207 3300046492 Bacteria 20945
604 Ga0495594_0023233 3300046499 Bacteria 3321
605 Ga0495594_0037055 3300046499 Bacteria 2661
606 Ga0495607_0004923 3300046501 Bacteria 9713
607 Ga0495608_0015277 3300046511 Bacteria 5327
608 Ga0495608_0107960 3300046511 Bacteria 1790
609 Ga0495608_0132380 3300046511 Bacteria 1595
610 Ga0495608_0235631 3300046511 Bacteria 1145
611 Ga0495616_0146103 3300046513 Bacteria 1073
612 Ga0495618_0036630 3300046514 Bacteria 3078
613 Ga0495628_0086094 3300046516 Bacteria 2437
614 Ga0495628_0110422 3300046516 Bacteria 2115
615 Ga0495628_0155343 3300046516 Bacteria 1741
616 Ga0495628_0170949 3300046516 Bacteria 1648
617 Ga0495628_0263973 3300046516 Bacteria 1282
618 Ga0495628_0289909 3300046516 Bacteria 1213
619 Ga0495630_0021325 3300046517 Bacteria 4783
620 Ga0495630_0508072 3300046517 Bacteria 924
621 Ga0495631_0021408 3300046518 Bacteria 3012
622 Ga0495637_0097569 3300046520 Bacteria 1152
623 Ga0495644_0000571 3300046523 Bacteria 15453
624 Ga0495663_0014599 3300046525 Bacteria 2203
625 Ga0495666_0030723 3300046526 Bacteria 2634
626 Ga0495652_0018029 3300046529 Bacteria 6297
627 Ga0495652_0024574 3300046529 Bacteria 5332
628 Ga0495652_0276128 3300046529 Bacteria 1233
629 Ga0495640_0221699 3300046533 Bacteria 1192
630 Ga0495586_0010183 3300046535 Bacteria 5003
631 Ga0495586_0063899 3300046535 Bacteria 2005
632 Ga0495587_0006331 3300046536 Bacteria 7720
633 Ga0495587_0030470 3300046536 Bacteria 3271
634 Ga0495598_0001757 3300046537 Bacteria 4351
635 Ga0495609_0012501 3300046538 Bacteria 4027
636 Ga0495621_0082389 3300046539 Bacteria 1201
637 Ga0495645_0000223 3300046543 Bacteria 40729
638 Ga0495645_0033789 3300046543 Bacteria 3731
639 Ga0495645_0239972 3300046543 Bacteria 1210
640 Ga0495645_0274605 3300046543 Bacteria 1111
641 Ga0495622_0005532 3300046557 Bacteria 5857
642 Ga0495622_0027314 3300046557 Bacteria 2664
643 Ga0495622_0108057 3300046557 Bacteria 1274
644 Ga0495633_0001185 3300046558 Bacteria 20944
645 Ga0495667_0031790 3300046559 Bacteria 3539
646 Ga0495667_0033059 3300046559 Bacteria 3461
647 Ga0495667_0051584 3300046559 Bacteria 2713
648 Ga0495667_0076909 3300046559 Bacteria 2171
649 Ga0495656_0001164 3300046615 Bacteria 8549
650 Ga0495634_0034266 3300046642 Bacteria 3485
651 Ga0495634_0181103 3300046642 Bacteria 1319
652 Ga0495611_0007125 3300046648 Bacteria 4750
653 Ga0495635_0000999 3300046663 Bacteria 18684
654 Ga0495635_0017785 3300046663 Bacteria 4966
655 Ga0495635_0089731 3300046663 Bacteria 2103
656 Ga0495635_0378365 3300046663 Bacteria 942
657 Ga0495659_0000975 3300046664 Bacteria 10042
658 Ga0495659_0029381 3300046664 Bacteria 1908
659 Ga0495659_0029982 3300046664 Bacteria 1891
660 Ga0495659_0132780 3300046664 Bacteria 988
661 Ga0495661_0025793 3300046665 Bacteria 3792
662 Ga0495588_0171359 3300046674 Bacteria 1147
663 Ga0495657_0002536 3300046675 Bacteria 15313
664 Ga0495657_0016458 3300046675 Bacteria 5388
665 Ga0495657_0018493 3300046675 Bacteria 5041
666 Ga0495599_0001964 3300046678 Bacteria 11912
667 Ga0495599_0010860 3300046678 Bacteria 5581
668 Ga0495599_0044219 3300046678 Bacteria 2793
669 Ga0495623_0000454 3300046679 Bacteria 26961
670 Ga0495623_0004056 3300046679 Bacteria 9643
671 Ga0495646_0006696 3300046680 Bacteria 7305
672 Ga0495646_0027070 3300046680 Bacteria 3598
673 Ga0495658_0001694 3300046683 Bacteria 11454
674 Ga0495658_0004617 3300046683 Bacteria 6774
675 Ga0495658_0028677 3300046683 Bacteria 3007
676 Ga0495658_0077116 3300046683 Bacteria 1948
677 Ga0495658_0290972 3300046683 Bacteria 1032
678 Ga0495669_0038709 3300046684 Bacteria 2112
679 Ga0495613_0001324 3300046689 Bacteria 18944
680 Ga0495613_0056789 3300046689 Bacteria 2874
681 Ga0495613_0079146 3300046689 Bacteria 2390
682 Ga0495624_0009215 3300046690 Bacteria 6840
683 Ga0495670_0000747 3300046691 Bacteria 15565
684 Ga0495671_0173976 3300046692 Bacteria 1046
685 Ga0495589_0065258 3300046794 Bacteria 1785
686 Ga0495600_0026812 3300046809 Bacteria 3721
687 Ga0495600_0056640 3300046809 Bacteria 2561
688 Ga0495600_0140451 3300046809 Bacteria 1567
689 Ga0495600_0216991 3300046809 Bacteria 1224
690 Ga0495604_0022921 3300047317 Bacteria 4983
691 Ga0495604_0037287 3300047317 Bacteria 3829
692 Ga0495604_0054164 3300047317 Bacteria 3097
693 Ga0495674_0024659 3300047319 Bacteria 5521
694 Ga0495676_0202244 3300047321 Bacteria 1379
695 Ga0495680_0001680 3300047322 Bacteria 23534
696 Ga0495680_0009135 3300047322 Bacteria 8947
697 Ga0495680_0010402 3300047322 Bacteria 8302
698 Ga0495680_0014617 3300047322 Bacteria 6794
699 Ga0495680_0028181 3300047322 Bacteria 4607
700 Ga0495683_0142503 3300047323 Bacteria 1122
701 Ga0495675_0001429 3300047444 Bacteria 14470
702 Ga0495675_0066407 3300047444 Bacteria 2280
703 Ga0495679_007873 3300047446 Bacteria 4390
704 Ga0495684_0004283 3300047471 Bacteria 11135
705 Ga0495593_0032912 3300047673 Bacteria 2824
706 Ga0495593_0081571 3300047673 Bacteria 1672
707 Ga0495593_0116075 3300047673 Bacteria 1364
708 Ga0495602_0013952 3300048088 Bacteria 8184
709 Ga0495602_0041284 3300048088 Bacteria 4216
710 Ga0495602_0071245 3300048088 Bacteria 2969
711 Ga0495602_0130857 3300048088 Bacteria 2002
712 Ga0495614_0013643 3300048089 Bacteria 3563
713 Ga0496100_0000161 3300048903 Bacteria 37028
714 Ga0496100_0002282 3300048903 Bacteria 9690
715 Ga0496100_0016513 3300048903 Bacteria 4336
716 Ga0496100_0042406 3300048903 Bacteria 2906
717 Ga0496101_0000869 3300048904 Bacteria 17794
718 Ga0496101_0021875 3300048904 Bacteria 4395
719 Ga0496101_0047296 3300048904 Bacteria 3088
720 Ga0496101_0256776 3300048904 Bacteria 1362
721 Ga0496101_0528848 3300048904 Bacteria 932
722 Ga0496102_0002837 3300048905 Bacteria 14721
723 Ga0496102_0005211 3300048905 Bacteria 11035
724 Ga0496102_0005523 3300048905 Bacteria 10736
725 Ga0496102_0015550 3300048905 Bacteria 6632
726 Ga0496102_0077239 3300048905 Bacteria 3064
727 Ga0496103_0000499 3300048906 Bacteria 32387
728 Ga0496103_0002698 3300048906 Bacteria 11071
729 Ga0496103_0092286 3300048906 Bacteria 1911
730 Ga0496103_0312243 3300048906 Bacteria 1011
731 Ga0496104_0000370 3300048907 Bacteria 39760
732 Ga0496104_0001967 3300048907 Bacteria 17802
733 Ga0496104_0005269 3300048907 Bacteria 11300
734 Ga0496104_0019317 3300048907 Bacteria 6231
735 Ga0496104_0023038 3300048907 Bacteria 5723
736 Ga0496104_0025999 3300048907 Bacteria 5399
737 Ga0496104_0096700 3300048907 Bacteria 2825
738 Ga0496105_0005159 3300048908 Bacteria 9905
739 Ga0496105_0021982 3300048908 Bacteria 5164
740 Ga0496105_0026435 3300048908 Bacteria 4733
741 Ga0496105_0039433 3300048908 Bacteria 3893
742 Ga0496105_0249719 3300048908 Bacteria 1437
743 Ga0496106_0000357 3300048909 Bacteria 32374
744 Ga0496106_0013549 3300048909 Bacteria 6020
745 Ga0496106_0022564 3300048909 Bacteria 4678
746 Ga0496106_0258367 3300048909 Bacteria 1393
747 Ga0496107_0000206 3300048910 Bacteria 31059
748 Ga0496107_0001825 3300048910 Bacteria 13436
749 Ga0496107_0007544 3300048910 Bacteria 7504
750 Ga0496107_0047489 3300048910 Bacteria 3092
751 Ga0496107_0050511 3300048910 Bacteria 2997
752 Ga0496107_0163807 3300048910 Unclassified 1649
753 Ga0496108_0007040 3300048911 Bacteria 9107
754 Ga0496108_0012661 3300048911 Bacteria 6873
755 Ga0496108_0017975 3300048911 Bacteria 5784
756 Ga0496108_0030762 3300048911 Bacteria 4449
757 Ga0496108_0037549 3300048911 Bacteria 4035
758 Ga0496108_0064702 3300048911 Bacteria 3081
759 Ga0496108_0182907 3300048911 Bacteria 1815
760 Ga0496109_0001922 3300048912 Bacteria 17256
761 Ga0496109_0001930 3300048912 Bacteria 17226
762 Ga0496109_0027546 3300048912 Bacteria 5075
763 Ga0496109_0281086 3300048912 Bacteria 1568
764 Ga0496109_0538594 3300048912 Bacteria 1101
765 Ga0496110_0005694 3300048913 Bacteria 9785
766 Ga0496110_0011922 3300048913 Bacteria 7141
767 Ga0496110_0029162 3300048913 Bacteria 4746
768 Ga0496110_0113541 3300048913 Bacteria 2436
769 Ga0496111_0008628 3300048914 Bacteria 6757
770 Ga0496111_0046671 3300048914 Bacteria 3119
771 Ga0496112_0003333 3300048915 Bacteria 13256
772 Ga0496112_0093856 3300048915 Bacteria 2971
773 Ga0496112_0125195 3300048915 Bacteria 2541
774 Ga0496112_0244975 3300048915 Bacteria 1744
775 Ga0496112_0265779 3300048915 Bacteria 1664
776 Ga0496113_0002587 3300048916 Bacteria 10567
777 Ga0496113_0003762 3300048916 Bacteria 9156
778 Ga0496113_0007424 3300048916 Bacteria 7053
779 Ga0496113_0013972 3300048916 Bacteria 5462
780 Ga0496113_0016330 3300048916 Bacteria 5126
781 Ga0496113_0036620 3300048916 Bacteria 3596
782 Ga0496114_0008819 3300048917 Bacteria 7994
783 Ga0496114_0011210 3300048917 Bacteria 7158
784 Ga0496114_0215058 3300048917 Bacteria 1686
785 Ga0496115_0001252 3300048918 Bacteria 18231
786 Ga0496115_0032161 3300048918 Bacteria 4138
787 Ga0496115_0058158 3300048918 Bacteria 3110
788 Ga0496115_0092042 3300048918 Bacteria 2479
789 Ga0496115_0099734 3300048918 Bacteria 2380
790 Ga0496115_0242170 3300048918 Bacteria 1486
791 Ga0496115_0306600 3300048918 Bacteria 1300
792 Ga0496121_0013535 3300048924 Bacteria 8750
793 Ga0496126_0003241 3300048929 Bacteria 20805
794 Ga0496126_0330957 3300048929 Bacteria 1250
795 Ga0501031_0036019 3300049568 Bacteria 3227
796 Ga0501032_0022653 3300049569 Bacteria 4352
797 Ga0501032_0041157 3300049569 Bacteria 3139
798 Ga0501032_0095686 3300049569 Bacteria 1969
799 Ga0501032_0130328 3300049569 Bacteria 1659
800 Ga0501032_0207272 3300049569 Bacteria 1279
801 Ga0501033_0014941 3300049570 Bacteria 5893
802 Ga0501033_0018414 3300049570 Bacteria 5275
803 Ga0501033_0029299 3300049570 Bacteria 4137
804 Ga0501033_0032178 3300049570 Bacteria 3938
805 Ga0501033_0166808 3300049570 Bacteria 1583
806 Ga0501033_0561564 3300049570 Bacteria 785
807 Ga0501034_0000726 3300049571 Bacteria 49878
808 Ga0501034_0002620 3300049571 Bacteria 21334
809 Ga0501034_0020502 3300049571 Bacteria 6750
810 Ga0501034_0042133 3300049571 Bacteria 4621
811 Ga0501034_0046563 3300049571 Bacteria 4381
812 Ga0501034_0062912 3300049571 Bacteria 3725
813 Ga0501034_0073842 3300049571 Bacteria 3419
814 Ga0501034_0103509 3300049571 Bacteria 2840
815 Ga0501036_0000751 3300049572 Bacteria 24046
816 Ga0501036_0038127 3300049572 Bacteria 4066
817 Ga0501036_0154804 3300049572 Bacteria 1933
818 Ga0501036_0155816 3300049572 Bacteria 1926
819 Ga0501036_0199175 3300049572 Bacteria 1684
820 Ga0501037_0018610 3300049573 Bacteria 5118
821 Ga0501037_0040837 3300049573 Bacteria 3413
822 Ga0501038_0021116 3300049574 Bacteria 5849
823 Ga0501038_0103581 3300049574 Bacteria 2366
824 Ga0501038_0108575 3300049574 Bacteria 2300
825 Ga0501039_0080147 3300049575 Bacteria 2540
826 Ga0501040_0483788 3300049576 Bacteria 892
827 Ga0501042_0084262 3300049578 Bacteria 2279
828 Ga0501043_0002856 3300049579 Bacteria 14425
829 Ga0501043_0020569 3300049579 Bacteria 5177
830 Ga0501043_0044466 3300049579 Bacteria 3492
831 Ga0501043_0059057 3300049579 Bacteria 3009
832 Ga0501043_0063655 3300049579 Bacteria 2896
833 Ga0501043_0242589 3300049579 Bacteria 1389
834 Ga0501046_0045486 3300049580 Bacteria 3487
835 Ga0501046_0094590 3300049580 Bacteria 2296
836 Ga0501046_0147582 3300049580 Bacteria 1775
837 Ga0501047_0000306 3300049581 Bacteria 56352
838 Ga0501047_0020132 3300049581 Bacteria 6405
839 Ga0501047_0050681 3300049581 Bacteria 4009
840 Ga0501047_0067244 3300049581 Bacteria 3454
841 Ga0501047_0122834 3300049581 Bacteria 2477
842 Ga0501047_0278134 3300049581 Bacteria 1519
843 Ga0501047_0487580 3300049581 Bacteria 1060
844 Ga0501048_0000137 3300049582 Bacteria 44038
845 Ga0501048_0021042 3300049582 Bacteria 4779
846 Ga0501048_0052355 3300049582 Bacteria 2905
847 Ga0501067_0039584 3300049583 Bacteria 2617
848 Ga0501068_0036641 3300049584 Bacteria 2934
849 Ga0501068_0358875 3300049584 Bacteria 937
850 Ga0501069_0013966 3300049585 Bacteria 4289
851 Ga0501069_0018134 3300049585 Bacteria 3796
852 Ga0501069_0292818 3300049585 Bacteria 954
853 Ga0501070_0001636 3300049586 Bacteria 19852
854 Ga0501070_0012886 3300049586 Bacteria 7045
855 Ga0501070_0014023 3300049586 Bacteria 6746
856 Ga0501070_0029633 3300049586 Bacteria 4587
857 Ga0501070_0044279 3300049586 Bacteria 3704
858 Ga0501070_0056080 3300049586 Bacteria 3266
859 Ga0501070_0111398 3300049586 Bacteria 2262
860 Ga0501070_0115556 3300049586 Bacteria 2216
861 Ga0501070_0143310 3300049586 Bacteria 1972
862 Ga0501070_0238250 3300049586 Bacteria 1489
863 Ga0501070_0428286 3300049586 Bacteria 1068
864 Ga0501070_0524901 3300049586 Bacteria 950
865 Ga0501071_0078716 3300049587 Bacteria 2409
866 Ga0501071_0204927 3300049587 Bacteria 1482
867 Ga0501071_0254009 3300049587 Bacteria 1327
868 Ga0501072_0006141 3300049588 Bacteria 9157
869 Ga0501072_0330020 3300049588 Bacteria 1212
870 Ga0501072_0412200 3300049588 Bacteria 1071
871 Ga0501073_0023532 3300049589 Bacteria 4423
872 Ga0501073_0168667 3300049589 Bacteria 1515
873 Ga0501073_0190366 3300049589 Bacteria 1420
874 Ga0501073_0227585 3300049589 Bacteria 1288
875 Ga0501073_0482583 3300049589 Unclassified 857
876 Ga0501074_0006141 3300049590 Bacteria 8675
877 Ga0501074_0039640 3300049590 Bacteria 3411
878 Ga0501074_0051064 3300049590 Bacteria 2984
879 Ga0501075_0394041 3300049591 Bacteria 1056
880 Ga0501079_0083671 3300049741 Bacteria 2468
881 Ga0501079_0162711 3300049741 Bacteria 1740
882 Ga0501079_0253480 3300049741 Bacteria 1375
883 Ga0501080_0000574 3300049742 Bacteria 29100
884 Ga0501080_0085483 3300049742 Bacteria 2931
885 Ga0501080_0087653 3300049742 Bacteria 2891
886 Ga0501080_0132108 3300049742 Bacteria 2311
887 Ga0501080_0328308 3300049742 Bacteria 1384
888 Ga0501080_0416193 3300049742 Bacteria 1208
889 Ga0501081_0157659 3300049743 Bacteria 1634
890 Ga0501083_0001509 3300049744 Bacteria 15904
891 Ga0501083_0017130 3300049744 Bacteria 5055
892 Ga0501083_0093288 3300049744 Bacteria 1987
893 Ga0501083_0178892 3300049744 Bacteria 1385
894 Ga0501083_0225597 3300049744 Bacteria 1220
895 Ga0501035_0000253 3300049822 Bacteria 64326
896 Ga0501035_0060470 3300049822 Bacteria 3372
897 Ga0501035_0094247 3300049822 Bacteria 2633
898 Ga0501035_0112609 3300049822 Bacteria 2384
899 Ga0501035_0206909 3300049822 Bacteria 1680
900 Ga0501044_0000815 3300049823 Bacteria 37466
901 Ga0501044_0003892 3300049823 Bacteria 16730
902 Ga0501044_0015393 3300049823 Bacteria 8237
903 Ga0501044_0022228 3300049823 Bacteria 6759
904 Ga0501044_0142897 3300049823 Bacteria 2381
905 Ga0501044_0178658 3300049823 Bacteria 2090
906 Ga0501044_0334848 3300049823 Bacteria 1435
907 Ga0501044_0480871 3300049823 Bacteria 1145
908 nmdc:mga03683_72812_c1 3300050489 Bacteria 1472
909 nmdc:mga03n38_58029_c1 3300050490 Bacteria 1752
910 nmdc:mga0k408_2232_c1 3300050493 Bacteria 10364
911 nmdc:mga06z11_21901_c1 3300050494 Bacteria 2976
912 nmdc:mga06z11_8599_c1 3300050494 Bacteria 4267
913 nmdc:mga04h51_156034_c1 3300050495 Bacteria 875
914 nmdc:mga04h51_157960_c1 3300050495 Bacteria 871
915 nmdc:mga07m45_166364_c1 3300050496 Bacteria 1281
916 nmdc:mga07m45_223644_c1 3300050496 Bacteria 1095
917 nmdc:mga07m45_36431_c1 3300050496 Bacteria 2740
918 nmdc:mga05p37_15391_c1 3300050507 Bacteria 9189
919 nmdc:mga05p37_155918_c1 3300050507 Bacteria 2790
920 nmdc:mga05p37_58_c1 3300050507 Bacteria 95765
921 nmdc:mga09592_246_c1 3300050508 Bacteria 39321
922 nmdc:mga0qj67_420_c1 3300050509 Bacteria 29051
923 nmdc:mga06r32_1189_c1 3300050510 Bacteria 23415
924 nmdc:mga06r32_350347_c1 3300050510 Bacteria 1461
925 nmdc:mga08y16_1095_c1 3300050511 Bacteria 26715
926 nmdc:mga08y16_408_c1 3300050511 Bacteria 29565
927 nmdc:mga08y16_426886_c1 3300050511 Bacteria 1354
928 nmdc:mga0n895_111650_c1 3300050512 Bacteria 2750
929 nmdc:mga0n895_136041_c1 3300050512 Bacteria 2484
930 nmdc:mga0n895_1786_c1 3300050512 Bacteria 16331
931 nmdc:mga0n895_210_c1 3300050512 Bacteria 36466
932 nmdc:mga0n895_29295_c1 3300050512 Bacteria 5249
933 nmdc:mga0n895_31739_c1 3300050512 Bacteria 5061
934 nmdc:mga0rr50_15101_c1 3300050513 Bacteria 5090
935 nmdc:mga0rr50_18046_c1 3300050513 Bacteria 4730
936 nmdc:mga0rr50_551_c1 3300050513 Bacteria 20118
937 nmdc:mga0rr50_554633_c1 3300050513 Bacteria 978
938 nmdc:mga08x19_332304_c1 3300050514 Bacteria 1059
939 nmdc:mga08x19_61867_c1 3300050514 Bacteria 2426
940 nmdc:mga08x19_70997_c1 3300050514 Bacteria 2270
941 nmdc:mga0a205_1998_c1 3300050515 Bacteria 17770
942 nmdc:mga0a205_6459_c3 3300050515 Bacteria 5099
943 Ga0495601_0000048 3300053077 Bacteria 69310
944 Ga0495601_0001704 3300053077 Bacteria 12143
945 Ga0495601_0004933 3300053077 Bacteria 7740
946 Ga0495601_0004989 3300053077 Bacteria 7703
947 Ga0495612_0001352 3300053078 Bacteria 10110
948 Ga0495612_0004252 3300053078 Bacteria 5945
949 Ga0495595_0001723 3300053084 Bacteria 8561
950 Ga0495595_0003173 3300053084 Bacteria 6519
951 Ga0495595_0004063 3300053084 Bacteria 5857
952 Ga0495595_0006739 3300053084 Bacteria 4686
953 Ga0495595_0011229 3300053084 Bacteria 3740
954 Ga0495595_0194127 3300053084 Bacteria 1009
955 Ga0495619_0000142 3300053085 Bacteria 53495
956 Ga0495619_0000348 3300053085 Bacteria 32235
957 Ga0495619_0000760 3300053085 Bacteria 21033
958 Ga0495619_0001740 3300053085 Bacteria 14448
959 Ga0495619_0073860 3300053085 Bacteria 2286
960 Ga0495619_0140689 3300053085 Bacteria 1661
961 Ga0495619_0225931 3300053085 Bacteria 1297
962 Ga0495619_0372070 3300053085 Bacteria 987
963 Ga0500641_0005256 3300053096 Bacteria 4587
964 Ga0500641_0027727 3300053096 Bacteria 2207
965 Ga0501084_0182134 3300054114 Bacteria 1773
966 Ga0501082_0251497 3300060353 Bacteria 1538
967 Ga0501082_0751270 3300060353 Bacteria 853
968 2738746795 2738541281 Bacteria 5112672
969 2739356025 2738543032 Bacteria 5115625
970 Ga0070681_10043022
971 JGI24752J21851_1007370
972 JGI24746J21847_1001303
973 JGI24747J21853_1002926
974 JGI24739J22299_10008549
975 JGI24737J22298_10007957
976 JGI24743J22301_10013113
977 JGI24750J21931_1000131
978 JGI24745J21846_1000345
979 JGI24748J21848_1000453
980 JGI24738J21930_10001862
981 JGI24749J21850_1000396
982 JGI24744J21845_10001151
983 JGI24034J26672_10007089
984 JGI24742J22300_10002797
985 JGI25405J52794_10006392
986 Ga0065715_10096672
987 Ga0070676_10000453
988 Ga0070683_100001364
989 Ga0070690_100001804
990 Ga0070690_100057455
991 Ga0070670_100002480
992 Ga0070670_100168389
993 Ga0070677_10009496
994 Ga0070677_10066993
995 Ga0068869_100000405
996 Ga0070666_10160023
997 Ga0070680_100001735
998 Ga0070680_100027948
999 Ga0070680_100291189
1000 Ga0070682_100002414
1001 Ga0070682_100154193
1002 Ga0070682_100176982
1003 Ga0070682_100424359
1004 Ga0068868_100000515
1005 Ga0068868_100185549
1006 Ga0070660_100000183
1007 Ga0070660_100068495
1008 Ga0070660_100114899
1009 Ga0070689_100009233
1010 Ga0070689_100097368
1011 Ga0070687_100000164
1012 Ga0070687_100125341
1013 Ga0070661_100000411
1014 Ga0070661_100382866
1015 Ga0070692_10001516
1016 Ga0070668_100010802
1017 Ga0070669_100000114
1018 Ga0070675_100000148
1019 Ga0070671_100000070
1020 Ga0070671_100062159
1021 Ga0070671_100116149
1022 Ga0070671_100122683
1023 Ga0070674_100046877
1024 Ga0070673_100000214
1025 Ga0070673_100186245
1026 Ga0070688_100004754
1027 Ga0070688_100016083
1028 Ga0070688_100018545
1029 Ga0070659_100001224
1030 Ga0070667_100002018
1031 Ga0070667_100059896
1032 Ga0070667_100117137
1033 Ga0070667_100227143
1034 Ga0070667_100233289
1035 Ga0070703_10002903
1036 Ga0070709_10155741
1037 Ga0070709_10584571
1038 Ga0070714_100020071
1039 Ga0070714_100027411
1040 Ga0070714_100056962
1041 Ga0070714_100179209
1042 Ga0070714_100352782
1043 Ga0070713_100000680
1044 Ga0070710_10006183
1045 Ga0070710_10057261
1046 Ga0070710_10151277
1047 Ga0070710_10234095
1048 Ga0070701_10000210
1049 Ga0070711_100179997
1050 Ga0070705_100000549
1051 Ga0070700_100000328
1052 Ga0070700_100165140
1053 Ga0070694_100013627
1054 Ga0070694_100401859
1055 Ga0070663_100000100
1056 Ga0070678_100001000
1057 Ga0070678_100288226
1058 Ga0070678_100488674
1059 Ga0070662_100008274
1060 Ga0070662_100085123
1061 Ga0070662_100111198
1062 Ga0070681_10001377
1063 Ga0070681_10068303
1064 Ga0070681_10156752
1065 Ga0070681_10225201
1066 Ga0070681_10254386
1067 Ga0068867_100001032
1068 Ga0068867_100078797
1069 Ga0070685_10010286
1070 Ga0070685_10024528
1071 Ga0070707_100054108
1072 Ga0070679_100002182
1073 Ga0070679_100023170
1074 Ga0070679_100107097
1075 Ga0070679_100138301
1076 Ga0070679_100277664
1077 Ga0070684_100000306
1078 Ga0070684_100086339
1079 Ga0070697_100172353
1080 Ga0068853_100006837
1081 Ga0070672_100000289
1082 Ga0070686_100000261
1083 Ga0070686_100003064
1084 Ga0070686_100230764
1085 Ga0070695_100012184
1086 Ga0070696_100005594
1087 Ga0070696_100048885
1088 Ga0070693_100000204
1089 Ga0070665_100046336
1090 Ga0070665_100425310
1091 Ga0070665_100522504
1092 Ga0070704_100000297
1093 Ga0070704_100149095
1094 Ga0068855_100004961
1095 Ga0070664_100002983
1096 Ga0070664_100313569
1097 Ga0068857_100001434
1098 Ga0068854_100005280
1099 Ga0068854_100127923
1100 Ga0068856_100009252
1101 Ga0068856_100072815
1102 Ga0070702_100000592
1103 Ga0068852_100000836
1104 Ga0068852_100045255
1105 Ga0068852_100080459
1106 Ga0068852_100208432
1107 Ga0068859_100002494
1108 Ga0068859_100472481
1109 Ga0068864_100000172
1110 Ga0068864_100380453
1111 Ga0068866_10000325
1112 Ga0068861_100002528
1113 Ga0068851_10026967
1114 Ga0068870_10000846
1115 Ga0068863_100002553
1116 Ga0068863_100088116
1117 Ga0068863_100193261
1118 Ga0068863_100545351
1119 Ga0068858_100001665
1120 Ga0068858_100155864
1121 Ga0068858_100480997
1122 Ga0068860_100001131
1123 Ga0068860_100282013
1124 Ga0068860_100341322
1125 Ga0068860_100346870
1126 Ga0068862_100185101
1127 Ga0081455_10000002
1128 Ga0081455_10002251
1129 Ga0081455_10162888
1130 Ga0081540_1000241
1131 Ga0070717_10006536
1132 Ga0070717_10021129
1133 Ga0070717_10100147
1134 Ga0070717_10309000
1135 Ga0070717_10320569
1136 Ga0075365_10317151
1137 Ga0075368_10019635
1138 Ga0075368_10126126
1139 Ga0075363_100081414
1140 Ga0075432_10002460
1141 Ga0070715_10011831
1142 Ga0070716_100000480
1143 Ga0070712_100104322
1144 Ga0075362_10022910
1145 Ga0075362_10086701
1146 Ga0075367_10011069
1147 Ga0075367_10040107
1148 Ga0075367_10182975
1149 Ga0075427_10000802
1150 Ga0075366_10000286
1151 Ga0075366_10054089
1152 Ga0097621_100000006
1153 Ga0097621_100028909
1154 Ga0075370_10011720
1155 Ga0075370_10097285
1156 Ga0068871_100001147
1157 Ga0068871_100038474
1158 Ga0075430_100000125
1159 Ga0075430_100328593
1160 Ga0075431_100007030
1161 Ga0075433_10000008
1162 Ga0075433_10021731
1163 Ga0075433_10078338
1164 Ga0075433_10175674
1165 Ga0075434_100000152
1166 Ga0075434_100003460
1167 Ga0075434_100059084
1168 Ga0075434_100098201
1169 Ga0075434_100104129
1170 Ga0075429_100000083
1171 Ga0068865_100000114
1172 Ga0075436_100006953
1173 Ga0075436_100076225
1174 Ga0097620_100002494
1175 Ga0097620_100472468
1176 Ga0075435_100012469
1177 Ga0075435_100057374
1178 Ga0075435_100243070
1179 Ga0075435_100269209
1180 Ga0099795_10000504
1181 Ga0099795_10049589
1182 Ga0105250_10054276
1183 Ga0105250_10069427
1184 Ga0105240_10012009
1185 Ga0105240_10015529
1186 Ga0111539_10001699
1187 Ga0111539_10019539
1188 Ga0111539_10145718
1189 Ga0111539_10315296
1190 Ga0105245_10000175
1191 Ga0105245_10278549
1192 Ga0105245_10477674
1193 Ga0105247_10001094
1194 Ga0105247_10018151
1195 Ga0105247_10093383
1196 Ga0114129_10000533
1197 Ga0114129_10010322
1198 Ga0105243_10000315
1199 Ga0105243_10106218
1200 Ga0105243_10157847
1201 Ga0105243_10434267
1202 Ga0105241_10000316
1203 Ga0105241_10107771
1204 Ga0105242_10000356
1205 Ga0105242_10015913
1206 Ga0105248_10001326
1207 Ga0105248_10007327
1208 Ga0105248_10010783
1209 Ga0105248_10224439
1210 Ga0105248_10416120
1211 Ga0105237_10019485
1212 Ga0105238_10214253
1213 Ga0105238_10667556
1214 Ga0105249_10000289
1215 Ga0099796_10000185
1216 Ga0105239_10008446
1217 Ga0105239_10331986
1218 Ga0105239_10756988
1219 Ga0105246_10000070
1220 Ga0105246_10093244
1221 Ga0157373_10029598
1222 Ga0157371_10005008
1223 Ga0157370_10054315
1224 Ga0157370_10129286
1225 Ga0157369_10563197
1226 Ga0157369_10688454
1227 Ga0157369_10797836
1228 Ga0157374_10001589
1229 Ga0157374_10304567
1230 Ga0157378_10000713
1231 Ga0157378_10096812
1232 Ga0157378_10559268
1233 Ga0163162_10000202
1234 Ga0163162_10448753
1235 Ga0157372_10036396
1236 Ga0157372_10293784
1237 Ga0157375_10000507
1238 Ga0157375_10281621
1239 Ga0163163_10001140
1240 Ga0163163_10002989
1241 Ga0163163_10012390
1242 Ga0157380_10000823
1243 Ga0157380_10328959
1244 Ga0157377_10000109
1245 Ga0157379_10008739
1246 Ga0157379_10026034
1247 Ga0157379_10170556
1248 Ga0157376_10000211
1249 Ga0157376_10186479
1250 Ga0163161_10000132
1251 Ga0163161_10034783
1252 Ga0163161_10154211
1253 Ga0163161_10232307
1254 Ga0206356_10802032
1255 Ga0206354_10645964
1256 Ga0206353_11534553
1257 Ga0213875_10000031
1258 Ga0207666_1000018
1259 Ga0207673_1000004
1260 Ga0207697_10000078
1261 Ga0207653_10012978
1262 Ga0207682_10000001
1263 Ga0207682_10028194
1264 Ga0207692_10012572
1265 Ga0207692_10031234
1266 Ga0207642_10003965
1267 Ga0207710_10003351
1268 Ga0207710_10016933
1269 Ga0207710_10131797
1270 Ga0207688_10000132
1271 Ga0207680_10019790
1272 Ga0207680_10227346
1273 Ga0207647_10000678
1274 Ga0207685_10014445
1275 Ga0207699_10000206
1276 Ga0207699_10131806
1277 Ga0207645_10000110
1278 Ga0207645_10009349
1279 Ga0207643_10001892
1280 Ga0207705_10105091
1281 Ga0207707_10000922
1282 Ga0207707_10040591
1283 Ga0207707_10192038
1284 Ga0207707_10214877
1285 Ga0207695_10051521
1286 Ga0207695_10065916
1287 Ga0207671_10009327
1288 Ga0207671_10212223
1289 Ga0207693_10018725
1290 Ga0207693_10076094
1291 Ga0207693_10081896
1292 Ga0207693_10240367
1293 Ga0207663_10044876
1294 Ga0207663_10175681
1295 Ga0207660_10000063
1296 Ga0207660_10051692
1297 Ga0207660_10400895
1298 Ga0207660_10562389
1299 Ga0207662_10000581
1300 Ga0207662_10040307
1301 Ga0207662_10139265
1302 Ga0207657_10002831
1303 Ga0207657_10012668
1304 Ga0207657_10113413
1305 Ga0207649_10000064
1306 Ga0207652_10000128
1307 Ga0207652_10010954
1308 Ga0207652_10091116
1309 Ga0207652_10137597
1310 Ga0207652_10224347
1311 Ga0207681_10000024
1312 Ga0207650_10008086
1313 Ga0207659_10000034
1314 Ga0207687_10000069
1315 Ga0207687_10243721
1316 Ga0207700_10007400
1317 Ga0207700_10215459
1318 Ga0207664_10002775
1319 Ga0207664_10080701
1320 Ga0207644_10000342
1321 Ga0207644_10011935
1322 Ga0207644_10084704
1323 Ga0207644_10121974
1324 Ga0207690_10000068
1325 Ga0207706_10002299
1326 Ga0207706_10019674
1327 Ga0207706_10268243
1328 Ga0207686_10000875
1329 Ga0207686_10021413
1330 Ga0207686_10180423
1331 Ga0207709_10003412
1332 Ga0207709_10042441
1333 Ga0207709_10296110
1334 Ga0207670_10000057
1335 Ga0207670_10018002
1336 Ga0207669_10000005
1337 Ga0207669_10037640
1338 Ga0207669_10060777
1339 Ga0207704_10000346
1340 Ga0207704_10030499
1341 Ga0207704_10078408
1342 Ga0207704_10344965
1343 Ga0207665_10001878
1344 Ga0207665_10080548
1345 Ga0207665_10104954
1346 Ga0207691_10000543
1347 Ga0207691_10114853
1348 Ga0207711_10004328
1349 Ga0207711_10014202
1350 Ga0207711_10017864
1351 Ga0207711_10141341
1352 Ga0207689_10000055
1353 Ga0207661_10000036
1354 Ga0207679_10000025
1355 Ga0207679_10124182
1356 Ga0207679_10250043
1357 Ga0207667_10003352
1358 Ga0207667_10038158
1359 Ga0207667_10283313
1360 Ga0207667_10549537
1361 Ga0207651_10000014
1362 Ga0207651_10114883
1363 Ga0207712_10000523
1364 Ga0207668_10000352
1365 Ga0207640_10000779
1366 Ga0207658_10001275
1367 Ga0207658_10050110
1368 Ga0207677_10000382
1369 Ga0207703_10001504
1370 Ga0207703_10018104
1371 Ga0207639_10000288
1372 Ga0207678_10000292
1373 Ga0207708_10001276
1374 Ga0207702_10084727
1375 Ga0207702_10113025
1376 Ga0207702_10302023
1377 Ga0207702_10610678
1378 Ga0207641_10058613
1379 Ga0207641_10111390
1380 Ga0207641_10259708
1381 Ga0207641_10404270
1382 Ga0207648_10003100
1383 Ga0207648_10012111
1384 Ga0207648_10048827
1385 Ga0207648_10314393
1386 Ga0207676_10000826
1387 Ga0207676_10022901
1388 Ga0207674_10000376
1389 Ga0207675_100002377
1390 Ga0207675_100088084
1391 Ga0207675_100515779
1392 Ga0207683_10000001
1393 Ga0207683_10021116
1394 Ga0207683_10026710
1395 Ga0207683_10046152
1396 Ga0207698_10000231
1397 Ga0207698_10043243
1398 Ga0207698_10419771
1399 Ga0209982_1022040
1400 Ga0209966_1008239
1401 Ga0209966_1015555
1402 Ga0209998_10003278
1403 Ga0209998_10003574
1404 Ga0209813_10033268
1405 Ga0209974_10001490
1406 Ga0207428_10000162
1407 Ga0207428_10000233
1408 Ga0268266_10033132
1409 Ga0268265_10000477
1410 Ga0268265_10650194
1411 Ga0268264_10000309
1412 Ga0268264_10027832
1413 Ga0268264_10539584
1414 Ga0265338_10076248
1415 Ga0265325_10000056
1416 Ga0265325_10001378
1417 Ga0265325_10003842
1418 Ga0265325_10032699
1419 Ga0265325_10096896
1420 Ga0265340_10019704
1421 Ga0265340_10054702
1422 Ga0265339_10001310
1423 Ga0265339_10003844
1424 Ga0265331_10100646
1425 Ga0265316_10218287
1426 Ga0265313_10014436
1427 Ga0265313_10062195
1428 Ga0265342_10000193
1429 Ga0307409_100323287
1430 Ga0373948_0000932
1431 Ga0373948_0013231
1432 Ga0373950_0008480
1433 Ga0373958_0003525
1434 Ga0373958_0049748
1435 Ga0373938_0001151
1436 Ga0373938_0001291
1437 Ga0373926_0027019
1438 Ga0373928_0002146
1439 Ga0373928_0002836
1440 Ga0373929_0000675
1441 Ga0373929_0016152
1442 Ga0373934_0059023
1443 Ga0373940_0003452
1444 Ga0373940_0025916
1445 Ga0373944_0009606
1446 Ga0373944_0046664
1447 Ga0373949_0001862
1448 Ga0373949_0004195
1449 Ga0373949_0024626
1450 Ga0373951_0000710
1451 Ga0373952_0001834
1452 Ga0373952_0014692
1453 Ga0373952_0030118
1454 Ga0373923_0054229
1455 Ga0373923_0144358
1456 Ga0373932_0000674
1457 Ga0373932_0001584
1458 Ga0373936_0019109
1459 Ga0373939_0001761
1460 Ga0373939_0008814
1461 Ga0373939_0028672
1462 Ga0373939_0029902
1463 Ga0373941_0000367
1464 Ga0373941_0002074
1465 Ga0373941_0023011
1466 Ga0373945_0073968
1467 Ga0373953_0014468
1468 Ga0373954_0000573
1469 Ga0373954_0060119
1470 Ga0373956_0053271
1471 Ga0373956_0142068
1472 Ga0373957_0003946
1473 Ga0373957_0050729
1474 Ga0373957_0141048
1475 Ga0373960_0001805
1476 Ga0373960_0001871
1477 Ga0373943_0184496
1478 Ga0373946_0010861
1479 Ga0373946_0052312
1480 Ga0373946_0058594
1481 Ga0373955_0001431
1482 Ga0373955_0055606
1483 Ga0373955_0210753
1484 Ga0373942_0010607
1485 Ga0373942_0042160
1486 Ga0373961_0005475
1487 Ga0373962_0000104
1488 Ga0373924_0065198
1489 Ga0373924_0082007
1490 Ga0373924_0101656
1491 Ga0373931_0000072
1492 Ga0373931_0000682
1493 Ga0373931_0004121
1494 Ga0373931_0033427
1495 Ga0373931_0113623
1496 Ga0373935_0006366
1497 Ga0373935_0019659
1498 Ga0373935_0044119
1499 Ga0373935_0131532
1500 Ga0373935_0204413
1501 Ga0373927_0014307
1502 Ga0373927_0410553
1503 Ga0373927_0458203
1504 Ga0373933_0002471
1505 Ga0373933_0003704
1506 Ga0373933_0025249
1507 Ga0373947_0017662
1508 Ga0373947_0020325
1509 Ga0373947_0315305
1510 Ga0373937_0014028
1511 Ga0373937_0029548
1512 Ga0373937_0081967
1513 Ga0373937_0109242
1514 Ga0373937_0114232
1515 Ga0373937_0148464
1516 Ga0373937_0474620
1517 Ga0373925_0007613
1518 Ga0373925_0060370
1519 Ga0373925_0074537
1520 Ga0373925_0165617
1521 Ga0436364_0793438
1522 Ga0395901_0009364
1523 Ga0395901_0688008
1524 Ga0436365_1569042
1525 Ga0436363_0254747
1526 Ga0439453_0020816
1527 Ga0439448_0012112
1528 Ga0439450_004592
1529 Ga0439455_0009610
1530 Ga0439463_011971
1531 Ga0439434_0090258
1532 Ga0439464_0089070
1533 Ga0466963_0083735
1534 Ga0466963_0136663
1535 Ga0466957_0011624
1536 Ga0466957_0053856
1537 Ga0466959_0015280
1538 Ga0466958_0032332
1539 Ga0495617_021410
1540 Ga0495592_0011976
1541 Ga0495592_0014877
1542 Ga0495592_0169073
1543 Ga0495603_0015018
1544 Ga0495603_0030359
1545 Ga0495590_0114743
1546 Ga0495629_0000301
1547 Ga0495629_0138563
1548 Ga0495641_0012536
1549 Ga0495651_0000931
1550 Ga0495651_0002045
1551 Ga0495651_0008299
1552 Ga0495651_0072527
1553 Ga0495653_0007314
1554 Ga0495653_0026303
1555 Ga0495653_0133035
1556 Ga0495580_0010672
1557 Ga0495580_0096909
1558 Ga0495582_0000165
1559 Ga0495582_0062824
1560 Ga0495582_0173353
1561 Ga0495605_0107640
1562 Ga0495639_0001251
1563 Ga0495639_0021907
1564 Ga0495662_0007950
1565 Ga0495662_0032820
1566 Ga0495662_0074838
1567 Ga0495662_0208957
1568 Ga0495664_0025708
1569 Ga0495664_0217281
1570 Ga0495664_0335571
1571 Ga0495584_0027415
1572 Ga0495585_0001207
1573 Ga0495594_0023233
1574 Ga0495594_0037055
1575 Ga0495607_0004923
1576 Ga0495608_0015277
1577 Ga0495608_0107960
1578 Ga0495608_0132380
1579 Ga0495608_0235631
1580 Ga0495616_0146103
1581 Ga0495618_0036630
1582 Ga0495628_0086094
1583 Ga0495628_0110422
1584 Ga0495628_0155343
1585 Ga0495628_0170949
1586 Ga0495628_0263973
1587 Ga0495628_0289909
1588 Ga0495630_0021325
1589 Ga0495630_0508072
1590 Ga0495631_0021408
1591 Ga0495637_0097569
1592 Ga0495644_0000571
1593 Ga0495663_0014599
1594 Ga0495666_0030723
1595 Ga0495652_0018029
1596 Ga0495652_0024574
1597 Ga0495652_0276128
1598 Ga0495640_0221699
1599 Ga0495586_0010183
1600 Ga0495586_0063899
1601 Ga0495587_0006331
1602 Ga0495587_0030470
1603 Ga0495598_0001757
1604 Ga0495609_0012501
1605 Ga0495621_0082389
1606 Ga0495645_0000223
1607 Ga0495645_0033789
1608 Ga0495645_0239972
1609 Ga0495645_0274605
1610 Ga0495622_0005532
1611 Ga0495622_0027314
1612 Ga0495622_0108057
1613 Ga0495633_0001185
1614 Ga0495667_0031790
1615 Ga0495667_0033059
1616 Ga0495667_0051584
1617 Ga0495667_0076909
1618 Ga0495656_0001164
1619 Ga0495634_0034266
1620 Ga0495634_0181103
1621 Ga0495611_0007125
1622 Ga0495635_0000999
1623 Ga0495635_0017785
1624 Ga0495635_0089731
1625 Ga0495635_0378365
1626 Ga0495659_0000975
1627 Ga0495659_0029381
1628 Ga0495659_0029982
1629 Ga0495659_0132780
1630 Ga0495661_0025793
1631 Ga0495588_0171359
1632 Ga0495657_0002536
1633 Ga0495657_0016458
1634 Ga0495657_0018493
1635 Ga0495599_0001964
1636 Ga0495599_0010860
1637 Ga0495599_0044219
1638 Ga0495623_0000454
1639 Ga0495623_0004056
1640 Ga0495646_0006696
1641 Ga0495646_0027070
1642 Ga0495658_0001694
1643 Ga0495658_0004617
1644 Ga0495658_0028677
1645 Ga0495658_0077116
1646 Ga0495658_0290972
1647 Ga0495669_0038709
1648 Ga0495613_0001324
1649 Ga0495613_0056789
1650 Ga0495613_0079146
1651 Ga0495624_0009215
1652 Ga0495670_0000747
1653 Ga0495671_0173976
1654 Ga0495589_0065258
1655 Ga0495600_0026812
1656 Ga0495600_0056640
1657 Ga0495600_0140451
1658 Ga0495600_0216991
1659 Ga0495604_0022921
1660 Ga0495604_0037287
1661 Ga0495604_0054164
1662 Ga0495674_0024659
1663 Ga0495676_0202244
1664 Ga0495680_0001680
1665 Ga0495680_0009135
1666 Ga0495680_0010402
1667 Ga0495680_0014617
1668 Ga0495680_0028181
1669 Ga0495683_0142503
1670 Ga0495675_0001429
1671 Ga0495675_0066407
1672 Ga0495679_007873
1673 Ga0495684_0004283
1674 Ga0495593_0032912
1675 Ga0495593_0081571
1676 Ga0495593_0116075
1677 Ga0495602_0013952
1678 Ga0495602_0041284
1679 Ga0495602_0071245
1680 Ga0495602_0130857
1681 Ga0495614_0013643
1682 Ga0496100_0000161
1683 Ga0496100_0002282
1684 Ga0496100_0016513
1685 Ga0496100_0042406
1686 Ga0496101_0000869
1687 Ga0496101_0021875
1688 Ga0496101_0047296
1689 Ga0496101_0256776
1690 Ga0496101_0528848
1691 Ga0496102_0002837
1692 Ga0496102_0005211
1693 Ga0496102_0005523
1694 Ga0496102_0015550
1695 Ga0496102_0077239
1696 Ga0496103_0000499
1697 Ga0496103_0002698
1698 Ga0496103_0092286
1699 Ga0496103_0312243
1700 Ga0496104_0000370
1701 Ga0496104_0001967
1702 Ga0496104_0005269
1703 Ga0496104_0019317
1704 Ga0496104_0023038
1705 Ga0496104_0025999
1706 Ga0496104_0096700
1707 Ga0496105_0005159
1708 Ga0496105_0021982
1709 Ga0496105_0026435
1710 Ga0496105_0039433
1711 Ga0496105_0249719
1712 Ga0496106_0000357
1713 Ga0496106_0013549
1714 Ga0496106_0022564
1715 Ga0496106_0258367
1716 Ga0496107_0000206
1717 Ga0496107_0001825
1718 Ga0496107_0007544
1719 Ga0496107_0047489
1720 Ga0496107_0050511
1721 Ga0496107_0163807
1722 Ga0496108_0007040
1723 Ga0496108_0012661
1724 Ga0496108_0017975
1725 Ga0496108_0030762
1726 Ga0496108_0037549
1727 Ga0496108_0064702
1728 Ga0496108_0182907
1729 Ga0496109_0001922
1730 Ga0496109_0001930
1731 Ga0496109_0027546
1732 Ga0496109_0281086
1733 Ga0496109_0538594
1734 Ga0496110_0005694
1735 Ga0496110_0011922
1736 Ga0496110_0029162
1737 Ga0496110_0113541
1738 Ga0496111_0008628
1739 Ga0496111_0046671
1740 Ga0496112_0003333
1741 Ga0496112_0093856
1742 Ga0496112_0125195
1743 Ga0496112_0244975
1744 Ga0496112_0265779
1745 Ga0496113_0002587
1746 Ga0496113_0003762
1747 Ga0496113_0007424
1748 Ga0496113_0013972
1749 Ga0496113_0016330
1750 Ga0496113_0036620
1751 Ga0496114_0008819
1752 Ga0496114_0011210
1753 Ga0496114_0215058
1754 Ga0496115_0001252
1755 Ga0496115_0032161
1756 Ga0496115_0058158
1757 Ga0496115_0092042
1758 Ga0496115_0099734
1759 Ga0496115_0242170
1760 Ga0496115_0306600
1761 Ga0496121_0013535
1762 Ga0496126_0003241
1763 Ga0496126_0330957
1764 Ga0501031_0036019
1765 Ga0501032_0022653
1766 Ga0501032_0041157
1767 Ga0501032_0095686
1768 Ga0501032_0130328
1769 Ga0501032_0207272
1770 Ga0501033_0014941
1771 Ga0501033_0018414
1772 Ga0501033_0029299
1773 Ga0501033_0032178
1774 Ga0501033_0166808
1775 Ga0501033_0561564
1776 Ga0501034_0000726
1777 Ga0501034_0002620
1778 Ga0501034_0020502
1779 Ga0501034_0042133
1780 Ga0501034_0046563
1781 Ga0501034_0062912
1782 Ga0501034_0073842
1783 Ga0501034_0103509
1784 Ga0501036_0000751
1785 Ga0501036_0038127
1786 Ga0501036_0154804
1787 Ga0501036_0155816
1788 Ga0501036_0199175
1789 Ga0501037_0018610
1790 Ga0501037_0040837
1791 Ga0501038_0021116
1792 Ga0501038_0103581
1793 Ga0501038_0108575
1794 Ga0501039_0080147
1795 Ga0501040_0483788
1796 Ga0501042_0084262
1797 Ga0501043_0002856
1798 Ga0501043_0020569
1799 Ga0501043_0044466
1800 Ga0501043_0059057
1801 Ga0501043_0063655
1802 Ga0501043_0242589
1803 Ga0501046_0045486
1804 Ga0501046_0094590
1805 Ga0501046_0147582
1806 Ga0501047_0000306
1807 Ga0501047_0020132
1808 Ga0501047_0050681
1809 Ga0501047_0067244
1810 Ga0501047_0122834
1811 Ga0501047_0278134
1812 Ga0501047_0487580
1813 Ga0501048_0000137
1814 Ga0501048_0021042
1815 Ga0501048_0052355
1816 Ga0501067_0039584
1817 Ga0501068_0036641
1818 Ga0501068_0358875
1819 Ga0501069_0013966
1820 Ga0501069_0018134
1821 Ga0501069_0292818
1822 Ga0501070_0001636
1823 Ga0501070_0012886
1824 Ga0501070_0014023
1825 Ga0501070_0029633
1826 Ga0501070_0044279
1827 Ga0501070_0056080
1828 Ga0501070_0111398
1829 Ga0501070_0115556
1830 Ga0501070_0143310
1831 Ga0501070_0238250
1832 Ga0501070_0428286
1833 Ga0501070_0524901
1834 Ga0501071_0078716
1835 Ga0501071_0204927
1836 Ga0501071_0254009
1837 Ga0501072_0006141
1838 Ga0501072_0330020
1839 Ga0501072_0412200
1840 Ga0501073_0023532
1841 Ga0501073_0168667
1842 Ga0501073_0190366
1843 Ga0501073_0227585
1844 Ga0501073_0482583
1845 Ga0501074_0006141
1846 Ga0501074_0039640
1847 Ga0501074_0051064
1848 Ga0501075_0394041
1849 Ga0501079_0083671
1850 Ga0501079_0162711
1851 Ga0501079_0253480
1852 Ga0501080_0000574
1853 Ga0501080_0085483
1854 Ga0501080_0087653
1855 Ga0501080_0132108
1856 Ga0501080_0328308
1857 Ga0501080_0416193
1858 Ga0501081_0157659
1859 Ga0501083_0001509
1860 Ga0501083_0017130
1861 Ga0501083_0093288
1862 Ga0501083_0178892
1863 Ga0501083_0225597
1864 Ga0501035_0000253
1865 Ga0501035_0060470
1866 Ga0501035_0094247
1867 Ga0501035_0112609
1868 Ga0501035_0206909
1869 Ga0501044_0000815
1870 Ga0501044_0003892
1871 Ga0501044_0015393
1872 Ga0501044_0022228
1873 Ga0501044_0142897
1874 Ga0501044_0178658
1875 Ga0501044_0334848
1876 Ga0501044_0480871
1877 nmdc:mga03683_72812_c1
1878 nmdc:mga03n38_58029_c1
1879 nmdc:mga0k408_2232_c1
1880 nmdc:mga06z11_21901_c1
1881 nmdc:mga06z11_8599_c1
1882 nmdc:mga04h51_156034_c1
1883 nmdc:mga04h51_157960_c1
1884 nmdc:mga07m45_166364_c1
1885 nmdc:mga07m45_223644_c1
1886 nmdc:mga07m45_36431_c1
1887 nmdc:mga05p37_15391_c1
1888 nmdc:mga05p37_155918_c1
1889 nmdc:mga05p37_58_c1
1890 nmdc:mga09592_246_c1
1891 nmdc:mga0qj67_420_c1
1892 nmdc:mga06r32_1189_c1
1893 nmdc:mga06r32_350347_c1
1894 nmdc:mga08y16_1095_c1
1895 nmdc:mga08y16_408_c1
1896 nmdc:mga08y16_426886_c1
1897 nmdc:mga0n895_111650_c1
1898 nmdc:mga0n895_136041_c1
1899 nmdc:mga0n895_1786_c1
1900 nmdc:mga0n895_210_c1
1901 nmdc:mga0n895_29295_c1
1902 nmdc:mga0n895_31739_c1
1903 nmdc:mga0rr50_15101_c1
1904 nmdc:mga0rr50_18046_c1
1905 nmdc:mga0rr50_551_c1
1906 nmdc:mga0rr50_554633_c1
1907 nmdc:mga08x19_332304_c1
1908 nmdc:mga08x19_61867_c1
1909 nmdc:mga08x19_70997_c1
1910 nmdc:mga0a205_1998_c1
1911 nmdc:mga0a205_6459_c3
1912 Ga0495601_0000048
1913 Ga0495601_0001704
1914 Ga0495601_0004933
1915 Ga0495601_0004989
1916 Ga0495612_0001352
1917 Ga0495612_0004252
1918 Ga0495595_0001723
1919 Ga0495595_0003173
1920 Ga0495595_0004063
1921 Ga0495595_0006739
1922 Ga0495595_0011229
1923 Ga0495595_0194127
1924 Ga0495619_0000142
1925 Ga0495619_0000348
1926 Ga0495619_0000760
1927 Ga0495619_0001740
1928 Ga0495619_0073860
1929 Ga0495619_0140689
1930 Ga0495619_0225931
1931 Ga0495619_0372070
1932 Ga0500641_0005256
1933 Ga0500641_0027727
1934 Ga0501084_0182134
1935 Ga0501082_0251497
1936 Ga0501082_0751270
1937 2738746795
1938 2739356025

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01863

YgjP-like

YgjP-like, metallopeptidase domain

76

279

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qhi-assembly2.cif.gz_C crystal structure of methanocaldococcus jannaschii selecase mutant r36w 0.8572 146 242
4jix-assembly1.cif.gz_B crystal structure of the metallopeptidase zymogen of methanocaldococcus jannaschii jannalysin 0.8437 148 238
4jiu-assembly1.cif.gz_A crystal structure of the metallopeptidase zymogen of pyrococcus abyssi abylysin 0.7989 148 248
4jix-assembly1.cif.gz_A crystal structure of the metallopeptidase zymogen of methanocaldococcus jannaschii jannalysin 0.7885 147 240
4qhj-assembly1.cif.gz_B crystal structure of methanocaldococcus jannaschii selecase mutant i100f+h107f 0.7866 146 241
ID Description Score Start End Superfamily
4qhiC00 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8572 146 242 3.30.2010.10
4jixB00 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8437 148 238 3.30.2010.10
af_P42597_68_160_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8142 167 242 3.30.2010.10
4jiuA00 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8131 148 246 3.30.2010.10
4qhiC00 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.7859 146 242 3.30.2010.10
ID Description Score Start End GO Terms
AF-A0A4R8FCZ9-F1-model_v4 deleted 0.9896 125 245
AF-J8W449-F1-model_v4 deleted 0.9738 150 243
AF-A0A7X2TI66-F1-model_v4 deleted 0.9716 151 244
AF-A0A4Q6BPD8-F1-model_v4 M48 family peptidase 0.9705 162 243
AF-A0A529Q2S7-F1-model_v4 M48 family metallopeptidase 0.9685 160 244

Map