F487029

General Info

Members Datasets Scaffolds Average Seq Length
967 353 944 187

Family's Representative Sequence

Representative Sequence 3300041443|Ga0451789_0709532|Ga0451789_0709532_719_1300
Length 193
Sequence MSRLRIYEDSGSTTPTATWTRHEDIARELAAAGVRFEQWQADQPIVPGASQDEVIAAYRNDIDRLMREEGYRSVDVISLTPDHPERANLRQKFLSEHTHSEDEVRFFVAGAGQFTLHIEGKVYDVLCEQGDLIGVPDGTPHWFDMSESPYFVAIRLFTNTDGWVANFTGADIATRFPRMQPHTSIHADSIRST

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
3 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
4 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
5 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
6 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
7 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
8 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
9 2734482264 Dyella sp. AD052 Isolate Unclassified
10 2738543009 Luteibacter sp. OK325 Isolate Unclassified
11 2739367700 Dyella sp. YR388 Isolate Unclassified
12 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
13 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
14 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
15 2884411467 Dyella sp. AD56 Isolate Rhizosphere
16 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
17 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
18 2919085039 Luteibacter sp. 1214 Isolate Unclassified
19 2919404418 Luteibacter sp. 3190 Isolate Unclassified
20 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
21 2928963466 Dyella japonica 1073 Isolate Unclassified
22 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
23 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
24 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
25 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
26 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
27 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
28 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
29 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
30 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
31 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
32 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
33 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
34 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
35 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
36 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
37 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
38 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
39 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
40 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
41 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
42 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
43 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
44 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
45 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
46 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
49 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
50 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
51 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
52 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
53 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
54 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
55 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
56 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
57 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
58 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
64 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
65 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
66 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
67 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
75 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
76 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
94 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
111 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
125 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
126 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
127 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
128 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
137 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
143 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
145 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
146 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
148 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
149 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
150 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
152 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
153 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
155 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
208 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
211 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
212 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
218 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
219 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
220 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
221 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
222 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
223 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
224 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
225 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
226 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
227 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
228 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
229 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
230 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
231 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
232 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
233 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
234 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
235 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
236 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
237 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
238 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
239 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
240 3300044536 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E Metagenome Unclassified
241 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
242 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
243 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
244 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
245 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
246 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
247 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
248 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
249 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
250 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
251 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
252 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
253 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
254 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
255 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
256 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
257 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
258 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
259 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
260 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
261 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
262 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
263 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
264 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
265 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
266 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
267 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
268 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
269 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
270 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
271 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
272 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
273 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
274 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
275 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
276 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
277 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
278 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
279 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
280 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
281 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
282 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
283 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
284 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
285 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
286 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
287 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
288 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
289 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
290 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
291 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
292 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
293 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
294 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
295 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
298 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
299 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
300 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
301 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
302 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
303 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
304 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
305 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
306 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
307 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
308 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
309 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
310 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
311 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
326 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
327 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
328 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
329 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
330 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
331 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
332 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
333 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
334 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
335 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
336 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
337 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
338 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
341 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
342 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
343 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
344 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
345 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
346 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
347 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
348 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
349 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
350 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
351 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
352 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
353 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.69
Metatranscriptomes 0.93
Isolates 2.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.51
Nodule 0
Rhizoplane 3.21
Rhizosphere 76.73
Stem 0
Stem Tuber 0
Unclassified 10.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000040 3300001989 Bacteria 35361
2 JGI24737J22298_10034231 3300001990 Bacteria 1575
3 JGI24735J21928_10033486 3300002067 Bacteria 1517
4 JGI24735J21928_10064702 3300002067 Bacteria 1050
5 JGI24738J21930_10004328 3300002075 Bacteria 3494
6 JGI25156J39149_1000336 3300002705 Bacteria 30956
7 JGI25162J39368_1000395 3300002737 Bacteria 36803
8 JGI25162J39368_1000684 3300002737 Bacteria 23728
9 JGI25162J39368_1001837 3300002737 Bacteria 9896
10 JGI25162J39368_1002286 3300002737 Bacteria 7726
11 JGI25162J39368_1002391 3300002737 Bacteria 7380
12 JGI25162J39368_1003957 3300002737 Bacteria 3778
13 JGI25154J39366_1019493 3300002738 Bacteria 657
14 JGI25157J39369_1000081 3300002741 Bacteria 85798
15 JGI25157J39369_1002084 3300002741 Bacteria 5673
16 JGI25157J39369_1004062 3300002741 Bacteria 2766
17 JGI25163J39215_1001484 3300002771 Bacteria 3776
18 JGI25164J39214_1000028 3300002772 Bacteria 150310
19 JGI25164J39214_1000046 3300002772 Bacteria 124984
20 JGI25164J39214_1000338 3300002772 Bacteria 29675
21 JGI25164J39214_1000416 3300002772 Bacteria 24162
22 JGI25165J46597_1000096 3300003214 Bacteria 161294
23 JGI25165J46597_1000108 3300003214 Bacteria 150310
24 JGI25165J46597_1000231 3300003214 Bacteria 77773
25 JGI25165J46597_1000513 3300003214 Bacteria 36803
26 JGI25153J46596_10030265 3300003215 Bacteria 1844
27 rootH2_10011443 3300003320 Bacteria 3963
28 rootH2_10026728 3300003320 Bacteria 23571
29 rootL2_10225786 3300003322 Bacteria 1065
30 rootL2_10233426 3300003322 Bacteria 1253
31 rootH1_10198539 3300003323 Bacteria 1270
32 Ga0006562J51391_1011242 3300003578 Bacteria 4170
33 Ga0006562J51391_1011245 3300003578 Bacteria 2790
34 Ga0006562J51391_1097585 3300003578 Bacteria 3440
35 Ga0055538_1001267 3300003751 Bacteria 5177
36 Ga0055533_1000667 3300003756 Bacteria 11379
37 Ga0055535_1000752 3300003761 Bacteria 24166
38 Ga0055535_1000771 3300003761 Bacteria 23731
39 Ga0055535_1001091 3300003761 Bacteria 16572
40 Ga0055542_1000477 3300003762 Bacteria 37334
41 Ga0055542_1000772 3300003762 Bacteria 24080
42 Ga0055542_1000787 3300003762 Bacteria 23728
43 Ga0055542_1000869 3300003762 Bacteria 21104
44 Ga0055529_1000078 3300003763 Bacteria 150310
45 Ga0055529_1000454 3300003763 Bacteria 40215
46 Ga0055529_1005844 3300003763 Bacteria 1750
47 Ga0055543_1006491 3300004625 Bacteria 2820
48 Ga0065165_1000001 3300005262 Bacteria 494087
49 Ga0065165_1008009 3300005262 Bacteria 5053
50 Ga0070658_10019429 3300005327 Bacteria 5441
51 Ga0070658_10104750 3300005327 Bacteria 2340
52 Ga0070676_10095321 3300005328 Bacteria 1830
53 Ga0070683_100295591 3300005329 Bacteria 1540
54 Ga0070683_100343365 3300005329 Bacteria 1422
55 Ga0068869_100717244 3300005334 Bacteria 854
56 Ga0068869_100937804 3300005334 Bacteria 751
57 Ga0070666_10000003 3300005335 Bacteria 463666
58 Ga0070666_10005072 3300005335 Bacteria 8059
59 Ga0070666_10070275 3300005335 Bacteria 2381
60 Ga0070680_100243790 3300005336 Bacteria 1519
61 Ga0070682_100001592 3300005337 Bacteria 12649
62 Ga0070682_100001976 3300005337 Bacteria 11428
63 Ga0070682_100078693 3300005337 Bacteria 2127
64 Ga0070682_100173860 3300005337 Bacteria 1499
65 Ga0070682_100229770 3300005337 Bacteria 1325
66 Ga0070682_100274649 3300005337 Bacteria 1226
67 Ga0068868_100037047 3300005338 Bacteria 3779
68 Ga0068868_100786187 3300005338 Bacteria 858
69 Ga0070660_100082402 3300005339 Bacteria 2526
70 Ga0070660_100139912 3300005339 Bacteria 1941
71 Ga0070660_100168006 3300005339 Bacteria 1770
72 Ga0070660_100281235 3300005339 Bacteria 1361
73 Ga0070689_100004487 3300005340 Bacteria 9440
74 Ga0070661_100024864 3300005344 Bacteria 4298
75 Ga0070661_100045487 3300005344 Bacteria 3209
76 Ga0070661_100054487 3300005344 Bacteria 2929
77 Ga0070661_100104467 3300005344 Bacteria 2110
78 Ga0070661_100122286 3300005344 Bacteria 1950
79 Ga0070661_100243738 3300005344 Bacteria 1385
80 Ga0070668_100193279 3300005347 Bacteria 1668
81 Ga0070668_100217428 3300005347 Bacteria 1574
82 Ga0070668_100396482 3300005347 Bacteria 1178
83 Ga0070673_100242715 3300005364 Bacteria 1567
84 Ga0070688_100883766 3300005365 Bacteria 704
85 Ga0070659_100003320 3300005366 Bacteria 11459
86 Ga0070659_100005797 3300005366 Bacteria 8894
87 Ga0070659_100169155 3300005366 Bacteria 1789
88 Ga0070659_100462548 3300005366 Bacteria 1077
89 Ga0070659_100577287 3300005366 Bacteria 964
90 Ga0070659_101063799 3300005366 Bacteria 712
91 Ga0070667_100000180 3300005367 Bacteria 77076
92 Ga0070667_100041334 3300005367 Bacteria 3868
93 Ga0070667_100082943 3300005367 Bacteria 2745
94 Ga0070667_100100606 3300005367 Bacteria 2497
95 Ga0070667_100135302 3300005367 Bacteria 2155
96 Ga0070667_100287219 3300005367 Bacteria 1478
97 Ga0070667_100586175 3300005367 Bacteria 1027
98 Ga0070667_100878523 3300005367 Bacteria 834
99 Ga0070714_100000528 3300005435 Bacteria 27622
100 Ga0070714_100006554 3300005435 Bacteria 9004
101 Ga0070710_10022125 3300005437 Bacteria 3322
102 Ga0070711_100152002 3300005439 Bacteria 1746
103 Ga0070694_100036484 3300005444 Bacteria 3257
104 Ga0070663_100001003 3300005455 Bacteria 15390
105 Ga0070663_100095804 3300005455 Bacteria 2206
106 Ga0070663_100098136 3300005455 Bacteria 2182
107 Ga0070663_100159801 3300005455 Bacteria 1734
108 Ga0070663_100435700 3300005455 Bacteria 1078
109 Ga0070662_100446501 3300005457 Bacteria 1073
110 Ga0070662_100613859 3300005457 Bacteria 915
111 Ga0070681_10001938 3300005458 Bacteria 18676
112 Ga0070681_10008924 3300005458 Bacteria 9854
113 Ga0070681_10032527 3300005458 Bacteria 5234
114 Ga0070681_10208587 3300005458 Bacteria 1870
115 Ga0070681_10280014 3300005458 Bacteria 1578
116 Ga0070685_10300721 3300005466 Bacteria 1081
117 Ga0070679_100058171 3300005530 Bacteria 3852
118 Ga0070679_100067990 3300005530 Bacteria 3554
119 Ga0070679_100239758 3300005530 Bacteria 1771
120 Ga0070679_100694970 3300005530 Unclassified 960
121 Ga0070684_100115300 3300005535 Bacteria 2412
122 Ga0068853_100007676 3300005539 Bacteria 8648
123 Ga0068853_100013355 3300005539 Bacteria 6704
124 Ga0068853_100015314 3300005539 Bacteria 6301
125 Ga0068853_100036094 3300005539 Bacteria 4201
126 Ga0068853_100036371 3300005539 Bacteria 4186
127 Ga0068853_100326142 3300005539 Bacteria 1424
128 Ga0068853_100486770 3300005539 Bacteria 1163
129 Ga0068853_100548992 3300005539 Bacteria 1094
130 Ga0068853_101235127 3300005539 Bacteria 722
131 Ga0070672_100269025 3300005543 Bacteria 1438
132 Ga0070696_100000939 3300005546 Bacteria 18891
133 Ga0070696_100001461 3300005546 Bacteria 15452
134 Ga0070696_100116198 3300005546 Bacteria 1932
135 Ga0070693_100009606 3300005547 Bacteria 4816
136 Ga0070693_100130664 3300005547 Bacteria 1569
137 Ga0070693_100288361 3300005547 Bacteria 1102
138 Ga0070693_100767953 3300005547 Bacteria 712
139 Ga0070665_100000062 3300005548 Bacteria 220304
140 Ga0070665_100018742 3300005548 Bacteria 6938
141 Ga0070665_100041675 3300005548 Bacteria 4616
142 Ga0070665_100057099 3300005548 Bacteria 3914
143 Ga0070665_100086618 3300005548 Bacteria 3138
144 Ga0070665_100111368 3300005548 Bacteria 2740
145 Ga0068855_100013349 3300005563 Bacteria 9909
146 Ga0068855_100029497 3300005563 Bacteria 6557
147 Ga0068855_100196665 3300005563 Bacteria 2271
148 Ga0068855_100549380 3300005563 Bacteria 1250
149 Ga0068855_100791577 3300005563 Bacteria 1008
150 Ga0068855_100932709 3300005563 Bacteria 915
151 Ga0070664_100203127 3300005564 Bacteria 1769
152 Ga0070664_100282309 3300005564 Bacteria 1497
153 Ga0070664_100419182 3300005564 Bacteria 1226
154 Ga0068857_100004673 3300005577 Bacteria 11601
155 Ga0068857_100023955 3300005577 Bacteria 5373
156 Ga0068857_100036253 3300005577 Bacteria 4370
157 Ga0068857_100039558 3300005577 Bacteria 4177
158 Ga0068857_100120486 3300005577 Bacteria 2362
159 Ga0068857_100149495 3300005577 Bacteria 2115
160 Ga0068857_100423311 3300005577 Bacteria 1242
161 Ga0068857_100533822 3300005577 Bacteria 1104
162 Ga0068854_100039734 3300005578 Bacteria 3316
163 Ga0068854_100050339 3300005578 Bacteria 2980
164 Ga0068856_100001449 3300005614 Bacteria 24884
165 Ga0068856_100003222 3300005614 Bacteria 16612
166 Ga0068856_100235000 3300005614 Bacteria 1848
167 Ga0068856_100268438 3300005614 Bacteria 1722
168 Ga0068856_100486909 3300005614 Bacteria 1254
169 Ga0068852_100020584 3300005616 Bacteria 5248
170 Ga0068852_100082075 3300005616 Bacteria 2863
171 Ga0068852_100107054 3300005616 Bacteria 2536
172 Ga0068852_100213935 3300005616 Bacteria 1830
173 Ga0068859_100003762 3300005617 Bacteria 15470
174 Ga0068859_100068360 3300005617 Bacteria 3587
175 Ga0068859_100127687 3300005617 Bacteria 2613
176 Ga0068859_100297205 3300005617 Bacteria 1708
177 Ga0068864_100037988 3300005618 Bacteria 4110
178 Ga0068866_10305878 3300005718 Bacteria 995
179 Ga0068861_100087560 3300005719 Bacteria 2451
180 Ga0068851_10085317 3300005834 Bacteria 1655
181 Ga0068851_10119350 3300005834 Bacteria 1415
182 Ga0068851_10466375 3300005834 Bacteria 753
183 Ga0068863_100010416 3300005841 Bacteria 9036
184 Ga0068863_100018621 3300005841 Bacteria 6643
185 Ga0068863_100264810 3300005841 Bacteria 1662
186 Ga0068863_100270434 3300005841 Bacteria 1645
187 Ga0068863_100477542 3300005841 Bacteria 1225
188 Ga0068858_100104492 3300005842 Bacteria 2643
189 Ga0068858_100364530 3300005842 Bacteria 1385
190 Ga0068858_100616166 3300005842 Bacteria 1053
191 Ga0068860_100016254 3300005843 Bacteria 7255
192 Ga0068860_100025004 3300005843 Bacteria 5766
193 Ga0068860_100066585 3300005843 Bacteria 3422
194 Ga0068860_100131914 3300005843 Bacteria 2398
195 Ga0068860_100349233 3300005843 Bacteria 1455
196 Ga0068860_101210222 3300005843 Bacteria 776
197 Ga0068860_101497191 3300005843 Bacteria 696
198 Ga0068862_100000214 3300005844 Bacteria 64702
199 Ga0068862_100113977 3300005844 Bacteria 2376
200 Ga0081540_1002208 3300005983 Bacteria 16074
201 Ga0070715_10114905 3300006163 Bacteria 1275
202 Ga0070712_100094322 3300006175 Bacteria 2199
203 Ga0097621_100088694 3300006237 Bacteria 2585
204 Ga0097621_100115404 3300006237 Bacteria 2273
205 Ga0097621_100427656 3300006237 Bacteria 1189
206 Ga0097621_100580498 3300006237 Bacteria 1023
207 Ga0068871_100018388 3300006358 Bacteria 5310
208 Ga0068871_100030975 3300006358 Bacteria 4215
209 Ga0068871_100054983 3300006358 Bacteria 3231
210 Ga0068871_100081002 3300006358 Bacteria 2689
211 Ga0068871_100497391 3300006358 Bacteria 1098
212 Ga0068865_100006181 3300006881 Bacteria 7302
213 Ga0097620_100003762 3300006931 Bacteria 15470
214 Ga0097620_100068360 3300006931 Bacteria 3587
215 Ga0097620_100127687 3300006931 Bacteria 2613
216 Ga0097620_100297206 3300006931 Bacteria 1708
217 Ga0105240_10000450 3300009093 Bacteria 75626
218 Ga0105240_10003424 3300009093 Bacteria 24649
219 Ga0105240_10014865 3300009093 Bacteria 10609
220 Ga0105240_10044895 3300009093 Bacteria 5610
221 Ga0105240_10612650 3300009093 Bacteria 1197
222 Ga0105245_10028285 3300009098 Bacteria 4943
223 Ga0105247_10037228 3300009101 Bacteria 2969
224 Ga0105243_10867021 3300009148 Bacteria 895
225 Ga0105241_10033340 3300009174 Bacteria 3866
226 Ga0105241_10127447 3300009174 Bacteria 2057
227 Ga0105241_10299673 3300009174 Bacteria 1379
228 Ga0105241_10443039 3300009174 Bacteria 1147
229 Ga0105241_10479464 3300009174 Bacteria 1105
230 Ga0105248_10000800 3300009177 Bacteria 35339
231 Ga0105248_10117041 3300009177 Bacteria 3006
232 Ga0105248_10140427 3300009177 Bacteria 2725
233 Ga0105237_10000023 3300009545 Bacteria 226144
234 Ga0105237_10000595 3300009545 Bacteria 50470
235 Ga0105237_10006056 3300009545 Bacteria 13526
236 Ga0105237_10054102 3300009545 Bacteria 4022
237 Ga0105237_10065006 3300009545 Bacteria 3644
238 Ga0105237_10137940 3300009545 Bacteria 2433
239 Ga0105237_10142402 3300009545 Bacteria 2392
240 Ga0105238_10005372 3300009551 Bacteria 12662
241 Ga0105238_10005997 3300009551 Bacteria 12051
242 Ga0105238_10006640 3300009551 Bacteria 11534
243 Ga0105238_10030736 3300009551 Bacteria 5467
244 Ga0105238_10167398 3300009551 Bacteria 2174
245 Ga0105238_10217253 3300009551 Bacteria 1888
246 Ga0105249_10006894 3300009553 Bacteria 9902
247 Ga0105249_10074773 3300009553 Bacteria 3137
248 Ga0105239_10000022 3300010375 Bacteria 257744
249 Ga0105239_10005808 3300010375 Bacteria 14395
250 Ga0105239_10030417 3300010375 Bacteria 5937
251 Ga0105239_10061115 3300010375 Bacteria 4135
252 Ga0105239_10070451 3300010375 Bacteria 3841
253 Ga0105239_10084962 3300010375 Bacteria 3487
254 Ga0105239_10179366 3300010375 Bacteria 2369
255 Ga0105239_10352118 3300010375 Bacteria 1663
256 Ga0105239_10406602 3300010375 Bacteria 1541
257 Ga0105239_10407897 3300010375 Bacteria 1538
258 Ga0105239_10421106 3300010375 Bacteria 1513
259 Ga0105239_10439555 3300010375 Bacteria 1479
260 Ga0105239_10467764 3300010375 Bacteria 1431
261 Ga0157314_1002322 3300012500 Bacteria 1318
262 Ga0157347_1003229 3300012502 Bacteria 1449
263 Ga0157373_10003463 3300013100 Bacteria 11936
264 Ga0157373_10741498 3300013100 Bacteria 722
265 Ga0157371_10005020 3300013102 Bacteria 11339
266 Ga0157371_10090527 3300013102 Bacteria 2167
267 Ga0157371_10178090 3300013102 Bacteria 1520
268 Ga0157371_10938154 3300013102 Bacteria 658
269 Ga0157370_10000204 3300013104 Bacteria 75030
270 Ga0157370_10010975 3300013104 Bacteria 9504
271 Ga0157370_10013955 3300013104 Bacteria 8250
272 Ga0157370_10020893 3300013104 Bacteria 6531
273 Ga0157370_10028735 3300013104 Bacteria 5467
274 Ga0157370_10281631 3300013104 Bacteria 1536
275 Ga0157370_10404224 3300013104 Bacteria 1257
276 Ga0157370_10602359 3300013104 Bacteria 1006
277 Ga0157369_10009962 3300013105 Bacteria 10857
278 Ga0157369_10059236 3300013105 Bacteria 4129
279 Ga0157369_10062234 3300013105 Bacteria 4022
280 Ga0157369_10126886 3300013105 Bacteria 2704
281 Ga0157369_10439166 3300013105 Bacteria 1352
282 Ga0157378_10000209 3300013297 Bacteria 56230
283 Ga0157378_10049496 3300013297 Bacteria 3739
284 Ga0157378_10159888 3300013297 Bacteria 2106
285 Ga0163162_10000003 3300013306 Bacteria 698280
286 Ga0163162_10000236 3300013306 Bacteria 50620
287 Ga0163162_10649439 3300013306 Bacteria 1179
288 Ga0157372_10008488 3300013307 Bacteria 10902
289 Ga0157372_10031789 3300013307 Bacteria 5782
290 Ga0157372_10037521 3300013307 Bacteria 5347
291 Ga0157372_10135157 3300013307 Bacteria 2839
292 Ga0157372_10217678 3300013307 Bacteria 2214
293 Ga0157372_10262190 3300013307 Bacteria 2007
294 Ga0157372_10366711 3300013307 Bacteria 1678
295 Ga0157375_10193497 3300013308 Bacteria 2189
296 Ga0163163_10000105 3300014325 Bacteria 89594
297 Ga0163163_10032965 3300014325 Bacteria 5007
298 Ga0163163_10062666 3300014325 Bacteria 3685
299 Ga0182008_10001033 3300014497 Bacteria 19349
300 Ga0182008_10102510 3300014497 Bacteria 1415
301 Ga0182008_10113685 3300014497 Bacteria 1342
302 Ga0182008_10284266 3300014497 Bacteria 862
303 Ga0157379_10005815 3300014968 Bacteria 10609
304 Ga0157379_10124504 3300014968 Bacteria 2319
305 Ga0157376_10003159 3300014969 Bacteria 11317
306 Ga0157376_10172184 3300014969 Bacteria 1972
307 Ga0182006_1000005 3300015261 Bacteria 621201
308 Ga0182006_1001892 3300015261 Bacteria 11944
309 Ga0182006_1052865 3300015261 Bacteria 1559
310 Ga0182007_10016330 3300015262 Bacteria 2741
311 Ga0182005_1000004 3300015265 Bacteria 609645
312 Ga0182005_1000611 3300015265 Bacteria 17260
313 Ga0182005_1006009 3300015265 Bacteria 3752
314 Ga0183369_1012 3300015685 Bacteria 251554
315 Ga0183368_1004 3300015687 Bacteria 1211761
316 Ga0163161_10094435 3300017792 Bacteria 2217
317 Ga0163161_10204772 3300017792 Bacteria 1522
318 Ga0197907_11318457 3300020069 Bacteria 1455
319 Ga0206356_10185075 3300020070 Bacteria 3556
320 Ga0206354_11193717 3300020081 Bacteria 1240
321 Ga0206353_11682619 3300020082 Bacteria 2150
322 Ga0154015_1034677 3300020610 Bacteria 1129
323 Ga0224712_10082087 3300022467 Bacteria 1333
324 Ga0209760_100998 3300025207 Bacteria 3359
325 Ga0209784_100047 3300025224 Bacteria 199596
326 Ga0209566_101849 3300025225 Bacteria 4787
327 Ga0209674_100016 3300025226 Bacteria 696756
328 Ga0209674_101250 3300025226 Bacteria 7157
329 Ga0209674_101491 3300025226 Bacteria 6101
330 Ga0209672_100237 3300025228 Bacteria 41924
331 Ga0209672_101254 3300025228 Bacteria 10148
332 Ga0209672_101809 3300025228 Bacteria 6527
333 Ga0209672_103717 3300025228 Bacteria 3052
334 Ga0207427_100023 3300025231 Bacteria 439725
335 Ga0207427_100040 3300025231 Bacteria 265135
336 Ga0207427_100115 3300025231 Bacteria 104282
337 Ga0207427_100130 3300025231 Bacteria 94510
338 Ga0207427_106386 3300025231 Bacteria 1499
339 Ga0209437_100015 3300025233 Bacteria 713457
340 Ga0209437_100020 3300025233 Bacteria 656374
341 Ga0209437_100079 3300025233 Bacteria 275948
342 Ga0209437_100172 3300025233 Bacteria 140146
343 Ga0209437_100276 3300025233 Bacteria 76094
344 Ga0209437_101299 3300025233 Bacteria 6702
345 Ga0209258_100043 3300025242 Bacteria 380685
346 Ga0209258_100246 3300025242 Bacteria 99606
347 Ga0209258_100335 3300025242 Bacteria 70307
348 Ga0209258_101024 3300025242 Bacteria 12600
349 Ga0209258_107872 3300025242 Bacteria 1544
350 Ga0209646_1000500 3300025246 Bacteria 18240
351 Ga0209646_1000913 3300025246 Bacteria 9526
352 Ga0209026_1000047 3300025250 Bacteria 261867
353 Ga0209026_1000105 3300025250 Bacteria 150738
354 Ga0209026_1000162 3300025250 Bacteria 102867
355 Ga0209026_1000640 3300025250 Bacteria 21592
356 Ga0209148_1000002 3300025254 Bacteria 2399500
357 Ga0209148_1000010 3300025254 Bacteria 1265567
358 Ga0209148_1000024 3300025254 Bacteria 669890
359 Ga0209148_1000307 3300025254 Bacteria 70291
360 Ga0209148_1002310 3300025254 Bacteria 6823
361 Ga0209759_1000318 3300025256 Bacteria 63865
362 Ga0209759_1000907 3300025256 Bacteria 22090
363 Ga0209759_1003785 3300025256 Bacteria 5895
364 Ga0209759_1005903 3300025256 Bacteria 4190
365 Ga0209759_1021278 3300025256 Bacteria 1481
366 Ga0209129_1000818 3300025258 Bacteria 19577
367 Ga0209129_1002610 3300025258 Bacteria 8597
368 Ga0209233_1000009 3300025261 Bacteria 1265567
369 Ga0209233_1000020 3300025261 Bacteria 798224
370 Ga0209233_1000108 3300025261 Bacteria 265137
371 Ga0209233_1000121 3300025261 Bacteria 233309
372 Ga0209233_1004909 3300025261 Bacteria 4498
373 Ga0209233_1022978 3300025261 Bacteria 1587
374 Ga0209233_1024645 3300025261 Bacteria 1501
375 Ga0209455_1000020 3300025272 Bacteria 702259
376 Ga0209455_1000025 3300025272 Bacteria 670673
377 Ga0209455_1000766 3300025272 Bacteria 18068
378 Ga0207673_1028407 3300025290 Bacteria 770
379 Ga0209758_1000959 3300025297 Bacteria 38968
380 Ga0209758_1017608 3300025297 Bacteria 3546
381 Ga0209256_1032037 3300025299 Bacteria 1430
382 Ga0207426_1012703 3300025302 Bacteria 3154
383 Ga0207426_1063397 3300025302 Bacteria 1055
384 Ga0209257_1063611 3300025304 Bacteria 995
385 Ga0207656_10002796 3300025321 Bacteria 5931
386 Ga0207692_10021865 3300025898 Bacteria 2934
387 Ga0207710_10420134 3300025900 Bacteria 688
388 Ga0207680_10000006 3300025903 Bacteria 635950
389 Ga0207680_10000982 3300025903 Bacteria 13441
390 Ga0207680_10011803 3300025903 Bacteria 4428
391 Ga0207680_10479187 3300025903 Bacteria 885
392 Ga0207647_10004661 3300025904 Bacteria 10156
393 Ga0207647_10008766 3300025904 Bacteria 7221
394 Ga0207647_10016388 3300025904 Bacteria 5058
395 Ga0207699_10413172 3300025906 Bacteria 963
396 Ga0207645_10065582 3300025907 Bacteria 2321
397 Ga0207705_10031658 3300025909 Bacteria 3777
398 Ga0207705_10121011 3300025909 Bacteria 1942
399 Ga0207705_10263522 3300025909 Bacteria 1316
400 Ga0207654_10000128 3300025911 Bacteria 49057
401 Ga0207654_10216000 3300025911 Bacteria 1269
402 Ga0207654_10593324 3300025911 Bacteria 790
403 Ga0207707_10007251 3300025912 Bacteria 9648
404 Ga0207707_10011138 3300025912 Bacteria 7822
405 Ga0207707_10011886 3300025912 Bacteria 7574
406 Ga0207707_10083765 3300025912 Unclassified 2784
407 Ga0207707_10091409 3300025912 Bacteria 2660
408 Ga0207707_10233153 3300025912 Bacteria 1601
409 Ga0207695_10000007 3300025913 Bacteria 1092551
410 Ga0207695_10000654 3300025913 Bacteria 68735
411 Ga0207695_10001750 3300025913 Bacteria 34466
412 Ga0207695_10008059 3300025913 Bacteria 13262
413 Ga0207695_10009244 3300025913 Bacteria 12214
414 Ga0207695_10048161 3300025913 Bacteria 4503
415 Ga0207695_10050583 3300025913 Bacteria 4370
416 Ga0207671_10000020 3300025914 Bacteria 309636
417 Ga0207671_10000033 3300025914 Bacteria 245869
418 Ga0207671_10000726 3300025914 Bacteria 41902
419 Ga0207671_10002123 3300025914 Bacteria 21636
420 Ga0207671_10006496 3300025914 Bacteria 10402
421 Ga0207671_10073102 3300025914 Bacteria 2560
422 Ga0207671_10283378 3300025914 Bacteria 1307
423 Ga0207671_10360662 3300025914 Bacteria 1153
424 Ga0207693_10419954 3300025915 Bacteria 1045
425 Ga0207663_10185899 3300025916 Bacteria 1488
426 Ga0207660_10135322 3300025917 Bacteria 1879
427 Ga0207660_10264362 3300025917 Bacteria 1361
428 Ga0207657_10053550 3300025919 Bacteria 3495
429 Ga0207657_10062726 3300025919 Bacteria 3181
430 Ga0207657_10068041 3300025919 Bacteria 3026
431 Ga0207657_10475617 3300025919 Bacteria 979
432 Ga0207657_10690757 3300025919 Bacteria 793
433 Ga0207649_10002389 3300025920 Bacteria 10531
434 Ga0207649_10037144 3300025920 Bacteria 2940
435 Ga0207649_10065674 3300025920 Bacteria 2298
436 Ga0207649_10236625 3300025920 Bacteria 1309
437 Ga0207649_10286398 3300025920 Bacteria 1200
438 Ga0207649_10345123 3300025920 Bacteria 1100
439 Ga0207649_10484425 3300025920 Bacteria 938
440 Ga0207652_10090542 3300025921 Bacteria 2688
441 Ga0207652_10114914 3300025921 Bacteria 2391
442 Ga0207652_10192770 3300025921 Bacteria 1833
443 Ga0207652_10873833 3300025921 Unclassified 795
444 Ga0207694_10007782 3300025924 Bacteria 8113
445 Ga0207694_10013442 3300025924 Bacteria 6166
446 Ga0207694_10033680 3300025924 Bacteria 3924
447 Ga0207694_10068549 3300025924 Bacteria 2770
448 Ga0207694_10076735 3300025924 Bacteria 2617
449 Ga0207694_10304410 3300025924 Bacteria 1313
450 Ga0207687_10013292 3300025927 Bacteria 5373
451 Ga0207700_10003865 3300025928 Bacteria 8752
452 Ga0207664_10000419 3300025929 Bacteria 30364
453 Ga0207664_10003176 3300025929 Bacteria 10917
454 Ga0207644_10301142 3300025931 Bacteria 1292
455 Ga0207690_10000314 3300025932 Bacteria 32801
456 Ga0207690_10000797 3300025932 Bacteria 20327
457 Ga0207690_10001245 3300025932 Bacteria 16100
458 Ga0207690_10005580 3300025932 Bacteria 7434
459 Ga0207690_10033829 3300025932 Bacteria 3289
460 Ga0207690_10037762 3300025932 Bacteria 3138
461 Ga0207690_10179906 3300025932 Bacteria 1591
462 Ga0207690_10973611 3300025932 Bacteria 705
463 Ga0207706_10072686 3300025933 Bacteria 3025
464 Ga0207706_10420039 3300025933 Bacteria 1158
465 Ga0207706_10712335 3300025933 Bacteria 857
466 Ga0207670_10028157 3300025936 Bacteria 3563
467 Ga0207704_10005277 3300025938 Bacteria 5954
468 Ga0207691_10062518 3300025940 Bacteria 3378
469 Ga0207711_10035009 3300025941 Bacteria 4254
470 Ga0207689_10418493 3300025942 Bacteria 1118
471 Ga0207689_10633505 3300025942 Bacteria 900
472 Ga0207689_10868561 3300025942 Bacteria 761
473 Ga0207679_10229411 3300025945 Bacteria 1567
474 Ga0207679_10331569 3300025945 Bacteria 1321
475 Ga0207667_10000130 3300025949 Bacteria 115321
476 Ga0207667_10002841 3300025949 Bacteria 21508
477 Ga0207667_10006239 3300025949 Bacteria 14468
478 Ga0207667_10006961 3300025949 Bacteria 13669
479 Ga0207667_10010499 3300025949 Bacteria 10821
480 Ga0207667_10206777 3300025949 Bacteria 2012
481 Ga0207667_10515755 3300025949 Bacteria 1211
482 Ga0207667_10718535 3300025949 Bacteria 1000
483 Ga0207667_10822867 3300025949 Bacteria 924
484 Ga0207712_10000336 3300025961 Bacteria 42617
485 Ga0207668_10365532 3300025972 Bacteria 1210
486 Ga0207640_10000434 3300025981 Bacteria 25494
487 Ga0207640_10000908 3300025981 Bacteria 16632
488 Ga0207640_10018008 3300025981 Bacteria 4144
489 Ga0207640_10052714 3300025981 Bacteria 2651
490 Ga0207640_10159214 3300025981 Bacteria 1668
491 Ga0207658_10000050 3300025986 Bacteria 129714
492 Ga0207658_10045710 3300025986 Bacteria 3193
493 Ga0207658_10075880 3300025986 Bacteria 2559
494 Ga0207658_10111658 3300025986 Bacteria 2162
495 Ga0207658_10242927 3300025986 Bacteria 1526
496 Ga0207658_10264976 3300025986 Bacteria 1466
497 Ga0207658_10682710 3300025986 Bacteria 927
498 Ga0207658_11075944 3300025986 Bacteria 734
499 Ga0207677_10502817 3300026023 Bacteria 1048
500 Ga0207703_10081573 3300026035 Bacteria 2697
501 Ga0207703_10723880 3300026035 Bacteria 947
502 Ga0207639_10002419 3300026041 Bacteria 12536
503 Ga0207639_10006393 3300026041 Bacteria 8004
504 Ga0207639_10008297 3300026041 Bacteria 7117
505 Ga0207639_10146578 3300026041 Bacteria 1972
506 Ga0207678_10000663 3300026067 Bacteria 31624
507 Ga0207678_10030133 3300026067 Bacteria 4737
508 Ga0207678_10062979 3300026067 Bacteria 3187
509 Ga0207678_10093446 3300026067 Bacteria 2570
510 Ga0207678_10154663 3300026067 Bacteria 1958
511 Ga0207678_10206492 3300026067 Bacteria 1680
512 Ga0207678_10293198 3300026067 Bacteria 1397
513 Ga0207678_10367915 3300026067 Bacteria 1241
514 Ga0207702_10000456 3300026078 Bacteria 46149
515 Ga0207702_10007594 3300026078 Bacteria 9229
516 Ga0207702_10176406 3300026078 Bacteria 1964
517 Ga0207702_10724066 3300026078 Bacteria 981
518 Ga0207641_10045365 3300026088 Bacteria 3701
519 Ga0207641_10088162 3300026088 Bacteria 2709
520 Ga0207641_10134040 3300026088 Bacteria 2227
521 Ga0207641_10177707 3300026088 Bacteria 1947
522 Ga0207648_10138452 3300026089 Bacteria 2145
523 Ga0207648_10865645 3300026089 Bacteria 843
524 Ga0207676_10038001 3300026095 Bacteria 3673
525 Ga0207676_10081877 3300026095 Bacteria 2624
526 Ga0207674_10000971 3300026116 Bacteria 37506
527 Ga0207674_10007254 3300026116 Bacteria 12927
528 Ga0207674_10009030 3300026116 Bacteria 11452
529 Ga0207674_10013654 3300026116 Bacteria 8995
530 Ga0207674_10072283 3300026116 Bacteria 3465
531 Ga0207674_10080018 3300026116 Bacteria 3271
532 Ga0207674_10144649 3300026116 Bacteria 2336
533 Ga0207674_10547967 3300026116 Bacteria 1117
534 Ga0207675_100120690 3300026118 Bacteria 2480
535 Ga0207683_10072794 3300026121 Bacteria 3039
536 Ga0207698_10030294 3300026142 Bacteria 3888
537 Ga0207698_10081310 3300026142 Bacteria 2615
538 Ga0207698_10182383 3300026142 Bacteria 1861
539 Ga0207698_10271479 3300026142 Bacteria 1564
540 Ga0207698_10765499 3300026142 Bacteria 965
541 Ga0268266_10000001 3300028379 Bacteria 4040580
542 Ga0268266_10000021 3300028379 Bacteria 522453
543 Ga0268266_10022097 3300028379 Bacteria 5423
544 Ga0268266_10028145 3300028379 Bacteria 4778
545 Ga0268266_10245055 3300028379 Bacteria 1655
546 Ga0268266_10681257 3300028379 Bacteria 990
547 Ga0268265_10000175 3300028380 Bacteria 76676
548 Ga0268265_10275169 3300028380 Bacteria 1504
549 Ga0268264_10023340 3300028381 Bacteria 5047
550 Ga0268264_10138543 3300028381 Bacteria 2167
551 Ga0268264_10138897 3300028381 Bacteria 2164
552 Ga0268264_10170663 3300028381 Bacteria 1967
553 Ga0316575_10014032 3300031665 Bacteria 3002
554 Ga0307413_10062876 3300031824 Bacteria 2299
555 Ga0307412_10056372 3300031911 Bacteria 2618
556 Ga0307507_10233868 3300033179 Bacteria 1214
557 Ga0307510_10036704 3300033180 Bacteria 5451
558 Ga0307510_10287535 3300033180 Bacteria 1111
559 Ga0395899_0019295 3300037312 Bacteria 5181
560 Ga0395899_0046593 3300037312 Bacteria 3229
561 Ga0395899_0760951 3300037312 Bacteria 602
562 Ga0395900_0000018 3300037418 Bacteria 363472
563 Ga0395900_0024507 3300037418 Bacteria 6178
564 Ga0395900_0071204 3300037418 Bacteria 3574
565 Ga0395898_0000213 3300037466 Bacteria 149036
566 Ga0395898_0003277 3300037466 Bacteria 18196
567 Ga0395898_0010007 3300037466 Bacteria 9929
568 Ga0395905_1047459 3300037471 Bacteria 719
569 Ga0395901_0000280 3300038443 Bacteria 63153
570 Ga0395901_0013263 3300038443 Bacteria 8369
571 Ga0395901_0065370 3300038443 Bacteria 3787
572 Ga0395901_0106492 3300038443 Bacteria 2943
573 Ga0395901_0242954 3300038443 Bacteria 1877
574 Ga0395901_1244728 3300038443 Bacteria 708
575 Ga0436365_0527005 3300039437 Bacteria 2970
576 Ga0439436_0000042 3300041404 Bacteria 39617
577 Ga0439465_0002276 3300041413 Bacteria 6306
578 Ga0451787_789512 3300041441 Bacteria 1312
579 Ga0451789_0188675 3300041443 Bacteria 1210
580 Ga0451789_0709532 3300041443 Bacteria 1371
581 Ga0451791_0481875 3300041451 Bacteria 799
582 Ga0451791_1376712 3300041451 Bacteria 1596
583 Ga0451793_0311790 3300041452 Bacteria 3193
584 Ga0451793_1541826 3300041452 Bacteria 696
585 Ga0451797_0275357 3300041453 Bacteria 1418
586 Ga0451797_0276813 3300041453 Bacteria 1715
587 Ga0451800_0619331 3300041459 Bacteria 795
588 Ga0451802_0264916 3300041460 Bacteria 7135
589 Ga0451802_0564149 3300041460 Bacteria 777
590 Ga0451804_0980518 3300041463 Bacteria 1213
591 Ga0451807_0469608 3300041486 Bacteria 1980
592 Ga0451807_2032690 3300041486 Bacteria 2790
593 Ga0451833_0880856 3300041491 Bacteria 862
594 Ga0451833_1325989 3300041491 Bacteria 1303
595 Ga0451837_0926139 3300041494 Bacteria 1565
596 Ga0451837_1815082 3300041494 Bacteria 1067
597 Ga0451849_0845794 3300041505 Bacteria 1007
598 Ga0451843_0063786 3300041509 Bacteria 829
599 Ga0451843_0142165 3300041509 Bacteria 1391
600 Ga0451853_2268669 3300041512 Bacteria 1787
601 Ga0439437_012635 3300042000 Bacteria 976
602 Ga0439445_0041112 3300042004 Bacteria 1228
603 Ga0439448_0068288 3300042005 Bacteria 1182
604 Ga0439455_0114900 3300042012 Bacteria 751
605 Ga0450908_000392 3300042184 Bacteria 8425
606 Ga0439459_0000410 3300042438 Bacteria 5436
607 Ga0466988_0050824 3300044536 Bacteria 2431
608 Ga0466969_0002538 3300044656 Bacteria 9755
609 Ga0466969_0013186 3300044656 Bacteria 4354
610 Ga0466969_0045770 3300044656 Bacteria 2171
611 Ga0466972_0002222 3300044658 Bacteria 9535
612 Ga0466972_0188953 3300044658 Bacteria 965
613 Ga0466989_0017210 3300044663 Bacteria 4086
614 Ga0466982_0000020 3300044672 Bacteria 99164
615 Ga0466982_0000196 3300044672 Bacteria 15881
616 Ga0466965_0113264 3300044683 Bacteria 1395
617 Ga0466966_0004856 3300044684 Bacteria 8843
618 Ga0466966_0009004 3300044684 Bacteria 6615
619 Ga0466966_0157211 3300044684 Bacteria 1384
620 Ga0466961_0008432 3300044693 Bacteria 6562
621 Ga0466961_0036384 3300044693 Bacteria 3160
622 Ga0466961_0053825 3300044693 Bacteria 2567
623 Ga0466961_0073664 3300044693 Bacteria 2165
624 Ga0466963_0065849 3300044694 Bacteria 2430
625 Ga0466963_0138018 3300044694 Bacteria 1688
626 Ga0466963_0243734 3300044694 Bacteria 1261
627 Ga0466971_0003916 3300044719 Bacteria 6385
628 Ga0466971_0004091 3300044719 Bacteria 6278
629 Ga0466968_0001991 3300044735 Bacteria 7422
630 Ga0466968_0003299 3300044735 Bacteria 5948
631 Ga0466970_0017240 3300044765 Bacteria 3730
632 Ga0466970_0023757 3300044765 Bacteria 3204
633 Ga0466970_0042853 3300044765 Bacteria 2407
634 Ga0466957_0002643 3300044842 Bacteria 9675
635 Ga0466957_0195597 3300044842 Bacteria 1326
636 Ga0466957_0355641 3300044842 Bacteria 994
637 Ga0466960_0237250 3300044901 Bacteria 1008
638 Ga0466959_0000164 3300045049 Bacteria 43915
639 Ga0466959_0057133 3300045049 Bacteria 2845
640 Ga0466959_0217674 3300045049 Bacteria 1325
641 Ga0466959_0408563 3300045049 Bacteria 922
642 Ga0466958_0010604 3300045836 Bacteria 5165
643 Ga0466958_0063353 3300045836 Bacteria 2255
644 Ga0466958_0223578 3300045836 Bacteria 1201
645 Ga0466958_0387053 3300045836 Bacteria 902
646 Ga0466967_0415555 3300045976 Bacteria 1310
647 Ga0495617_000016 3300046452 Bacteria 253600
648 Ga0495617_002329 3300046452 Bacteria 7633
649 Ga0495638_0000049 3300046460 Bacteria 206725
650 Ga0495638_0000063 3300046460 Bacteria 185733
651 Ga0495638_0000916 3300046460 Bacteria 30114
652 Ga0495638_0001592 3300046460 Bacteria 20319
653 Ga0495638_0029458 3300046460 Bacteria 3540
654 Ga0495650_0001052 3300046471 Bacteria 30673
655 Ga0495650_0001214 3300046471 Bacteria 27066
656 Ga0495650_0016165 3300046471 Bacteria 3791
657 Ga0495584_0047922 3300046491 Bacteria 2155
658 Ga0495585_0000007 3300046492 Bacteria 288113
659 Ga0495585_0002049 3300046492 Bacteria 14849
660 Ga0495607_0000003 3300046501 Bacteria 366900
661 Ga0495607_0000437 3300046501 Bacteria 42089
662 Ga0495607_0006648 3300046501 Bacteria 8105
663 Ga0495583_0017791 3300046506 Bacteria 3761
664 Ga0495606_0001000 3300046507 Bacteria 41217
665 Ga0495606_0001571 3300046507 Bacteria 29944
666 Ga0495606_0001761 3300046507 Bacteria 27728
667 Ga0495606_0012718 3300046507 Bacteria 6712
668 Ga0495606_0022014 3300046507 Bacteria 4658
669 Ga0495606_0029760 3300046507 Bacteria 3827
670 Ga0495606_0385282 3300046507 Bacteria 734
671 Ga0495610_0010317 3300046512 Bacteria 5816
672 Ga0495610_0016234 3300046512 Bacteria 4296
673 Ga0495616_0000001 3300046513 Bacteria 780061
674 Ga0495616_0065294 3300046513 Bacteria 1773
675 Ga0495620_0001003 3300046515 Bacteria 17446
676 Ga0495620_0005384 3300046515 Bacteria 7146
677 Ga0495631_0000065 3300046518 Bacteria 65356
678 Ga0495631_0000217 3300046518 Bacteria 39565
679 Ga0495632_0000011 3300046519 Bacteria 266804
680 Ga0495632_0000581 3300046519 Bacteria 33896
681 Ga0495632_0008388 3300046519 Bacteria 6348
682 Ga0495637_0006365 3300046520 Bacteria 5935
683 Ga0495643_0052286 3300046522 Bacteria 2194
684 Ga0495648_0002069 3300046524 Bacteria 18985
685 Ga0495648_0026344 3300046524 Bacteria 3916
686 Ga0495609_0026775 3300046538 Bacteria 2638
687 Ga0495622_0186885 3300046557 Bacteria 927
688 Ga0495622_0356848 3300046557 Bacteria 632
689 Ga0495668_0033645 3300046616 Bacteria 2878
690 Ga0495668_0059070 3300046616 Bacteria 2116
691 Ga0495611_0000001 3300046648 Bacteria 2628469
692 Ga0495611_0000068 3300046648 Bacteria 71983
693 Ga0495625_0000001 3300046660 Bacteria 1641829
694 Ga0495625_0037488 3300046660 Bacteria 3557
695 Ga0495625_0053013 3300046660 Bacteria 2903
696 Ga0495625_0056442 3300046660 Bacteria 2795
697 Ga0495661_0001999 3300046665 Bacteria 16088
698 Ga0495661_0050434 3300046665 Bacteria 2520
699 Ga0495670_0022794 3300046691 Bacteria 3092
700 Ga0495670_0054887 3300046691 Bacteria 1997
701 Ga0495671_0004638 3300046692 Bacteria 8148
702 Ga0495649_0000823 3300046694 Bacteria 24933
703 Ga0495649_0027338 3300046694 Bacteria 3166
704 Ga0495649_0036294 3300046694 Bacteria 2708
705 Ga0495589_0000016 3300046794 Bacteria 209027
706 Ga0495660_0000018 3300046810 Bacteria 317061
707 Ga0495660_0000294 3300046810 Bacteria 45736
708 Ga0495683_0005603 3300047323 Bacteria 6959
709 Ga0495679_000001 3300047446 Bacteria 1607568
710 Ga0495673_0000001 3300047469 Bacteria 1630730
711 Ga0495673_0000018 3300047469 Bacteria 569190
712 Ga0495673_0006286 3300047469 Bacteria 6998
713 Ga0495681_0068986 3300047470 Bacteria 1607
714 Ga0495686_0000037 3300047472 Bacteria 307937
715 Ga0495686_0003997 3300047472 Bacteria 12342
716 Ga0495686_0013479 3300047472 Bacteria 5668
717 Ga0495686_0033176 3300047472 Bacteria 3335
718 Ga0495686_0088850 3300047472 Bacteria 1878
719 Ga0495686_0123538 3300047472 Bacteria 1540
720 Ga0496100_0023006 3300048903 Bacteria 3779
721 Ga0496100_0450304 3300048903 Bacteria 987
722 Ga0496101_0306566 3300048904 Bacteria 1244
723 Ga0496103_0081894 3300048906 Bacteria 2031
724 Ga0496104_0243722 3300048907 Bacteria 1710
725 Ga0496105_0001964 3300048908 Bacteria 14781
726 Ga0496106_0010344 3300048909 Bacteria 6894
727 Ga0496107_0198853 3300048910 Bacteria 1490
728 Ga0496107_0390773 3300048910 Bacteria 1035
729 Ga0496113_0017059 3300048916 Bacteria 5032
730 Ga0496115_0000024 3300048918 Bacteria 154488
731 Ga0496115_0000103 3300048918 Bacteria 80518
732 Ga0496115_0011553 3300048918 Bacteria 6620
733 Ga0496115_0014517 3300048918 Bacteria 5963
734 Ga0496115_0108062 3300048918 Bacteria 2284
735 Ga0496115_0394882 3300048918 Bacteria 1123
736 Ga0496116_0165588 3300048919 Bacteria 1206
737 Ga0496117_0011428 3300048920 Bacteria 7954
738 Ga0496117_0044089 3300048920 Bacteria 3233
739 Ga0496117_0194571 3300048920 Bacteria 1151
740 Ga0496117_0299950 3300048920 Bacteria 851
741 Ga0496118_0000642 3300048921 Bacteria 57288
742 Ga0496118_0005395 3300048921 Bacteria 14551
743 Ga0496118_0006935 3300048921 Bacteria 12250
744 Ga0496118_0041512 3300048921 Bacteria 3641
745 Ga0496118_0051577 3300048921 Bacteria 3146
746 Ga0496118_0195442 3300048921 Bacteria 1205
747 Ga0496119_0001743 3300048922 Bacteria 25359
748 Ga0496119_0002432 3300048922 Bacteria 20445
749 Ga0496119_0046099 3300048922 Bacteria 2726
750 Ga0496119_0165912 3300048922 Bacteria 1170
751 Ga0496120_0000167 3300048923 Bacteria 110734
752 Ga0496120_0000868 3300048923 Bacteria 42806
753 Ga0496121_0000532 3300048924 Bacteria 72417
754 Ga0496121_0001002 3300048924 Bacteria 50506
755 Ga0496121_0001590 3300048924 Bacteria 37776
756 Ga0496121_0031746 3300048924 Bacteria 4818
757 Ga0496121_0055760 3300048924 Bacteria 3289
758 Ga0496121_0066930 3300048924 Bacteria 2914
759 Ga0496121_0067748 3300048924 Bacteria 2891
760 Ga0496121_0079741 3300048924 Bacteria 2598
761 Ga0496122_0000677 3300048925 Bacteria 68515
762 Ga0496122_0011204 3300048925 Bacteria 9121
763 Ga0496122_0012727 3300048925 Bacteria 8328
764 Ga0496123_0001221 3300048926 Bacteria 37471
765 Ga0496123_0012693 3300048926 Bacteria 7151
766 Ga0496124_0000840 3300048927 Bacteria 50101
767 Ga0496124_0000893 3300048927 Bacteria 48172
768 Ga0496125_0000344 3300048928 Bacteria 88380
769 Ga0496126_0000581 3300048929 Bacteria 69541
770 Ga0496126_0007111 3300048929 Bacteria 12330
771 Ga0496126_0023466 3300048929 Bacteria 5978
772 Ga0496126_0038848 3300048929 Bacteria 4424
773 Ga0496126_0146108 3300048929 Bacteria 2031
774 Ga0496126_0201315 3300048929 Bacteria 1681
775 Ga0496126_0360246 3300048929 Bacteria 1188
776 Ga0496126_0454696 3300048929 Bacteria 1030
777 Ga0496126_0677876 3300048929 Bacteria 803
778 Ga0495678_001288 3300049459 Bacteria 20269
779 Ga0495678_022417 3300049459 Bacteria 2761
780 Ga0495682_0000948 3300049460 Bacteria 17553
781 Ga0495682_0007665 3300049460 Bacteria 4283
782 Ga0501031_0009050 3300049568 Bacteria 6477
783 Ga0501031_0020009 3300049568 Bacteria 4363
784 Ga0501031_0032550 3300049568 Bacteria 3399
785 Ga0501031_0054292 3300049568 Bacteria 2611
786 Ga0501031_0106366 3300049568 Bacteria 1831
787 Ga0501031_0194942 3300049568 Bacteria 1322
788 Ga0501032_0000406 3300049569 Bacteria 35558
789 Ga0501032_0016880 3300049569 Bacteria 5131
790 Ga0501032_0069111 3300049569 Bacteria 2357
791 Ga0501032_0143104 3300049569 Bacteria 1574
792 Ga0501032_0201180 3300049569 Bacteria 1300
793 Ga0501032_0655579 3300049569 Bacteria 666
794 Ga0501033_0002545 3300049570 Bacteria 15427
795 Ga0501033_0003460 3300049570 Bacteria 12956
796 Ga0501033_0013310 3300049570 Bacteria 6268
797 Ga0501033_0013369 3300049570 Bacteria 6252
798 Ga0501033_0083095 3300049570 Bacteria 2347
799 Ga0501034_0002029 3300049571 Bacteria 25488
800 Ga0501034_0005630 3300049571 Bacteria 13643
801 Ga0501034_0037069 3300049571 Bacteria 4937
802 Ga0501034_0058066 3300049571 Bacteria 3889
803 Ga0501034_0112750 3300049571 Bacteria 2709
804 Ga0501034_0151738 3300049571 Bacteria 2292
805 Ga0501034_0380609 3300049571 Bacteria 1336
806 Ga0501034_0549958 3300049571 Bacteria 1064
807 Ga0501034_0702164 3300049571 Bacteria 910
808 Ga0501036_0022554 3300049572 Bacteria 5296
809 Ga0501036_0027253 3300049572 Bacteria 4827
810 Ga0501036_0040482 3300049572 Bacteria 3941
811 Ga0501036_0088867 3300049572 Bacteria 2611
812 Ga0501036_0128200 3300049572 Bacteria 2142
813 Ga0501036_0264937 3300049572 Bacteria 1439
814 Ga0501037_0001182 3300049573 Bacteria 19278
815 Ga0501037_0013005 3300049573 Bacteria 6134
816 Ga0501037_0015919 3300049573 Bacteria 5537
817 Ga0501037_0022201 3300049573 Bacteria 4695
818 Ga0501037_0042331 3300049573 Bacteria 3347
819 Ga0501037_0165561 3300049573 Bacteria 1574
820 Ga0501037_0363027 3300049573 Bacteria 997
821 Ga0501038_0000761 3300049574 Bacteria 28678
822 Ga0501038_0012150 3300049574 Bacteria 7863
823 Ga0501038_0016264 3300049574 Bacteria 6746
824 Ga0501038_0065173 3300049574 Bacteria 3104
825 Ga0501038_0086975 3300049574 Bacteria 2625
826 Ga0501038_0749371 3300049574 Bacteria 728
827 Ga0501039_0017008 3300049575 Bacteria 5574
828 Ga0501039_0121324 3300049575 Bacteria 2048
829 Ga0501039_0238317 3300049575 Bacteria 1430
830 Ga0501040_0032622 3300049576 Bacteria 3525
831 Ga0501042_0722478 3300049578 Bacteria 724
832 Ga0501043_0000788 3300049579 Bacteria 28179
833 Ga0501043_0011641 3300049579 Bacteria 6884
834 Ga0501043_0033296 3300049579 Bacteria 4054
835 Ga0501043_0058077 3300049579 Bacteria 3037
836 Ga0501043_0060006 3300049579 Bacteria 2985
837 Ga0501043_0088599 3300049579 Bacteria 2432
838 Ga0501043_0287472 3300049579 Bacteria 1259
839 Ga0501043_0401884 3300049579 Bacteria 1035
840 Ga0501046_0002185 3300049580 Bacteria 18466
841 Ga0501046_0010595 3300049580 Bacteria 7913
842 Ga0501046_0027099 3300049580 Bacteria 4679
843 Ga0501046_0032417 3300049580 Bacteria 4230
844 Ga0501046_0034740 3300049580 Bacteria 4066
845 Ga0501046_0035596 3300049580 Bacteria 4011
846 Ga0501046_0060050 3300049580 Bacteria 2976
847 Ga0501047_0003603 3300049581 Bacteria 14602
848 Ga0501047_0011160 3300049581 Bacteria 8503
849 Ga0501047_0016499 3300049581 Bacteria 7051
850 Ga0501047_0058885 3300049581 Bacteria 3710
851 Ga0501047_0147958 3300049581 Bacteria 2225
852 Ga0501047_0209588 3300049581 Bacteria 1807
853 Ga0501047_0237105 3300049581 Bacteria 1676
854 Ga0501047_0262474 3300049581 Bacteria 1574
855 Ga0501047_0262821 3300049581 Bacteria 1573
856 Ga0501047_0285146 3300049581 Bacteria 1495
857 Ga0501047_0304719 3300049581 Bacteria 1435
858 Ga0501047_0528304 3300049581 Bacteria 1005
859 Ga0501047_0665987 3300049581 Bacteria 859
860 Ga0501048_0259072 3300049582 Bacteria 1236
861 Ga0501048_0281690 3300049582 Bacteria 1182
862 Ga0501048_0340252 3300049582 Bacteria 1070
863 Ga0501067_0004312 3300049583 Bacteria 7837
864 Ga0501067_0203654 3300049583 Bacteria 1102
865 Ga0501068_0094431 3300049584 Bacteria 1849
866 Ga0501069_0013841 3300049585 Bacteria 4306
867 Ga0501069_0164842 3300049585 Bacteria 1277
868 Ga0501070_0021022 3300049586 Bacteria 5475
869 Ga0501070_0038908 3300049586 Bacteria 3968
870 Ga0501070_0063758 3300049586 Bacteria 3052
871 Ga0501070_0065891 3300049586 Bacteria 2999
872 Ga0501070_0133512 3300049586 Bacteria 2050
873 Ga0501070_0400005 3300049586 Bacteria 1111
874 Ga0501070_0441694 3300049586 Bacteria 1049
875 Ga0501070_0887112 3300049586 Bacteria 696
876 Ga0501071_0028619 3300049587 Bacteria 3928
877 Ga0501073_0001883 3300049589 Bacteria 15617
878 Ga0501073_0002262 3300049589 Bacteria 14399
879 Ga0501073_0050674 3300049589 Bacteria 2909
880 Ga0501073_0059868 3300049589 Bacteria 2658
881 Ga0501073_0070536 3300049589 Bacteria 2434
882 Ga0501073_0096445 3300049589 Bacteria 2053
883 Ga0501073_0112830 3300049589 Bacteria 1885
884 Ga0501073_0126204 3300049589 Bacteria 1774
885 Ga0501074_0039600 3300049590 Bacteria 3413
886 Ga0501074_0239875 3300049590 Bacteria 1289
887 Ga0501074_0293481 3300049590 Bacteria 1155
888 Ga0501075_0793260 3300049591 Bacteria 721
889 Ga0501076_0230212 3300049592 Bacteria 1515
890 Ga0501079_0053102 3300049741 Bacteria 3126
891 Ga0501080_0011069 3300049742 Bacteria 8255
892 Ga0501080_0021304 3300049742 Bacteria 6000
893 Ga0501080_0029025 3300049742 Bacteria 5149
894 Ga0501080_0069954 3300049742 Bacteria 3264
895 Ga0501080_0349009 3300049742 Bacteria 1336
896 Ga0501081_0062767 3300049743 Bacteria 2577
897 Ga0501083_0117491 3300049744 Bacteria 1745
898 Ga0501083_0207565 3300049744 Bacteria 1277
899 Ga0501035_0003118 3300049822 Bacteria 15929
900 Ga0501035_0005912 3300049822 Bacteria 11521
901 Ga0501035_0014669 3300049822 Bacteria 7234
902 Ga0501035_0025590 3300049822 Bacteria 5408
903 Ga0501035_0034049 3300049822 Bacteria 4630
904 Ga0501035_0054769 3300049822 Bacteria 3562
905 Ga0501035_0137734 3300049822 Bacteria 2124
906 Ga0501035_0142940 3300049822 Bacteria 2079
907 Ga0501035_0150069 3300049822 Bacteria 2023
908 Ga0501035_0351865 3300049822 Bacteria 1232
909 Ga0501035_0378738 3300049822 Bacteria 1180
910 Ga0501044_0001589 3300049823 Bacteria 26601
911 Ga0501044_0005237 3300049823 Bacteria 14426
912 Ga0501044_0014274 3300049823 Bacteria 8576
913 Ga0501044_0018671 3300049823 Bacteria 7427
914 Ga0501044_0020827 3300049823 Bacteria 6999
915 Ga0501044_0085461 3300049823 Bacteria 3188
916 Ga0501044_0142577 3300049823 Bacteria 2384
917 Ga0501044_0202879 3300049823 Bacteria 1940
918 Ga0501044_0207250 3300049823 Bacteria 1916
919 Ga0501044_0377379 3300049823 Bacteria 1333
920 Ga0501045_0006433 3300049824 Bacteria 8136
921 Ga0501045_0082489 3300049824 Bacteria 2371
922 nmdc:mga0sz30_99638_c1 3300050516 Bacteria 1269
923 Ga0500610_0011293 3300053079 Bacteria 4061
924 Ga0500643_000002 3300053087 Bacteria 1277657
925 Ga0500643_002177 3300053087 Bacteria 10371
926 Ga0500651_0000070 3300053093 Bacteria 67252
927 Ga0500651_0037958 3300053093 Bacteria 3035
928 Ga0500651_0078917 3300053093 Bacteria 2041
929 Ga0500555_011185 3300053103 Bacteria 2577
930 Ga0500597_000625 3300053120 Bacteria 7747
931 Ga0500559_0024736 3300053136 Bacteria 2556
932 Ga0500568_0000801 3300053139 Bacteria 22167
933 Ga0500645_003001 3300053730 Bacteria 7140
934 Ga0501084_0236355 3300054114 Bacteria 1542
935 Ga0501084_0242015 3300054114 Bacteria 1523
936 Ga0501084_0297444 3300054114 Bacteria 1363
937 Ga0501082_0000103 3300060353 Bacteria 66445
938 Ga0501082_0072168 3300060353 Bacteria 2973
939 Ga0501082_0113959 3300060353 Bacteria 2341
940 Ga0501082_0274491 3300060353 Bacteria 1467
941 Ga0466962_0002155 3300061719 Bacteria 9303
942 Ga0466962_0003389 3300061719 Bacteria 7588
943 Ga0466962_0003697 3300061719 Bacteria 7296
944 Ga0530510_0195282 3300061734 Bacteria 1503

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041491 Ga0451833_1325989 Ga0451833_1325989_743_1222 154
2 3300025290 Ga0207673_1028407 Ga0207673_10284071 155
3 3300041443 Ga0451789_0188675 Ga0451789_0188675_29_538 169
4 3300049574 Ga0501038_0749371 Ga0501038_0749371_199_714 171
5 3300025250 Ga0209026_1000640 Ga0209026_10006408 174
6 3300025256 Ga0209759_1000907 Ga0209759_100090711 174
7 iso_pu_bacteria 2919534386 2919537930 176
8 3300046501 Ga0495607_0000003 Ga0495607_0000003_70235_70810 179
9 iso_pu_bacteria 2537561836 2538832448 179
10 iso_pu_bacteria 2643221562 2643830494 179
11 iso_pu_bacteria 2895395659 2895398762 179
12 3300005458 Ga0070681_10001938 Ga0070681_1000193818 181
13 3300005530 Ga0070679_100694970 Ga0070679_1006949702 181
14 3300013307 Ga0157372_10262190 Ga0157372_102621901 181
15 3300025912 Ga0207707_10083765 Ga0207707_100837655 181
16 3300025921 Ga0207652_10873833 Ga0207652_108738332 181
17 iso_pu_bacteria 2643221577 2643894238 181
18 iso_pu_bacteria 2643221685 2644476440 181
19 3300010375 Ga0105239_10084962 Ga0105239_100849622 182
20 3300003320 rootH2_10026728 rootH2_1002672811 183
21 3300003323 rootH1_10198539 rootH1_101985392 183
22 3300005337 Ga0070682_100001592 Ga0070682_1000015925 183
23 3300005337 Ga0070682_100001976 Ga0070682_1000019765 183
24 3300005339 Ga0070660_100082402 Ga0070660_1000824023 183
25 3300005366 Ga0070659_100003320 Ga0070659_1000033206 183
26 3300005366 Ga0070659_100005797 Ga0070659_10000579710 183
27 3300005458 Ga0070681_10008924 Ga0070681_100089246 183
28 3300005530 Ga0070679_100239758 Ga0070679_1002397582 183
29 3300005539 Ga0068853_100007676 Ga0068853_1000076769 183
30 3300005546 Ga0070696_100116198 Ga0070696_1001161983 183
31 3300005577 Ga0068857_100039558 Ga0068857_1000395585 183
32 3300005577 Ga0068857_100120486 Ga0068857_1001204862 183
33 3300009551 Ga0105238_10005372 Ga0105238_100053727 183
34 3300013100 Ga0157373_10003463 Ga0157373_100034639 183
35 3300013102 Ga0157371_10005020 Ga0157371_100050208 183
36 3300013104 Ga0157370_10028735 Ga0157370_100287353 183
37 3300013307 Ga0157372_10031789 Ga0157372_100317895 183
38 3300025912 Ga0207707_10007251 Ga0207707_100072516 183
39 3300025919 Ga0207657_10475617 Ga0207657_104756171 183
40 3300025919 Ga0207657_10690757 Ga0207657_106907572 183
41 3300025921 Ga0207652_10192770 Ga0207652_101927703 183
42 3300025924 Ga0207694_10068549 Ga0207694_100685493 183
43 3300025932 Ga0207690_10001245 Ga0207690_100012456 183
44 3300025932 Ga0207690_10033829 Ga0207690_100338294 183
45 3300025949 Ga0207667_10006239 Ga0207667_100062399 183
46 3300026041 Ga0207639_10146578 Ga0207639_101465782 183
47 3300026116 Ga0207674_10144649 Ga0207674_101446493 183
48 3300049571 Ga0501034_0005630 Ga0501034_0005630_5213_5764 183
49 3300049572 Ga0501036_0264937 Ga0501036_0264937_644_1195 183
50 3300049573 Ga0501037_0015919 Ga0501037_0015919_2766_3317 183
51 3300049586 Ga0501070_0063758 Ga0501070_0063758_1339_1890 183
52 3300049822 Ga0501035_0005912 Ga0501035_0005912_8295_8846 183
53 3300049822 Ga0501035_0034049 Ga0501035_0034049_248_799 183
54 3300049823 Ga0501044_0014274 Ga0501044_0014274_4641_5192 183
55 iso_pu_bacteria 2939611941 2939612348 183
56 3300009148 Ga0105243_10867021 Ga0105243_108670212 184
57 3300013104 Ga0157370_10281631 Ga0157370_102816313 184
58 3300013307 Ga0157372_10008488 Ga0157372_1000848810 184
59 3300025911 Ga0207654_10000128 Ga0207654_1000012835 184
60 3300037312 Ga0395899_0019295 Ga0395899_0019295_899_1453 184
61 3300037312 Ga0395899_0046593 Ga0395899_0046593_24_578 184
62 3300037418 Ga0395900_0024507 Ga0395900_0024507_3623_4177 184
63 3300037466 Ga0395898_0003277 Ga0395898_0003277_10504_11058 184
64 3300037466 Ga0395898_0010007 Ga0395898_0010007_2726_3280 184
65 3300037471 Ga0395905_1047459 Ga0395905_1047459_83_637 184
66 3300038443 Ga0395901_0000280 Ga0395901_0000280_42762_43316 184
67 3300038443 Ga0395901_0065370 Ga0395901_0065370_1365_1919 184
68 3300049581 Ga0501047_0003603 Ga0501047_0003603_10792_11346 184
69 3300049586 Ga0501070_0021022 Ga0501070_0021022_1474_2028 184
70 iso_pu_bacteria 2739367700 2739730771 184
71 iso_pu_bacteria 2884411467 2884414402 184
72 iso_pu_bacteria 2928963466 2928964155 184
73 3300037418 Ga0395900_0000018 Ga0395900_0000018_182801_183358 185
74 3300038443 Ga0395901_0242954 Ga0395901_0242954_815_1372 185
75 3300044536 Ga0466988_0050824 Ga0466988_0050824_1641_2198 185
76 3300044656 Ga0466969_0002538 Ga0466969_0002538_8225_8782 185
77 3300044663 Ga0466989_0017210 Ga0466989_0017210_836_1393 185
78 3300044684 Ga0466966_0004856 Ga0466966_0004856_348_905 185
79 3300044693 Ga0466961_0008432 Ga0466961_0008432_5566_6123 185
80 3300044694 Ga0466963_0243734 Ga0466963_0243734_209_766 185
81 3300061719 Ga0466962_0003697 Ga0466962_0003697_5475_6032 185
82 iso_pu_bacteria 2593339238 2595446310 185
83 iso_pu_bacteria 2593339239 2595452254 185
84 iso_pu_bacteria 2687453130 2687582896 185
85 iso_pu_bacteria 2718218334 2721027250 185
86 iso_pu_bacteria 2734482264 2735837157 185
87 iso_pu_bacteria 2738543009 2739226617 185
88 iso_pu_bacteria 2818991440 2819562901 185
89 iso_pu_bacteria 2842914999 2842916606 185
90 iso_pu_bacteria 2842918807 2842919058 185
91 iso_pu_bacteria 2904463128 2904463513 185
92 iso_pu_bacteria 2919085039 2919085272 185
93 iso_pu_bacteria 2919404418 2919405595 185
94 iso_pu_bacteria 2953994433 2953994661 185
95 3300002705 JGI25156J39149_1000336 JGI25156J39149_100033619 186
96 3300002737 JGI25162J39368_1002391 JGI25162J39368_10023916 186
97 3300002738 JGI25154J39366_1019493 JGI25154J39366_10194931 186
98 3300002741 JGI25157J39369_1002084 JGI25157J39369_10020846 186
99 3300002772 JGI25164J39214_1000046 JGI25164J39214_100004663 186
100 3300003214 JGI25165J46597_1000096 JGI25165J46597_10000962 186
101 3300003214 JGI25165J46597_1000231 JGI25165J46597_100023164 186
102 3300003761 Ga0055535_1000752 Ga0055535_100075210 186
103 3300003761 Ga0055535_1001091 Ga0055535_100109114 186
104 3300003762 Ga0055542_1000477 Ga0055542_100047717 186
105 3300003762 Ga0055542_1000869 Ga0055542_100086916 186
106 3300003763 Ga0055529_1000454 Ga0055529_100045425 186
107 3300003763 Ga0055529_1005844 Ga0055529_10058442 186
108 3300005327 Ga0070658_10104750 Ga0070658_101047503 186
109 3300005329 Ga0070683_100295591 Ga0070683_1002955913 186
110 3300005334 Ga0068869_100937804 Ga0068869_1009378041 186
111 3300005335 Ga0070666_10005072 Ga0070666_100050729 186
112 3300005335 Ga0070666_10070275 Ga0070666_100702753 186
113 3300005337 Ga0070682_100078693 Ga0070682_1000786932 186
114 3300005337 Ga0070682_100229770 Ga0070682_1002297701 186
115 3300005338 Ga0068868_100786187 Ga0068868_1007861872 186
116 3300005339 Ga0070660_100281235 Ga0070660_1002812352 186
117 3300005344 Ga0070661_100045487 Ga0070661_1000454874 186
118 3300005344 Ga0070661_100122286 Ga0070661_1001222862 186
119 3300005344 Ga0070661_100243738 Ga0070661_1002437382 186
120 3300005365 Ga0070688_100883766 Ga0070688_1008837661 186
121 3300005366 Ga0070659_100169155 Ga0070659_1001691551 186
122 3300005367 Ga0070667_100041334 Ga0070667_1000413344 186
123 3300005367 Ga0070667_100586175 Ga0070667_1005861752 186
124 3300005367 Ga0070667_100878523 Ga0070667_1008785231 186
125 3300005455 Ga0070663_100159801 Ga0070663_1001598012 186
126 3300005455 Ga0070663_100435700 Ga0070663_1004357002 186
127 3300005458 Ga0070681_10280014 Ga0070681_102800142 186
128 3300005535 Ga0070684_100115300 Ga0070684_1001153004 186
129 3300005539 Ga0068853_100486770 Ga0068853_1004867701 186
130 3300005539 Ga0068853_100548992 Ga0068853_1005489921 186
131 3300005539 Ga0068853_101235127 Ga0068853_1012351272 186
132 3300005547 Ga0070693_100767953 Ga0070693_1007679531 186
133 3300005563 Ga0068855_100013349 Ga0068855_1000133492 186
134 3300005563 Ga0068855_100549380 Ga0068855_1005493802 186
135 3300005563 Ga0068855_100791577 Ga0068855_1007915772 186
136 3300005564 Ga0070664_100203127 Ga0070664_1002031273 186
137 3300005564 Ga0070664_100282309 Ga0070664_1002823092 186
138 3300005577 Ga0068857_100149495 Ga0068857_1001494952 186
139 3300005578 Ga0068854_100039734 Ga0068854_1000397342 186
140 3300005578 Ga0068854_100050339 Ga0068854_1000503393 186
141 3300005614 Ga0068856_100001449 Ga0068856_10000144920 186
142 3300005614 Ga0068856_100003222 Ga0068856_10000322213 186
143 3300005614 Ga0068856_100235000 Ga0068856_1002350007 186
144 3300005614 Ga0068856_100486909 Ga0068856_1004869093 186
145 3300005616 Ga0068852_100082075 Ga0068852_1000820752 186
146 3300005616 Ga0068852_100107054 Ga0068852_1001070543 186
147 3300005616 Ga0068852_100213935 Ga0068852_1002139352 186
148 3300005617 Ga0068859_100068360 Ga0068859_1000683601 186
149 3300005617 Ga0068859_100127687 Ga0068859_1001276873 186
150 3300005617 Ga0068859_100297205 Ga0068859_1002972052 186
151 3300005618 Ga0068864_100037988 Ga0068864_1000379884 186
152 3300005834 Ga0068851_10119350 Ga0068851_101193503 186
153 3300005841 Ga0068863_100018621 Ga0068863_1000186215 186
154 3300005841 Ga0068863_100270434 Ga0068863_1002704342 186
155 3300005842 Ga0068858_100616166 Ga0068858_1006161662 186
156 3300005843 Ga0068860_100025004 Ga0068860_1000250049 186
157 3300005843 Ga0068860_100131914 Ga0068860_1001319142 186
158 3300006175 Ga0070712_100094322 Ga0070712_1000943224 186
159 3300006237 Ga0097621_100088694 Ga0097621_1000886943 186
160 3300006358 Ga0068871_100018388 Ga0068871_1000183884 186
161 3300006931 Ga0097620_100068360 Ga0097620_1000683605 186
162 3300006931 Ga0097620_100127687 Ga0097620_1001276873 186
163 3300006931 Ga0097620_100297206 Ga0097620_1002972062 186
164 3300009093 Ga0105240_10000450 Ga0105240_1000045047 186
165 3300009093 Ga0105240_10044895 Ga0105240_100448956 186
166 3300009093 Ga0105240_10612650 Ga0105240_106126502 186
167 3300009098 Ga0105245_10028285 Ga0105245_100282857 186
168 3300009174 Ga0105241_10033340 Ga0105241_100333406 186
169 3300009174 Ga0105241_10299673 Ga0105241_102996732 186
170 3300009177 Ga0105248_10117041 Ga0105248_101170412 186
171 3300009545 Ga0105237_10000595 Ga0105237_100005954 186
172 3300009545 Ga0105237_10054102 Ga0105237_100541029 186
173 3300009551 Ga0105238_10005997 Ga0105238_100059972 186
174 3300009551 Ga0105238_10030736 Ga0105238_100307364 186
175 3300009551 Ga0105238_10217253 Ga0105238_102172532 186
176 3300010375 Ga0105239_10352118 Ga0105239_103521183 186
177 3300010375 Ga0105239_10406602 Ga0105239_104066022 186
178 3300010375 Ga0105239_10421106 Ga0105239_104211062 186
179 3300010375 Ga0105239_10439555 Ga0105239_104395552 186
180 3300010375 Ga0105239_10467764 Ga0105239_104677642 186
181 3300013100 Ga0157373_10741498 Ga0157373_107414981 186
182 3300013102 Ga0157371_10090527 Ga0157371_100905273 186
183 3300013102 Ga0157371_10178090 Ga0157371_101780902 186
184 3300013104 Ga0157370_10010975 Ga0157370_100109753 186
185 3300013104 Ga0157370_10020893 Ga0157370_100208936 186
186 3300013104 Ga0157370_10404224 Ga0157370_104042244 186
187 3300013105 Ga0157369_10009962 Ga0157369_100099627 186
188 3300013105 Ga0157369_10059236 Ga0157369_100592364 186
189 3300013105 Ga0157369_10062234 Ga0157369_100622345 186
190 3300013297 Ga0157378_10000209 Ga0157378_1000020926 186
191 3300013297 Ga0157378_10049496 Ga0157378_100494964 186
192 3300013297 Ga0157378_10159888 Ga0157378_101598883 186
193 3300013306 Ga0163162_10000003 Ga0163162_10000003293 186
194 3300013307 Ga0157372_10135157 Ga0157372_101351578 186
195 3300013308 Ga0157375_10193497 Ga0157375_101934972 186
196 3300014325 Ga0163163_10000105 Ga0163163_1000010571 186
197 3300014325 Ga0163163_10032965 Ga0163163_100329654 186
198 3300014497 Ga0182008_10102510 Ga0182008_101025102 186
199 3300014968 Ga0157379_10005815 Ga0157379_1000581510 186
200 3300014969 Ga0157376_10172184 Ga0157376_101721842 186
201 3300020069 Ga0197907_11318457 Ga0197907_113184572 186
202 3300020070 Ga0206356_10185075 Ga0206356_101850752 186
203 3300020081 Ga0206354_11193717 Ga0206354_111937171 186
204 3300020082 Ga0206353_11682619 Ga0206353_116826194 186
205 3300020610 Ga0154015_1034677 Ga0154015_10346772 186
206 3300025228 Ga0209672_100237 Ga0209672_10023723 186
207 3300025228 Ga0209672_101809 Ga0209672_1018095 186
208 3300025231 Ga0207427_100040 Ga0207427_10004060 186
209 3300025233 Ga0209437_100172 Ga0209437_10017260 186
210 3300025242 Ga0209258_100246 Ga0209258_10024620 186
211 3300025242 Ga0209258_100335 Ga0209258_10033545 186
212 3300025246 Ga0209646_1000500 Ga0209646_100050015 186
213 3300025250 Ga0209026_1000162 Ga0209026_10001624 186
214 3300025254 Ga0209148_1000024 Ga0209148_1000024512 186
215 3300025254 Ga0209148_1000307 Ga0209148_100030744 186
216 3300025256 Ga0209759_1005903 Ga0209759_10059034 186
217 3300025261 Ga0209233_1000108 Ga0209233_1000108166 186
218 3300025272 Ga0209455_1000025 Ga0209455_1000025512 186
219 3300025272 Ga0209455_1000766 Ga0209455_100076614 186
220 3300025903 Ga0207680_10000982 Ga0207680_100009824 186
221 3300025903 Ga0207680_10479187 Ga0207680_104791872 186
222 3300025904 Ga0207647_10008766 Ga0207647_1000876610 186
223 3300025906 Ga0207699_10413172 Ga0207699_104131721 186
224 3300025911 Ga0207654_10593324 Ga0207654_105933241 186
225 3300025912 Ga0207707_10091409 Ga0207707_100914092 186
226 3300025913 Ga0207695_10000007 Ga0207695_10000007756 186
227 3300025913 Ga0207695_10001750 Ga0207695_100017504 186
228 3300025913 Ga0207695_10009244 Ga0207695_100092449 186
229 3300025913 Ga0207695_10048161 Ga0207695_100481612 186
230 3300025914 Ga0207671_10000726 Ga0207671_1000072624 186
231 3300025914 Ga0207671_10002123 Ga0207671_100021235 186
232 3300025914 Ga0207671_10283378 Ga0207671_102833782 186
233 3300025919 Ga0207657_10062726 Ga0207657_100627264 186
234 3300025920 Ga0207649_10002389 Ga0207649_100023895 186
235 3300025920 Ga0207649_10236625 Ga0207649_102366252 186
236 3300025920 Ga0207649_10484425 Ga0207649_104844252 186
237 3300025924 Ga0207694_10007782 Ga0207694_1000778213 186
238 3300025924 Ga0207694_10033680 Ga0207694_100336804 186
239 3300025927 Ga0207687_10013292 Ga0207687_100132926 186
240 3300025932 Ga0207690_10179906 Ga0207690_101799063 186
241 3300025933 Ga0207706_10420039 Ga0207706_104200392 186
242 3300025942 Ga0207689_10868561 Ga0207689_108685611 186
243 3300025945 Ga0207679_10229411 Ga0207679_102294112 186
244 3300025945 Ga0207679_10331569 Ga0207679_103315692 186
245 3300025949 Ga0207667_10010499 Ga0207667_1001049920 186
246 3300025949 Ga0207667_10822867 Ga0207667_108228672 186
247 3300025981 Ga0207640_10018008 Ga0207640_100180084 186
248 3300025981 Ga0207640_10052714 Ga0207640_100527142 186
249 3300025986 Ga0207658_10242927 Ga0207658_102429272 186
250 3300026041 Ga0207639_10002419 Ga0207639_1000241913 186
251 3300026067 Ga0207678_10030133 Ga0207678_100301334 186
252 3300026067 Ga0207678_10206492 Ga0207678_102064922 186
253 3300026067 Ga0207678_10293198 Ga0207678_102931982 186
254 3300026078 Ga0207702_10000456 Ga0207702_1000045630 186
255 3300026078 Ga0207702_10007594 Ga0207702_100075948 186
256 3300026078 Ga0207702_10176406 Ga0207702_101764062 186
257 3300026088 Ga0207641_10134040 Ga0207641_101340403 186
258 3300026088 Ga0207641_10177707 Ga0207641_101777072 186
259 3300026095 Ga0207676_10038001 Ga0207676_100380017 186
260 3300026116 Ga0207674_10007254 Ga0207674_1000725414 186
261 3300026142 Ga0207698_10030294 Ga0207698_100302947 186
262 3300026142 Ga0207698_10081310 Ga0207698_100813103 186
263 3300026142 Ga0207698_10182383 Ga0207698_101823833 186
264 3300028381 Ga0268264_10138543 Ga0268264_101385432 186
265 3300028381 Ga0268264_10138897 Ga0268264_101388972 186
266 3300037312 Ga0395899_0760951 Ga0395899_0760951_15_575 186
267 3300037466 Ga0395898_0000213 Ga0395898_0000213_45909_46469 186
268 3300038443 Ga0395901_1244728 Ga0395901_1244728_98_658 186
269 3300039437 Ga0436365_0527005 Ga0436365_0527005_490_1050 186
270 3300044656 Ga0466969_0013186 Ga0466969_0013186_2400_2960 186
271 3300044684 Ga0466966_0157211 Ga0466966_0157211_623_1183 186
272 3300044693 Ga0466961_0036384 Ga0466961_0036384_1584_2144 186
273 3300044693 Ga0466961_0053825 Ga0466961_0053825_357_917 186
274 3300044693 Ga0466961_0073664 Ga0466961_0073664_202_762 186
275 3300044694 Ga0466963_0065849 Ga0466963_0065849_394_954 186
276 3300044694 Ga0466963_0138018 Ga0466963_0138018_974_1534 186
277 3300044719 Ga0466971_0003916 Ga0466971_0003916_4008_4568 186
278 3300044765 Ga0466970_0042853 Ga0466970_0042853_816_1376 186
279 3300044842 Ga0466957_0002643 Ga0466957_0002643_6244_6804 186
280 3300044842 Ga0466957_0355641 Ga0466957_0355641_294_854 186
281 3300045049 Ga0466959_0000164 Ga0466959_0000164_23540_24100 186
282 3300045049 Ga0466959_0057133 Ga0466959_0057133_2094_2654 186
283 3300045049 Ga0466959_0408563 Ga0466959_0408563_226_786 186
284 3300045836 Ga0466958_0010604 Ga0466958_0010604_969_1529 186
285 3300045836 Ga0466958_0063353 Ga0466958_0063353_1356_1916 186
286 3300045836 Ga0466958_0223578 Ga0466958_0223578_546_1106 186
287 3300045976 Ga0466967_0415555 Ga0466967_0415555_164_724 186
288 3300048906 Ga0496103_0081894 Ga0496103_0081894_333_893 186
289 3300048920 Ga0496117_0194571 Ga0496117_0194571_121_681 186
290 3300048921 Ga0496118_0051577 Ga0496118_0051577_530_1090 186
291 3300048929 Ga0496126_0146108 Ga0496126_0146108_753_1313 186
292 3300049568 Ga0501031_0020009 Ga0501031_0020009_245_805 186
293 3300049568 Ga0501031_0106366 Ga0501031_0106366_759_1319 186
294 3300049568 Ga0501031_0194942 Ga0501031_0194942_61_621 186
295 3300049569 Ga0501032_0069111 Ga0501032_0069111_641_1201 186
296 3300049569 Ga0501032_0655579 Ga0501032_0655579_90_650 186
297 3300049570 Ga0501033_0002545 Ga0501033_0002545_6758_7318 186
298 3300049570 Ga0501033_0013310 Ga0501033_0013310_3287_3847 186
299 3300049571 Ga0501034_0112750 Ga0501034_0112750_731_1291 186
300 3300049571 Ga0501034_0380609 Ga0501034_0380609_42_602 186
301 3300049572 Ga0501036_0128200 Ga0501036_0128200_568_1128 186
302 3300049573 Ga0501037_0022201 Ga0501037_0022201_1965_2525 186
303 3300049573 Ga0501037_0042331 Ga0501037_0042331_2104_2664 186
304 3300049574 Ga0501038_0065173 Ga0501038_0065173_2305_2865 186
305 3300049574 Ga0501038_0086975 Ga0501038_0086975_1298_1858 186
306 3300049575 Ga0501039_0238317 Ga0501039_0238317_17_577 186
307 3300049579 Ga0501043_0011641 Ga0501043_0011641_3630_4190 186
308 3300049579 Ga0501043_0060006 Ga0501043_0060006_1278_1838 186
309 3300049580 Ga0501046_0027099 Ga0501046_0027099_3300_3860 186
310 3300049580 Ga0501046_0032417 Ga0501046_0032417_2470_3030 186
311 3300049581 Ga0501047_0058885 Ga0501047_0058885_2212_2772 186
312 3300049581 Ga0501047_0237105 Ga0501047_0237105_15_575 186
313 3300049581 Ga0501047_0285146 Ga0501047_0285146_415_975 186
314 3300049822 Ga0501035_0054769 Ga0501035_0054769_882_1442 186
315 3300049822 Ga0501035_0137734 Ga0501035_0137734_1014_1574 186
316 3300049822 Ga0501035_0351865 Ga0501035_0351865_580_1140 186
317 3300049823 Ga0501044_0020827 Ga0501044_0020827_5558_6118 186
318 3300049823 Ga0501044_0207250 Ga0501044_0207250_152_712 186
319 3300049824 Ga0501045_0082489 Ga0501045_0082489_1454_2014 186
320 3300061719 Ga0466962_0002155 Ga0466962_0002155_4824_5384 186
321 3300002737 JGI25162J39368_1000395 JGI25162J39368_10003955 187
322 3300002737 JGI25162J39368_1002286 JGI25162J39368_10022868 187
323 3300002741 JGI25157J39369_1004062 JGI25157J39369_10040623 187
324 3300002772 JGI25164J39214_1000338 JGI25164J39214_10003385 187
325 3300002772 JGI25164J39214_1000416 JGI25164J39214_10004165 187
326 3300003214 JGI25165J46597_1000513 JGI25165J46597_100051337 187
327 3300005336 Ga0070680_100243790 Ga0070680_1002437902 187
328 3300005337 Ga0070682_100274649 Ga0070682_1002746492 187
329 3300005339 Ga0070660_100139912 Ga0070660_1001399121 187
330 3300005339 Ga0070660_100168006 Ga0070660_1001680062 187
331 3300005344 Ga0070661_100024864 Ga0070661_1000248642 187
332 3300005366 Ga0070659_100462548 Ga0070659_1004625481 187
333 3300005366 Ga0070659_100577287 Ga0070659_1005772872 187
334 3300005435 Ga0070714_100000528 Ga0070714_10000052825 187
335 3300005435 Ga0070714_100006554 Ga0070714_1000065543 187
336 3300005437 Ga0070710_10022125 Ga0070710_100221253 187
337 3300005444 Ga0070694_100036484 Ga0070694_1000364842 187
338 3300005457 Ga0070662_100613859 Ga0070662_1006138592 187
339 3300005458 Ga0070681_10032527 Ga0070681_100325275 187
340 3300005458 Ga0070681_10208587 Ga0070681_102085873 187
341 3300005530 Ga0070679_100058171 Ga0070679_1000581713 187
342 3300005530 Ga0070679_100067990 Ga0070679_1000679903 187
343 3300005546 Ga0070696_100000939 Ga0070696_1000009393 187
344 3300005546 Ga0070696_100001461 Ga0070696_10000146115 187
345 3300005547 Ga0070693_100009606 Ga0070693_1000096063 187
346 3300005547 Ga0070693_100288361 Ga0070693_1002883611 187
347 3300005577 Ga0068857_100023955 Ga0068857_1000239554 187
348 3300009545 Ga0105237_10142402 Ga0105237_101424022 187
349 3300009551 Ga0105238_10167398 Ga0105238_101673983 187
350 3300010375 Ga0105239_10179366 Ga0105239_101793662 187
351 3300013102 Ga0157371_10938154 Ga0157371_109381542 187
352 3300013104 Ga0157370_10013955 Ga0157370_100139559 187
353 3300013307 Ga0157372_10037521 Ga0157372_100375215 187
354 3300014497 Ga0182008_10113685 Ga0182008_101136852 187
355 3300015261 Ga0182006_1052865 Ga0182006_10528652 187
356 3300015262 Ga0182007_10016330 Ga0182007_100163303 187
357 3300017792 Ga0163161_10204772 Ga0163161_102047722 187
358 3300025226 Ga0209674_101491 Ga0209674_1014913 187
359 3300025231 Ga0207427_100115 Ga0207427_10011557 187
360 3300025231 Ga0207427_100130 Ga0207427_10013056 187
361 3300025233 Ga0209437_100020 Ga0209437_100020199 187
362 3300025233 Ga0209437_100079 Ga0209437_100079217 187
363 3300025242 Ga0209258_107872 Ga0209258_1078722 187
364 3300025250 Ga0209026_1000105 Ga0209026_100010580 187
365 3300025256 Ga0209759_1003785 Ga0209759_10037852 187
366 3300025261 Ga0209233_1000020 Ga0209233_1000020426 187
367 3300025261 Ga0209233_1000121 Ga0209233_1000121174 187
368 3300025261 Ga0209233_1024645 Ga0209233_10246452 187
369 3300025898 Ga0207692_10021865 Ga0207692_100218652 187
370 3300025904 Ga0207647_10016388 Ga0207647_100163886 187
371 3300025909 Ga0207705_10121011 Ga0207705_101210112 187
372 3300025912 Ga0207707_10011138 Ga0207707_100111384 187
373 3300025912 Ga0207707_10011886 Ga0207707_100118864 187
374 3300025915 Ga0207693_10419954 Ga0207693_104199542 187
375 3300025917 Ga0207660_10135322 Ga0207660_101353222 187
376 3300025917 Ga0207660_10264362 Ga0207660_102643622 187
377 3300025919 Ga0207657_10053550 Ga0207657_100535505 187
378 3300025919 Ga0207657_10068041 Ga0207657_100680414 187
379 3300025921 Ga0207652_10090542 Ga0207652_100905421 187
380 3300025921 Ga0207652_10114914 Ga0207652_101149143 187
381 3300025924 Ga0207694_10076735 Ga0207694_100767354 187
382 3300025928 Ga0207700_10003865 Ga0207700_100038654 187
383 3300025929 Ga0207664_10000419 Ga0207664_100004198 187
384 3300025929 Ga0207664_10003176 Ga0207664_1000317610 187
385 3300025932 Ga0207690_10000314 Ga0207690_100003148 187
386 3300025932 Ga0207690_10000797 Ga0207690_1000079722 187
387 3300025932 Ga0207690_10005580 Ga0207690_100055806 187
388 3300025932 Ga0207690_10037762 Ga0207690_100377623 187
389 3300025933 Ga0207706_10072686 Ga0207706_100726863 187
390 3300025949 Ga0207667_10515755 Ga0207667_105157552 187
391 3300026116 Ga0207674_10013654 Ga0207674_100136544 187
392 3300031665 Ga0316575_10014032 Ga0316575_100140322 187
393 3300038443 Ga0395901_0106492 Ga0395901_0106492_1009_1572 187
394 3300042000 Ga0439437_012635 Ga0439437_012635_339_902 187
395 3300042012 Ga0439455_0114900 Ga0439455_0114900_155_718 187
396 3300048903 Ga0496100_0023006 Ga0496100_0023006_2776_3345 187
397 3300048920 Ga0496117_0011428 Ga0496117_0011428_3788_4354 187
398 3300048921 Ga0496118_0000642 Ga0496118_0000642_7966_8532 187
399 3300048924 Ga0496121_0066930 Ga0496121_0066930_270_836 187
400 3300048925 Ga0496122_0012727 Ga0496122_0012727_5162_5731 187
401 3300049581 Ga0501047_0665987 Ga0501047_0665987_243_806 187
402 3300049582 Ga0501048_0340252 Ga0501048_0340252_494_1057 187
403 3300053093 Ga0500651_0037958 Ga0500651_0037958_461_1024 187
404 3300002737 JGI25162J39368_1000684 JGI25162J39368_100068424 188
405 3300002737 JGI25162J39368_1001837 JGI25162J39368_10018379 188
406 3300002741 JGI25157J39369_1000081 JGI25157J39369_100008156 188
407 3300002771 JGI25163J39215_1001484 JGI25163J39215_10014844 188
408 3300002772 JGI25164J39214_1000028 JGI25164J39214_100002826 188
409 3300003214 JGI25165J46597_1000108 JGI25165J46597_100010826 188
410 3300003322 rootL2_10225786 rootL2_102257861 188
411 3300003751 Ga0055538_1001267 Ga0055538_10012675 188
412 3300003756 Ga0055533_1000667 Ga0055533_10006676 188
413 3300003761 Ga0055535_1000771 Ga0055535_100077124 188
414 3300003762 Ga0055542_1000772 Ga0055542_10007724 188
415 3300003762 Ga0055542_1000787 Ga0055542_10007874 188
416 3300003763 Ga0055529_1000078 Ga0055529_100007826 188
417 3300005328 Ga0070676_10095321 Ga0070676_100953212 188
418 3300005329 Ga0070683_100343365 Ga0070683_1003433652 188
419 3300005334 Ga0068869_100717244 Ga0068869_1007172442 188
420 3300005337 Ga0070682_100173860 Ga0070682_1001738602 188
421 3300005338 Ga0068868_100037047 Ga0068868_1000370472 188
422 3300005340 Ga0070689_100004487 Ga0070689_1000044876 188
423 3300005344 Ga0070661_100104467 Ga0070661_1001044672 188
424 3300005347 Ga0070668_100217428 Ga0070668_1002174282 188
425 3300005347 Ga0070668_100396482 Ga0070668_1003964822 188
426 3300005364 Ga0070673_100242715 Ga0070673_1002427152 188
427 3300005366 Ga0070659_101063799 Ga0070659_1010637992 188
428 3300005367 Ga0070667_100000180 Ga0070667_10000018010 188
429 3300005367 Ga0070667_100100606 Ga0070667_1001006062 188
430 3300005367 Ga0070667_100135302 Ga0070667_1001353022 188
431 3300005367 Ga0070667_100287219 Ga0070667_1002872192 188
432 3300005439 Ga0070711_100152002 Ga0070711_1001520022 188
433 3300005455 Ga0070663_100001003 Ga0070663_1000010035 188
434 3300005455 Ga0070663_100095804 Ga0070663_1000958043 188
435 3300005457 Ga0070662_100446501 Ga0070662_1004465012 188
436 3300005539 Ga0068853_100013355 Ga0068853_1000133553 188
437 3300005539 Ga0068853_100015314 Ga0068853_1000153145 188
438 3300005539 Ga0068853_100036094 Ga0068853_1000360944 188
439 3300005539 Ga0068853_100036371 Ga0068853_1000363713 188
440 3300005543 Ga0070672_100269025 Ga0070672_1002690252 188
441 3300005547 Ga0070693_100130664 Ga0070693_1001306642 188
442 3300005548 Ga0070665_100000062 Ga0070665_10000006210 188
443 3300005548 Ga0070665_100041675 Ga0070665_1000416754 188
444 3300005548 Ga0070665_100057099 Ga0070665_1000570994 188
445 3300005548 Ga0070665_100086618 Ga0070665_1000866184 188
446 3300005563 Ga0068855_100029497 Ga0068855_1000294974 188
447 3300005563 Ga0068855_100196665 Ga0068855_1001966653 188
448 3300005563 Ga0068855_100932709 Ga0068855_1009327092 188
449 3300005564 Ga0070664_100419182 Ga0070664_1004191822 188
450 3300005577 Ga0068857_100036253 Ga0068857_1000362533 188
451 3300005577 Ga0068857_100423311 Ga0068857_1004233112 188
452 3300005577 Ga0068857_100533822 Ga0068857_1005338222 188
453 3300005614 Ga0068856_100268438 Ga0068856_1002684383 188
454 3300005617 Ga0068859_100003762 Ga0068859_10000376210 188
455 3300005718 Ga0068866_10305878 Ga0068866_103058782 188
456 3300005719 Ga0068861_100087560 Ga0068861_1000875604 188
457 3300005834 Ga0068851_10085317 Ga0068851_100853172 188
458 3300005834 Ga0068851_10466375 Ga0068851_104663751 188
459 3300005841 Ga0068863_100010416 Ga0068863_1000104165 188
460 3300005841 Ga0068863_100264810 Ga0068863_1002648102 188
461 3300005841 Ga0068863_100477542 Ga0068863_1004775423 188
462 3300005843 Ga0068860_100066585 Ga0068860_1000665854 188
463 3300005843 Ga0068860_100349233 Ga0068860_1003492332 188
464 3300005843 Ga0068860_101210222 Ga0068860_1012102222 188
465 3300005843 Ga0068860_101497191 Ga0068860_1014971911 188
466 3300005844 Ga0068862_100000214 Ga0068862_10000021449 188
467 3300005844 Ga0068862_100113977 Ga0068862_1001139774 188
468 3300005983 Ga0081540_1002208 Ga0081540_10022082 188
469 3300006163 Ga0070715_10114905 Ga0070715_101149052 188
470 3300006237 Ga0097621_100115404 Ga0097621_1001154043 188
471 3300006237 Ga0097621_100427656 Ga0097621_1004276562 188
472 3300006358 Ga0068871_100030975 Ga0068871_1000309755 188
473 3300006358 Ga0068871_100054983 Ga0068871_1000549833 188
474 3300006358 Ga0068871_100081002 Ga0068871_1000810024 188
475 3300006358 Ga0068871_100497391 Ga0068871_1004973912 188
476 3300006881 Ga0068865_100006181 Ga0068865_10000618110 188
477 3300006931 Ga0097620_100003762 Ga0097620_10000376210 188
478 3300009174 Ga0105241_10127447 Ga0105241_101274473 188
479 3300009174 Ga0105241_10443039 Ga0105241_104430392 188
480 3300009174 Ga0105241_10479464 Ga0105241_104794642 188
481 3300009177 Ga0105248_10000800 Ga0105248_1000080033 188
482 3300009177 Ga0105248_10140427 Ga0105248_101404274 188
483 3300009545 Ga0105237_10006056 Ga0105237_100060569 188
484 3300009545 Ga0105237_10065006 Ga0105237_100650064 188
485 3300009545 Ga0105237_10137940 Ga0105237_101379402 188
486 3300009553 Ga0105249_10006894 Ga0105249_100068949 188
487 3300009553 Ga0105249_10074773 Ga0105249_100747734 188
488 3300010375 Ga0105239_10005808 Ga0105239_100058088 188
489 3300010375 Ga0105239_10030417 Ga0105239_100304175 188
490 3300010375 Ga0105239_10407897 Ga0105239_104078972 188
491 3300013104 Ga0157370_10602359 Ga0157370_106023592 188
492 3300013105 Ga0157369_10439166 Ga0157369_104391662 188
493 3300013307 Ga0157372_10217678 Ga0157372_102176782 188
494 3300013307 Ga0157372_10366711 Ga0157372_103667112 188
495 3300014325 Ga0163163_10062666 Ga0163163_100626664 188
496 3300014968 Ga0157379_10124504 Ga0157379_101245043 188
497 3300014969 Ga0157376_10003159 Ga0157376_100031598 188
498 3300015685 Ga0183369_1012 Ga0183369_1012203 188
499 3300015687 Ga0183368_1004 Ga0183368_1004249 188
500 3300025207 Ga0209760_100998 Ga0209760_1009983 188
501 3300025224 Ga0209784_100047 Ga0209784_100047129 188
502 3300025225 Ga0209566_101849 Ga0209566_1018494 188
503 3300025226 Ga0209674_100016 Ga0209674_100016385 188
504 3300025228 Ga0209672_101254 Ga0209672_1012549 188
505 3300025228 Ga0209672_103717 Ga0209672_1037172 188
506 3300025231 Ga0207427_100023 Ga0207427_100023365 188
507 3300025231 Ga0207427_106386 Ga0207427_1063861 188
508 3300025233 Ga0209437_100015 Ga0209437_100015551 188
509 3300025233 Ga0209437_100276 Ga0209437_10027655 188
510 3300025242 Ga0209258_100043 Ga0209258_10004384 188
511 3300025242 Ga0209258_101024 Ga0209258_1010248 188
512 3300025246 Ga0209646_1000913 Ga0209646_10009137 188
513 3300025250 Ga0209026_1000047 Ga0209026_100004784 188
514 3300025254 Ga0209148_1000002 Ga0209148_10000021953 188
515 3300025254 Ga0209148_1000010 Ga0209148_1000010364 188
516 3300025256 Ga0209759_1000318 Ga0209759_100031840 188
517 3300025256 Ga0209759_1021278 Ga0209759_10212781 188
518 3300025261 Ga0209233_1000009 Ga0209233_1000009808 188
519 3300025261 Ga0209233_1004909 Ga0209233_10049093 188
520 3300025261 Ga0209233_1022978 Ga0209233_10229783 188
521 3300025272 Ga0209455_1000020 Ga0209455_1000020240 188
522 3300025900 Ga0207710_10420134 Ga0207710_104201341 188
523 3300025903 Ga0207680_10011803 Ga0207680_100118035 188
524 3300025907 Ga0207645_10065582 Ga0207645_100655823 188
525 3300025911 Ga0207654_10216000 Ga0207654_102160002 188
526 3300025912 Ga0207707_10233153 Ga0207707_102331532 188
527 3300025914 Ga0207671_10006496 Ga0207671_100064969 188
528 3300025914 Ga0207671_10073102 Ga0207671_100731024 188
529 3300025914 Ga0207671_10360662 Ga0207671_103606622 188
530 3300025916 Ga0207663_10185899 Ga0207663_101858993 188
531 3300025920 Ga0207649_10286398 Ga0207649_102863983 188
532 3300025920 Ga0207649_10345123 Ga0207649_103451232 188
533 3300025924 Ga0207694_10304410 Ga0207694_103044102 188
534 3300025931 Ga0207644_10301142 Ga0207644_103011422 188
535 3300025932 Ga0207690_10973611 Ga0207690_109736112 188
536 3300025933 Ga0207706_10712335 Ga0207706_107123352 188
537 3300025936 Ga0207670_10028157 Ga0207670_100281572 188
538 3300025938 Ga0207704_10005277 Ga0207704_100052775 188
539 3300025940 Ga0207691_10062518 Ga0207691_100625183 188
540 3300025941 Ga0207711_10035009 Ga0207711_100350093 188
541 3300025942 Ga0207689_10418493 Ga0207689_104184932 188
542 3300025942 Ga0207689_10633505 Ga0207689_106335052 188
543 3300025949 Ga0207667_10006961 Ga0207667_1000696111 188
544 3300025949 Ga0207667_10206777 Ga0207667_102067772 188
545 3300025949 Ga0207667_10718535 Ga0207667_107185352 188
546 3300025961 Ga0207712_10000336 Ga0207712_1000033646 188
547 3300025981 Ga0207640_10159214 Ga0207640_101592142 188
548 3300025986 Ga0207658_10000050 Ga0207658_1000005025 188
549 3300025986 Ga0207658_10045710 Ga0207658_100457102 188
550 3300025986 Ga0207658_10111658 Ga0207658_101116583 188
551 3300025986 Ga0207658_10264976 Ga0207658_102649762 188
552 3300025986 Ga0207658_11075944 Ga0207658_110759442 188
553 3300026023 Ga0207677_10502817 Ga0207677_105028172 188
554 3300026035 Ga0207703_10723880 Ga0207703_107238801 188
555 3300026041 Ga0207639_10006393 Ga0207639_100063935 188
556 3300026041 Ga0207639_10008297 Ga0207639_100082974 188
557 3300026067 Ga0207678_10000663 Ga0207678_100006639 188
558 3300026067 Ga0207678_10062979 Ga0207678_100629793 188
559 3300026067 Ga0207678_10093446 Ga0207678_100934463 188
560 3300026067 Ga0207678_10367915 Ga0207678_103679152 188
561 3300026078 Ga0207702_10724066 Ga0207702_107240662 188
562 3300026088 Ga0207641_10045365 Ga0207641_100453654 188
563 3300026088 Ga0207641_10088162 Ga0207641_100881622 188
564 3300026089 Ga0207648_10138452 Ga0207648_101384523 188
565 3300026089 Ga0207648_10865645 Ga0207648_108656452 188
566 3300026095 Ga0207676_10081877 Ga0207676_100818772 188
567 3300026116 Ga0207674_10072283 Ga0207674_100722834 188
568 3300026116 Ga0207674_10080018 Ga0207674_100800184 188
569 3300026116 Ga0207674_10547967 Ga0207674_105479672 188
570 3300026118 Ga0207675_100120690 Ga0207675_1001206902 188
571 3300026142 Ga0207698_10271479 Ga0207698_102714792 188
572 3300026142 Ga0207698_10765499 Ga0207698_107654992 188
573 3300028379 Ga0268266_10000001 Ga0268266_100000011688 188
574 3300028379 Ga0268266_10022097 Ga0268266_100220974 188
575 3300028379 Ga0268266_10028145 Ga0268266_100281455 188
576 3300028379 Ga0268266_10245055 Ga0268266_102450552 188
577 3300028380 Ga0268265_10000175 Ga0268265_1000017549 188
578 3300028380 Ga0268265_10275169 Ga0268265_102751693 188
579 3300028381 Ga0268264_10170663 Ga0268264_101706633 188
580 3300031824 Ga0307413_10062876 Ga0307413_100628762 188
581 3300033179 Ga0307507_10233868 Ga0307507_102338682 188
582 3300037418 Ga0395900_0071204 Ga0395900_0071204_2192_2758 188
583 3300038443 Ga0395901_0013263 Ga0395901_0013263_1973_2539 188
584 3300041441 Ga0451787_789512 Ga0451787_789512_179_745 188
585 3300041451 Ga0451791_1376712 Ga0451791_1376712_631_1197 188
586 3300041452 Ga0451793_1541826 Ga0451793_1541826_71_637 188
587 3300041453 Ga0451797_0275357 Ga0451797_0275357_543_1109 188
588 3300041453 Ga0451797_0276813 Ga0451797_0276813_1114_1680 188
589 3300041459 Ga0451800_0619331 Ga0451800_0619331_13_579 188
590 3300041460 Ga0451802_0264916 Ga0451802_0264916_3479_4045 188
591 3300041460 Ga0451802_0564149 Ga0451802_0564149_52_618 188
592 3300041463 Ga0451804_0980518 Ga0451804_0980518_155_721 188
593 3300041486 Ga0451807_0469608 Ga0451807_0469608_818_1384 188
594 3300041486 Ga0451807_2032690 Ga0451807_2032690_902_1468 188
595 3300041494 Ga0451837_0926139 Ga0451837_0926139_297_863 188
596 3300041494 Ga0451837_1815082 Ga0451837_1815082_236_802 188
597 3300041505 Ga0451849_0845794 Ga0451849_0845794_161_727 188
598 3300041509 Ga0451843_0063786 Ga0451843_0063786_103_669 188
599 3300041509 Ga0451843_0142165 Ga0451843_0142165_484_1050 188
600 3300041512 Ga0451853_2268669 Ga0451853_2268669_238_804 188
601 3300042438 Ga0439459_0000410 Ga0439459_0000410_4253_4819 188
602 3300044658 Ga0466972_0002222 Ga0466972_0002222_7449_8015 188
603 3300044765 Ga0466970_0017240 Ga0466970_0017240_1781_2347 188
604 3300046460 Ga0495638_0000049 Ga0495638_0000049_11298_11864 188
605 3300046460 Ga0495638_0000063 Ga0495638_0000063_108650_109216 188
606 3300046460 Ga0495638_0000916 Ga0495638_0000916_11382_11948 188
607 3300046471 Ga0495650_0001214 Ga0495650_0001214_18192_18758 188
608 3300046507 Ga0495606_0001000 Ga0495606_0001000_22785_23351 188
609 3300046557 Ga0495622_0186885 Ga0495622_0186885_115_681 188
610 3300046660 Ga0495625_0053013 Ga0495625_0053013_1650_2216 188
611 3300046694 Ga0495649_0000823 Ga0495649_0000823_18230_18796 188
612 3300046694 Ga0495649_0036294 Ga0495649_0036294_1672_2238 188
613 3300047472 Ga0495686_0003997 Ga0495686_0003997_6798_7364 188
614 3300048903 Ga0496100_0450304 Ga0496100_0450304_351_917 188
615 3300048907 Ga0496104_0243722 Ga0496104_0243722_910_1476 188
616 3300048910 Ga0496107_0198853 Ga0496107_0198853_254_820 188
617 3300048916 Ga0496113_0017059 Ga0496113_0017059_795_1361 188
618 3300048918 Ga0496115_0000024 Ga0496115_0000024_122526_123092 188
619 3300048918 Ga0496115_0000103 Ga0496115_0000103_6461_7027 188
620 3300048918 Ga0496115_0014517 Ga0496115_0014517_5338_5904 188
621 3300048918 Ga0496115_0108062 Ga0496115_0108062_941_1507 188
622 3300048918 Ga0496115_0394882 Ga0496115_0394882_329_895 188
623 3300048921 Ga0496118_0005395 Ga0496118_0005395_11744_12310 188
624 3300048921 Ga0496118_0195442 Ga0496118_0195442_417_983 188
625 3300048924 Ga0496121_0055760 Ga0496121_0055760_2455_3021 188
626 3300048924 Ga0496121_0079741 Ga0496121_0079741_1172_1738 188
627 3300048925 Ga0496122_0000677 Ga0496122_0000677_34485_35051 188
628 3300048926 Ga0496123_0001221 Ga0496123_0001221_3301_3867 188
629 3300048929 Ga0496126_0007111 Ga0496126_0007111_11654_12220 188
630 3300048929 Ga0496126_0038848 Ga0496126_0038848_3038_3604 188
631 3300048929 Ga0496126_0454696 Ga0496126_0454696_149_715 188
632 3300048929 Ga0496126_0677876 Ga0496126_0677876_50_616 188
633 3300049459 Ga0495678_022417 Ga0495678_022417_99_665 188
634 3300049568 Ga0501031_0009050 Ga0501031_0009050_5634_6200 188
635 3300049568 Ga0501031_0032550 Ga0501031_0032550_1762_2328 188
636 3300049568 Ga0501031_0054292 Ga0501031_0054292_1917_2483 188
637 3300049569 Ga0501032_0000406 Ga0501032_0000406_17640_18206 188
638 3300049569 Ga0501032_0016880 Ga0501032_0016880_2517_3083 188
639 3300049569 Ga0501032_0143104 Ga0501032_0143104_409_975 188
640 3300049569 Ga0501032_0201180 Ga0501032_0201180_329_895 188
641 3300049570 Ga0501033_0003460 Ga0501033_0003460_10767_11333 188
642 3300049570 Ga0501033_0013369 Ga0501033_0013369_1147_1713 188
643 3300049570 Ga0501033_0083095 Ga0501033_0083095_1373_1939 188
644 3300049571 Ga0501034_0037069 Ga0501034_0037069_2815_3381 188
645 3300049571 Ga0501034_0058066 Ga0501034_0058066_424_990 188
646 3300049571 Ga0501034_0151738 Ga0501034_0151738_853_1419 188
647 3300049571 Ga0501034_0549958 Ga0501034_0549958_389_955 188
648 3300049571 Ga0501034_0702164 Ga0501034_0702164_61_627 188
649 3300049572 Ga0501036_0022554 Ga0501036_0022554_2773_3339 188
650 3300049572 Ga0501036_0027253 Ga0501036_0027253_2114_2680 188
651 3300049572 Ga0501036_0040482 Ga0501036_0040482_2508_3074 188
652 3300049573 Ga0501037_0001182 Ga0501037_0001182_2386_2952 188
653 3300049573 Ga0501037_0013005 Ga0501037_0013005_48_614 188
654 3300049573 Ga0501037_0165561 Ga0501037_0165561_600_1166 188
655 3300049573 Ga0501037_0363027 Ga0501037_0363027_361_927 188
656 3300049574 Ga0501038_0000761 Ga0501038_0000761_11302_11868 188
657 3300049574 Ga0501038_0012150 Ga0501038_0012150_6126_6692 188
658 3300049574 Ga0501038_0016264 Ga0501038_0016264_3501_4067 188
659 3300049575 Ga0501039_0017008 Ga0501039_0017008_257_823 188
660 3300049575 Ga0501039_0121324 Ga0501039_0121324_619_1185 188
661 3300049576 Ga0501040_0032622 Ga0501040_0032622_2546_3112 188
662 3300049578 Ga0501042_0722478 Ga0501042_0722478_52_618 188
663 3300049579 Ga0501043_0000788 Ga0501043_0000788_25210_25776 188
664 3300049579 Ga0501043_0058077 Ga0501043_0058077_1752_2318 188
665 3300049579 Ga0501043_0088599 Ga0501043_0088599_980_1546 188
666 3300049579 Ga0501043_0287472 Ga0501043_0287472_233_799 188
667 3300049580 Ga0501046_0002185 Ga0501046_0002185_8777_9343 188
668 3300049580 Ga0501046_0010595 Ga0501046_0010595_2680_3246 188
669 3300049580 Ga0501046_0035596 Ga0501046_0035596_2994_3560 188
670 3300049580 Ga0501046_0060050 Ga0501046_0060050_2354_2920 188
671 3300049581 Ga0501047_0011160 Ga0501047_0011160_2730_3296 188
672 3300049581 Ga0501047_0016499 Ga0501047_0016499_3635_4201 188
673 3300049581 Ga0501047_0147958 Ga0501047_0147958_735_1301 188
674 3300049581 Ga0501047_0262474 Ga0501047_0262474_600_1166 188
675 3300049581 Ga0501047_0262821 Ga0501047_0262821_614_1180 188
676 3300049581 Ga0501047_0304719 Ga0501047_0304719_278_844 188
677 3300049581 Ga0501047_0528304 Ga0501047_0528304_337_903 188
678 3300049582 Ga0501048_0281690 Ga0501048_0281690_234_800 188
679 3300049583 Ga0501067_0004312 Ga0501067_0004312_3591_4157 188
680 3300049583 Ga0501067_0203654 Ga0501067_0203654_489_1055 188
681 3300049584 Ga0501068_0094431 Ga0501068_0094431_500_1066 188
682 3300049585 Ga0501069_0013841 Ga0501069_0013841_3230_3796 188
683 3300049586 Ga0501070_0038908 Ga0501070_0038908_409_975 188
684 3300049586 Ga0501070_0133512 Ga0501070_0133512_877_1443 188
685 3300049586 Ga0501070_0400005 Ga0501070_0400005_111_677 188
686 3300049586 Ga0501070_0441694 Ga0501070_0441694_392_958 188
687 3300049586 Ga0501070_0887112 Ga0501070_0887112_32_598 188
688 3300049587 Ga0501071_0028619 Ga0501071_0028619_648_1214 188
689 3300049589 Ga0501073_0001883 Ga0501073_0001883_12913_13479 188
690 3300049589 Ga0501073_0002262 Ga0501073_0002262_3417_3983 188
691 3300049589 Ga0501073_0050674 Ga0501073_0050674_1396_1962 188
692 3300049589 Ga0501073_0059868 Ga0501073_0059868_73_639 188
693 3300049589 Ga0501073_0096445 Ga0501073_0096445_257_823 188
694 3300049589 Ga0501073_0112830 Ga0501073_0112830_59_625 188
695 3300049589 Ga0501073_0126204 Ga0501073_0126204_374_940 188
696 3300049590 Ga0501074_0293481 Ga0501074_0293481_254_820 188
697 3300049591 Ga0501075_0793260 Ga0501075_0793260_41_607 188
698 3300049592 Ga0501076_0230212 Ga0501076_0230212_502_1068 188
699 3300049741 Ga0501079_0053102 Ga0501079_0053102_1793_2359 188
700 3300049742 Ga0501080_0021304 Ga0501080_0021304_2826_3392 188
701 3300049742 Ga0501080_0069954 Ga0501080_0069954_167_733 188
702 3300049742 Ga0501080_0349009 Ga0501080_0349009_332_898 188
703 3300049743 Ga0501081_0062767 Ga0501081_0062767_1450_2016 188
704 3300049744 Ga0501083_0117491 Ga0501083_0117491_374_940 188
705 3300049744 Ga0501083_0207565 Ga0501083_0207565_498_1064 188
706 3300049822 Ga0501035_0003118 Ga0501035_0003118_14235_14801 188
707 3300049822 Ga0501035_0014669 Ga0501035_0014669_2994_3560 188
708 3300049822 Ga0501035_0025590 Ga0501035_0025590_1024_1590 188
709 3300049822 Ga0501035_0142940 Ga0501035_0142940_1361_1927 188
710 3300049822 Ga0501035_0150069 Ga0501035_0150069_1408_1974 188
711 3300049822 Ga0501035_0378738 Ga0501035_0378738_145_711 188
712 3300049823 Ga0501044_0001589 Ga0501044_0001589_15493_16059 188
713 3300049823 Ga0501044_0005237 Ga0501044_0005237_10388_10954 188
714 3300049823 Ga0501044_0018671 Ga0501044_0018671_2994_3560 188
715 3300049823 Ga0501044_0085461 Ga0501044_0085461_1107_1673 188
716 3300049823 Ga0501044_0202879 Ga0501044_0202879_691_1257 188
717 3300049823 Ga0501044_0377379 Ga0501044_0377379_295_861 188
718 3300049824 Ga0501045_0006433 Ga0501045_0006433_31_597 188
719 3300053087 Ga0500643_002177 Ga0500643_002177_6444_7010 188
720 3300053093 Ga0500651_0000070 Ga0500651_0000070_52189_52755 188
721 3300053120 Ga0500597_000625 Ga0500597_000625_6000_6566 188
722 3300053136 Ga0500559_0024736 Ga0500559_0024736_1030_1596 188
723 3300053139 Ga0500568_0000801 Ga0500568_0000801_3240_3806 188
724 3300054114 Ga0501084_0236355 Ga0501084_0236355_910_1476 188
725 3300060353 Ga0501082_0000103 Ga0501082_0000103_3331_3897 188
726 3300060353 Ga0501082_0072168 Ga0501082_0072168_1821_2387 188
727 3300060353 Ga0501082_0274491 Ga0501082_0274491_572_1138 188
728 3300061734 Ga0530510_0195282 Ga0530510_0195282_49_615 188
729 3300001989 JGI24739J22299_10000040 JGI24739J22299_1000004013 189
730 3300001990 JGI24737J22298_10034231 JGI24737J22298_100342313 189
731 3300002067 JGI24735J21928_10033486 JGI24735J21928_100334863 189
732 3300002067 JGI24735J21928_10064702 JGI24735J21928_100647022 189
733 3300002075 JGI24738J21930_10004328 JGI24738J21930_100043282 189
734 3300002737 JGI25162J39368_1003957 JGI25162J39368_10039572 189
735 3300003215 JGI25153J46596_10030265 JGI25153J46596_100302652 189
736 3300003320 rootH2_10011443 rootH2_100114435 189
737 3300003322 rootL2_10233426 rootL2_102334262 189
738 3300003578 Ga0006562J51391_1011242 Ga0006562J51391_10112423 189
739 3300003578 Ga0006562J51391_1011245 Ga0006562J51391_10112453 189
740 3300003578 Ga0006562J51391_1097585 Ga0006562J51391_10975854 189
741 3300004625 Ga0055543_1006491 Ga0055543_10064914 189
742 3300005262 Ga0065165_1000001 Ga0065165_1000001187 189
743 3300005262 Ga0065165_1008009 Ga0065165_10080093 189
744 3300005327 Ga0070658_10019429 Ga0070658_100194293 189
745 3300005335 Ga0070666_10000003 Ga0070666_10000003304 189
746 3300005344 Ga0070661_100054487 Ga0070661_1000544872 189
747 3300005347 Ga0070668_100193279 Ga0070668_1001932792 189
748 3300005367 Ga0070667_100082943 Ga0070667_1000829432 189
749 3300005455 Ga0070663_100098136 Ga0070663_1000981362 189
750 3300005466 Ga0070685_10300721 Ga0070685_103007211 189
751 3300005539 Ga0068853_100326142 Ga0068853_1003261421 189
752 3300005548 Ga0070665_100018742 Ga0070665_1000187425 189
753 3300005548 Ga0070665_100111368 Ga0070665_1001113682 189
754 3300005577 Ga0068857_100004673 Ga0068857_10000467311 189
755 3300005616 Ga0068852_100020584 Ga0068852_1000205844 189
756 3300005842 Ga0068858_100104492 Ga0068858_1001044922 189
757 3300005842 Ga0068858_100364530 Ga0068858_1003645302 189
758 3300005843 Ga0068860_100016254 Ga0068860_1000162547 189
759 3300006237 Ga0097621_100580498 Ga0097621_1005804982 189
760 3300009093 Ga0105240_10003424 Ga0105240_1000342412 189
761 3300009093 Ga0105240_10014865 Ga0105240_100148652 189
762 3300009101 Ga0105247_10037228 Ga0105247_100372282 189
763 3300009545 Ga0105237_10000023 Ga0105237_1000002357 189
764 3300009551 Ga0105238_10006640 Ga0105238_100066405 189
765 3300010375 Ga0105239_10000022 Ga0105239_10000022100 189
766 3300010375 Ga0105239_10061115 Ga0105239_100611152 189
767 3300010375 Ga0105239_10070451 Ga0105239_100704512 189
768 3300012500 Ga0157314_1002322 Ga0157314_10023222 189
769 3300012502 Ga0157347_1003229 Ga0157347_10032292 189
770 3300013104 Ga0157370_10000204 Ga0157370_1000020417 189
771 3300013105 Ga0157369_10126886 Ga0157369_101268863 189
772 3300013306 Ga0163162_10000236 Ga0163162_1000023627 189
773 3300013306 Ga0163162_10649439 Ga0163162_106494392 189
774 3300014497 Ga0182008_10001033 Ga0182008_100010333 189
775 3300014497 Ga0182008_10284266 Ga0182008_102842662 189
776 3300015261 Ga0182006_1000005 Ga0182006_1000005254 189
777 3300015261 Ga0182006_1001892 Ga0182006_100189212 189
778 3300015265 Ga0182005_1000004 Ga0182005_1000004336 189
779 3300015265 Ga0182005_1000611 Ga0182005_10006114 189
780 3300015265 Ga0182005_1006009 Ga0182005_10060092 189
781 3300017792 Ga0163161_10094435 Ga0163161_100944352 189
782 3300022467 Ga0224712_10082087 Ga0224712_100820871 189
783 3300025226 Ga0209674_101250 Ga0209674_1012506 189
784 3300025233 Ga0209437_101299 Ga0209437_1012996 189
785 3300025254 Ga0209148_1002310 Ga0209148_10023108 189
786 3300025258 Ga0209129_1000818 Ga0209129_100081818 189
787 3300025258 Ga0209129_1002610 Ga0209129_10026104 189
788 3300025297 Ga0209758_1000959 Ga0209758_100095927 189
789 3300025297 Ga0209758_1017608 Ga0209758_10176084 189
790 3300025299 Ga0209256_1032037 Ga0209256_10320372 189
791 3300025302 Ga0207426_1012703 Ga0207426_10127034 189
792 3300025302 Ga0207426_1063397 Ga0207426_10633972 189
793 3300025304 Ga0209257_1063611 Ga0209257_10636112 189
794 3300025321 Ga0207656_10002796 Ga0207656_100027962 189
795 3300025903 Ga0207680_10000006 Ga0207680_10000006451 189
796 3300025904 Ga0207647_10004661 Ga0207647_100046617 189
797 3300025909 Ga0207705_10031658 Ga0207705_100316585 189
798 3300025909 Ga0207705_10263522 Ga0207705_102635222 189
799 3300025913 Ga0207695_10000654 Ga0207695_1000065434 189
800 3300025913 Ga0207695_10008059 Ga0207695_1000805911 189
801 3300025913 Ga0207695_10050583 Ga0207695_100505832 189
802 3300025914 Ga0207671_10000020 Ga0207671_10000020178 189
803 3300025914 Ga0207671_10000033 Ga0207671_1000003377 189
804 3300025920 Ga0207649_10037144 Ga0207649_100371442 189
805 3300025920 Ga0207649_10065674 Ga0207649_100656743 189
806 3300025924 Ga0207694_10013442 Ga0207694_100134425 189
807 3300025949 Ga0207667_10000130 Ga0207667_1000013066 189
808 3300025949 Ga0207667_10002841 Ga0207667_100028413 189
809 3300025972 Ga0207668_10365532 Ga0207668_103655321 189
810 3300025981 Ga0207640_10000434 Ga0207640_1000043410 189
811 3300025981 Ga0207640_10000908 Ga0207640_1000090813 189
812 3300025986 Ga0207658_10075880 Ga0207658_100758803 189
813 3300025986 Ga0207658_10682710 Ga0207658_106827102 189
814 3300026035 Ga0207703_10081573 Ga0207703_100815733 189
815 3300026067 Ga0207678_10154663 Ga0207678_101546633 189
816 3300026116 Ga0207674_10000971 Ga0207674_1000097113 189
817 3300026116 Ga0207674_10009030 Ga0207674_100090308 189
818 3300026121 Ga0207683_10072794 Ga0207683_100727942 189
819 3300028379 Ga0268266_10000021 Ga0268266_10000021366 189
820 3300028379 Ga0268266_10681257 Ga0268266_106812572 189
821 3300028381 Ga0268264_10023340 Ga0268264_100233404 189
822 3300031911 Ga0307412_10056372 Ga0307412_100563724 189
823 3300033180 Ga0307510_10036704 Ga0307510_100367046 189
824 3300033180 Ga0307510_10287535 Ga0307510_102875352 189
825 3300041404 Ga0439436_0000042 Ga0439436_0000042_11387_11956 189
826 3300041413 Ga0439465_0002276 Ga0439465_0002276_1019_1588 189
827 3300041443 Ga0451789_0709532 Ga0451789_0709532_719_1300 189
828 3300041451 Ga0451791_0481875 Ga0451791_0481875_155_724 189
829 3300041452 Ga0451793_0311790 Ga0451793_0311790_410_991 189
830 3300041491 Ga0451833_0880856 Ga0451833_0880856_70_639 189
831 3300042004 Ga0439445_0041112 Ga0439445_0041112_645_1214 189
832 3300042005 Ga0439448_0068288 Ga0439448_0068288_110_679 189
833 3300042184 Ga0450908_000392 Ga0450908_000392_204_773 189
834 3300044656 Ga0466969_0045770 Ga0466969_0045770_136_705 189
835 3300044658 Ga0466972_0188953 Ga0466972_0188953_183_752 189
836 3300044672 Ga0466982_0000020 Ga0466982_0000020_32852_33421 189
837 3300044672 Ga0466982_0000196 Ga0466982_0000196_5473_6042 189
838 3300044683 Ga0466965_0113264 Ga0466965_0113264_486_1055 189
839 3300044684 Ga0466966_0009004 Ga0466966_0009004_35_604 189
840 3300044719 Ga0466971_0004091 Ga0466971_0004091_114_683 189
841 3300044735 Ga0466968_0001991 Ga0466968_0001991_1693_2262 189
842 3300044735 Ga0466968_0003299 Ga0466968_0003299_270_839 189
843 3300044765 Ga0466970_0023757 Ga0466970_0023757_1718_2287 189
844 3300044842 Ga0466957_0195597 Ga0466957_0195597_571_1140 189
845 3300044901 Ga0466960_0237250 Ga0466960_0237250_236_805 189
846 3300045049 Ga0466959_0217674 Ga0466959_0217674_634_1203 189
847 3300045836 Ga0466958_0387053 Ga0466958_0387053_163_732 189
848 3300046452 Ga0495617_000016 Ga0495617_000016_251587_252162 189
849 3300046452 Ga0495617_002329 Ga0495617_002329_1297_1872 189
850 3300046460 Ga0495638_0001592 Ga0495638_0001592_18442_19017 189
851 3300046460 Ga0495638_0029458 Ga0495638_0029458_1252_1827 189
852 3300046471 Ga0495650_0001052 Ga0495650_0001052_18680_19249 189
853 3300046471 Ga0495650_0016165 Ga0495650_0016165_1903_2478 189
854 3300046491 Ga0495584_0047922 Ga0495584_0047922_746_1321 189
855 3300046492 Ga0495585_0000007 Ga0495585_0000007_68645_69220 189
856 3300046492 Ga0495585_0002049 Ga0495585_0002049_2963_3538 189
857 3300046501 Ga0495607_0000437 Ga0495607_0000437_21375_21950 189
858 3300046501 Ga0495607_0006648 Ga0495607_0006648_2323_2898 189
859 3300046506 Ga0495583_0017791 Ga0495583_0017791_1277_1852 189
860 3300046507 Ga0495606_0001571 Ga0495606_0001571_1359_1934 189
861 3300046507 Ga0495606_0001761 Ga0495606_0001761_18501_19076 189
862 3300046507 Ga0495606_0012718 Ga0495606_0012718_4122_4691 189
863 3300046507 Ga0495606_0022014 Ga0495606_0022014_1415_1990 189
864 3300046507 Ga0495606_0029760 Ga0495606_0029760_1292_1861 189
865 3300046507 Ga0495606_0385282 Ga0495606_0385282_118_687 189
866 3300046512 Ga0495610_0010317 Ga0495610_0010317_1898_2467 189
867 3300046512 Ga0495610_0016234 Ga0495610_0016234_1199_1774 189
868 3300046513 Ga0495616_0000001 Ga0495616_0000001_614771_615346 189
869 3300046513 Ga0495616_0065294 Ga0495616_0065294_671_1246 189
870 3300046515 Ga0495620_0001003 Ga0495620_0001003_1341_1916 189
871 3300046515 Ga0495620_0005384 Ga0495620_0005384_1394_1969 189
872 3300046518 Ga0495631_0000065 Ga0495631_0000065_17358_17933 189
873 3300046518 Ga0495631_0000217 Ga0495631_0000217_36979_37554 189
874 3300046519 Ga0495632_0000011 Ga0495632_0000011_157374_157943 189
875 3300046519 Ga0495632_0000581 Ga0495632_0000581_6751_7326 189
876 3300046519 Ga0495632_0008388 Ga0495632_0008388_2169_2744 189
877 3300046520 Ga0495637_0006365 Ga0495637_0006365_4526_5101 189
878 3300046522 Ga0495643_0052286 Ga0495643_0052286_706_1281 189
879 3300046524 Ga0495648_0002069 Ga0495648_0002069_1333_1908 189
880 3300046524 Ga0495648_0026344 Ga0495648_0026344_2085_2660 189
881 3300046538 Ga0495609_0026775 Ga0495609_0026775_1133_1708 189
882 3300046557 Ga0495622_0356848 Ga0495622_0356848_42_617 189
883 3300046616 Ga0495668_0033645 Ga0495668_0033645_401_976 189
884 3300046616 Ga0495668_0059070 Ga0495668_0059070_1034_1609 189
885 3300046648 Ga0495611_0000001 Ga0495611_0000001_1381552_1382127 189
886 3300046648 Ga0495611_0000068 Ga0495611_0000068_43461_44036 189
887 3300046660 Ga0495625_0000001 Ga0495625_0000001_533910_534485 189
888 3300046660 Ga0495625_0037488 Ga0495625_0037488_74_649 189
889 3300046660 Ga0495625_0056442 Ga0495625_0056442_833_1402 189
890 3300046665 Ga0495661_0001999 Ga0495661_0001999_1300_1875 189
891 3300046665 Ga0495661_0050434 Ga0495661_0050434_1410_1985 189
892 3300046691 Ga0495670_0022794 Ga0495670_0022794_672_1247 189
893 3300046691 Ga0495670_0054887 Ga0495670_0054887_718_1287 189
894 3300046692 Ga0495671_0004638 Ga0495671_0004638_2507_3082 189
895 3300046694 Ga0495649_0027338 Ga0495649_0027338_998_1567 189
896 3300046794 Ga0495589_0000016 Ga0495589_0000016_100881_101456 189
897 3300046810 Ga0495660_0000018 Ga0495660_0000018_302982_303557 189
898 3300046810 Ga0495660_0000294 Ga0495660_0000294_31701_32276 189
899 3300047323 Ga0495683_0005603 Ga0495683_0005603_5068_5643 189
900 3300047446 Ga0495679_000001 Ga0495679_000001_204828_205403 189
901 3300047469 Ga0495673_0000001 Ga0495673_0000001_533632_534207 189
902 3300047469 Ga0495673_0000018 Ga0495673_0000018_1299_1874 189
903 3300047469 Ga0495673_0006286 Ga0495673_0006286_5117_5692 189
904 3300047470 Ga0495681_0068986 Ga0495681_0068986_443_1018 189
905 3300047472 Ga0495686_0000037 Ga0495686_0000037_288349_288924 189
906 3300047472 Ga0495686_0013479 Ga0495686_0013479_438_1013 189
907 3300047472 Ga0495686_0033176 Ga0495686_0033176_1332_1907 189
908 3300047472 Ga0495686_0088850 Ga0495686_0088850_1087_1662 189
909 3300047472 Ga0495686_0123538 Ga0495686_0123538_456_1031 189
910 3300048904 Ga0496101_0306566 Ga0496101_0306566_512_1084 189
911 3300048908 Ga0496105_0001964 Ga0496105_0001964_7551_8123 189
912 3300048909 Ga0496106_0010344 Ga0496106_0010344_1233_1808 189
913 3300048910 Ga0496107_0390773 Ga0496107_0390773_274_843 189
914 3300048918 Ga0496115_0011553 Ga0496115_0011553_5391_5963 189
915 3300048919 Ga0496116_0165588 Ga0496116_0165588_29_598 189
916 3300048920 Ga0496117_0044089 Ga0496117_0044089_1517_2089 189
917 3300048920 Ga0496117_0299950 Ga0496117_0299950_235_810 189
918 3300048921 Ga0496118_0006935 Ga0496118_0006935_5807_6379 189
919 3300048921 Ga0496118_0041512 Ga0496118_0041512_1130_1702 189
920 3300048922 Ga0496119_0001743 Ga0496119_0001743_16608_17180 189
921 3300048922 Ga0496119_0002432 Ga0496119_0002432_9626_10198 189
922 3300048922 Ga0496119_0046099 Ga0496119_0046099_1550_2119 189
923 3300048922 Ga0496119_0165912 Ga0496119_0165912_362_931 189
924 3300048923 Ga0496120_0000167 Ga0496120_0000167_100542_101114 189
925 3300048923 Ga0496120_0000868 Ga0496120_0000868_29560_30132 189
926 3300048924 Ga0496121_0000532 Ga0496121_0000532_55495_56067 189
927 3300048924 Ga0496121_0001002 Ga0496121_0001002_18394_18969 189
928 3300048924 Ga0496121_0001590 Ga0496121_0001590_25818_26393 189
929 3300048924 Ga0496121_0031746 Ga0496121_0031746_1764_2333 189
930 3300048924 Ga0496121_0067748 Ga0496121_0067748_1931_2503 189
931 3300048925 Ga0496122_0011204 Ga0496122_0011204_4035_4610 189
932 3300048926 Ga0496123_0012693 Ga0496123_0012693_5093_5668 189
933 3300048927 Ga0496124_0000840 Ga0496124_0000840_20471_21046 189
934 3300048927 Ga0496124_0000893 Ga0496124_0000893_20405_20980 189
935 3300048928 Ga0496125_0000344 Ga0496125_0000344_32074_32643 189
936 3300048929 Ga0496126_0000581 Ga0496126_0000581_33913_34485 189
937 3300048929 Ga0496126_0023466 Ga0496126_0023466_1453_2025 189
938 3300048929 Ga0496126_0201315 Ga0496126_0201315_226_795 189
939 3300048929 Ga0496126_0360246 Ga0496126_0360246_512_1087 189
940 3300049459 Ga0495678_001288 Ga0495678_001288_1309_1884 189
941 3300049460 Ga0495682_0000948 Ga0495682_0000948_1344_1919 189
942 3300049460 Ga0495682_0007665 Ga0495682_0007665_1646_2221 189
943 3300049571 Ga0501034_0002029 Ga0501034_0002029_22123_22695 189
944 3300049572 Ga0501036_0088867 Ga0501036_0088867_334_906 189
945 3300049579 Ga0501043_0033296 Ga0501043_0033296_550_1122 189
946 3300049579 Ga0501043_0401884 Ga0501043_0401884_410_982 189
947 3300049580 Ga0501046_0034740 Ga0501046_0034740_2476_3048 189
948 3300049581 Ga0501047_0209588 Ga0501047_0209588_1188_1760 189
949 3300049582 Ga0501048_0259072 Ga0501048_0259072_461_1033 189
950 3300049585 Ga0501069_0164842 Ga0501069_0164842_636_1208 189
951 3300049586 Ga0501070_0065891 Ga0501070_0065891_1285_1857 189
952 3300049589 Ga0501073_0070536 Ga0501073_0070536_63_635 189
953 3300049590 Ga0501074_0039600 Ga0501074_0039600_1181_1753 189
954 3300049590 Ga0501074_0239875 Ga0501074_0239875_71_643 189
955 3300049742 Ga0501080_0011069 Ga0501080_0011069_4596_5168 189
956 3300049742 Ga0501080_0029025 Ga0501080_0029025_3781_4353 189
957 3300049823 Ga0501044_0142577 Ga0501044_0142577_515_1087 189
958 3300050516 nmdc:mga0sz30_99638_c1 nmdc:mga0sz30_99638_c1_504_1073 189
959 3300053079 Ga0500610_0011293 Ga0500610_0011293_2938_3510 189
960 3300053087 Ga0500643_000002 Ga0500643_000002_434218_434793 189
961 3300053093 Ga0500651_0078917 Ga0500651_0078917_467_1039 189
962 3300053103 Ga0500555_011185 Ga0500555_011185_598_1173 189
963 3300053730 Ga0500645_003001 Ga0500645_003001_5269_5844 189
964 3300054114 Ga0501084_0242015 Ga0501084_0242015_831_1403 189
965 3300054114 Ga0501084_0297444 Ga0501084_0297444_776_1348 189
966 3300060353 Ga0501082_0113959 Ga0501082_0113959_148_720 189
967 3300061719 Ga0466962_0003389 Ga0466962_0003389_1626_2195 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03079

ARD

ARD/ARD' family

3

165

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hji-assembly1.cif.gz_A structural model for the fe-containing isoform of acireductone dioxygenase 0.8835 3 157
4qgm-assembly1.cif.gz_A acireductone dioxygenase from bacillus anthracis with cadmium ion in active center 0.8734 1 167
2hji-assembly1.cif.gz_A structural model for the fe-containing isoform of acireductone dioxygenase 0.8732 3 157
4qgm-assembly1.cif.gz_A acireductone dioxygenase from bacillus anthracis with cadmium ion in active center 0.8399 1 167
1zrr-assembly1.cif.gz_A residual dipolar coupling refinement of acireductone dioxygenase from klebsiella 0.8376 3 180
ID Description Score Start End Superfamily
af_Q54ER6_1_147_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9098 3 167 2.60.120.10
af_Q54ER6_1_147_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8865 3 167 2.60.120.10
2hjiA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8835 3 157 2.60.120.10
4qgmA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8734 1 167 2.60.120.10
2hjiA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8732 3 157 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7W9XTH1-F1-model_v4 deleted 0.9969 1 181
AF-A0A839IWF8-F1-model_v4 Acireductone dioxygenase (1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase) (DHK-MTPene dioxygenase) (Acireductone dioxygenase (Fe(2+)-requiring)) (ARD') (Fe-ARD) (EC 1.13.11.54) (Acireductone dioxygenase (Ni(2+)-requiring)) (ARD) (Ni-ARD) (EC 1.13.11.53) 0.9943 1 179 GO:0005506
GO:0010308
GO:0010309
GO:0016151
GO:0019284
GO:0019509
AF-A0A3B8U0X9-F1-model_v4 deleted 0.993 19 179
AF-A0A6I1W7N7-F1-model_v4 acireductone dioxygenase (Fe(2+)-requiring) (EC 1.13.11.54) 0.9924 75 159 GO:0009086
GO:0010309
GO:0046872
AF-B8GMB2-F1-model_v4 Acireductone dioxygenase (1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase) (DHK-MTPene dioxygenase) (Acireductone dioxygenase (Fe(2+)-requiring)) (ARD') (Fe-ARD) (EC 1.13.11.54) (Acireductone dioxygenase (Ni(2+)-requiring)) (ARD) (Ni-ARD) (EC 1.13.11.53) 0.9903 1 179 GO:0005506
GO:0010308
GO:0010309
GO:0016151
GO:0019284
GO:0019509

Feature Viewer

pLDDT pTM Quality
90.86 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map