F486943
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 964 | 306 | 964 | 61 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_1743657|Ga0395905_1743657_253_459 |
| Length | 68 |
| Sequence | VVPQVIPMMNKLYFGYGALILSLLATSEYRGWSMMSVNQVKNVPKSIRDNPGAYRSHYAFYHHYSGGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 88 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 124 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 125 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 186 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 187 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 191 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 199 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 200 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 201 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 202 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 204 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 205 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 207 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 208 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 209 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 210 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 211 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 212 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 213 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 214 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 215 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 216 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 217 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 218 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 219 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 220 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 221 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 222 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 223 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 225 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 226 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 228 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 229 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 230 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 232 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 234 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 236 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 237 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 239 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 240 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 241 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 242 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 245 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 246 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 247 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 248 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 249 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 250 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 251 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 252 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 253 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 254 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 255 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 256 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 257 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 258 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 259 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 260 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 261 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 262 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 263 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 286 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 287 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 288 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 289 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 290 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 292 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 293 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 294 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 295 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 296 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 306 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.38 |
| Metatranscriptomes | 0.62 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.1 |
| Nodule | 0 |
| Rhizoplane | 1.76 |
| Rhizosphere | 97.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10052680 | 3300001990 | Unclassified | 1233 |
| 2 | Ga0065712_10128202 | 3300005290 | Unclassified | 1582 |
| 3 | Ga0065715_10483383 | 3300005293 | Unclassified | 795 |
| 4 | Ga0065715_10745196 | 3300005293 | Unclassified | 633 |
| 5 | Ga0070658_11165103 | 3300005327 | Unclassified | 670 |
| 6 | Ga0070676_10056342 | 3300005328 | Bacteria | 2322 |
| 7 | Ga0070676_10452113 | 3300005328 | Unclassified | 903 |
| 8 | Ga0070683_100000438 | 3300005329 | Bacteria | 28908 |
| 9 | Ga0070683_100033813 | 3300005329 | Bacteria | 4665 |
| 10 | Ga0070683_100066343 | 3300005329 | Bacteria | 3362 |
| 11 | Ga0070690_100966941 | 3300005330 | Bacteria | 669 |
| 12 | Ga0070690_101082296 | 3300005330 | Unclassified | 635 |
| 13 | Ga0070690_101497252 | 3300005330 | Unclassified | 545 |
| 14 | Ga0070670_100001632 | 3300005331 | Bacteria | 18140 |
| 15 | Ga0070670_100014132 | 3300005331 | Bacteria | 6848 |
| 16 | Ga0068869_100002425 | 3300005334 | Bacteria | 11241 |
| 17 | Ga0068869_100060526 | 3300005334 | Bacteria | 2775 |
| 18 | Ga0068869_101604483 | 3300005334 | Unclassified | 579 |
| 19 | Ga0070666_10178838 | 3300005335 | Bacteria | 1487 |
| 20 | Ga0070666_10254320 | 3300005335 | Bacteria | 1244 |
| 21 | Ga0070680_100013605 | 3300005336 | Bacteria | 6342 |
| 22 | Ga0070680_100021282 | 3300005336 | Bacteria | 5153 |
| 23 | Ga0070680_100103935 | 3300005336 | Unclassified | 2360 |
| 24 | Ga0070680_100661587 | 3300005336 | Unclassified | 898 |
| 25 | Ga0068868_100009252 | 3300005338 | Bacteria | 7080 |
| 26 | Ga0068868_100017460 | 3300005338 | Bacteria | 5348 |
| 27 | Ga0068868_100042485 | 3300005338 | Bacteria | 3548 |
| 28 | Ga0068868_100107646 | 3300005338 | Bacteria | 2262 |
| 29 | Ga0068868_100521159 | 3300005338 | Bacteria | 1043 |
| 30 | Ga0070660_100450202 | 3300005339 | Bacteria | 1068 |
| 31 | Ga0070660_101351183 | 3300005339 | Unclassified | 605 |
| 32 | Ga0070660_101688382 | 3300005339 | Bacteria | 539 |
| 33 | Ga0070689_100026616 | 3300005340 | Bacteria | 4355 |
| 34 | Ga0070691_10146632 | 3300005341 | Unclassified | 1207 |
| 35 | Ga0070691_10248354 | 3300005341 | Unclassified | 953 |
| 36 | Ga0070687_100422813 | 3300005343 | Bacteria | 879 |
| 37 | Ga0070661_100021208 | 3300005344 | Bacteria | 4637 |
| 38 | Ga0070661_100154423 | 3300005344 | Bacteria | 1736 |
| 39 | Ga0070661_100181596 | 3300005344 | Unclassified | 1601 |
| 40 | Ga0070661_100182799 | 3300005344 | Bacteria | 1596 |
| 41 | Ga0070661_100427738 | 3300005344 | Bacteria | 1050 |
| 42 | Ga0070675_100919342 | 3300005354 | Unclassified | 802 |
| 43 | Ga0070675_101545372 | 3300005354 | Unclassified | 612 |
| 44 | Ga0070671_100013048 | 3300005355 | Bacteria | 6697 |
| 45 | Ga0070673_100029967 | 3300005364 | Bacteria | 4065 |
| 46 | Ga0070673_100517225 | 3300005364 | Bacteria | 1081 |
| 47 | Ga0070673_100541546 | 3300005364 | Bacteria | 1057 |
| 48 | Ga0070688_100615938 | 3300005365 | Unclassified | 832 |
| 49 | Ga0070688_100987175 | 3300005365 | Bacteria | 668 |
| 50 | Ga0070659_100110279 | 3300005366 | Bacteria | 2221 |
| 51 | Ga0070667_100002851 | 3300005367 | Bacteria | 14921 |
| 52 | Ga0070667_100713627 | 3300005367 | Unclassified | 928 |
| 53 | Ga0070667_101007700 | 3300005367 | Bacteria | 777 |
| 54 | Ga0070667_101462817 | 3300005367 | Unclassified | 641 |
| 55 | Ga0070703_10001660 | 3300005406 | Bacteria | 6604 |
| 56 | Ga0070703_10064328 | 3300005406 | Unclassified | 1208 |
| 57 | Ga0070703_10456501 | 3300005406 | Unclassified | 567 |
| 58 | Ga0070709_10000507 | 3300005434 | Bacteria | 22990 |
| 59 | Ga0070709_10264690 | 3300005434 | Bacteria | 1244 |
| 60 | Ga0070709_10391021 | 3300005434 | Bacteria | 1036 |
| 61 | Ga0070709_10521166 | 3300005434 | Bacteria | 906 |
| 62 | Ga0070709_10688130 | 3300005434 | Unclassified | 795 |
| 63 | Ga0070709_10847955 | 3300005434 | Unclassified | 720 |
| 64 | Ga0070709_10917543 | 3300005434 | Unclassified | 693 |
| 65 | Ga0070709_10940574 | 3300005434 | Unclassified | 685 |
| 66 | Ga0070709_11124098 | 3300005434 | Bacteria | 629 |
| 67 | Ga0070709_11378858 | 3300005434 | Unclassified | 570 |
| 68 | Ga0070709_11578350 | 3300005434 | Unclassified | 534 |
| 69 | Ga0070714_100003128 | 3300005435 | Bacteria | 12293 |
| 70 | Ga0070714_100032923 | 3300005435 | Bacteria | 4330 |
| 71 | Ga0070714_100089449 | 3300005435 | Archaea | 2695 |
| 72 | Ga0070714_100107226 | 3300005435 | Unclassified | 2469 |
| 73 | Ga0070714_100142199 | 3300005435 | Bacteria | 2155 |
| 74 | Ga0070714_100302845 | 3300005435 | Bacteria | 1490 |
| 75 | Ga0070714_100396821 | 3300005435 | Bacteria | 1303 |
| 76 | Ga0070714_100502360 | 3300005435 | Bacteria | 1156 |
| 77 | Ga0070714_101046412 | 3300005435 | Unclassified | 795 |
| 78 | Ga0070714_101163503 | 3300005435 | Bacteria | 752 |
| 79 | Ga0070714_102134848 | 3300005435 | Unclassified | 546 |
| 80 | Ga0070713_100001370 | 3300005436 | Bacteria | 15591 |
| 81 | Ga0070713_100010397 | 3300005436 | Bacteria | 6720 |
| 82 | Ga0070713_100026210 | 3300005436 | Bacteria | 4573 |
| 83 | Ga0070713_100030154 | 3300005436 | Bacteria | 4304 |
| 84 | Ga0070713_100084861 | 3300005436 | Bacteria | 2711 |
| 85 | Ga0070713_100095619 | 3300005436 | Unclassified | 2563 |
| 86 | Ga0070713_100106076 | 3300005436 | Bacteria | 2442 |
| 87 | Ga0070713_100161289 | 3300005436 | Unclassified | 2002 |
| 88 | Ga0070713_100323505 | 3300005436 | Bacteria | 1425 |
| 89 | Ga0070713_100332755 | 3300005436 | Bacteria | 1405 |
| 90 | Ga0070713_100360917 | 3300005436 | Unclassified | 1350 |
| 91 | Ga0070713_100419342 | 3300005436 | Bacteria | 1253 |
| 92 | Ga0070713_101100887 | 3300005436 | Unclassified | 768 |
| 93 | Ga0070713_101303826 | 3300005436 | Unclassified | 704 |
| 94 | Ga0070713_101553265 | 3300005436 | Bacteria | 642 |
| 95 | Ga0070713_101587095 | 3300005436 | Unclassified | 635 |
| 96 | Ga0070710_10159850 | 3300005437 | Bacteria | 1396 |
| 97 | Ga0070710_10237380 | 3300005437 | Bacteria | 1166 |
| 98 | Ga0070710_10269649 | 3300005437 | Unclassified | 1100 |
| 99 | Ga0070710_10280676 | 3300005437 | Bacteria | 1081 |
| 100 | Ga0070710_10855398 | 3300005437 | Unclassified | 653 |
| 101 | Ga0070710_11160455 | 3300005437 | Unclassified | 569 |
| 102 | Ga0070710_11294409 | 3300005437 | Bacteria | 542 |
| 103 | Ga0070711_100018228 | 3300005439 | Bacteria | 4479 |
| 104 | Ga0070711_100072732 | 3300005439 | Unclassified | 2426 |
| 105 | Ga0070711_100125948 | 3300005439 | Bacteria | 1901 |
| 106 | Ga0070711_100222946 | 3300005439 | Bacteria | 1466 |
| 107 | Ga0070711_100723820 | 3300005439 | Bacteria | 839 |
| 108 | Ga0070711_100783166 | 3300005439 | Unclassified | 808 |
| 109 | Ga0070711_101369111 | 3300005439 | Unclassified | 615 |
| 110 | Ga0070711_101516063 | 3300005439 | Unclassified | 585 |
| 111 | Ga0070711_102061543 | 3300005439 | Unclassified | 502 |
| 112 | Ga0070705_100003341 | 3300005440 | Bacteria | 7874 |
| 113 | Ga0070705_100093454 | 3300005440 | Bacteria | 1880 |
| 114 | Ga0070705_100982017 | 3300005440 | Bacteria | 684 |
| 115 | Ga0070705_101844869 | 3300005440 | Unclassified | 513 |
| 116 | Ga0070700_100839847 | 3300005441 | Bacteria | 743 |
| 117 | Ga0070700_101280456 | 3300005441 | Bacteria | 615 |
| 118 | Ga0070700_101479031 | 3300005441 | Bacteria | 577 |
| 119 | Ga0070694_100031049 | 3300005444 | Bacteria | 3501 |
| 120 | Ga0070694_100169399 | 3300005444 | Unclassified | 1608 |
| 121 | Ga0070694_100218210 | 3300005444 | Unclassified | 1429 |
| 122 | Ga0070694_100301584 | 3300005444 | Unclassified | 1228 |
| 123 | Ga0070694_100558985 | 3300005444 | Unclassified | 917 |
| 124 | Ga0070694_101245056 | 3300005444 | Unclassified | 624 |
| 125 | Ga0070708_100002244 | 3300005445 | Bacteria | 14935 |
| 126 | Ga0070678_100946737 | 3300005456 | Bacteria | 789 |
| 127 | Ga0070678_102053868 | 3300005456 | Unclassified | 541 |
| 128 | Ga0070662_100260396 | 3300005457 | Bacteria | 1397 |
| 129 | Ga0070681_10000889 | 3300005458 | Bacteria | 25259 |
| 130 | Ga0070681_10100708 | 3300005458 | Bacteria | 2835 |
| 131 | Ga0070681_10488730 | 3300005458 | Unclassified | 1144 |
| 132 | Ga0070681_10505248 | 3300005458 | Archaea | 1122 |
| 133 | Ga0070681_10523702 | 3300005458 | Unclassified | 1099 |
| 134 | Ga0068867_100032811 | 3300005459 | Bacteria | 3757 |
| 135 | Ga0068867_100451641 | 3300005459 | Bacteria | 1095 |
| 136 | Ga0068867_100579779 | 3300005459 | Unclassified | 975 |
| 137 | Ga0070685_10344213 | 3300005466 | Unclassified | 1017 |
| 138 | Ga0070706_100001656 | 3300005467 | Bacteria | 23195 |
| 139 | Ga0070706_100022160 | 3300005467 | Bacteria | 5849 |
| 140 | Ga0070707_100057490 | 3300005468 | Bacteria | 3731 |
| 141 | Ga0070707_101546296 | 3300005468 | Unclassified | 630 |
| 142 | Ga0070698_101466640 | 3300005471 | Unclassified | 633 |
| 143 | Ga0070699_100015160 | 3300005518 | Bacteria | 6621 |
| 144 | Ga0070699_100046927 | 3300005518 | Bacteria | 3738 |
| 145 | Ga0070699_100524529 | 3300005518 | Bacteria | 1077 |
| 146 | Ga0070679_100004003 | 3300005530 | Bacteria | 13576 |
| 147 | Ga0070679_100017595 | 3300005530 | Bacteria | 6918 |
| 148 | Ga0070679_100185470 | 3300005530 | Bacteria | 2051 |
| 149 | Ga0070679_100920642 | 3300005530 | Bacteria | 818 |
| 150 | Ga0070679_101404800 | 3300005530 | Unclassified | 644 |
| 151 | Ga0070679_102068572 | 3300005530 | Bacteria | 519 |
| 152 | Ga0070684_100000161 | 3300005535 | Bacteria | 45787 |
| 153 | Ga0070684_100051499 | 3300005535 | Unclassified | 3577 |
| 154 | Ga0070684_100160856 | 3300005535 | Bacteria | 2037 |
| 155 | Ga0070684_100424625 | 3300005535 | Bacteria | 1227 |
| 156 | Ga0070697_100001122 | 3300005536 | Bacteria | 20239 |
| 157 | Ga0070697_101891067 | 3300005536 | Unclassified | 534 |
| 158 | Ga0068853_100002829 | 3300005539 | Bacteria | 13148 |
| 159 | Ga0068853_100036727 | 3300005539 | Bacteria | 4167 |
| 160 | Ga0068853_100066650 | 3300005539 | Bacteria | 3127 |
| 161 | Ga0068853_100077660 | 3300005539 | Bacteria | 2901 |
| 162 | Ga0068853_100243654 | 3300005539 | Bacteria | 1648 |
| 163 | Ga0068853_100374128 | 3300005539 | Bacteria | 1329 |
| 164 | Ga0068853_100375091 | 3300005539 | Bacteria | 1328 |
| 165 | Ga0070672_102163906 | 3300005543 | Unclassified | 501 |
| 166 | Ga0070686_100681698 | 3300005544 | Unclassified | 818 |
| 167 | Ga0070695_100023474 | 3300005545 | Bacteria | 3791 |
| 168 | Ga0070695_100731539 | 3300005545 | Unclassified | 788 |
| 169 | Ga0070696_100002232 | 3300005546 | Bacteria | 12773 |
| 170 | Ga0070696_100027378 | 3300005546 | Bacteria | 3883 |
| 171 | Ga0070696_100836421 | 3300005546 | Unclassified | 760 |
| 172 | Ga0070693_100000295 | 3300005547 | Bacteria | 23286 |
| 173 | Ga0070693_100089502 | 3300005547 | Unclassified | 1853 |
| 174 | Ga0070693_100341745 | 3300005547 | Bacteria | 1022 |
| 175 | Ga0070693_100364139 | 3300005547 | Unclassified | 993 |
| 176 | Ga0070665_100073606 | 3300005548 | Bacteria | 3422 |
| 177 | Ga0070665_100904305 | 3300005548 | Unclassified | 895 |
| 178 | Ga0070704_100007127 | 3300005549 | Bacteria | 6640 |
| 179 | Ga0070704_100010318 | 3300005549 | Bacteria | 5682 |
| 180 | Ga0070704_101173491 | 3300005549 | Unclassified | 699 |
| 181 | Ga0070704_101529067 | 3300005549 | Unclassified | 614 |
| 182 | Ga0070704_102281412 | 3300005549 | Bacteria | 503 |
| 183 | Ga0068855_100002570 | 3300005563 | Bacteria | 22367 |
| 184 | Ga0068855_100003811 | 3300005563 | Bacteria | 18432 |
| 185 | Ga0068855_100008508 | 3300005563 | Bacteria | 12405 |
| 186 | Ga0068855_100048632 | 3300005563 | Bacteria | 5004 |
| 187 | Ga0068855_100323864 | 3300005563 | Bacteria | 1703 |
| 188 | Ga0068855_100551543 | 3300005563 | Bacteria | 1247 |
| 189 | Ga0070664_100000783 | 3300005564 | Bacteria | 24509 |
| 190 | Ga0070664_100147701 | 3300005564 | Bacteria | 2074 |
| 191 | Ga0070664_100275354 | 3300005564 | Bacteria | 1517 |
| 192 | Ga0070664_100498614 | 3300005564 | Bacteria | 1122 |
| 193 | Ga0068857_100003923 | 3300005577 | Bacteria | 12520 |
| 194 | Ga0068857_100005145 | 3300005577 | Bacteria | 11123 |
| 195 | Ga0068857_100014161 | 3300005577 | Bacteria | 6945 |
| 196 | Ga0068857_100928660 | 3300005577 | Bacteria | 835 |
| 197 | Ga0068854_100019251 | 3300005578 | Bacteria | 4597 |
| 198 | Ga0068854_100040920 | 3300005578 | Bacteria | 3272 |
| 199 | Ga0068854_100109442 | 3300005578 | Unclassified | 2082 |
| 200 | Ga0068854_100163713 | 3300005578 | Bacteria | 1725 |
| 201 | Ga0068854_100259920 | 3300005578 | Unclassified | 1390 |
| 202 | Ga0068854_100351078 | 3300005578 | Bacteria | 1207 |
| 203 | Ga0068856_100001743 | 3300005614 | Bacteria | 22730 |
| 204 | Ga0068856_100002735 | 3300005614 | Bacteria | 18057 |
| 205 | Ga0068856_100008054 | 3300005614 | Bacteria | 10286 |
| 206 | Ga0068856_100010164 | 3300005614 | Bacteria | 9146 |
| 207 | Ga0068856_100016286 | 3300005614 | Bacteria | 7194 |
| 208 | Ga0068856_100036270 | 3300005614 | Bacteria | 4835 |
| 209 | Ga0068856_100799421 | 3300005614 | Bacteria | 963 |
| 210 | Ga0070702_100312074 | 3300005615 | Bacteria | 1092 |
| 211 | Ga0070702_101192025 | 3300005615 | Unclassified | 613 |
| 212 | Ga0068852_100000168 | 3300005616 | Bacteria | 43887 |
| 213 | Ga0068852_100069289 | 3300005616 | Bacteria | 3091 |
| 214 | Ga0068852_100137636 | 3300005616 | Bacteria | 2256 |
| 215 | Ga0068852_100237394 | 3300005616 | Bacteria | 1740 |
| 216 | Ga0068852_100399355 | 3300005616 | Bacteria | 1352 |
| 217 | Ga0068852_102336666 | 3300005616 | Bacteria | 555 |
| 218 | Ga0068859_100003212 | 3300005617 | Bacteria | 16644 |
| 219 | Ga0068859_100014850 | 3300005617 | Bacteria | 7820 |
| 220 | Ga0068859_100140371 | 3300005617 | Bacteria | 2490 |
| 221 | Ga0068859_100257426 | 3300005617 | Bacteria | 1836 |
| 222 | Ga0068859_100295863 | 3300005617 | Bacteria | 1712 |
| 223 | Ga0068859_101272925 | 3300005617 | Unclassified | 810 |
| 224 | Ga0068864_100000766 | 3300005618 | Bacteria | 27024 |
| 225 | Ga0068864_100011620 | 3300005618 | Bacteria | 7271 |
| 226 | Ga0068864_100095357 | 3300005618 | Bacteria | 2631 |
| 227 | Ga0068864_100203680 | 3300005618 | Bacteria | 1819 |
| 228 | Ga0068864_102024714 | 3300005618 | Unclassified | 582 |
| 229 | Ga0068866_10002462 | 3300005718 | Bacteria | 7635 |
| 230 | Ga0068866_10157226 | 3300005718 | Unclassified | 1322 |
| 231 | Ga0068866_10231881 | 3300005718 | Bacteria | 1120 |
| 232 | Ga0068866_10738451 | 3300005718 | Unclassified | 679 |
| 233 | Ga0068861_100489373 | 3300005719 | Unclassified | 1110 |
| 234 | Ga0068861_100651228 | 3300005719 | Bacteria | 973 |
| 235 | Ga0068861_101412505 | 3300005719 | Unclassified | 680 |
| 236 | Ga0068851_10020291 | 3300005834 | Bacteria | 3216 |
| 237 | Ga0068851_10160405 | 3300005834 | Bacteria | 1235 |
| 238 | Ga0068851_10315542 | 3300005834 | Unclassified | 902 |
| 239 | Ga0068851_10487564 | 3300005834 | Unclassified | 737 |
| 240 | Ga0068851_10959188 | 3300005834 | Bacteria | 538 |
| 241 | Ga0068870_10065149 | 3300005840 | Bacteria | 1970 |
| 242 | Ga0068870_10720017 | 3300005840 | Unclassified | 690 |
| 243 | Ga0068863_100030309 | 3300005841 | Bacteria | 5167 |
| 244 | Ga0068863_100216816 | 3300005841 | Bacteria | 1843 |
| 245 | Ga0068863_100720980 | 3300005841 | Unclassified | 992 |
| 246 | Ga0068863_102173634 | 3300005841 | Unclassified | 565 |
| 247 | Ga0068858_100004451 | 3300005842 | Bacteria | 13736 |
| 248 | Ga0068858_100251338 | 3300005842 | Unclassified | 1679 |
| 249 | Ga0068858_100451508 | 3300005842 | Bacteria | 1239 |
| 250 | Ga0068858_100476863 | 3300005842 | Bacteria | 1204 |
| 251 | Ga0068858_100607844 | 3300005842 | Bacteria | 1061 |
| 252 | Ga0068858_101995095 | 3300005842 | Bacteria | 574 |
| 253 | Ga0068860_100000853 | 3300005843 | Bacteria | 34017 |
| 254 | Ga0068860_100020434 | 3300005843 | Bacteria | 6413 |
| 255 | Ga0068860_100167732 | 3300005843 | Bacteria | 2120 |
| 256 | Ga0068860_100271543 | 3300005843 | Unclassified | 1655 |
| 257 | Ga0068860_100586861 | 3300005843 | Bacteria | 1119 |
| 258 | Ga0068860_101312552 | 3300005843 | Unclassified | 744 |
| 259 | Ga0068862_100073831 | 3300005844 | Unclassified | 2948 |
| 260 | Ga0068862_100370621 | 3300005844 | Bacteria | 1333 |
| 261 | Ga0068862_100508828 | 3300005844 | Unclassified | 1144 |
| 262 | Ga0068862_100750699 | 3300005844 | Unclassified | 949 |
| 263 | Ga0070717_10012117 | 3300006028 | Bacteria | 6571 |
| 264 | Ga0070717_10012954 | 3300006028 | Bacteria | 6370 |
| 265 | Ga0070717_10020526 | 3300006028 | Bacteria | 5198 |
| 266 | Ga0070717_10042888 | 3300006028 | Bacteria | 3691 |
| 267 | Ga0070717_10152624 | 3300006028 | Bacteria | 1999 |
| 268 | Ga0070717_10542042 | 3300006028 | Unclassified | 1053 |
| 269 | Ga0070717_10630547 | 3300006028 | Bacteria | 973 |
| 270 | Ga0070717_10709328 | 3300006028 | Unclassified | 914 |
| 271 | Ga0070717_10979485 | 3300006028 | Unclassified | 770 |
| 272 | Ga0070717_11233949 | 3300006028 | Unclassified | 680 |
| 273 | Ga0070717_11457961 | 3300006028 | Bacteria | 621 |
| 274 | Ga0070717_11485981 | 3300006028 | Unclassified | 615 |
| 275 | Ga0070717_11713681 | 3300006028 | Unclassified | 569 |
| 276 | Ga0070717_11789576 | 3300006028 | Unclassified | 555 |
| 277 | Ga0070715_10000253 | 3300006163 | Bacteria | 12883 |
| 278 | Ga0070715_10034982 | 3300006163 | Bacteria | 2063 |
| 279 | Ga0070715_10238212 | 3300006163 | Unclassified | 945 |
| 280 | Ga0070715_10328535 | 3300006163 | Unclassified | 828 |
| 281 | Ga0070715_10838494 | 3300006163 | Unclassified | 561 |
| 282 | Ga0070716_100000178 | 3300006173 | Bacteria | 24984 |
| 283 | Ga0070716_100000490 | 3300006173 | Bacteria | 16446 |
| 284 | Ga0070716_100042800 | 3300006173 | Bacteria | 2530 |
| 285 | Ga0070716_100920431 | 3300006173 | Bacteria | 686 |
| 286 | Ga0070716_101506081 | 3300006173 | Unclassified | 550 |
| 287 | Ga0070712_100000621 | 3300006175 | Bacteria | 20835 |
| 288 | Ga0070712_100018290 | 3300006175 | Unclassified | 4549 |
| 289 | Ga0070712_100027738 | 3300006175 | Bacteria | 3784 |
| 290 | Ga0070712_100122448 | 3300006175 | Bacteria | 1959 |
| 291 | Ga0070712_100154487 | 3300006175 | Bacteria | 1765 |
| 292 | Ga0070712_100195428 | 3300006175 | Bacteria | 1586 |
| 293 | Ga0070712_100226607 | 3300006175 | Bacteria | 1482 |
| 294 | Ga0070712_100286398 | 3300006175 | Unclassified | 1329 |
| 295 | Ga0070712_100471613 | 3300006175 | Bacteria | 1048 |
| 296 | Ga0070712_100590917 | 3300006175 | Bacteria | 939 |
| 297 | Ga0070712_100818760 | 3300006175 | Bacteria | 800 |
| 298 | Ga0097621_100000511 | 3300006237 | Bacteria | 27180 |
| 299 | Ga0097621_100001738 | 3300006237 | Bacteria | 14915 |
| 300 | Ga0097621_100002181 | 3300006237 | Bacteria | 13401 |
| 301 | Ga0097621_100211540 | 3300006237 | Bacteria | 1687 |
| 302 | Ga0097621_101084681 | 3300006237 | Unclassified | 751 |
| 303 | Ga0097621_102375710 | 3300006237 | Unclassified | 507 |
| 304 | Ga0068871_100000684 | 3300006358 | Bacteria | 23102 |
| 305 | Ga0068871_100000776 | 3300006358 | Bacteria | 21491 |
| 306 | Ga0068871_100628260 | 3300006358 | Unclassified | 979 |
| 307 | Ga0068871_101000732 | 3300006358 | Unclassified | 778 |
| 308 | Ga0075428_100188782 | 3300006844 | Bacteria | 2229 |
| 309 | Ga0075430_100782983 | 3300006846 | Bacteria | 786 |
| 310 | Ga0075431_100257664 | 3300006847 | Bacteria | 1771 |
| 311 | Ga0075431_100982536 | 3300006847 | Unclassified | 812 |
| 312 | Ga0075431_101519816 | 3300006847 | Unclassified | 628 |
| 313 | Ga0075433_10004290 | 3300006852 | Bacteria | 11075 |
| 314 | Ga0075433_10007666 | 3300006852 | Bacteria | 8572 |
| 315 | Ga0075433_10474590 | 3300006852 | Bacteria | 1102 |
| 316 | Ga0075433_10759547 | 3300006852 | Unclassified | 848 |
| 317 | Ga0075434_100003219 | 3300006871 | Bacteria | 14566 |
| 318 | Ga0075434_100010157 | 3300006871 | Bacteria | 8819 |
| 319 | Ga0075434_100086778 | 3300006871 | Bacteria | 3130 |
| 320 | Ga0075429_100163757 | 3300006880 | Bacteria | 1948 |
| 321 | Ga0068865_100350187 | 3300006881 | Bacteria | 1196 |
| 322 | Ga0068865_100502159 | 3300006881 | Bacteria | 1011 |
| 323 | Ga0075436_100000734 | 3300006914 | Bacteria | 21719 |
| 324 | Ga0075436_100169836 | 3300006914 | Bacteria | 1540 |
| 325 | Ga0075436_100745924 | 3300006914 | Unclassified | 727 |
| 326 | Ga0075436_100892282 | 3300006914 | Bacteria | 665 |
| 327 | Ga0097620_100003212 | 3300006931 | Bacteria | 16644 |
| 328 | Ga0097620_100014850 | 3300006931 | Bacteria | 7820 |
| 329 | Ga0097620_100140376 | 3300006931 | Bacteria | 2490 |
| 330 | Ga0097620_100257421 | 3300006931 | Bacteria | 1836 |
| 331 | Ga0097620_100295829 | 3300006931 | Bacteria | 1712 |
| 332 | Ga0097620_101272729 | 3300006931 | Unclassified | 810 |
| 333 | Ga0075435_100262401 | 3300007076 | Unclassified | 1472 |
| 334 | Ga0075435_101437597 | 3300007076 | Unclassified | 604 |
| 335 | Ga0075435_101799759 | 3300007076 | Unclassified | 538 |
| 336 | Ga0099794_10014819 | 3300007265 | Bacteria | 3426 |
| 337 | Ga0099794_10099181 | 3300007265 | Unclassified | 1453 |
| 338 | Ga0099794_10145911 | 3300007265 | Bacteria | 1200 |
| 339 | Ga0099794_10253522 | 3300007265 | Unclassified | 908 |
| 340 | Ga0099794_10275485 | 3300007265 | Bacteria | 869 |
| 341 | Ga0099794_10471416 | 3300007265 | Bacteria | 659 |
| 342 | Ga0099794_10647655 | 3300007265 | Unclassified | 561 |
| 343 | Ga0099795_10009030 | 3300007788 | Unclassified | 2875 |
| 344 | Ga0099795_10581405 | 3300007788 | Unclassified | 531 |
| 345 | Ga0105240_10002969 | 3300009093 | Bacteria | 26696 |
| 346 | Ga0105240_10004531 | 3300009093 | Bacteria | 21107 |
| 347 | Ga0105240_10008135 | 3300009093 | Bacteria | 15045 |
| 348 | Ga0105240_10015824 | 3300009093 | Bacteria | 10232 |
| 349 | Ga0105240_10021182 | 3300009093 | Bacteria | 8653 |
| 350 | Ga0105240_10373775 | 3300009093 | Bacteria | 1611 |
| 351 | Ga0105240_11635146 | 3300009093 | Unclassified | 673 |
| 352 | Ga0105240_12191163 | 3300009093 | Unclassified | 573 |
| 353 | Ga0105240_12210262 | 3300009093 | Bacteria | 570 |
| 354 | Ga0111539_10008937 | 3300009094 | Bacteria | 12685 |
| 355 | Ga0111539_10040813 | 3300009094 | Bacteria | 5584 |
| 356 | Ga0105245_10002548 | 3300009098 | Bacteria | 16410 |
| 357 | Ga0105245_10058933 | 3300009098 | Bacteria | 3456 |
| 358 | Ga0105245_10179032 | 3300009098 | Bacteria | 2024 |
| 359 | Ga0105245_10826583 | 3300009098 | Bacteria | 965 |
| 360 | Ga0105245_10910675 | 3300009098 | Bacteria | 921 |
| 361 | Ga0105245_11448356 | 3300009098 | Bacteria | 737 |
| 362 | Ga0105245_12307064 | 3300009098 | Unclassified | 592 |
| 363 | Ga0105245_13150453 | 3300009098 | Unclassified | 511 |
| 364 | Ga0105247_10000309 | 3300009101 | Bacteria | 43841 |
| 365 | Ga0105247_11074500 | 3300009101 | Unclassified | 633 |
| 366 | Ga0105247_11075328 | 3300009101 | Bacteria | 633 |
| 367 | Ga0114129_10027832 | 3300009147 | Bacteria | 8006 |
| 368 | Ga0114129_10229636 | 3300009147 | Bacteria | 2500 |
| 369 | Ga0114129_10316878 | 3300009147 | Bacteria | 2074 |
| 370 | Ga0114129_10670886 | 3300009147 | Unclassified | 1336 |
| 371 | Ga0114129_11211637 | 3300009147 | Bacteria | 940 |
| 372 | Ga0105243_11970850 | 3300009148 | Unclassified | 618 |
| 373 | Ga0105241_10000484 | 3300009174 | Bacteria | 30045 |
| 374 | Ga0105241_10002430 | 3300009174 | Bacteria | 13979 |
| 375 | Ga0105241_10003383 | 3300009174 | Bacteria | 11881 |
| 376 | Ga0105241_10009593 | 3300009174 | Bacteria | 7116 |
| 377 | Ga0105241_10084876 | 3300009174 | Bacteria | 2487 |
| 378 | Ga0105241_10217895 | 3300009174 | Bacteria | 1602 |
| 379 | Ga0105241_10272123 | 3300009174 | Bacteria | 1443 |
| 380 | Ga0105241_10296555 | 3300009174 | Bacteria | 1386 |
| 381 | Ga0105241_10427908 | 3300009174 | Unclassified | 1166 |
| 382 | Ga0105241_12438448 | 3300009174 | Unclassified | 523 |
| 383 | Ga0105242_10626314 | 3300009176 | Bacteria | 1043 |
| 384 | Ga0105242_12143368 | 3300009176 | Bacteria | 603 |
| 385 | Ga0105248_10002507 | 3300009177 | Bacteria | 20434 |
| 386 | Ga0105248_10004010 | 3300009177 | Bacteria | 16271 |
| 387 | Ga0105248_10006361 | 3300009177 | Bacteria | 12955 |
| 388 | Ga0105248_10103783 | 3300009177 | Bacteria | 3204 |
| 389 | Ga0105248_10148866 | 3300009177 | Bacteria | 2641 |
| 390 | Ga0105248_10203549 | 3300009177 | Bacteria | 2230 |
| 391 | Ga0105248_10380910 | 3300009177 | Bacteria | 1588 |
| 392 | Ga0105248_10464828 | 3300009177 | Bacteria | 1426 |
| 393 | Ga0105248_12442422 | 3300009177 | Bacteria | 595 |
| 394 | Ga0105248_12815132 | 3300009177 | Bacteria | 555 |
| 395 | Ga0105237_10003212 | 3300009545 | Bacteria | 19577 |
| 396 | Ga0105237_10006164 | 3300009545 | Bacteria | 13401 |
| 397 | Ga0105237_10013070 | 3300009545 | Bacteria | 8717 |
| 398 | Ga0105237_10053146 | 3300009545 | Bacteria | 4064 |
| 399 | Ga0105237_10070700 | 3300009545 | Bacteria | 3486 |
| 400 | Ga0105237_10099970 | 3300009545 | Bacteria | 2891 |
| 401 | Ga0105237_10189691 | 3300009545 | Bacteria | 2056 |
| 402 | Ga0105237_10305096 | 3300009545 | Bacteria | 1595 |
| 403 | Ga0105237_12114703 | 3300009545 | Bacteria | 572 |
| 404 | Ga0105238_10000064 | 3300009551 | Bacteria | 122380 |
| 405 | Ga0105238_10000158 | 3300009551 | Bacteria | 74148 |
| 406 | Ga0105238_10003686 | 3300009551 | Bacteria | 15258 |
| 407 | Ga0105238_10192473 | 3300009551 | Bacteria | 2015 |
| 408 | Ga0105238_10244069 | 3300009551 | Bacteria | 1774 |
| 409 | Ga0105238_10252412 | 3300009551 | Unclassified | 1742 |
| 410 | Ga0105238_10431567 | 3300009551 | Unclassified | 1313 |
| 411 | Ga0105238_10540399 | 3300009551 | Bacteria | 1169 |
| 412 | Ga0105238_11164847 | 3300009551 | Bacteria | 795 |
| 413 | Ga0105238_11564820 | 3300009551 | Unclassified | 689 |
| 414 | Ga0105238_12277319 | 3300009551 | Unclassified | 577 |
| 415 | Ga0105249_10016698 | 3300009553 | Bacteria | 6514 |
| 416 | Ga0105249_10018782 | 3300009553 | Bacteria | 6160 |
| 417 | Ga0105249_10616205 | 3300009553 | Bacteria | 1141 |
| 418 | Ga0105249_11138738 | 3300009553 | Unclassified | 851 |
| 419 | Ga0099796_10095858 | 3300010159 | Unclassified | 1109 |
| 420 | Ga0099796_10129073 | 3300010159 | Bacteria | 978 |
| 421 | Ga0105239_10005034 | 3300010375 | Bacteria | 15602 |
| 422 | Ga0105239_10006631 | 3300010375 | Bacteria | 13401 |
| 423 | Ga0105239_10008365 | 3300010375 | Bacteria | 11785 |
| 424 | Ga0105239_10161015 | 3300010375 | Bacteria | 2507 |
| 425 | Ga0105239_10308132 | 3300010375 | Bacteria | 1784 |
| 426 | Ga0105239_11358221 | 3300010375 | Unclassified | 820 |
| 427 | Ga0105239_11858183 | 3300010375 | Unclassified | 698 |
| 428 | Ga0105246_10143174 | 3300011119 | Bacteria | 1800 |
| 429 | Ga0105246_10796550 | 3300011119 | Bacteria | 838 |
| 430 | Ga0157345_1053021 | 3300012498 | Unclassified | 521 |
| 431 | Ga0157373_10024268 | 3300013100 | Bacteria | 4394 |
| 432 | Ga0157373_10224107 | 3300013100 | Bacteria | 1327 |
| 433 | Ga0157373_10354300 | 3300013100 | Bacteria | 1047 |
| 434 | Ga0157373_10360877 | 3300013100 | Unclassified | 1037 |
| 435 | Ga0157373_11556906 | 3300013100 | Unclassified | 505 |
| 436 | Ga0157371_10071067 | 3300013102 | Bacteria | 2464 |
| 437 | Ga0157371_10326905 | 3300013102 | Bacteria | 1113 |
| 438 | Ga0157371_10377394 | 3300013102 | Unclassified | 1035 |
| 439 | Ga0157371_10958241 | 3300013102 | Unclassified | 651 |
| 440 | Ga0157370_10316768 | 3300013104 | Bacteria | 1439 |
| 441 | Ga0157370_10370282 | 3300013104 | Bacteria | 1320 |
| 442 | Ga0157370_10375612 | 3300013104 | Bacteria | 1310 |
| 443 | Ga0157369_10001758 | 3300013105 | Bacteria | 26263 |
| 444 | Ga0157369_10012629 | 3300013105 | Bacteria | 9577 |
| 445 | Ga0157369_10040898 | 3300013105 | Bacteria | 5059 |
| 446 | Ga0157369_10047007 | 3300013105 | Bacteria | 4687 |
| 447 | Ga0157369_10285123 | 3300013105 | Bacteria | 1720 |
| 448 | Ga0157369_12597355 | 3300013105 | Unclassified | 512 |
| 449 | Ga0157374_10000140 | 3300013296 | Bacteria | 65420 |
| 450 | Ga0157374_10000606 | 3300013296 | Bacteria | 31772 |
| 451 | Ga0157374_10000932 | 3300013296 | Bacteria | 25459 |
| 452 | Ga0157374_10003280 | 3300013296 | Bacteria | 13597 |
| 453 | Ga0157374_10023342 | 3300013296 | Bacteria | 5532 |
| 454 | Ga0157374_10777652 | 3300013296 | Bacteria | 973 |
| 455 | Ga0157374_10871434 | 3300013296 | Bacteria | 918 |
| 456 | Ga0157374_12190900 | 3300013296 | Unclassified | 580 |
| 457 | Ga0157374_12354741 | 3300013296 | Unclassified | 560 |
| 458 | Ga0157378_10000135 | 3300013297 | Bacteria | 69913 |
| 459 | Ga0157378_10000455 | 3300013297 | Bacteria | 39050 |
| 460 | Ga0157378_10001627 | 3300013297 | Bacteria | 20310 |
| 461 | Ga0157378_10007973 | 3300013297 | Bacteria | 9245 |
| 462 | Ga0157378_10052473 | 3300013297 | Unclassified | 3628 |
| 463 | Ga0157378_10248780 | 3300013297 | Unclassified | 1701 |
| 464 | Ga0157378_10251800 | 3300013297 | Bacteria | 1691 |
| 465 | Ga0157378_10447143 | 3300013297 | Bacteria | 1282 |
| 466 | Ga0157378_10718565 | 3300013297 | Bacteria | 1020 |
| 467 | Ga0157378_10825081 | 3300013297 | Bacteria | 954 |
| 468 | Ga0157378_12769575 | 3300013297 | Unclassified | 543 |
| 469 | Ga0163162_10042583 | 3300013306 | Bacteria | 4545 |
| 470 | Ga0163162_10216306 | 3300013306 | Unclassified | 2046 |
| 471 | Ga0163162_10349710 | 3300013306 | Unclassified | 1611 |
| 472 | Ga0163162_11027437 | 3300013306 | Bacteria | 932 |
| 473 | Ga0163162_12743808 | 3300013306 | Unclassified | 567 |
| 474 | Ga0163162_13428395 | 3300013306 | Bacteria | 505 |
| 475 | Ga0157372_10000516 | 3300013307 | Bacteria | 42622 |
| 476 | Ga0157372_10001989 | 3300013307 | Bacteria | 22214 |
| 477 | Ga0157372_10004593 | 3300013307 | Bacteria | 14679 |
| 478 | Ga0157372_10008726 | 3300013307 | Bacteria | 10767 |
| 479 | Ga0157372_10031843 | 3300013307 | Bacteria | 5779 |
| 480 | Ga0157372_10112498 | 3300013307 | Bacteria | 3119 |
| 481 | Ga0157372_10362242 | 3300013307 | Bacteria | 1690 |
| 482 | Ga0157372_10374710 | 3300013307 | Bacteria | 1659 |
| 483 | Ga0157372_10501921 | 3300013307 | Bacteria | 1415 |
| 484 | Ga0157372_12212515 | 3300013307 | Bacteria | 632 |
| 485 | Ga0157372_12666079 | 3300013307 | Unclassified | 573 |
| 486 | Ga0157375_10001472 | 3300013308 | Bacteria | 20241 |
| 487 | Ga0157375_10006442 | 3300013308 | Bacteria | 10225 |
| 488 | Ga0157375_11893193 | 3300013308 | Unclassified | 708 |
| 489 | Ga0157375_12171293 | 3300013308 | Unclassified | 661 |
| 490 | Ga0163163_10206958 | 3300014325 | Bacteria | 2010 |
| 491 | Ga0163163_10794279 | 3300014325 | Bacteria | 1010 |
| 492 | Ga0163163_12209526 | 3300014325 | Unclassified | 609 |
| 493 | Ga0157380_10594063 | 3300014326 | Bacteria | 1094 |
| 494 | Ga0157380_12050046 | 3300014326 | Unclassified | 634 |
| 495 | Ga0182008_10135353 | 3300014497 | Unclassified | 1230 |
| 496 | Ga0157377_10197526 | 3300014745 | Bacteria | 1275 |
| 497 | Ga0157377_11405361 | 3300014745 | Bacteria | 550 |
| 498 | Ga0157379_10009173 | 3300014968 | Bacteria | 8618 |
| 499 | Ga0157379_10608431 | 3300014968 | Bacteria | 1021 |
| 500 | Ga0157379_10758045 | 3300014968 | Bacteria | 914 |
| 501 | Ga0157379_11723075 | 3300014968 | Bacteria | 614 |
| 502 | Ga0157379_11908651 | 3300014968 | Bacteria | 585 |
| 503 | Ga0157376_10000792 | 3300014969 | Bacteria | 20695 |
| 504 | Ga0157376_10141601 | 3300014969 | Bacteria | 2158 |
| 505 | Ga0157376_10351056 | 3300014969 | Bacteria | 1411 |
| 506 | Ga0157376_10541961 | 3300014969 | Bacteria | 1150 |
| 507 | Ga0182007_10092972 | 3300015262 | Bacteria | 994 |
| 508 | Ga0182005_1273487 | 3300015265 | Unclassified | 528 |
| 509 | Ga0163161_11612295 | 3300017792 | Bacteria | 573 |
| 510 | Ga0213873_10237122 | 3300021358 | Unclassified | 575 |
| 511 | Ga0228598_1006840 | 3300024227 | Bacteria | 2344 |
| 512 | Ga0207656_10026621 | 3300025321 | Bacteria | 2360 |
| 513 | Ga0207656_10057595 | 3300025321 | Bacteria | 1696 |
| 514 | Ga0207656_10086396 | 3300025321 | Bacteria | 1417 |
| 515 | Ga0207656_10162584 | 3300025321 | Bacteria | 1063 |
| 516 | Ga0207653_10001051 | 3300025885 | Bacteria | 9083 |
| 517 | Ga0207692_10199554 | 3300025898 | Bacteria | 1175 |
| 518 | Ga0207692_10376344 | 3300025898 | Bacteria | 880 |
| 519 | Ga0207692_10455578 | 3300025898 | Bacteria | 806 |
| 520 | Ga0207692_10713275 | 3300025898 | Unclassified | 652 |
| 521 | Ga0207692_10755779 | 3300025898 | Bacteria | 634 |
| 522 | Ga0207692_10787837 | 3300025898 | Bacteria | 621 |
| 523 | Ga0207642_10010232 | 3300025899 | Bacteria | 3296 |
| 524 | Ga0207710_10000259 | 3300025900 | Bacteria | 43990 |
| 525 | Ga0207680_10204301 | 3300025903 | Bacteria | 1348 |
| 526 | Ga0207647_10661016 | 3300025904 | Bacteria | 572 |
| 527 | Ga0207685_10004549 | 3300025905 | Unclassified | 3544 |
| 528 | Ga0207685_10034299 | 3300025905 | Bacteria | 1842 |
| 529 | Ga0207699_10001122 | 3300025906 | Bacteria | 12669 |
| 530 | Ga0207699_10043049 | 3300025906 | Bacteria | 2621 |
| 531 | Ga0207699_10051030 | 3300025906 | Bacteria | 2443 |
| 532 | Ga0207699_10568389 | 3300025906 | Bacteria | 824 |
| 533 | Ga0207699_11046953 | 3300025906 | Unclassified | 604 |
| 534 | Ga0207699_11186629 | 3300025906 | Bacteria | 565 |
| 535 | Ga0207643_10073546 | 3300025908 | Bacteria | 1970 |
| 536 | Ga0207705_10551370 | 3300025909 | Bacteria | 896 |
| 537 | Ga0207705_11108553 | 3300025909 | Bacteria | 609 |
| 538 | Ga0207684_10054909 | 3300025910 | Bacteria | 3380 |
| 539 | Ga0207684_10336419 | 3300025910 | Bacteria | 1300 |
| 540 | Ga0207654_10000151 | 3300025911 | Bacteria | 43832 |
| 541 | Ga0207654_10000976 | 3300025911 | Bacteria | 15728 |
| 542 | Ga0207654_10013505 | 3300025911 | Bacteria | 4202 |
| 543 | Ga0207654_10060382 | 3300025911 | Bacteria | 2214 |
| 544 | Ga0207654_10367985 | 3300025911 | Unclassified | 993 |
| 545 | Ga0207654_10626877 | 3300025911 | Bacteria | 769 |
| 546 | Ga0207707_10013785 | 3300025912 | Bacteria | 7049 |
| 547 | Ga0207707_10046843 | 3300025912 | Bacteria | 3766 |
| 548 | Ga0207707_10137038 | 3300025912 | Bacteria | 2140 |
| 549 | Ga0207707_10371025 | 3300025912 | Archaea | 1231 |
| 550 | Ga0207707_10506079 | 3300025912 | Bacteria | 1030 |
| 551 | Ga0207695_10001158 | 3300025913 | Bacteria | 45742 |
| 552 | Ga0207695_10001234 | 3300025913 | Bacteria | 43772 |
| 553 | Ga0207695_10006741 | 3300025913 | Bacteria | 14810 |
| 554 | Ga0207695_10035725 | 3300025913 | Bacteria | 5383 |
| 555 | Ga0207695_10089462 | 3300025913 | Bacteria | 3096 |
| 556 | Ga0207695_10171220 | 3300025913 | Unclassified | 2097 |
| 557 | Ga0207695_10273976 | 3300025913 | Bacteria | 1582 |
| 558 | Ga0207695_10584963 | 3300025913 | Bacteria | 998 |
| 559 | Ga0207671_10000942 | 3300025914 | Bacteria | 36249 |
| 560 | Ga0207671_10003174 | 3300025914 | Bacteria | 16603 |
| 561 | Ga0207671_10023281 | 3300025914 | Bacteria | 4672 |
| 562 | Ga0207671_10060323 | 3300025914 | Bacteria | 2814 |
| 563 | Ga0207671_10124349 | 3300025914 | Bacteria | 1974 |
| 564 | Ga0207671_10398154 | 3300025914 | Bacteria | 1095 |
| 565 | Ga0207671_10637122 | 3300025914 | Bacteria | 849 |
| 566 | Ga0207671_11056502 | 3300025914 | Unclassified | 639 |
| 567 | Ga0207693_10000087 | 3300025915 | Bacteria | 82834 |
| 568 | Ga0207693_10004922 | 3300025915 | Bacteria | 11223 |
| 569 | Ga0207693_10006414 | 3300025915 | Bacteria | 9750 |
| 570 | Ga0207693_10013894 | 3300025915 | Bacteria | 6484 |
| 571 | Ga0207693_10058732 | 3300025915 | Bacteria | 3013 |
| 572 | Ga0207693_10086818 | 3300025915 | Bacteria | 2451 |
| 573 | Ga0207693_10331581 | 3300025915 | Bacteria | 1191 |
| 574 | Ga0207693_10364303 | 3300025915 | Bacteria | 1131 |
| 575 | Ga0207693_11243120 | 3300025915 | Unclassified | 560 |
| 576 | Ga0207663_10007120 | 3300025916 | Bacteria | 5779 |
| 577 | Ga0207663_10023743 | 3300025916 | Bacteria | 3524 |
| 578 | Ga0207663_10081288 | 3300025916 | Bacteria | 2121 |
| 579 | Ga0207663_10257266 | 3300025916 | Bacteria | 1288 |
| 580 | Ga0207663_10263485 | 3300025916 | Unclassified | 1274 |
| 581 | Ga0207663_10435253 | 3300025916 | Bacteria | 1009 |
| 582 | Ga0207663_10594328 | 3300025916 | Unclassified | 869 |
| 583 | Ga0207660_10020764 | 3300025917 | Unclassified | 4413 |
| 584 | Ga0207660_10040717 | 3300025917 | Bacteria | 3253 |
| 585 | Ga0207660_10098100 | 3300025917 | Unclassified | 2185 |
| 586 | Ga0207660_10632907 | 3300025917 | Unclassified | 872 |
| 587 | Ga0207660_11655731 | 3300025917 | Unclassified | 515 |
| 588 | Ga0207657_11452719 | 3300025919 | Bacteria | 514 |
| 589 | Ga0207649_10016805 | 3300025920 | Bacteria | 4138 |
| 590 | Ga0207649_10026172 | 3300025920 | Unclassified | 3411 |
| 591 | Ga0207649_10097483 | 3300025920 | Bacteria | 1939 |
| 592 | Ga0207649_10139682 | 3300025920 | Bacteria | 1656 |
| 593 | Ga0207652_10013414 | 3300025921 | Bacteria | 6632 |
| 594 | Ga0207652_10058182 | 3300025921 | Bacteria | 3330 |
| 595 | Ga0207652_10348568 | 3300025921 | Bacteria | 1336 |
| 596 | Ga0207646_10280052 | 3300025922 | Bacteria | 1507 |
| 597 | Ga0207694_10000083 | 3300025924 | Bacteria | 109611 |
| 598 | Ga0207694_10000290 | 3300025924 | Bacteria | 47323 |
| 599 | Ga0207694_10001486 | 3300025924 | Bacteria | 20008 |
| 600 | Ga0207694_10017160 | 3300025924 | Bacteria | 5469 |
| 601 | Ga0207694_10122058 | 3300025924 | Bacteria | 2081 |
| 602 | Ga0207694_10135431 | 3300025924 | Bacteria | 1978 |
| 603 | Ga0207694_10809768 | 3300025924 | Unclassified | 791 |
| 604 | Ga0207694_11708307 | 3300025924 | Unclassified | 530 |
| 605 | Ga0207650_10003501 | 3300025925 | Bacteria | 10783 |
| 606 | Ga0207650_10036753 | 3300025925 | Unclassified | 3564 |
| 607 | Ga0207687_10025686 | 3300025927 | Unclassified | 3942 |
| 608 | Ga0207687_10404208 | 3300025927 | Bacteria | 1124 |
| 609 | Ga0207687_10690895 | 3300025927 | Bacteria | 865 |
| 610 | Ga0207687_11921077 | 3300025927 | Unclassified | 506 |
| 611 | Ga0207700_10004413 | 3300025928 | Bacteria | 8293 |
| 612 | Ga0207700_10007789 | 3300025928 | Bacteria | 6582 |
| 613 | Ga0207700_10010256 | 3300025928 | Bacteria | 5899 |
| 614 | Ga0207700_10078613 | 3300025928 | Bacteria | 2567 |
| 615 | Ga0207700_10176955 | 3300025928 | Unclassified | 1783 |
| 616 | Ga0207700_10189481 | 3300025928 | Bacteria | 1728 |
| 617 | Ga0207700_10233116 | 3300025928 | Bacteria | 1566 |
| 618 | Ga0207700_10263921 | 3300025928 | Bacteria | 1475 |
| 619 | Ga0207700_10989656 | 3300025928 | Bacteria | 753 |
| 620 | Ga0207700_11078737 | 3300025928 | Bacteria | 718 |
| 621 | Ga0207664_10016879 | 3300025929 | Bacteria | 5338 |
| 622 | Ga0207664_10022657 | 3300025929 | Bacteria | 4694 |
| 623 | Ga0207664_10029459 | 3300025929 | Bacteria | 4181 |
| 624 | Ga0207664_10080768 | 3300025929 | Bacteria | 2644 |
| 625 | Ga0207664_10148999 | 3300025929 | Unclassified | 1986 |
| 626 | Ga0207664_10278329 | 3300025929 | Bacteria | 1468 |
| 627 | Ga0207664_11779499 | 3300025929 | Unclassified | 539 |
| 628 | Ga0207664_11812150 | 3300025929 | Unclassified | 533 |
| 629 | Ga0207644_10015999 | 3300025931 | Bacteria | 5043 |
| 630 | Ga0207644_11623210 | 3300025931 | Unclassified | 542 |
| 631 | Ga0207690_10124302 | 3300025932 | Bacteria | 1879 |
| 632 | Ga0207706_10630245 | 3300025933 | Unclassified | 919 |
| 633 | Ga0207686_10862373 | 3300025934 | Unclassified | 729 |
| 634 | Ga0207686_10962535 | 3300025934 | Unclassified | 691 |
| 635 | Ga0207709_10594899 | 3300025935 | Bacteria | 875 |
| 636 | Ga0207709_10611036 | 3300025935 | Bacteria | 864 |
| 637 | Ga0207670_10650059 | 3300025936 | Unclassified | 869 |
| 638 | Ga0207669_10610727 | 3300025937 | Bacteria | 887 |
| 639 | Ga0207704_10852352 | 3300025938 | Unclassified | 764 |
| 640 | Ga0207665_10000015 | 3300025939 | Bacteria | 133147 |
| 641 | Ga0207665_10001233 | 3300025939 | Bacteria | 17248 |
| 642 | Ga0207665_10161663 | 3300025939 | Bacteria | 1611 |
| 643 | Ga0207665_10464952 | 3300025939 | Unclassified | 973 |
| 644 | Ga0207711_10006467 | 3300025941 | Bacteria | 9862 |
| 645 | Ga0207711_10034373 | 3300025941 | Bacteria | 4294 |
| 646 | Ga0207711_10070197 | 3300025941 | Unclassified | 3037 |
| 647 | Ga0207711_10075506 | 3300025941 | Bacteria | 2933 |
| 648 | Ga0207711_10233489 | 3300025941 | Bacteria | 1685 |
| 649 | Ga0207711_10298697 | 3300025941 | Unclassified | 1485 |
| 650 | Ga0207711_10945457 | 3300025941 | Unclassified | 801 |
| 651 | Ga0207711_11075911 | 3300025941 | Unclassified | 745 |
| 652 | Ga0207689_10002236 | 3300025942 | Bacteria | 18132 |
| 653 | Ga0207661_10011686 | 3300025944 | Bacteria | 6373 |
| 654 | Ga0207661_10026192 | 3300025944 | Bacteria | 4440 |
| 655 | Ga0207661_10073225 | 3300025944 | Unclassified | 2805 |
| 656 | Ga0207679_10062875 | 3300025945 | Bacteria | 2768 |
| 657 | Ga0207679_10216289 | 3300025945 | Bacteria | 1610 |
| 658 | Ga0207679_10405642 | 3300025945 | Bacteria | 1200 |
| 659 | Ga0207667_10000421 | 3300025949 | Bacteria | 57073 |
| 660 | Ga0207667_10004502 | 3300025949 | Bacteria | 17076 |
| 661 | Ga0207667_10007763 | 3300025949 | Bacteria | 12827 |
| 662 | Ga0207667_10018826 | 3300025949 | Bacteria | 7731 |
| 663 | Ga0207667_11232861 | 3300025949 | Unclassified | 726 |
| 664 | Ga0207651_10178702 | 3300025960 | Bacteria | 1681 |
| 665 | Ga0207651_10377906 | 3300025960 | Bacteria | 1200 |
| 666 | Ga0207712_10082876 | 3300025961 | Bacteria | 2339 |
| 667 | Ga0207712_10763314 | 3300025961 | Unclassified | 848 |
| 668 | Ga0207712_11520671 | 3300025961 | Unclassified | 600 |
| 669 | Ga0207640_10012094 | 3300025981 | Bacteria | 4906 |
| 670 | Ga0207640_10013311 | 3300025981 | Bacteria | 4711 |
| 671 | Ga0207640_10100448 | 3300025981 | Bacteria | 2027 |
| 672 | Ga0207640_10226484 | 3300025981 | Unclassified | 1435 |
| 673 | Ga0207640_10477656 | 3300025981 | Bacteria | 1033 |
| 674 | Ga0207640_11352793 | 3300025981 | Bacteria | 637 |
| 675 | Ga0207658_10002295 | 3300025986 | Bacteria | 14127 |
| 676 | Ga0207658_10945985 | 3300025986 | Unclassified | 785 |
| 677 | Ga0207658_12140708 | 3300025986 | Unclassified | 508 |
| 678 | Ga0207677_10001520 | 3300026023 | Bacteria | 12266 |
| 679 | Ga0207677_10005380 | 3300026023 | Bacteria | 6943 |
| 680 | Ga0207677_10116801 | 3300026023 | Bacteria | 1998 |
| 681 | Ga0207677_10210593 | 3300026023 | Bacteria | 1552 |
| 682 | Ga0207677_10236897 | 3300026023 | Bacteria | 1474 |
| 683 | Ga0207677_10316522 | 3300026023 | Bacteria | 1295 |
| 684 | Ga0207677_11015086 | 3300026023 | Bacteria | 753 |
| 685 | Ga0207703_10006079 | 3300026035 | Bacteria | 9657 |
| 686 | Ga0207703_10010887 | 3300026035 | Bacteria | 7091 |
| 687 | Ga0207703_11588043 | 3300026035 | Unclassified | 629 |
| 688 | Ga0207703_11841494 | 3300026035 | Bacteria | 581 |
| 689 | Ga0207703_12099056 | 3300026035 | Bacteria | 541 |
| 690 | Ga0207639_10000027 | 3300026041 | Bacteria | 197829 |
| 691 | Ga0207639_10068385 | 3300026041 | Bacteria | 2768 |
| 692 | Ga0207639_10082567 | 3300026041 | Bacteria | 2548 |
| 693 | Ga0207639_10083705 | 3300026041 | Bacteria | 2532 |
| 694 | Ga0207639_10978454 | 3300026041 | Bacteria | 792 |
| 695 | Ga0207708_10986582 | 3300026075 | Bacteria | 731 |
| 696 | Ga0207702_10000219 | 3300026078 | Bacteria | 66719 |
| 697 | Ga0207702_10000823 | 3300026078 | Bacteria | 32729 |
| 698 | Ga0207702_10008293 | 3300026078 | Bacteria | 8780 |
| 699 | Ga0207702_10038960 | 3300026078 | Unclassified | 3981 |
| 700 | Ga0207702_10044168 | 3300026078 | Bacteria | 3745 |
| 701 | Ga0207702_10308799 | 3300026078 | Bacteria | 1503 |
| 702 | Ga0207702_10963540 | 3300026078 | Unclassified | 846 |
| 703 | Ga0207641_10001089 | 3300026088 | Bacteria | 27318 |
| 704 | Ga0207641_10123368 | 3300026088 | Bacteria | 2315 |
| 705 | Ga0207641_10380575 | 3300026088 | Bacteria | 1351 |
| 706 | Ga0207641_11274287 | 3300026088 | Unclassified | 735 |
| 707 | Ga0207641_11303512 | 3300026088 | Unclassified | 727 |
| 708 | Ga0207641_11596231 | 3300026088 | Unclassified | 654 |
| 709 | Ga0207648_10021804 | 3300026089 | Bacteria | 5755 |
| 710 | Ga0207648_10200527 | 3300026089 | Bacteria | 1769 |
| 711 | Ga0207648_11801858 | 3300026089 | Bacteria | 574 |
| 712 | Ga0207648_12276187 | 3300026089 | Unclassified | 502 |
| 713 | Ga0207676_10012214 | 3300026095 | Bacteria | 6148 |
| 714 | Ga0207676_10013135 | 3300026095 | Bacteria | 5945 |
| 715 | Ga0207676_10139407 | 3300026095 | Bacteria | 2074 |
| 716 | Ga0207676_10785085 | 3300026095 | Bacteria | 928 |
| 717 | Ga0207676_12589116 | 3300026095 | Unclassified | 504 |
| 718 | Ga0207674_10000385 | 3300026116 | Bacteria | 57430 |
| 719 | Ga0207674_10005465 | 3300026116 | Bacteria | 15094 |
| 720 | Ga0207674_10007264 | 3300026116 | Bacteria | 12914 |
| 721 | Ga0207675_101301928 | 3300026118 | Bacteria | 747 |
| 722 | Ga0207675_101561887 | 3300026118 | Unclassified | 680 |
| 723 | Ga0207675_102644636 | 3300026118 | Unclassified | 511 |
| 724 | Ga0207683_10139086 | 3300026121 | Bacteria | 2187 |
| 725 | Ga0207683_11621094 | 3300026121 | Unclassified | 596 |
| 726 | Ga0207698_10000065 | 3300026142 | Bacteria | 71171 |
| 727 | Ga0207698_10160701 | 3300026142 | Bacteria | 1964 |
| 728 | Ga0207698_10242796 | 3300026142 | Bacteria | 1643 |
| 729 | Ga0207698_10471317 | 3300026142 | Bacteria | 1216 |
| 730 | Ga0207698_10985380 | 3300026142 | Bacteria | 853 |
| 731 | Ga0207698_11578763 | 3300026142 | Bacteria | 672 |
| 732 | Ga0209179_1060307 | 3300027512 | Bacteria | 823 |
| 733 | Ga0209588_1012680 | 3300027671 | Unclassified | 2561 |
| 734 | Ga0209588_1016448 | 3300027671 | Bacteria | 2284 |
| 735 | Ga0209588_1016784 | 3300027671 | Bacteria | 2264 |
| 736 | Ga0209588_1036120 | 3300027671 | Unclassified | 1589 |
| 737 | Ga0207428_10012122 | 3300027907 | Bacteria | 7584 |
| 738 | Ga0207428_10188719 | 3300027907 | Bacteria | 1554 |
| 739 | Ga0265354_1000540 | 3300028016 | Bacteria | 6496 |
| 740 | Ga0265354_1000550 | 3300028016 | Bacteria | 6420 |
| 741 | Ga0268266_10318150 | 3300028379 | Unclassified | 1456 |
| 742 | Ga0268266_10735083 | 3300028379 | Bacteria | 952 |
| 743 | Ga0268265_10008987 | 3300028380 | Bacteria | 6758 |
| 744 | Ga0268265_10556925 | 3300028380 | Unclassified | 1089 |
| 745 | Ga0268265_11284883 | 3300028380 | Bacteria | 731 |
| 746 | Ga0268264_10002414 | 3300028381 | Bacteria | 16444 |
| 747 | Ga0268264_10040893 | 3300028381 | Bacteria | 3831 |
| 748 | Ga0268264_10817677 | 3300028381 | Bacteria | 932 |
| 749 | Ga0268264_12285767 | 3300028381 | Unclassified | 548 |
| 750 | Ga0265337_1228702 | 3300028556 | Unclassified | 506 |
| 751 | Ga0265338_10668045 | 3300028800 | Unclassified | 719 |
| 752 | Ga0265338_10841360 | 3300028800 | Unclassified | 627 |
| 753 | Ga0265762_1015436 | 3300030760 | Bacteria | 1382 |
| 754 | Ga0265770_1028698 | 3300030878 | Unclassified | 921 |
| 755 | Ga0265765_1000615 | 3300030879 | Unclassified | 2927 |
| 756 | Ga0265765_1054039 | 3300030879 | Unclassified | 557 |
| 757 | Ga0265773_1005394 | 3300031018 | Unclassified | 928 |
| 758 | Ga0265760_10309186 | 3300031090 | Unclassified | 561 |
| 759 | Ga0265332_10061438 | 3300031238 | Unclassified | 1606 |
| 760 | Ga0265328_10076485 | 3300031239 | Unclassified | 1232 |
| 761 | Ga0265320_10011528 | 3300031240 | Bacteria | 5195 |
| 762 | Ga0265320_10237009 | 3300031240 | Unclassified | 811 |
| 763 | Ga0265320_10392853 | 3300031240 | Bacteria | 613 |
| 764 | Ga0265329_10015332 | 3300031242 | Bacteria | 2679 |
| 765 | Ga0265340_10076476 | 3300031247 | Unclassified | 1581 |
| 766 | Ga0265331_10002105 | 3300031250 | Bacteria | 13715 |
| 767 | Ga0265316_10006389 | 3300031344 | Bacteria | 11264 |
| 768 | Ga0265316_10007173 | 3300031344 | Bacteria | 10531 |
| 769 | Ga0265316_10049086 | 3300031344 | Bacteria | 3326 |
| 770 | Ga0265316_11269424 | 3300031344 | Unclassified | 509 |
| 771 | Ga0307408_100040799 | 3300031548 | Bacteria | 3288 |
| 772 | Ga0307408_100051369 | 3300031548 | Bacteria | 2969 |
| 773 | Ga0265314_10003845 | 3300031711 | Bacteria | 14315 |
| 774 | Ga0265342_10191914 | 3300031712 | Unclassified | 1114 |
| 775 | Ga0307405_10020293 | 3300031731 | Bacteria | 3710 |
| 776 | Ga0307405_10610833 | 3300031731 | Bacteria | 891 |
| 777 | Ga0307413_10013897 | 3300031824 | Bacteria | 4070 |
| 778 | Ga0307413_10154372 | 3300031824 | Bacteria | 1604 |
| 779 | Ga0307410_10000364 | 3300031852 | Bacteria | 17661 |
| 780 | Ga0307410_10162450 | 3300031852 | Bacteria | 1675 |
| 781 | Ga0307406_10140360 | 3300031901 | Bacteria | 1709 |
| 782 | Ga0307406_10331852 | 3300031901 | Bacteria | 1181 |
| 783 | Ga0307407_10009343 | 3300031903 | Bacteria | 4560 |
| 784 | Ga0307407_10500635 | 3300031903 | Bacteria | 890 |
| 785 | Ga0307412_10146615 | 3300031911 | Bacteria | 1736 |
| 786 | Ga0307409_100010224 | 3300031995 | Bacteria | 5818 |
| 787 | Ga0307409_101076962 | 3300031995 | Bacteria | 824 |
| 788 | Ga0307409_101451085 | 3300031995 | Bacteria | 713 |
| 789 | Ga0307409_102796888 | 3300031995 | Unclassified | 516 |
| 790 | Ga0307416_100001048 | 3300032002 | Bacteria | 14732 |
| 791 | Ga0307416_100035989 | 3300032002 | Bacteria | 3790 |
| 792 | Ga0307416_100641409 | 3300032002 | Bacteria | 1146 |
| 793 | Ga0307414_11631032 | 3300032004 | Bacteria | 601 |
| 794 | Ga0307411_10009924 | 3300032005 | Bacteria | 5041 |
| 795 | Ga0307411_10056579 | 3300032005 | Bacteria | 2586 |
| 796 | Ga0307411_10819393 | 3300032005 | Bacteria | 821 |
| 797 | Ga0307411_11391500 | 3300032005 | Bacteria | 642 |
| 798 | Ga0307415_100000628 | 3300032126 | Bacteria | 15477 |
| 799 | Ga0307415_100266277 | 3300032126 | Archaea | 1401 |
| 800 | Ga0307415_100982811 | 3300032126 | Bacteria | 783 |
| 801 | Ga0316212_1007686 | 3300033547 | Unclassified | 1556 |
| 802 | Ga0316212_1031013 | 3300033547 | Unclassified | 751 |
| 803 | Ga0373948_0014544 | 3300034817 | Bacteria | 1434 |
| 804 | Ga0373938_0049951 | 3300034957 | Unclassified | 953 |
| 805 | Ga0373926_0000611 | 3300035083 | Bacteria | 9693 |
| 806 | Ga0373926_0068355 | 3300035083 | Bacteria | 1302 |
| 807 | Ga0373929_0048737 | 3300035085 | Unclassified | 963 |
| 808 | Ga0373934_0357297 | 3300035086 | Unclassified | 608 |
| 809 | Ga0373944_0401689 | 3300035089 | Unclassified | 528 |
| 810 | Ga0373949_0043357 | 3300035090 | Bacteria | 1113 |
| 811 | Ga0373923_0376838 | 3300035111 | Bacteria | 680 |
| 812 | Ga0373923_0444072 | 3300035111 | Bacteria | 628 |
| 813 | Ga0373939_0155034 | 3300035114 | Unclassified | 837 |
| 814 | Ga0373953_0199119 | 3300035117 | Bacteria | 866 |
| 815 | Ga0373954_0045616 | 3300035118 | Bacteria | 2048 |
| 816 | Ga0373954_0461304 | 3300035118 | Unclassified | 629 |
| 817 | Ga0373956_0151804 | 3300035119 | Unclassified | 1090 |
| 818 | Ga0373957_0391468 | 3300035120 | Unclassified | 597 |
| 819 | Ga0373960_0241946 | 3300035121 | Bacteria | 653 |
| 820 | Ga0373943_0006771 | 3300035170 | Bacteria | 5144 |
| 821 | Ga0373946_0006398 | 3300035171 | Bacteria | 4267 |
| 822 | Ga0373946_0031565 | 3300035171 | Bacteria | 2123 |
| 823 | Ga0373955_0180858 | 3300035172 | Bacteria | 1251 |
| 824 | Ga0373962_0062936 | 3300035242 | Bacteria | 1093 |
| 825 | Ga0373931_0005325 | 3300035691 | Bacteria | 5937 |
| 826 | Ga0373931_0048580 | 3300035691 | Bacteria | 2250 |
| 827 | Ga0373931_0070647 | 3300035691 | Bacteria | 1905 |
| 828 | Ga0373931_0187341 | 3300035691 | Bacteria | 1229 |
| 829 | Ga0373931_0620619 | 3300035691 | Unclassified | 708 |
| 830 | Ga0373935_0092720 | 3300035692 | Bacteria | 1980 |
| 831 | Ga0373935_0310347 | 3300035692 | Bacteria | 1117 |
| 832 | Ga0373927_0000461 | 3300035695 | Bacteria | 31104 |
| 833 | Ga0373927_0000786 | 3300035695 | Bacteria | 24231 |
| 834 | Ga0373927_0003818 | 3300035695 | Bacteria | 10694 |
| 835 | Ga0373927_0005082 | 3300035695 | Bacteria | 9103 |
| 836 | Ga0373927_0099367 | 3300035695 | Unclassified | 1892 |
| 837 | Ga0373927_0189597 | 3300035695 | Bacteria | 1349 |
| 838 | Ga0373927_1040691 | 3300035695 | Unclassified | 540 |
| 839 | Ga0373933_0309769 | 3300035724 | Bacteria | 1023 |
| 840 | Ga0373933_0691004 | 3300035724 | Unclassified | 671 |
| 841 | Ga0373933_0875055 | 3300035724 | Bacteria | 591 |
| 842 | Ga0373933_1135182 | 3300035724 | Unclassified | 515 |
| 843 | Ga0373947_0003616 | 3300035725 | Bacteria | 9123 |
| 844 | Ga0373947_0016152 | 3300035725 | Bacteria | 4290 |
| 845 | Ga0373947_0076883 | 3300035725 | Bacteria | 2058 |
| 846 | Ga0373947_0518013 | 3300035725 | Unclassified | 811 |
| 847 | Ga0373947_1152399 | 3300035725 | Unclassified | 528 |
| 848 | Ga0373937_0066395 | 3300036401 | Bacteria | 3322 |
| 849 | Ga0373937_0136201 | 3300036401 | Bacteria | 2296 |
| 850 | Ga0373937_0342388 | 3300036401 | Bacteria | 1416 |
| 851 | Ga0373937_1132494 | 3300036401 | Unclassified | 731 |
| 852 | Ga0373925_0000106 | 3300037068 | Bacteria | 89944 |
| 853 | Ga0373925_0001038 | 3300037068 | Bacteria | 25179 |
| 854 | Ga0373925_0021121 | 3300037068 | Bacteria | 4743 |
| 855 | Ga0373925_0325824 | 3300037068 | Unclassified | 1244 |
| 856 | Ga0373925_0556247 | 3300037068 | Bacteria | 944 |
| 857 | Ga0373925_1045422 | 3300037068 | Unclassified | 672 |
| 858 | Ga0373925_1648891 | 3300037068 | Unclassified | 524 |
| 859 | Ga0373925_1694977 | 3300037068 | Unclassified | 516 |
| 860 | Ga0395905_1743657 | 3300037471 | Unclassified | 528 |
| 861 | Ga0436364_1532051 | 3300037853 | Unclassified | 707 |
| 862 | Ga0436365_0370185 | 3300039437 | Bacteria | 1107 |
| 863 | Ga0436365_0815773 | 3300039437 | Bacteria | 3494 |
| 864 | Ga0436365_1276255 | 3300039437 | Bacteria | 902 |
| 865 | Ga0436360_0578704 | 3300039438 | Unclassified | 1783 |
| 866 | Ga0436363_0572162 | 3300039450 | Unclassified | 583 |
| 867 | Ga0436363_1192250 | 3300039450 | Bacteria | 588 |
| 868 | Ga0436362_0648093 | 3300039453 | Unclassified | 621 |
| 869 | Ga0436362_0752321 | 3300039453 | Bacteria | 1917 |
| 870 | Ga0436362_0821875 | 3300039453 | Unclassified | 906 |
| 871 | Ga0451853_0563989 | 3300041512 | Unclassified | 613 |
| 872 | Ga0451853_1646197 | 3300041512 | Unclassified | 739 |
| 873 | Ga0451577_0098135 | 3300042876 | Bacteria | 2617 |
| 874 | Ga0451577_1058754 | 3300042876 | Unclassified | 727 |
| 875 | Ga0466972_0626559 | 3300044658 | Bacteria | 509 |
| 876 | Ga0466966_0122081 | 3300044684 | Unclassified | 1600 |
| 877 | Ga0466961_0034338 | 3300044693 | Unclassified | 3256 |
| 878 | Ga0466963_0065154 | 3300044694 | Unclassified | 2442 |
| 879 | Ga0466963_0663537 | 3300044694 | Bacteria | 736 |
| 880 | Ga0453684_0604637 | 3300044712 | Unclassified | 1201 |
| 881 | Ga0453684_0784449 | 3300044712 | Bacteria | 1029 |
| 882 | Ga0466971_0285547 | 3300044719 | Unclassified | 790 |
| 883 | Ga0466957_0684828 | 3300044842 | Unclassified | 723 |
| 884 | Ga0466959_0047933 | 3300045049 | Unclassified | 3142 |
| 885 | Ga0451576_0066198 | 3300045051 | Bacteria | 3762 |
| 886 | Ga0451576_0197439 | 3300045051 | Bacteria | 2102 |
| 887 | Ga0451576_0581604 | 3300045051 | Unclassified | 1177 |
| 888 | Ga0466958_0674096 | 3300045836 | Unclassified | 673 |
| 889 | Ga0466967_2387611 | 3300045976 | Bacteria | 524 |
| 890 | Ga0495651_0172470 | 3300046462 | Bacteria | 1539 |
| 891 | Ga0495580_0002472 | 3300046472 | Bacteria | 16135 |
| 892 | Ga0495580_0003322 | 3300046472 | Bacteria | 13758 |
| 893 | Ga0495580_0030510 | 3300046472 | Bacteria | 3903 |
| 894 | Ga0495580_0074846 | 3300046472 | Bacteria | 2363 |
| 895 | Ga0495580_0095841 | 3300046472 | Unclassified | 2064 |
| 896 | Ga0495580_0100731 | 3300046472 | Bacteria | 2009 |
| 897 | Ga0495580_0131309 | 3300046472 | Bacteria | 1737 |
| 898 | Ga0495580_0203860 | 3300046472 | Unclassified | 1362 |
| 899 | Ga0495580_0524060 | 3300046472 | Bacteria | 789 |
| 900 | Ga0495582_0408599 | 3300046473 | Unclassified | 783 |
| 901 | Ga0495639_0229007 | 3300046475 | Bacteria | 915 |
| 902 | Ga0495662_0191230 | 3300046476 | Unclassified | 1009 |
| 903 | Ga0495664_0144379 | 3300046477 | Bacteria | 1443 |
| 904 | Ga0495594_0442760 | 3300046499 | Unclassified | 739 |
| 905 | Ga0495630_0459193 | 3300046517 | Unclassified | 976 |
| 906 | Ga0495630_1472165 | 3300046517 | Unclassified | 511 |
| 907 | Ga0495666_0007843 | 3300046526 | Bacteria | 5346 |
| 908 | Ga0495666_0276428 | 3300046526 | Unclassified | 762 |
| 909 | Ga0495642_0074780 | 3300046528 | Bacteria | 1421 |
| 910 | Ga0495586_0034954 | 3300046535 | Unclassified | 2700 |
| 911 | Ga0495587_0004260 | 3300046536 | Bacteria | 9457 |
| 912 | Ga0495645_0087801 | 3300046543 | Bacteria | 2224 |
| 913 | Ga0495622_0426245 | 3300046557 | Unclassified | 570 |
| 914 | Ga0495599_0809772 | 3300046678 | Bacteria | 535 |
| 915 | Ga0495624_0119783 | 3300046690 | Unclassified | 1617 |
| 916 | Ga0495624_0130295 | 3300046690 | Bacteria | 1542 |
| 917 | Ga0495604_1013738 | 3300047317 | Unclassified | 513 |
| 918 | Ga0495674_0381070 | 3300047319 | Bacteria | 1141 |
| 919 | Ga0495674_0605045 | 3300047319 | Unclassified | 868 |
| 920 | Ga0495674_0885641 | 3300047319 | Bacteria | 690 |
| 921 | Ga0495675_0843045 | 3300047444 | Unclassified | 505 |
| 922 | Ga0495684_0208026 | 3300047471 | Bacteria | 1440 |
| 923 | Ga0496100_0392106 | 3300048903 | Unclassified | 1056 |
| 924 | Ga0496101_0115366 | 3300048904 | Bacteria | 2026 |
| 925 | Ga0496102_0008830 | 3300048905 | Bacteria | 8645 |
| 926 | Ga0496102_0030578 | 3300048905 | Bacteria | 4821 |
| 927 | Ga0496102_1478544 | 3300048905 | Unclassified | 598 |
| 928 | Ga0496104_0152457 | 3300048907 | Bacteria | 2218 |
| 929 | Ga0496105_0357345 | 3300048908 | Unclassified | 1166 |
| 930 | Ga0496106_0036367 | 3300048909 | Bacteria | 3684 |
| 931 | Ga0496107_0437307 | 3300048910 | Unclassified | 972 |
| 932 | Ga0496109_0817441 | 3300048912 | Unclassified | 870 |
| 933 | Ga0496109_1419701 | 3300048912 | Unclassified | 629 |
| 934 | Ga0496112_0003406 | 3300048915 | Bacteria | 13134 |
| 935 | Ga0496112_0014039 | 3300048915 | Bacteria | 7415 |
| 936 | Ga0496112_0027515 | 3300048915 | Bacteria | 5483 |
| 937 | Ga0496113_1324769 | 3300048916 | Unclassified | 559 |
| 938 | Ga0496114_1165769 | 3300048917 | Unclassified | 656 |
| 939 | Ga0496115_0568471 | 3300048918 | Bacteria | 904 |
| 940 | Ga0501299_021400 | 3300049522 | Bacteria | 1186 |
| 941 | nmdc:mga05p37_1279440_c1 | 3300050507 | Bacteria | 750 |
| 942 | nmdc:mga05p37_1807418_c1 | 3300050507 | Unclassified | 589 |
| 943 | nmdc:mga05p37_212744_c1 | 3300050507 | Bacteria | 2336 |
| 944 | nmdc:mga09592_1293121_c1 | 3300050508 | Unclassified | 600 |
| 945 | nmdc:mga09592_175258_c1 | 3300050508 | Bacteria | 1855 |
| 946 | nmdc:mga0qj67_648852_c1 | 3300050509 | Bacteria | 842 |
| 947 | nmdc:mga06r32_188450_c1 | 3300050510 | Bacteria | 2050 |
| 948 | nmdc:mga06r32_572099_c1 | 3300050510 | Bacteria | 1102 |
| 949 | nmdc:mga08y16_151719_c1 | 3300050511 | Bacteria | 2408 |
| 950 | nmdc:mga08y16_16731_c1 | 3300050511 | Bacteria | 7718 |
| 951 | nmdc:mga0n895_112487_c1 | 3300050512 | Bacteria | 2739 |
| 952 | nmdc:mga0n895_13067_c1 | 3300050512 | Bacteria | 7469 |
| 953 | nmdc:mga0n895_187_c1 | 3300050512 | Bacteria | 38298 |
| 954 | nmdc:mga0rr50_1790897_c1 | 3300050513 | Unclassified | 517 |
| 955 | nmdc:mga0rr50_700269_c1 | 3300050513 | Unclassified | 865 |
| 956 | nmdc:mga08x19_166904_c1 | 3300050514 | Bacteria | 1497 |
| 957 | nmdc:mga08x19_523384_c1 | 3300050514 | Bacteria | 838 |
| 958 | nmdc:mga0a205_1043704_c1 | 3300050515 | Unclassified | 664 |
| 959 | nmdc:mga0a205_20947_c1 | 3300050515 | Bacteria | 6179 |
| 960 | nmdc:mga0a205_274461_c1 | 3300050515 | Bacteria | 1562 |
| 961 | nmdc:mga0a205_5879_c1 | 3300050515 | Bacteria | 11049 |
| 962 | nmdc:mga0a205_749800_c1 | 3300050515 | Unclassified | 825 |
| 963 | Ga0500604_0262787 | 3300053151 | Unclassified | 598 |
| 964 | Ga0466962_0022369 | 3300061719 | Unclassified | 3038 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006028 | Ga0070717_10012954 | Ga0070717_100129542 | 50 |
| 2 | 3300025898 | Ga0207692_10713275 | Ga0207692_107132752 | 50 |
| 3 | 3300035170 | Ga0373943_0006771 | Ga0373943_0006771_874_1035 | 50 |
| 4 | 3300035171 | Ga0373946_0031565 | Ga0373946_0031565_1542_1703 | 50 |
| 5 | 3300035692 | Ga0373935_0092720 | Ga0373935_0092720_1266_1427 | 50 |
| 6 | 3300035695 | Ga0373927_0000461 | Ga0373927_0000461_9450_9611 | 50 |
| 7 | 3300035725 | Ga0373947_0003616 | Ga0373947_0003616_1023_1184 | 50 |
| 8 | 3300037068 | Ga0373925_0000106 | Ga0373925_0000106_86429_86590 | 50 |
| 9 | 3300046476 | Ga0495662_0191230 | Ga0495662_0191230_831_992 | 50 |
| 10 | 3300046517 | Ga0495630_0459193 | Ga0495630_0459193_138_299 | 50 |
| 11 | 3300046535 | Ga0495586_0034954 | Ga0495586_0034954_2085_2246 | 50 |
| 12 | 3300046690 | Ga0495624_0119783 | Ga0495624_0119783_546_707 | 50 |
| 13 | 3300039450 | Ga0436363_1192250 | Ga0436363_1192250_70_237 | 55 |
| 14 | 3300044658 | Ga0466972_0626559 | Ga0466972_0626559_323_490 | 55 |
| 15 | 3300044684 | Ga0466966_0122081 | Ga0466966_0122081_648_815 | 55 |
| 16 | 3300044693 | Ga0466961_0034338 | Ga0466961_0034338_2888_3055 | 55 |
| 17 | 3300044694 | Ga0466963_0065154 | Ga0466963_0065154_2138_2305 | 55 |
| 18 | 3300044842 | Ga0466957_0684828 | Ga0466957_0684828_462_629 | 55 |
| 19 | 3300045049 | Ga0466959_0047933 | Ga0466959_0047933_273_440 | 55 |
| 20 | 3300045836 | Ga0466958_0674096 | Ga0466958_0674096_77_244 | 55 |
| 21 | 3300045976 | Ga0466967_2387611 | Ga0466967_2387611_76_243 | 55 |
| 22 | 3300047319 | Ga0495674_0605045 | Ga0495674_0605045_95_262 | 55 |
| 23 | 3300050512 | nmdc:mga0n895_187_c1 | nmdc:mga0n895_187_c1_23037_23204 | 55 |
| 24 | 3300050513 | nmdc:mga0rr50_700269_c1 | nmdc:mga0rr50_700269_c1_190_357 | 55 |
| 25 | 3300050515 | nmdc:mga0a205_5879_c1 | nmdc:mga0a205_5879_c1_2016_2183 | 55 |
| 26 | 3300053151 | Ga0500604_0262787 | Ga0500604_0262787_51_218 | 55 |
| 27 | 3300061719 | Ga0466962_0022369 | Ga0466962_0022369_1608_1775 | 55 |
| 28 | 3300005293 | Ga0065715_10483383 | Ga0065715_104833832 | 56 |
| 29 | 3300005328 | Ga0070676_10452113 | Ga0070676_104521133 | 56 |
| 30 | 3300005354 | Ga0070675_101545372 | Ga0070675_1015453722 | 56 |
| 31 | 3300005365 | Ga0070688_100987175 | Ga0070688_1009871752 | 56 |
| 32 | 3300005441 | Ga0070700_101280456 | Ga0070700_1012804562 | 56 |
| 33 | 3300005444 | Ga0070694_100558985 | Ga0070694_1005589851 | 56 |
| 34 | 3300005518 | Ga0070699_100524529 | Ga0070699_1005245293 | 56 |
| 35 | 3300005543 | Ga0070672_102163906 | Ga0070672_1021639061 | 56 |
| 36 | 3300005546 | Ga0070696_100836421 | Ga0070696_1008364212 | 56 |
| 37 | 3300005719 | Ga0068861_101412505 | Ga0068861_1014125053 | 56 |
| 38 | 3300005840 | Ga0068870_10720017 | Ga0068870_107200172 | 56 |
| 39 | 3300005842 | Ga0068858_100251338 | Ga0068858_1002513382 | 56 |
| 40 | 3300005844 | Ga0068862_100370621 | Ga0068862_1003706212 | 56 |
| 41 | 3300006844 | Ga0075428_100188782 | Ga0075428_1001887822 | 56 |
| 42 | 3300006846 | Ga0075430_100782983 | Ga0075430_1007829832 | 56 |
| 43 | 3300006847 | Ga0075431_101519816 | Ga0075431_1015198162 | 56 |
| 44 | 3300006852 | Ga0075433_10007666 | Ga0075433_100076665 | 56 |
| 45 | 3300006852 | Ga0075433_10474590 | Ga0075433_104745902 | 56 |
| 46 | 3300006852 | Ga0075433_10759547 | Ga0075433_107595472 | 56 |
| 47 | 3300006871 | Ga0075434_100010157 | Ga0075434_1000101578 | 56 |
| 48 | 3300006871 | Ga0075434_100086778 | Ga0075434_1000867783 | 56 |
| 49 | 3300006880 | Ga0075429_100163757 | Ga0075429_1001637573 | 56 |
| 50 | 3300007076 | Ga0075435_100262401 | Ga0075435_1002624012 | 56 |
| 51 | 3300009094 | Ga0111539_10008937 | Ga0111539_100089372 | 56 |
| 52 | 3300009094 | Ga0111539_10040813 | Ga0111539_100408134 | 56 |
| 53 | 3300009101 | Ga0105247_11075328 | Ga0105247_110753282 | 56 |
| 54 | 3300009147 | Ga0114129_10027832 | Ga0114129_100278327 | 56 |
| 55 | 3300009147 | Ga0114129_10670886 | Ga0114129_106708862 | 56 |
| 56 | 3300009147 | Ga0114129_11211637 | Ga0114129_112116372 | 56 |
| 57 | 3300009177 | Ga0105248_10380910 | Ga0105248_103809102 | 56 |
| 58 | 3300013297 | Ga0157378_10718565 | Ga0157378_107185652 | 56 |
| 59 | 3300013306 | Ga0163162_10216306 | Ga0163162_102163063 | 56 |
| 60 | 3300013308 | Ga0157375_11893193 | Ga0157375_118931932 | 56 |
| 61 | 3300013308 | Ga0157375_12171293 | Ga0157375_121712932 | 56 |
| 62 | 3300014326 | Ga0157380_10594063 | Ga0157380_105940633 | 56 |
| 63 | 3300017792 | Ga0163161_11612295 | Ga0163161_116122952 | 56 |
| 64 | 3300026035 | Ga0207703_11588043 | Ga0207703_115880432 | 56 |
| 65 | 3300026095 | Ga0207676_12589116 | Ga0207676_125891162 | 56 |
| 66 | 3300026118 | Ga0207675_101561887 | Ga0207675_1015618871 | 56 |
| 67 | 3300027907 | Ga0207428_10012122 | Ga0207428_100121225 | 56 |
| 68 | 3300027907 | Ga0207428_10188719 | Ga0207428_101887191 | 56 |
| 69 | 3300028380 | Ga0268265_11284883 | Ga0268265_112848831 | 56 |
| 70 | 3300045051 | Ga0451576_0066198 | Ga0451576_0066198_2972_3142 | 56 |
| 71 | 3300050507 | nmdc:mga05p37_1279440_c1 | nmdc:mga05p37_1279440_c1_174_344 | 56 |
| 72 | 3300050507 | nmdc:mga05p37_1807418_c1 | nmdc:mga05p37_1807418_c1_267_437 | 56 |
| 73 | 3300050507 | nmdc:mga05p37_212744_c1 | nmdc:mga05p37_212744_c1_2125_2295 | 56 |
| 74 | 3300050508 | nmdc:mga09592_1293121_c1 | nmdc:mga09592_1293121_c1_17_187 | 56 |
| 75 | 3300050508 | nmdc:mga09592_175258_c1 | nmdc:mga09592_175258_c1_912_1082 | 56 |
| 76 | 3300050509 | nmdc:mga0qj67_648852_c1 | nmdc:mga0qj67_648852_c1_368_538 | 56 |
| 77 | 3300050511 | nmdc:mga08y16_151719_c1 | nmdc:mga08y16_151719_c1_1043_1213 | 56 |
| 78 | 3300050511 | nmdc:mga08y16_16731_c1 | nmdc:mga08y16_16731_c1_3868_4038 | 56 |
| 79 | 3300050512 | nmdc:mga0n895_112487_c1 | nmdc:mga0n895_112487_c1_148_318 | 56 |
| 80 | 3300050512 | nmdc:mga0n895_13067_c1 | nmdc:mga0n895_13067_c1_1391_1561 | 56 |
| 81 | 3300050513 | nmdc:mga0rr50_1790897_c1 | nmdc:mga0rr50_1790897_c1_90_260 | 56 |
| 82 | 3300050515 | nmdc:mga0a205_1043704_c1 | nmdc:mga0a205_1043704_c1_118_288 | 56 |
| 83 | 3300050515 | nmdc:mga0a205_20947_c1 | nmdc:mga0a205_20947_c1_1278_1448 | 56 |
| 84 | 3300050515 | nmdc:mga0a205_274461_c1 | nmdc:mga0a205_274461_c1_376_546 | 56 |
| 85 | 3300050515 | nmdc:mga0a205_749800_c1 | nmdc:mga0a205_749800_c1_585_755 | 56 |
| 86 | 3300005842 | Ga0068858_101995095 | Ga0068858_1019950952 | 59 |
| 87 | 3300005843 | Ga0068860_100586861 | Ga0068860_1005868613 | 59 |
| 88 | 3300009098 | Ga0105245_11448356 | Ga0105245_114483563 | 59 |
| 89 | 3300009176 | Ga0105242_10626314 | Ga0105242_106263143 | 59 |
| 90 | 3300009177 | Ga0105248_12815132 | Ga0105248_128151322 | 59 |
| 91 | 3300014968 | Ga0157379_11908651 | Ga0157379_119086512 | 59 |
| 92 | 3300025927 | Ga0207687_10690895 | Ga0207687_106908952 | 59 |
| 93 | 3300026035 | Ga0207703_11841494 | Ga0207703_118414942 | 59 |
| 94 | 3300028381 | Ga0268264_10817677 | Ga0268264_108176772 | 59 |
| 95 | 3300031548 | Ga0307408_100040799 | Ga0307408_1000407993 | 59 |
| 96 | 3300031731 | Ga0307405_10610833 | Ga0307405_106108332 | 59 |
| 97 | 3300031901 | Ga0307406_10331852 | Ga0307406_103318522 | 59 |
| 98 | 3300031995 | Ga0307409_101076962 | Ga0307409_1010769622 | 59 |
| 99 | 3300032002 | Ga0307416_100035989 | Ga0307416_1000359893 | 59 |
| 100 | 3300032005 | Ga0307411_10056579 | Ga0307411_100565792 | 59 |
| 101 | 3300049522 | Ga0501299_021400 | Ga0501299_021400_160_339 | 59 |
| 102 | 3300005293 | Ga0065715_10745196 | Ga0065715_107451962 | 60 |
| 103 | 3300005327 | Ga0070658_11165103 | Ga0070658_111651032 | 60 |
| 104 | 3300005329 | Ga0070683_100066343 | Ga0070683_1000663432 | 60 |
| 105 | 3300005336 | Ga0070680_100013605 | Ga0070680_1000136052 | 60 |
| 106 | 3300005336 | Ga0070680_100661587 | Ga0070680_1006615872 | 60 |
| 107 | 3300005338 | Ga0068868_100017460 | Ga0068868_1000174604 | 60 |
| 108 | 3300005339 | Ga0070660_101351183 | Ga0070660_1013511832 | 60 |
| 109 | 3300005341 | Ga0070691_10248354 | Ga0070691_102483543 | 60 |
| 110 | 3300005364 | Ga0070673_100541546 | Ga0070673_1005415462 | 60 |
| 111 | 3300005406 | Ga0070703_10064328 | Ga0070703_100643283 | 60 |
| 112 | 3300005434 | Ga0070709_10000507 | Ga0070709_100005074 | 60 |
| 113 | 3300005434 | Ga0070709_11578350 | Ga0070709_115783502 | 60 |
| 114 | 3300005436 | Ga0070713_100001370 | Ga0070713_1000013703 | 60 |
| 115 | 3300005436 | Ga0070713_100084861 | Ga0070713_1000848612 | 60 |
| 116 | 3300005436 | Ga0070713_100332755 | Ga0070713_1003327552 | 60 |
| 117 | 3300005437 | Ga0070710_10280676 | Ga0070710_102806763 | 60 |
| 118 | 3300005439 | Ga0070711_100125948 | Ga0070711_1001259482 | 60 |
| 119 | 3300005439 | Ga0070711_100222946 | Ga0070711_1002229461 | 60 |
| 120 | 3300005441 | Ga0070700_101479031 | Ga0070700_1014790311 | 60 |
| 121 | 3300005444 | Ga0070694_100031049 | Ga0070694_1000310492 | 60 |
| 122 | 3300005457 | Ga0070662_100260396 | Ga0070662_1002603962 | 60 |
| 123 | 3300005458 | Ga0070681_10488730 | Ga0070681_104887303 | 60 |
| 124 | 3300005530 | Ga0070679_100920642 | Ga0070679_1009206422 | 60 |
| 125 | 3300005530 | Ga0070679_102068572 | Ga0070679_1020685721 | 60 |
| 126 | 3300005539 | Ga0068853_100036727 | Ga0068853_1000367273 | 60 |
| 127 | 3300005549 | Ga0070704_100010318 | Ga0070704_1000103182 | 60 |
| 128 | 3300005563 | Ga0068855_100008508 | Ga0068855_1000085085 | 60 |
| 129 | 3300005564 | Ga0070664_100000783 | Ga0070664_1000007835 | 60 |
| 130 | 3300005577 | Ga0068857_100005145 | Ga0068857_1000051456 | 60 |
| 131 | 3300005578 | Ga0068854_100019251 | Ga0068854_1000192512 | 60 |
| 132 | 3300005614 | Ga0068856_100001743 | Ga0068856_10000174314 | 60 |
| 133 | 3300005614 | Ga0068856_100008054 | Ga0068856_10000805412 | 60 |
| 134 | 3300005617 | Ga0068859_100003212 | Ga0068859_10000321214 | 60 |
| 135 | 3300005617 | Ga0068859_100257426 | Ga0068859_1002574263 | 60 |
| 136 | 3300005618 | Ga0068864_100011620 | Ga0068864_1000116207 | 60 |
| 137 | 3300005618 | Ga0068864_102024714 | Ga0068864_1020247142 | 60 |
| 138 | 3300005718 | Ga0068866_10002462 | Ga0068866_100024626 | 60 |
| 139 | 3300005842 | Ga0068858_100004451 | Ga0068858_10000445114 | 60 |
| 140 | 3300005843 | Ga0068860_100020434 | Ga0068860_1000204346 | 60 |
| 141 | 3300005844 | Ga0068862_100750699 | Ga0068862_1007506993 | 60 |
| 142 | 3300006028 | Ga0070717_10542042 | Ga0070717_105420421 | 60 |
| 143 | 3300006028 | Ga0070717_11457961 | Ga0070717_114579612 | 60 |
| 144 | 3300006163 | Ga0070715_10034982 | Ga0070715_100349823 | 60 |
| 145 | 3300006173 | Ga0070716_100042800 | Ga0070716_1000428003 | 60 |
| 146 | 3300006173 | Ga0070716_100920431 | Ga0070716_1009204312 | 60 |
| 147 | 3300006173 | Ga0070716_101506081 | Ga0070716_1015060812 | 60 |
| 148 | 3300006175 | Ga0070712_100000621 | Ga0070712_10000062113 | 60 |
| 149 | 3300006175 | Ga0070712_100122448 | Ga0070712_1001224483 | 60 |
| 150 | 3300006175 | Ga0070712_100471613 | Ga0070712_1004716133 | 60 |
| 151 | 3300006237 | Ga0097621_100000511 | Ga0097621_10000051111 | 60 |
| 152 | 3300006237 | Ga0097621_100211540 | Ga0097621_1002115402 | 60 |
| 153 | 3300006358 | Ga0068871_100000776 | Ga0068871_10000077612 | 60 |
| 154 | 3300006847 | Ga0075431_100982536 | Ga0075431_1009825363 | 60 |
| 155 | 3300006931 | Ga0097620_100003212 | Ga0097620_10000321214 | 60 |
| 156 | 3300006931 | Ga0097620_100257421 | Ga0097620_1002574211 | 60 |
| 157 | 3300009553 | Ga0105249_11138738 | Ga0105249_111387382 | 60 |
| 158 | 3300010375 | Ga0105239_11358221 | Ga0105239_113582213 | 60 |
| 159 | 3300013100 | Ga0157373_10024268 | Ga0157373_100242686 | 60 |
| 160 | 3300013297 | Ga0157378_10825081 | Ga0157378_108250813 | 60 |
| 161 | 3300014326 | Ga0157380_12050046 | Ga0157380_120500462 | 60 |
| 162 | 3300014745 | Ga0157377_11405361 | Ga0157377_114053612 | 60 |
| 163 | 3300025898 | Ga0207692_10455578 | Ga0207692_104555782 | 60 |
| 164 | 3300025899 | Ga0207642_10010232 | Ga0207642_100102322 | 60 |
| 165 | 3300025905 | Ga0207685_10034299 | Ga0207685_100342992 | 60 |
| 166 | 3300025906 | Ga0207699_10001122 | Ga0207699_100011225 | 60 |
| 167 | 3300025912 | Ga0207707_10013785 | Ga0207707_100137853 | 60 |
| 168 | 3300025912 | Ga0207707_10137038 | Ga0207707_101370382 | 60 |
| 169 | 3300025915 | Ga0207693_10000087 | Ga0207693_1000008749 | 60 |
| 170 | 3300025915 | Ga0207693_10006414 | Ga0207693_100064148 | 60 |
| 171 | 3300025915 | Ga0207693_10086818 | Ga0207693_100868182 | 60 |
| 172 | 3300025916 | Ga0207663_10007120 | Ga0207663_100071206 | 60 |
| 173 | 3300025916 | Ga0207663_10081288 | Ga0207663_100812882 | 60 |
| 174 | 3300025916 | Ga0207663_10257266 | Ga0207663_102572663 | 60 |
| 175 | 3300025917 | Ga0207660_10040717 | Ga0207660_100407172 | 60 |
| 176 | 3300025925 | Ga0207650_10003501 | Ga0207650_1000350110 | 60 |
| 177 | 3300025928 | Ga0207700_10004413 | Ga0207700_100044138 | 60 |
| 178 | 3300025928 | Ga0207700_10233116 | Ga0207700_102331162 | 60 |
| 179 | 3300025928 | Ga0207700_11078737 | Ga0207700_110787372 | 60 |
| 180 | 3300025929 | Ga0207664_11779499 | Ga0207664_117794991 | 60 |
| 181 | 3300025932 | Ga0207690_10124302 | Ga0207690_101243022 | 60 |
| 182 | 3300025939 | Ga0207665_10161663 | Ga0207665_101616633 | 60 |
| 183 | 3300025941 | Ga0207711_10034373 | Ga0207711_100343735 | 60 |
| 184 | 3300025944 | Ga0207661_10011686 | Ga0207661_100116866 | 60 |
| 185 | 3300025949 | Ga0207667_10007763 | Ga0207667_100077635 | 60 |
| 186 | 3300025949 | Ga0207667_10018826 | Ga0207667_100188265 | 60 |
| 187 | 3300025960 | Ga0207651_10377906 | Ga0207651_103779062 | 60 |
| 188 | 3300025961 | Ga0207712_10763314 | Ga0207712_107633142 | 60 |
| 189 | 3300025981 | Ga0207640_10012094 | Ga0207640_100120944 | 60 |
| 190 | 3300026035 | Ga0207703_10006079 | Ga0207703_100060797 | 60 |
| 191 | 3300026078 | Ga0207702_10008293 | Ga0207702_100082932 | 60 |
| 192 | 3300026078 | Ga0207702_10044168 | Ga0207702_100441685 | 60 |
| 193 | 3300026095 | Ga0207676_10012214 | Ga0207676_100122145 | 60 |
| 194 | 3300026095 | Ga0207676_10785085 | Ga0207676_107850853 | 60 |
| 195 | 3300026116 | Ga0207674_10007264 | Ga0207674_100072646 | 60 |
| 196 | 3300028380 | Ga0268265_10556925 | Ga0268265_105569252 | 60 |
| 197 | 3300028381 | Ga0268264_10040893 | Ga0268264_100408932 | 60 |
| 198 | 3300034817 | Ga0373948_0014544 | Ga0373948_0014544_728_910 | 60 |
| 199 | 3300034957 | Ga0373938_0049951 | Ga0373938_0049951_114_296 | 60 |
| 200 | 3300035085 | Ga0373929_0048737 | Ga0373929_0048737_678_860 | 60 |
| 201 | 3300035090 | Ga0373949_0043357 | Ga0373949_0043357_383_565 | 60 |
| 202 | 3300035114 | Ga0373939_0155034 | Ga0373939_0155034_324_506 | 60 |
| 203 | 3300035242 | Ga0373962_0062936 | Ga0373962_0062936_804_986 | 60 |
| 204 | 3300035691 | Ga0373931_0005325 | Ga0373931_0005325_3788_3970 | 60 |
| 205 | 3300035691 | Ga0373931_0070647 | Ga0373931_0070647_292_474 | 60 |
| 206 | 3300037068 | Ga0373925_0556247 | Ga0373925_0556247_262_444 | 60 |
| 207 | 3300042876 | Ga0451577_0098135 | Ga0451577_0098135_364_546 | 60 |
| 208 | 3300044694 | Ga0466963_0663537 | Ga0466963_0663537_38_220 | 60 |
| 209 | 3300044712 | Ga0453684_0604637 | Ga0453684_0604637_983_1165 | 60 |
| 210 | 3300048905 | Ga0496102_0008830 | Ga0496102_0008830_968_1150 | 60 |
| 211 | 3300048909 | Ga0496106_0036367 | Ga0496106_0036367_3330_3512 | 60 |
| 212 | 3300048910 | Ga0496107_0437307 | Ga0496107_0437307_161_343 | 60 |
| 213 | 3300048915 | Ga0496112_0027515 | Ga0496112_0027515_1893_2075 | 60 |
| 214 | 3300050510 | nmdc:mga06r32_188450_c1 | nmdc:mga06r32_188450_c1_1329_1511 | 60 |
| 215 | 3300001990 | JGI24737J22298_10052680 | JGI24737J22298_100526802 | 61 |
| 216 | 3300005290 | Ga0065712_10128202 | Ga0065712_101282022 | 61 |
| 217 | 3300005328 | Ga0070676_10056342 | Ga0070676_100563423 | 61 |
| 218 | 3300005329 | Ga0070683_100000438 | Ga0070683_1000004384 | 61 |
| 219 | 3300005329 | Ga0070683_100033813 | Ga0070683_1000338131 | 61 |
| 220 | 3300005330 | Ga0070690_100966941 | Ga0070690_1009669412 | 61 |
| 221 | 3300005330 | Ga0070690_101082296 | Ga0070690_1010822962 | 61 |
| 222 | 3300005330 | Ga0070690_101497252 | Ga0070690_1014972521 | 61 |
| 223 | 3300005331 | Ga0070670_100001632 | Ga0070670_1000016328 | 61 |
| 224 | 3300005331 | Ga0070670_100014132 | Ga0070670_1000141322 | 61 |
| 225 | 3300005334 | Ga0068869_100002425 | Ga0068869_1000024254 | 61 |
| 226 | 3300005334 | Ga0068869_100060526 | Ga0068869_1000605262 | 61 |
| 227 | 3300005334 | Ga0068869_101604483 | Ga0068869_1016044832 | 61 |
| 228 | 3300005335 | Ga0070666_10178838 | Ga0070666_101788382 | 61 |
| 229 | 3300005335 | Ga0070666_10254320 | Ga0070666_102543203 | 61 |
| 230 | 3300005336 | Ga0070680_100021282 | Ga0070680_1000212825 | 61 |
| 231 | 3300005336 | Ga0070680_100103935 | Ga0070680_1001039353 | 61 |
| 232 | 3300005338 | Ga0068868_100009252 | Ga0068868_1000092528 | 61 |
| 233 | 3300005338 | Ga0068868_100042485 | Ga0068868_1000424855 | 61 |
| 234 | 3300005338 | Ga0068868_100107646 | Ga0068868_1001076463 | 61 |
| 235 | 3300005338 | Ga0068868_100521159 | Ga0068868_1005211593 | 61 |
| 236 | 3300005339 | Ga0070660_100450202 | Ga0070660_1004502022 | 61 |
| 237 | 3300005339 | Ga0070660_101688382 | Ga0070660_1016883821 | 61 |
| 238 | 3300005340 | Ga0070689_100026616 | Ga0070689_1000266165 | 61 |
| 239 | 3300005341 | Ga0070691_10146632 | Ga0070691_101466322 | 61 |
| 240 | 3300005343 | Ga0070687_100422813 | Ga0070687_1004228132 | 61 |
| 241 | 3300005344 | Ga0070661_100021208 | Ga0070661_1000212083 | 61 |
| 242 | 3300005344 | Ga0070661_100154423 | Ga0070661_1001544233 | 61 |
| 243 | 3300005344 | Ga0070661_100181596 | Ga0070661_1001815963 | 61 |
| 244 | 3300005344 | Ga0070661_100182799 | Ga0070661_1001827992 | 61 |
| 245 | 3300005344 | Ga0070661_100427738 | Ga0070661_1004277382 | 61 |
| 246 | 3300005354 | Ga0070675_100919342 | Ga0070675_1009193421 | 61 |
| 247 | 3300005355 | Ga0070671_100013048 | Ga0070671_1000130486 | 61 |
| 248 | 3300005364 | Ga0070673_100029967 | Ga0070673_1000299672 | 61 |
| 249 | 3300005364 | Ga0070673_100517225 | Ga0070673_1005172253 | 61 |
| 250 | 3300005365 | Ga0070688_100615938 | Ga0070688_1006159382 | 61 |
| 251 | 3300005366 | Ga0070659_100110279 | Ga0070659_1001102791 | 61 |
| 252 | 3300005367 | Ga0070667_100002851 | Ga0070667_1000028519 | 61 |
| 253 | 3300005367 | Ga0070667_100713627 | Ga0070667_1007136272 | 61 |
| 254 | 3300005367 | Ga0070667_101007700 | Ga0070667_1010077003 | 61 |
| 255 | 3300005367 | Ga0070667_101462817 | Ga0070667_1014628172 | 61 |
| 256 | 3300005406 | Ga0070703_10001660 | Ga0070703_100016607 | 61 |
| 257 | 3300005406 | Ga0070703_10456501 | Ga0070703_104565011 | 61 |
| 258 | 3300005434 | Ga0070709_10264690 | Ga0070709_102646902 | 61 |
| 259 | 3300005434 | Ga0070709_10391021 | Ga0070709_103910212 | 61 |
| 260 | 3300005434 | Ga0070709_10521166 | Ga0070709_105211662 | 61 |
| 261 | 3300005434 | Ga0070709_10688130 | Ga0070709_106881302 | 61 |
| 262 | 3300005434 | Ga0070709_10847955 | Ga0070709_108479552 | 61 |
| 263 | 3300005434 | Ga0070709_10917543 | Ga0070709_109175432 | 61 |
| 264 | 3300005434 | Ga0070709_10940574 | Ga0070709_109405742 | 61 |
| 265 | 3300005434 | Ga0070709_11124098 | Ga0070709_111240982 | 61 |
| 266 | 3300005434 | Ga0070709_11378858 | Ga0070709_113788581 | 61 |
| 267 | 3300005435 | Ga0070714_100003128 | Ga0070714_10000312811 | 61 |
| 268 | 3300005435 | Ga0070714_100032923 | Ga0070714_1000329235 | 61 |
| 269 | 3300005435 | Ga0070714_100089449 | Ga0070714_1000894494 | 61 |
| 270 | 3300005435 | Ga0070714_100107226 | Ga0070714_1001072262 | 61 |
| 271 | 3300005435 | Ga0070714_100142199 | Ga0070714_1001421993 | 61 |
| 272 | 3300005435 | Ga0070714_100302845 | Ga0070714_1003028451 | 61 |
| 273 | 3300005435 | Ga0070714_100396821 | Ga0070714_1003968212 | 61 |
| 274 | 3300005435 | Ga0070714_100502360 | Ga0070714_1005023603 | 61 |
| 275 | 3300005435 | Ga0070714_101046412 | Ga0070714_1010464122 | 61 |
| 276 | 3300005435 | Ga0070714_101163503 | Ga0070714_1011635032 | 61 |
| 277 | 3300005435 | Ga0070714_102134848 | Ga0070714_1021348482 | 61 |
| 278 | 3300005436 | Ga0070713_100010397 | Ga0070713_1000103976 | 61 |
| 279 | 3300005436 | Ga0070713_100026210 | Ga0070713_1000262103 | 61 |
| 280 | 3300005436 | Ga0070713_100030154 | Ga0070713_1000301545 | 61 |
| 281 | 3300005436 | Ga0070713_100095619 | Ga0070713_1000956193 | 61 |
| 282 | 3300005436 | Ga0070713_100106076 | Ga0070713_1001060764 | 61 |
| 283 | 3300005436 | Ga0070713_100161289 | Ga0070713_1001612892 | 61 |
| 284 | 3300005436 | Ga0070713_100323505 | Ga0070713_1003235052 | 61 |
| 285 | 3300005436 | Ga0070713_100360917 | Ga0070713_1003609173 | 61 |
| 286 | 3300005436 | Ga0070713_100419342 | Ga0070713_1004193422 | 61 |
| 287 | 3300005436 | Ga0070713_101100887 | Ga0070713_1011008872 | 61 |
| 288 | 3300005436 | Ga0070713_101303826 | Ga0070713_1013038261 | 61 |
| 289 | 3300005436 | Ga0070713_101553265 | Ga0070713_1015532651 | 61 |
| 290 | 3300005436 | Ga0070713_101587095 | Ga0070713_1015870951 | 61 |
| 291 | 3300005437 | Ga0070710_10159850 | Ga0070710_101598503 | 61 |
| 292 | 3300005437 | Ga0070710_10237380 | Ga0070710_102373801 | 61 |
| 293 | 3300005437 | Ga0070710_10269649 | Ga0070710_102696492 | 61 |
| 294 | 3300005437 | Ga0070710_10855398 | Ga0070710_108553982 | 61 |
| 295 | 3300005437 | Ga0070710_11160455 | Ga0070710_111604552 | 61 |
| 296 | 3300005437 | Ga0070710_11294409 | Ga0070710_112944091 | 61 |
| 297 | 3300005439 | Ga0070711_100018228 | Ga0070711_1000182285 | 61 |
| 298 | 3300005439 | Ga0070711_100072732 | Ga0070711_1000727322 | 61 |
| 299 | 3300005439 | Ga0070711_100723820 | Ga0070711_1007238203 | 61 |
| 300 | 3300005439 | Ga0070711_100783166 | Ga0070711_1007831662 | 61 |
| 301 | 3300005439 | Ga0070711_101369111 | Ga0070711_1013691112 | 61 |
| 302 | 3300005439 | Ga0070711_101516063 | Ga0070711_1015160631 | 61 |
| 303 | 3300005439 | Ga0070711_102061543 | Ga0070711_1020615432 | 61 |
| 304 | 3300005440 | Ga0070705_100003341 | Ga0070705_1000033414 | 61 |
| 305 | 3300005440 | Ga0070705_100093454 | Ga0070705_1000934542 | 61 |
| 306 | 3300005440 | Ga0070705_100982017 | Ga0070705_1009820173 | 61 |
| 307 | 3300005440 | Ga0070705_101844869 | Ga0070705_1018448692 | 61 |
| 308 | 3300005441 | Ga0070700_100839847 | Ga0070700_1008398471 | 61 |
| 309 | 3300005444 | Ga0070694_100169399 | Ga0070694_1001693992 | 61 |
| 310 | 3300005444 | Ga0070694_100218210 | Ga0070694_1002182103 | 61 |
| 311 | 3300005444 | Ga0070694_100301584 | Ga0070694_1003015843 | 61 |
| 312 | 3300005444 | Ga0070694_101245056 | Ga0070694_1012450562 | 61 |
| 313 | 3300005445 | Ga0070708_100002244 | Ga0070708_1000022446 | 61 |
| 314 | 3300005456 | Ga0070678_100946737 | Ga0070678_1009467372 | 61 |
| 315 | 3300005456 | Ga0070678_102053868 | Ga0070678_1020538681 | 61 |
| 316 | 3300005458 | Ga0070681_10000889 | Ga0070681_1000088931 | 61 |
| 317 | 3300005458 | Ga0070681_10100708 | Ga0070681_101007083 | 61 |
| 318 | 3300005458 | Ga0070681_10505248 | Ga0070681_105052482 | 61 |
| 319 | 3300005458 | Ga0070681_10523702 | Ga0070681_105237022 | 61 |
| 320 | 3300005459 | Ga0068867_100032811 | Ga0068867_1000328114 | 61 |
| 321 | 3300005459 | Ga0068867_100451641 | Ga0068867_1004516412 | 61 |
| 322 | 3300005459 | Ga0068867_100579779 | Ga0068867_1005797792 | 61 |
| 323 | 3300005466 | Ga0070685_10344213 | Ga0070685_103442132 | 61 |
| 324 | 3300005467 | Ga0070706_100001656 | Ga0070706_1000016566 | 61 |
| 325 | 3300005467 | Ga0070706_100022160 | Ga0070706_1000221606 | 61 |
| 326 | 3300005468 | Ga0070707_100057490 | Ga0070707_1000574904 | 61 |
| 327 | 3300005468 | Ga0070707_101546296 | Ga0070707_1015462962 | 61 |
| 328 | 3300005471 | Ga0070698_101466640 | Ga0070698_1014666402 | 61 |
| 329 | 3300005518 | Ga0070699_100015160 | Ga0070699_1000151603 | 61 |
| 330 | 3300005518 | Ga0070699_100046927 | Ga0070699_1000469272 | 61 |
| 331 | 3300005530 | Ga0070679_100004003 | Ga0070679_1000040032 | 61 |
| 332 | 3300005530 | Ga0070679_100017595 | Ga0070679_1000175957 | 61 |
| 333 | 3300005530 | Ga0070679_100185470 | Ga0070679_1001854703 | 61 |
| 334 | 3300005530 | Ga0070679_101404800 | Ga0070679_1014048001 | 61 |
| 335 | 3300005535 | Ga0070684_100000161 | Ga0070684_1000001619 | 61 |
| 336 | 3300005535 | Ga0070684_100051499 | Ga0070684_1000514994 | 61 |
| 337 | 3300005535 | Ga0070684_100160856 | Ga0070684_1001608563 | 61 |
| 338 | 3300005535 | Ga0070684_100424625 | Ga0070684_1004246252 | 61 |
| 339 | 3300005536 | Ga0070697_100001122 | Ga0070697_1000011225 | 61 |
| 340 | 3300005536 | Ga0070697_101891067 | Ga0070697_1018910672 | 61 |
| 341 | 3300005539 | Ga0068853_100002829 | Ga0068853_1000028296 | 61 |
| 342 | 3300005539 | Ga0068853_100066650 | Ga0068853_1000666503 | 61 |
| 343 | 3300005539 | Ga0068853_100077660 | Ga0068853_1000776601 | 61 |
| 344 | 3300005539 | Ga0068853_100243654 | Ga0068853_1002436542 | 61 |
| 345 | 3300005539 | Ga0068853_100374128 | Ga0068853_1003741281 | 61 |
| 346 | 3300005539 | Ga0068853_100375091 | Ga0068853_1003750912 | 61 |
| 347 | 3300005544 | Ga0070686_100681698 | Ga0070686_1006816982 | 61 |
| 348 | 3300005545 | Ga0070695_100023474 | Ga0070695_1000234743 | 61 |
| 349 | 3300005545 | Ga0070695_100731539 | Ga0070695_1007315392 | 61 |
| 350 | 3300005546 | Ga0070696_100002232 | Ga0070696_10000223214 | 61 |
| 351 | 3300005546 | Ga0070696_100027378 | Ga0070696_1000273784 | 61 |
| 352 | 3300005547 | Ga0070693_100000295 | Ga0070693_10000029523 | 61 |
| 353 | 3300005547 | Ga0070693_100089502 | Ga0070693_1000895023 | 61 |
| 354 | 3300005547 | Ga0070693_100341745 | Ga0070693_1003417452 | 61 |
| 355 | 3300005547 | Ga0070693_100364139 | Ga0070693_1003641392 | 61 |
| 356 | 3300005548 | Ga0070665_100073606 | Ga0070665_1000736065 | 61 |
| 357 | 3300005548 | Ga0070665_100904305 | Ga0070665_1009043052 | 61 |
| 358 | 3300005549 | Ga0070704_100007127 | Ga0070704_1000071277 | 61 |
| 359 | 3300005549 | Ga0070704_101173491 | Ga0070704_1011734911 | 61 |
| 360 | 3300005549 | Ga0070704_101529067 | Ga0070704_1015290672 | 61 |
| 361 | 3300005549 | Ga0070704_102281412 | Ga0070704_1022814122 | 61 |
| 362 | 3300005563 | Ga0068855_100002570 | Ga0068855_1000025704 | 61 |
| 363 | 3300005563 | Ga0068855_100003811 | Ga0068855_1000038114 | 61 |
| 364 | 3300005563 | Ga0068855_100048632 | Ga0068855_1000486324 | 61 |
| 365 | 3300005563 | Ga0068855_100323864 | Ga0068855_1003238643 | 61 |
| 366 | 3300005563 | Ga0068855_100551543 | Ga0068855_1005515431 | 61 |
| 367 | 3300005564 | Ga0070664_100147701 | Ga0070664_1001477013 | 61 |
| 368 | 3300005564 | Ga0070664_100275354 | Ga0070664_1002753542 | 61 |
| 369 | 3300005564 | Ga0070664_100498614 | Ga0070664_1004986142 | 61 |
| 370 | 3300005577 | Ga0068857_100003923 | Ga0068857_1000039236 | 61 |
| 371 | 3300005577 | Ga0068857_100014161 | Ga0068857_1000141616 | 61 |
| 372 | 3300005577 | Ga0068857_100928660 | Ga0068857_1009286602 | 61 |
| 373 | 3300005578 | Ga0068854_100040920 | Ga0068854_1000409202 | 61 |
| 374 | 3300005578 | Ga0068854_100109442 | Ga0068854_1001094423 | 61 |
| 375 | 3300005578 | Ga0068854_100163713 | Ga0068854_1001637132 | 61 |
| 376 | 3300005578 | Ga0068854_100259920 | Ga0068854_1002599202 | 61 |
| 377 | 3300005578 | Ga0068854_100351078 | Ga0068854_1003510783 | 61 |
| 378 | 3300005614 | Ga0068856_100002735 | Ga0068856_10000273516 | 61 |
| 379 | 3300005614 | Ga0068856_100010164 | Ga0068856_1000101646 | 61 |
| 380 | 3300005614 | Ga0068856_100016286 | Ga0068856_1000162862 | 61 |
| 381 | 3300005614 | Ga0068856_100036270 | Ga0068856_1000362706 | 61 |
| 382 | 3300005614 | Ga0068856_100799421 | Ga0068856_1007994213 | 61 |
| 383 | 3300005615 | Ga0070702_100312074 | Ga0070702_1003120742 | 61 |
| 384 | 3300005615 | Ga0070702_101192025 | Ga0070702_1011920252 | 61 |
| 385 | 3300005616 | Ga0068852_100000168 | Ga0068852_1000001684 | 61 |
| 386 | 3300005616 | Ga0068852_100069289 | Ga0068852_1000692891 | 61 |
| 387 | 3300005616 | Ga0068852_100137636 | Ga0068852_1001376362 | 61 |
| 388 | 3300005616 | Ga0068852_100237394 | Ga0068852_1002373943 | 61 |
| 389 | 3300005616 | Ga0068852_100399355 | Ga0068852_1003993553 | 61 |
| 390 | 3300005616 | Ga0068852_102336666 | Ga0068852_1023366662 | 61 |
| 391 | 3300005617 | Ga0068859_100014850 | Ga0068859_1000148503 | 61 |
| 392 | 3300005617 | Ga0068859_100140371 | Ga0068859_1001403714 | 61 |
| 393 | 3300005617 | Ga0068859_100295863 | Ga0068859_1002958633 | 61 |
| 394 | 3300005617 | Ga0068859_101272925 | Ga0068859_1012729253 | 61 |
| 395 | 3300005618 | Ga0068864_100000766 | Ga0068864_1000007669 | 61 |
| 396 | 3300005618 | Ga0068864_100095357 | Ga0068864_1000953572 | 61 |
| 397 | 3300005618 | Ga0068864_100203680 | Ga0068864_1002036803 | 61 |
| 398 | 3300005718 | Ga0068866_10157226 | Ga0068866_101572262 | 61 |
| 399 | 3300005718 | Ga0068866_10231881 | Ga0068866_102318813 | 61 |
| 400 | 3300005718 | Ga0068866_10738451 | Ga0068866_107384512 | 61 |
| 401 | 3300005719 | Ga0068861_100489373 | Ga0068861_1004893733 | 61 |
| 402 | 3300005719 | Ga0068861_100651228 | Ga0068861_1006512282 | 61 |
| 403 | 3300005834 | Ga0068851_10020291 | Ga0068851_100202913 | 61 |
| 404 | 3300005834 | Ga0068851_10160405 | Ga0068851_101604052 | 61 |
| 405 | 3300005834 | Ga0068851_10315542 | Ga0068851_103155422 | 61 |
| 406 | 3300005834 | Ga0068851_10487564 | Ga0068851_104875642 | 61 |
| 407 | 3300005834 | Ga0068851_10959188 | Ga0068851_109591882 | 61 |
| 408 | 3300005840 | Ga0068870_10065149 | Ga0068870_100651493 | 61 |
| 409 | 3300005841 | Ga0068863_100030309 | Ga0068863_1000303094 | 61 |
| 410 | 3300005841 | Ga0068863_100216816 | Ga0068863_1002168162 | 61 |
| 411 | 3300005841 | Ga0068863_100720980 | Ga0068863_1007209802 | 61 |
| 412 | 3300005841 | Ga0068863_102173634 | Ga0068863_1021736342 | 61 |
| 413 | 3300005842 | Ga0068858_100451508 | Ga0068858_1004515081 | 61 |
| 414 | 3300005842 | Ga0068858_100476863 | Ga0068858_1004768632 | 61 |
| 415 | 3300005842 | Ga0068858_100607844 | Ga0068858_1006078442 | 61 |
| 416 | 3300005843 | Ga0068860_100000853 | Ga0068860_1000008536 | 61 |
| 417 | 3300005843 | Ga0068860_100167732 | Ga0068860_1001677323 | 61 |
| 418 | 3300005843 | Ga0068860_100271543 | Ga0068860_1002715432 | 61 |
| 419 | 3300005843 | Ga0068860_101312552 | Ga0068860_1013125523 | 61 |
| 420 | 3300005844 | Ga0068862_100073831 | Ga0068862_1000738312 | 61 |
| 421 | 3300005844 | Ga0068862_100508828 | Ga0068862_1005088282 | 61 |
| 422 | 3300006028 | Ga0070717_10012117 | Ga0070717_100121173 | 61 |
| 423 | 3300006028 | Ga0070717_10020526 | Ga0070717_100205264 | 61 |
| 424 | 3300006028 | Ga0070717_10042888 | Ga0070717_100428884 | 61 |
| 425 | 3300006028 | Ga0070717_10152624 | Ga0070717_101526242 | 61 |
| 426 | 3300006028 | Ga0070717_10630547 | Ga0070717_106305471 | 61 |
| 427 | 3300006028 | Ga0070717_10709328 | Ga0070717_107093283 | 61 |
| 428 | 3300006028 | Ga0070717_10979485 | Ga0070717_109794853 | 61 |
| 429 | 3300006028 | Ga0070717_11233949 | Ga0070717_112339492 | 61 |
| 430 | 3300006028 | Ga0070717_11485981 | Ga0070717_114859812 | 61 |
| 431 | 3300006028 | Ga0070717_11713681 | Ga0070717_117136812 | 61 |
| 432 | 3300006028 | Ga0070717_11789576 | Ga0070717_117895761 | 61 |
| 433 | 3300006163 | Ga0070715_10000253 | Ga0070715_100002536 | 61 |
| 434 | 3300006163 | Ga0070715_10238212 | Ga0070715_102382123 | 61 |
| 435 | 3300006163 | Ga0070715_10328535 | Ga0070715_103285352 | 61 |
| 436 | 3300006163 | Ga0070715_10838494 | Ga0070715_108384942 | 61 |
| 437 | 3300006173 | Ga0070716_100000178 | Ga0070716_1000001784 | 61 |
| 438 | 3300006173 | Ga0070716_100000490 | Ga0070716_10000049010 | 61 |
| 439 | 3300006175 | Ga0070712_100018290 | Ga0070712_1000182903 | 61 |
| 440 | 3300006175 | Ga0070712_100027738 | Ga0070712_1000277384 | 61 |
| 441 | 3300006175 | Ga0070712_100154487 | Ga0070712_1001544872 | 61 |
| 442 | 3300006175 | Ga0070712_100195428 | Ga0070712_1001954282 | 61 |
| 443 | 3300006175 | Ga0070712_100226607 | Ga0070712_1002266073 | 61 |
| 444 | 3300006175 | Ga0070712_100286398 | Ga0070712_1002863983 | 61 |
| 445 | 3300006175 | Ga0070712_100590917 | Ga0070712_1005909172 | 61 |
| 446 | 3300006175 | Ga0070712_100818760 | Ga0070712_1008187602 | 61 |
| 447 | 3300006237 | Ga0097621_100001738 | Ga0097621_10000173821 | 61 |
| 448 | 3300006237 | Ga0097621_100002181 | Ga0097621_1000021819 | 61 |
| 449 | 3300006237 | Ga0097621_101084681 | Ga0097621_1010846812 | 61 |
| 450 | 3300006237 | Ga0097621_102375710 | Ga0097621_1023757102 | 61 |
| 451 | 3300006358 | Ga0068871_100000684 | Ga0068871_10000068431 | 61 |
| 452 | 3300006358 | Ga0068871_100628260 | Ga0068871_1006282602 | 61 |
| 453 | 3300006358 | Ga0068871_101000732 | Ga0068871_1010007323 | 61 |
| 454 | 3300006847 | Ga0075431_100257664 | Ga0075431_1002576642 | 61 |
| 455 | 3300006852 | Ga0075433_10004290 | Ga0075433_1000429011 | 61 |
| 456 | 3300006871 | Ga0075434_100003219 | Ga0075434_1000032197 | 61 |
| 457 | 3300006881 | Ga0068865_100350187 | Ga0068865_1003501872 | 61 |
| 458 | 3300006881 | Ga0068865_100502159 | Ga0068865_1005021592 | 61 |
| 459 | 3300006914 | Ga0075436_100000734 | Ga0075436_1000007343 | 61 |
| 460 | 3300006914 | Ga0075436_100169836 | Ga0075436_1001698363 | 61 |
| 461 | 3300006914 | Ga0075436_100745924 | Ga0075436_1007459242 | 61 |
| 462 | 3300006914 | Ga0075436_100892282 | Ga0075436_1008922822 | 61 |
| 463 | 3300006931 | Ga0097620_100014850 | Ga0097620_1000148503 | 61 |
| 464 | 3300006931 | Ga0097620_100140376 | Ga0097620_1001403762 | 61 |
| 465 | 3300006931 | Ga0097620_100295829 | Ga0097620_1002958293 | 61 |
| 466 | 3300006931 | Ga0097620_101272729 | Ga0097620_1012727293 | 61 |
| 467 | 3300007076 | Ga0075435_101437597 | Ga0075435_1014375972 | 61 |
| 468 | 3300007076 | Ga0075435_101799759 | Ga0075435_1017997592 | 61 |
| 469 | 3300007265 | Ga0099794_10014819 | Ga0099794_100148195 | 61 |
| 470 | 3300007265 | Ga0099794_10099181 | Ga0099794_100991812 | 61 |
| 471 | 3300007265 | Ga0099794_10145911 | Ga0099794_101459113 | 61 |
| 472 | 3300007265 | Ga0099794_10253522 | Ga0099794_102535222 | 61 |
| 473 | 3300007265 | Ga0099794_10275485 | Ga0099794_102754853 | 61 |
| 474 | 3300007265 | Ga0099794_10471416 | Ga0099794_104714162 | 61 |
| 475 | 3300007265 | Ga0099794_10647655 | Ga0099794_106476552 | 61 |
| 476 | 3300007788 | Ga0099795_10009030 | Ga0099795_100090303 | 61 |
| 477 | 3300007788 | Ga0099795_10581405 | Ga0099795_105814052 | 61 |
| 478 | 3300009093 | Ga0105240_10002969 | Ga0105240_1000296915 | 61 |
| 479 | 3300009093 | Ga0105240_10004531 | Ga0105240_100045314 | 61 |
| 480 | 3300009093 | Ga0105240_10008135 | Ga0105240_100081359 | 61 |
| 481 | 3300009093 | Ga0105240_10015824 | Ga0105240_100158242 | 61 |
| 482 | 3300009093 | Ga0105240_10021182 | Ga0105240_100211822 | 61 |
| 483 | 3300009093 | Ga0105240_10373775 | Ga0105240_103737752 | 61 |
| 484 | 3300009093 | Ga0105240_11635146 | Ga0105240_116351463 | 61 |
| 485 | 3300009093 | Ga0105240_12191163 | Ga0105240_121911631 | 61 |
| 486 | 3300009093 | Ga0105240_12210262 | Ga0105240_122102622 | 61 |
| 487 | 3300009098 | Ga0105245_10002548 | Ga0105245_100025489 | 61 |
| 488 | 3300009098 | Ga0105245_10058933 | Ga0105245_100589333 | 61 |
| 489 | 3300009098 | Ga0105245_10179032 | Ga0105245_101790322 | 61 |
| 490 | 3300009098 | Ga0105245_10826583 | Ga0105245_108265832 | 61 |
| 491 | 3300009098 | Ga0105245_10910675 | Ga0105245_109106751 | 61 |
| 492 | 3300009098 | Ga0105245_12307064 | Ga0105245_123070643 | 61 |
| 493 | 3300009098 | Ga0105245_13150453 | Ga0105245_131504531 | 61 |
| 494 | 3300009101 | Ga0105247_10000309 | Ga0105247_1000030910 | 61 |
| 495 | 3300009101 | Ga0105247_11074500 | Ga0105247_110745002 | 61 |
| 496 | 3300009147 | Ga0114129_10229636 | Ga0114129_102296363 | 61 |
| 497 | 3300009147 | Ga0114129_10316878 | Ga0114129_103168783 | 61 |
| 498 | 3300009148 | Ga0105243_11970850 | Ga0105243_119708502 | 61 |
| 499 | 3300009174 | Ga0105241_10000484 | Ga0105241_100004845 | 61 |
| 500 | 3300009174 | Ga0105241_10002430 | Ga0105241_100024309 | 61 |
| 501 | 3300009174 | Ga0105241_10003383 | Ga0105241_1000338315 | 61 |
| 502 | 3300009174 | Ga0105241_10009593 | Ga0105241_100095934 | 61 |
| 503 | 3300009174 | Ga0105241_10084876 | Ga0105241_100848763 | 61 |
| 504 | 3300009174 | Ga0105241_10217895 | Ga0105241_102178953 | 61 |
| 505 | 3300009174 | Ga0105241_10272123 | Ga0105241_102721232 | 61 |
| 506 | 3300009174 | Ga0105241_10296555 | Ga0105241_102965552 | 61 |
| 507 | 3300009174 | Ga0105241_10427908 | Ga0105241_104279082 | 61 |
| 508 | 3300009174 | Ga0105241_12438448 | Ga0105241_124384482 | 61 |
| 509 | 3300009176 | Ga0105242_12143368 | Ga0105242_121433683 | 61 |
| 510 | 3300009177 | Ga0105248_10002507 | Ga0105248_100025074 | 61 |
| 511 | 3300009177 | Ga0105248_10004010 | Ga0105248_1000401013 | 61 |
| 512 | 3300009177 | Ga0105248_10006361 | Ga0105248_1000636110 | 61 |
| 513 | 3300009177 | Ga0105248_10103783 | Ga0105248_101037834 | 61 |
| 514 | 3300009177 | Ga0105248_10148866 | Ga0105248_101488663 | 61 |
| 515 | 3300009177 | Ga0105248_10203549 | Ga0105248_102035492 | 61 |
| 516 | 3300009177 | Ga0105248_10464828 | Ga0105248_104648282 | 61 |
| 517 | 3300009177 | Ga0105248_12442422 | Ga0105248_124424222 | 61 |
| 518 | 3300009545 | Ga0105237_10003212 | Ga0105237_1000321212 | 61 |
| 519 | 3300009545 | Ga0105237_10006164 | Ga0105237_100061649 | 61 |
| 520 | 3300009545 | Ga0105237_10013070 | Ga0105237_100130705 | 61 |
| 521 | 3300009545 | Ga0105237_10053146 | Ga0105237_100531464 | 61 |
| 522 | 3300009545 | Ga0105237_10070700 | Ga0105237_100707002 | 61 |
| 523 | 3300009545 | Ga0105237_10099970 | Ga0105237_100999702 | 61 |
| 524 | 3300009545 | Ga0105237_10189691 | Ga0105237_101896913 | 61 |
| 525 | 3300009545 | Ga0105237_10305096 | Ga0105237_103050962 | 61 |
| 526 | 3300009545 | Ga0105237_12114703 | Ga0105237_121147032 | 61 |
| 527 | 3300009551 | Ga0105238_10000064 | Ga0105238_1000006411 | 61 |
| 528 | 3300009551 | Ga0105238_10000158 | Ga0105238_100001584 | 61 |
| 529 | 3300009551 | Ga0105238_10003686 | Ga0105238_100036864 | 61 |
| 530 | 3300009551 | Ga0105238_10192473 | Ga0105238_101924732 | 61 |
| 531 | 3300009551 | Ga0105238_10244069 | Ga0105238_102440692 | 61 |
| 532 | 3300009551 | Ga0105238_10252412 | Ga0105238_102524122 | 61 |
| 533 | 3300009551 | Ga0105238_10431567 | Ga0105238_104315673 | 61 |
| 534 | 3300009551 | Ga0105238_10540399 | Ga0105238_105403992 | 61 |
| 535 | 3300009551 | Ga0105238_11164847 | Ga0105238_111648472 | 61 |
| 536 | 3300009551 | Ga0105238_11564820 | Ga0105238_115648202 | 61 |
| 537 | 3300009551 | Ga0105238_12277319 | Ga0105238_122773192 | 61 |
| 538 | 3300009553 | Ga0105249_10016698 | Ga0105249_100166982 | 61 |
| 539 | 3300009553 | Ga0105249_10018782 | Ga0105249_100187824 | 61 |
| 540 | 3300009553 | Ga0105249_10616205 | Ga0105249_106162053 | 61 |
| 541 | 3300010159 | Ga0099796_10095858 | Ga0099796_100958581 | 61 |
| 542 | 3300010159 | Ga0099796_10129073 | Ga0099796_101290731 | 61 |
| 543 | 3300010375 | Ga0105239_10005034 | Ga0105239_100050345 | 61 |
| 544 | 3300010375 | Ga0105239_10006631 | Ga0105239_100066319 | 61 |
| 545 | 3300010375 | Ga0105239_10008365 | Ga0105239_1000836520 | 61 |
| 546 | 3300010375 | Ga0105239_10161015 | Ga0105239_101610153 | 61 |
| 547 | 3300010375 | Ga0105239_10308132 | Ga0105239_103081322 | 61 |
| 548 | 3300010375 | Ga0105239_11858183 | Ga0105239_118581832 | 61 |
| 549 | 3300011119 | Ga0105246_10143174 | Ga0105246_101431742 | 61 |
| 550 | 3300011119 | Ga0105246_10796550 | Ga0105246_107965503 | 61 |
| 551 | 3300012498 | Ga0157345_1053021 | Ga0157345_10530212 | 61 |
| 552 | 3300013100 | Ga0157373_10224107 | Ga0157373_102241072 | 61 |
| 553 | 3300013100 | Ga0157373_10354300 | Ga0157373_103543003 | 61 |
| 554 | 3300013100 | Ga0157373_10360877 | Ga0157373_103608772 | 61 |
| 555 | 3300013100 | Ga0157373_11556906 | Ga0157373_115569062 | 61 |
| 556 | 3300013102 | Ga0157371_10071067 | Ga0157371_100710673 | 61 |
| 557 | 3300013102 | Ga0157371_10326905 | Ga0157371_103269053 | 61 |
| 558 | 3300013102 | Ga0157371_10377394 | Ga0157371_103773942 | 61 |
| 559 | 3300013102 | Ga0157371_10958241 | Ga0157371_109582411 | 61 |
| 560 | 3300013104 | Ga0157370_10316768 | Ga0157370_103167683 | 61 |
| 561 | 3300013104 | Ga0157370_10370282 | Ga0157370_103702823 | 61 |
| 562 | 3300013104 | Ga0157370_10375612 | Ga0157370_103756123 | 61 |
| 563 | 3300013105 | Ga0157369_10001758 | Ga0157369_1000175810 | 61 |
| 564 | 3300013105 | Ga0157369_10012629 | Ga0157369_100126294 | 61 |
| 565 | 3300013105 | Ga0157369_10040898 | Ga0157369_100408984 | 61 |
| 566 | 3300013105 | Ga0157369_10047007 | Ga0157369_100470073 | 61 |
| 567 | 3300013105 | Ga0157369_10285123 | Ga0157369_102851232 | 61 |
| 568 | 3300013105 | Ga0157369_12597355 | Ga0157369_125973552 | 61 |
| 569 | 3300013296 | Ga0157374_10000140 | Ga0157374_100001407 | 61 |
| 570 | 3300013296 | Ga0157374_10000606 | Ga0157374_1000060614 | 61 |
| 571 | 3300013296 | Ga0157374_10000932 | Ga0157374_1000093210 | 61 |
| 572 | 3300013296 | Ga0157374_10003280 | Ga0157374_100032803 | 61 |
| 573 | 3300013296 | Ga0157374_10023342 | Ga0157374_100233424 | 61 |
| 574 | 3300013296 | Ga0157374_10777652 | Ga0157374_107776522 | 61 |
| 575 | 3300013296 | Ga0157374_10871434 | Ga0157374_108714342 | 61 |
| 576 | 3300013296 | Ga0157374_12190900 | Ga0157374_121909002 | 61 |
| 577 | 3300013296 | Ga0157374_12354741 | Ga0157374_123547412 | 61 |
| 578 | 3300013297 | Ga0157378_10000135 | Ga0157378_100001356 | 61 |
| 579 | 3300013297 | Ga0157378_10000455 | Ga0157378_1000045521 | 61 |
| 580 | 3300013297 | Ga0157378_10001627 | Ga0157378_1000162714 | 61 |
| 581 | 3300013297 | Ga0157378_10007973 | Ga0157378_100079734 | 61 |
| 582 | 3300013297 | Ga0157378_10052473 | Ga0157378_100524734 | 61 |
| 583 | 3300013297 | Ga0157378_10248780 | Ga0157378_102487802 | 61 |
| 584 | 3300013297 | Ga0157378_10251800 | Ga0157378_102518001 | 61 |
| 585 | 3300013297 | Ga0157378_10447143 | Ga0157378_104471432 | 61 |
| 586 | 3300013297 | Ga0157378_12769575 | Ga0157378_127695752 | 61 |
| 587 | 3300013306 | Ga0163162_10042583 | Ga0163162_100425834 | 61 |
| 588 | 3300013306 | Ga0163162_10349710 | Ga0163162_103497102 | 61 |
| 589 | 3300013306 | Ga0163162_11027437 | Ga0163162_110274373 | 61 |
| 590 | 3300013306 | Ga0163162_12743808 | Ga0163162_127438082 | 61 |
| 591 | 3300013306 | Ga0163162_13428395 | Ga0163162_134283952 | 61 |
| 592 | 3300013307 | Ga0157372_10000516 | Ga0157372_1000051615 | 61 |
| 593 | 3300013307 | Ga0157372_10001989 | Ga0157372_1000198918 | 61 |
| 594 | 3300013307 | Ga0157372_10004593 | Ga0157372_1000459314 | 61 |
| 595 | 3300013307 | Ga0157372_10008726 | Ga0157372_100087264 | 61 |
| 596 | 3300013307 | Ga0157372_10031843 | Ga0157372_100318435 | 61 |
| 597 | 3300013307 | Ga0157372_10112498 | Ga0157372_101124984 | 61 |
| 598 | 3300013307 | Ga0157372_10362242 | Ga0157372_103622422 | 61 |
| 599 | 3300013307 | Ga0157372_10374710 | Ga0157372_103747103 | 61 |
| 600 | 3300013307 | Ga0157372_10501921 | Ga0157372_105019212 | 61 |
| 601 | 3300013307 | Ga0157372_12212515 | Ga0157372_122125153 | 61 |
| 602 | 3300013307 | Ga0157372_12666079 | Ga0157372_126660791 | 61 |
| 603 | 3300013308 | Ga0157375_10001472 | Ga0157375_1000147214 | 61 |
| 604 | 3300013308 | Ga0157375_10006442 | Ga0157375_100064426 | 61 |
| 605 | 3300014325 | Ga0163163_10206958 | Ga0163163_102069582 | 61 |
| 606 | 3300014325 | Ga0163163_10794279 | Ga0163163_107942792 | 61 |
| 607 | 3300014325 | Ga0163163_12209526 | Ga0163163_122095262 | 61 |
| 608 | 3300014497 | Ga0182008_10135353 | Ga0182008_101353532 | 61 |
| 609 | 3300014745 | Ga0157377_10197526 | Ga0157377_101975262 | 61 |
| 610 | 3300014968 | Ga0157379_10009173 | Ga0157379_100091738 | 61 |
| 611 | 3300014968 | Ga0157379_10608431 | Ga0157379_106084313 | 61 |
| 612 | 3300014968 | Ga0157379_10758045 | Ga0157379_107580453 | 61 |
| 613 | 3300014968 | Ga0157379_11723075 | Ga0157379_117230752 | 61 |
| 614 | 3300014969 | Ga0157376_10000792 | Ga0157376_100007924 | 61 |
| 615 | 3300014969 | Ga0157376_10141601 | Ga0157376_101416013 | 61 |
| 616 | 3300014969 | Ga0157376_10351056 | Ga0157376_103510563 | 61 |
| 617 | 3300014969 | Ga0157376_10541961 | Ga0157376_105419613 | 61 |
| 618 | 3300015262 | Ga0182007_10092972 | Ga0182007_100929723 | 61 |
| 619 | 3300015265 | Ga0182005_1273487 | Ga0182005_12734871 | 61 |
| 620 | 3300021358 | Ga0213873_10237122 | Ga0213873_102371222 | 61 |
| 621 | 3300024227 | Ga0228598_1006840 | Ga0228598_10068402 | 61 |
| 622 | 3300025321 | Ga0207656_10026621 | Ga0207656_100266212 | 61 |
| 623 | 3300025321 | Ga0207656_10057595 | Ga0207656_100575952 | 61 |
| 624 | 3300025321 | Ga0207656_10086396 | Ga0207656_100863962 | 61 |
| 625 | 3300025321 | Ga0207656_10162584 | Ga0207656_101625842 | 61 |
| 626 | 3300025885 | Ga0207653_10001051 | Ga0207653_100010517 | 61 |
| 627 | 3300025898 | Ga0207692_10199554 | Ga0207692_101995543 | 61 |
| 628 | 3300025898 | Ga0207692_10376344 | Ga0207692_103763441 | 61 |
| 629 | 3300025898 | Ga0207692_10755779 | Ga0207692_107557792 | 61 |
| 630 | 3300025898 | Ga0207692_10787837 | Ga0207692_107878373 | 61 |
| 631 | 3300025900 | Ga0207710_10000259 | Ga0207710_100002599 | 61 |
| 632 | 3300025903 | Ga0207680_10204301 | Ga0207680_102043012 | 61 |
| 633 | 3300025904 | Ga0207647_10661016 | Ga0207647_106610162 | 61 |
| 634 | 3300025905 | Ga0207685_10004549 | Ga0207685_100045495 | 61 |
| 635 | 3300025906 | Ga0207699_10043049 | Ga0207699_100430494 | 61 |
| 636 | 3300025906 | Ga0207699_10051030 | Ga0207699_100510303 | 61 |
| 637 | 3300025906 | Ga0207699_10568389 | Ga0207699_105683892 | 61 |
| 638 | 3300025906 | Ga0207699_11046953 | Ga0207699_110469532 | 61 |
| 639 | 3300025906 | Ga0207699_11186629 | Ga0207699_111866291 | 61 |
| 640 | 3300025908 | Ga0207643_10073546 | Ga0207643_100735463 | 61 |
| 641 | 3300025909 | Ga0207705_10551370 | Ga0207705_105513702 | 61 |
| 642 | 3300025909 | Ga0207705_11108553 | Ga0207705_111085532 | 61 |
| 643 | 3300025910 | Ga0207684_10054909 | Ga0207684_100549095 | 61 |
| 644 | 3300025910 | Ga0207684_10336419 | Ga0207684_103364193 | 61 |
| 645 | 3300025911 | Ga0207654_10000151 | Ga0207654_100001515 | 61 |
| 646 | 3300025911 | Ga0207654_10000976 | Ga0207654_100009769 | 61 |
| 647 | 3300025911 | Ga0207654_10013505 | Ga0207654_100135054 | 61 |
| 648 | 3300025911 | Ga0207654_10060382 | Ga0207654_100603823 | 61 |
| 649 | 3300025911 | Ga0207654_10367985 | Ga0207654_103679852 | 61 |
| 650 | 3300025911 | Ga0207654_10626877 | Ga0207654_106268772 | 61 |
| 651 | 3300025912 | Ga0207707_10046843 | Ga0207707_100468433 | 61 |
| 652 | 3300025912 | Ga0207707_10371025 | Ga0207707_103710253 | 61 |
| 653 | 3300025912 | Ga0207707_10506079 | Ga0207707_105060792 | 61 |
| 654 | 3300025913 | Ga0207695_10001158 | Ga0207695_1000115820 | 61 |
| 655 | 3300025913 | Ga0207695_10001234 | Ga0207695_1000123418 | 61 |
| 656 | 3300025913 | Ga0207695_10006741 | Ga0207695_100067414 | 61 |
| 657 | 3300025913 | Ga0207695_10035725 | Ga0207695_100357252 | 61 |
| 658 | 3300025913 | Ga0207695_10089462 | Ga0207695_100894622 | 61 |
| 659 | 3300025913 | Ga0207695_10171220 | Ga0207695_101712202 | 61 |
| 660 | 3300025913 | Ga0207695_10273976 | Ga0207695_102739762 | 61 |
| 661 | 3300025913 | Ga0207695_10584963 | Ga0207695_105849633 | 61 |
| 662 | 3300025914 | Ga0207671_10000942 | Ga0207671_1000094221 | 61 |
| 663 | 3300025914 | Ga0207671_10003174 | Ga0207671_1000317410 | 61 |
| 664 | 3300025914 | Ga0207671_10023281 | Ga0207671_100232813 | 61 |
| 665 | 3300025914 | Ga0207671_10060323 | Ga0207671_100603234 | 61 |
| 666 | 3300025914 | Ga0207671_10124349 | Ga0207671_101243493 | 61 |
| 667 | 3300025914 | Ga0207671_10398154 | Ga0207671_103981542 | 61 |
| 668 | 3300025914 | Ga0207671_10637122 | Ga0207671_106371223 | 61 |
| 669 | 3300025914 | Ga0207671_11056502 | Ga0207671_110565022 | 61 |
| 670 | 3300025915 | Ga0207693_10004922 | Ga0207693_100049225 | 61 |
| 671 | 3300025915 | Ga0207693_10013894 | Ga0207693_100138941 | 61 |
| 672 | 3300025915 | Ga0207693_10058732 | Ga0207693_100587323 | 61 |
| 673 | 3300025915 | Ga0207693_10331581 | Ga0207693_103315812 | 61 |
| 674 | 3300025915 | Ga0207693_10364303 | Ga0207693_103643032 | 61 |
| 675 | 3300025915 | Ga0207693_11243120 | Ga0207693_112431202 | 61 |
| 676 | 3300025916 | Ga0207663_10023743 | Ga0207663_100237435 | 61 |
| 677 | 3300025916 | Ga0207663_10263485 | Ga0207663_102634852 | 61 |
| 678 | 3300025916 | Ga0207663_10435253 | Ga0207663_104352533 | 61 |
| 679 | 3300025916 | Ga0207663_10594328 | Ga0207663_105943282 | 61 |
| 680 | 3300025917 | Ga0207660_10020764 | Ga0207660_100207645 | 61 |
| 681 | 3300025917 | Ga0207660_10098100 | Ga0207660_100981003 | 61 |
| 682 | 3300025917 | Ga0207660_10632907 | Ga0207660_106329072 | 61 |
| 683 | 3300025917 | Ga0207660_11655731 | Ga0207660_116557312 | 61 |
| 684 | 3300025919 | Ga0207657_11452719 | Ga0207657_114527192 | 61 |
| 685 | 3300025920 | Ga0207649_10016805 | Ga0207649_100168052 | 61 |
| 686 | 3300025920 | Ga0207649_10026172 | Ga0207649_100261722 | 61 |
| 687 | 3300025920 | Ga0207649_10097483 | Ga0207649_100974833 | 61 |
| 688 | 3300025920 | Ga0207649_10139682 | Ga0207649_101396822 | 61 |
| 689 | 3300025921 | Ga0207652_10013414 | Ga0207652_100134148 | 61 |
| 690 | 3300025921 | Ga0207652_10058182 | Ga0207652_100581824 | 61 |
| 691 | 3300025921 | Ga0207652_10348568 | Ga0207652_103485682 | 61 |
| 692 | 3300025922 | Ga0207646_10280052 | Ga0207646_102800522 | 61 |
| 693 | 3300025924 | Ga0207694_10000083 | Ga0207694_1000008377 | 61 |
| 694 | 3300025924 | Ga0207694_10000290 | Ga0207694_100002904 | 61 |
| 695 | 3300025924 | Ga0207694_10001486 | Ga0207694_1000148612 | 61 |
| 696 | 3300025924 | Ga0207694_10017160 | Ga0207694_100171603 | 61 |
| 697 | 3300025924 | Ga0207694_10122058 | Ga0207694_101220582 | 61 |
| 698 | 3300025924 | Ga0207694_10135431 | Ga0207694_101354313 | 61 |
| 699 | 3300025924 | Ga0207694_10809768 | Ga0207694_108097682 | 61 |
| 700 | 3300025924 | Ga0207694_11708307 | Ga0207694_117083072 | 61 |
| 701 | 3300025925 | Ga0207650_10036753 | Ga0207650_100367532 | 61 |
| 702 | 3300025927 | Ga0207687_10025686 | Ga0207687_100256861 | 61 |
| 703 | 3300025927 | Ga0207687_10404208 | Ga0207687_104042083 | 61 |
| 704 | 3300025927 | Ga0207687_11921077 | Ga0207687_119210772 | 61 |
| 705 | 3300025928 | Ga0207700_10007789 | Ga0207700_100077895 | 61 |
| 706 | 3300025928 | Ga0207700_10010256 | Ga0207700_100102563 | 61 |
| 707 | 3300025928 | Ga0207700_10078613 | Ga0207700_100786134 | 61 |
| 708 | 3300025928 | Ga0207700_10176955 | Ga0207700_101769552 | 61 |
| 709 | 3300025928 | Ga0207700_10189481 | Ga0207700_101894812 | 61 |
| 710 | 3300025928 | Ga0207700_10263921 | Ga0207700_102639213 | 61 |
| 711 | 3300025928 | Ga0207700_10989656 | Ga0207700_109896562 | 61 |
| 712 | 3300025929 | Ga0207664_10016879 | Ga0207664_100168796 | 61 |
| 713 | 3300025929 | Ga0207664_10022657 | Ga0207664_100226573 | 61 |
| 714 | 3300025929 | Ga0207664_10029459 | Ga0207664_100294592 | 61 |
| 715 | 3300025929 | Ga0207664_10080768 | Ga0207664_100807683 | 61 |
| 716 | 3300025929 | Ga0207664_10148999 | Ga0207664_101489993 | 61 |
| 717 | 3300025929 | Ga0207664_10278329 | Ga0207664_102783291 | 61 |
| 718 | 3300025929 | Ga0207664_11812150 | Ga0207664_118121502 | 61 |
| 719 | 3300025931 | Ga0207644_10015999 | Ga0207644_100159996 | 61 |
| 720 | 3300025931 | Ga0207644_11623210 | Ga0207644_116232102 | 61 |
| 721 | 3300025933 | Ga0207706_10630245 | Ga0207706_106302452 | 61 |
| 722 | 3300025934 | Ga0207686_10862373 | Ga0207686_108623732 | 61 |
| 723 | 3300025934 | Ga0207686_10962535 | Ga0207686_109625352 | 61 |
| 724 | 3300025935 | Ga0207709_10594899 | Ga0207709_105948993 | 61 |
| 725 | 3300025935 | Ga0207709_10611036 | Ga0207709_106110361 | 61 |
| 726 | 3300025936 | Ga0207670_10650059 | Ga0207670_106500593 | 61 |
| 727 | 3300025937 | Ga0207669_10610727 | Ga0207669_106107272 | 61 |
| 728 | 3300025938 | Ga0207704_10852352 | Ga0207704_108523522 | 61 |
| 729 | 3300025939 | Ga0207665_10000015 | Ga0207665_1000001584 | 61 |
| 730 | 3300025939 | Ga0207665_10001233 | Ga0207665_1000123317 | 61 |
| 731 | 3300025939 | Ga0207665_10464952 | Ga0207665_104649522 | 61 |
| 732 | 3300025941 | Ga0207711_10006467 | Ga0207711_100064674 | 61 |
| 733 | 3300025941 | Ga0207711_10070197 | Ga0207711_100701971 | 61 |
| 734 | 3300025941 | Ga0207711_10075506 | Ga0207711_100755064 | 61 |
| 735 | 3300025941 | Ga0207711_10233489 | Ga0207711_102334893 | 61 |
| 736 | 3300025941 | Ga0207711_10298697 | Ga0207711_102986972 | 61 |
| 737 | 3300025941 | Ga0207711_10945457 | Ga0207711_109454573 | 61 |
| 738 | 3300025941 | Ga0207711_11075911 | Ga0207711_110759112 | 61 |
| 739 | 3300025942 | Ga0207689_10002236 | Ga0207689_100022369 | 61 |
| 740 | 3300025944 | Ga0207661_10026192 | Ga0207661_100261925 | 61 |
| 741 | 3300025944 | Ga0207661_10073225 | Ga0207661_100732253 | 61 |
| 742 | 3300025945 | Ga0207679_10062875 | Ga0207679_100628753 | 61 |
| 743 | 3300025945 | Ga0207679_10216289 | Ga0207679_102162891 | 61 |
| 744 | 3300025945 | Ga0207679_10405642 | Ga0207679_104056423 | 61 |
| 745 | 3300025949 | Ga0207667_10000421 | Ga0207667_1000042150 | 61 |
| 746 | 3300025949 | Ga0207667_10004502 | Ga0207667_100045029 | 61 |
| 747 | 3300025949 | Ga0207667_11232861 | Ga0207667_112328612 | 61 |
| 748 | 3300025960 | Ga0207651_10178702 | Ga0207651_101787023 | 61 |
| 749 | 3300025961 | Ga0207712_10082876 | Ga0207712_100828763 | 61 |
| 750 | 3300025961 | Ga0207712_11520671 | Ga0207712_115206712 | 61 |
| 751 | 3300025981 | Ga0207640_10013311 | Ga0207640_100133114 | 61 |
| 752 | 3300025981 | Ga0207640_10100448 | Ga0207640_101004483 | 61 |
| 753 | 3300025981 | Ga0207640_10226484 | Ga0207640_102264843 | 61 |
| 754 | 3300025981 | Ga0207640_10477656 | Ga0207640_104776561 | 61 |
| 755 | 3300025981 | Ga0207640_11352793 | Ga0207640_113527932 | 61 |
| 756 | 3300025986 | Ga0207658_10002295 | Ga0207658_100022959 | 61 |
| 757 | 3300025986 | Ga0207658_10945985 | Ga0207658_109459852 | 61 |
| 758 | 3300025986 | Ga0207658_12140708 | Ga0207658_121407082 | 61 |
| 759 | 3300026023 | Ga0207677_10001520 | Ga0207677_100015209 | 61 |
| 760 | 3300026023 | Ga0207677_10005380 | Ga0207677_100053803 | 61 |
| 761 | 3300026023 | Ga0207677_10116801 | Ga0207677_101168012 | 61 |
| 762 | 3300026023 | Ga0207677_10210593 | Ga0207677_102105933 | 61 |
| 763 | 3300026023 | Ga0207677_10236897 | Ga0207677_102368973 | 61 |
| 764 | 3300026023 | Ga0207677_10316522 | Ga0207677_103165223 | 61 |
| 765 | 3300026023 | Ga0207677_11015086 | Ga0207677_110150862 | 61 |
| 766 | 3300026035 | Ga0207703_10010887 | Ga0207703_100108874 | 61 |
| 767 | 3300026035 | Ga0207703_12099056 | Ga0207703_120990562 | 61 |
| 768 | 3300026041 | Ga0207639_10000027 | Ga0207639_1000002783 | 61 |
| 769 | 3300026041 | Ga0207639_10068385 | Ga0207639_100683852 | 61 |
| 770 | 3300026041 | Ga0207639_10082567 | Ga0207639_100825673 | 61 |
| 771 | 3300026041 | Ga0207639_10083705 | Ga0207639_100837053 | 61 |
| 772 | 3300026041 | Ga0207639_10978454 | Ga0207639_109784543 | 61 |
| 773 | 3300026075 | Ga0207708_10986582 | Ga0207708_109865823 | 61 |
| 774 | 3300026078 | Ga0207702_10000219 | Ga0207702_1000021963 | 61 |
| 775 | 3300026078 | Ga0207702_10000823 | Ga0207702_100008234 | 61 |
| 776 | 3300026078 | Ga0207702_10038960 | Ga0207702_100389604 | 61 |
| 777 | 3300026078 | Ga0207702_10308799 | Ga0207702_103087993 | 61 |
| 778 | 3300026078 | Ga0207702_10963540 | Ga0207702_109635402 | 61 |
| 779 | 3300026088 | Ga0207641_10001089 | Ga0207641_100010894 | 61 |
| 780 | 3300026088 | Ga0207641_10123368 | Ga0207641_101233683 | 61 |
| 781 | 3300026088 | Ga0207641_10380575 | Ga0207641_103805752 | 61 |
| 782 | 3300026088 | Ga0207641_11274287 | Ga0207641_112742871 | 61 |
| 783 | 3300026088 | Ga0207641_11303512 | Ga0207641_113035122 | 61 |
| 784 | 3300026088 | Ga0207641_11596231 | Ga0207641_115962313 | 61 |
| 785 | 3300026089 | Ga0207648_10021804 | Ga0207648_100218043 | 61 |
| 786 | 3300026089 | Ga0207648_10200527 | Ga0207648_102005273 | 61 |
| 787 | 3300026089 | Ga0207648_11801858 | Ga0207648_118018582 | 61 |
| 788 | 3300026089 | Ga0207648_12276187 | Ga0207648_122761872 | 61 |
| 789 | 3300026095 | Ga0207676_10013135 | Ga0207676_100131356 | 61 |
| 790 | 3300026095 | Ga0207676_10139407 | Ga0207676_101394073 | 61 |
| 791 | 3300026116 | Ga0207674_10000385 | Ga0207674_1000038531 | 61 |
| 792 | 3300026116 | Ga0207674_10005465 | Ga0207674_100054654 | 61 |
| 793 | 3300026118 | Ga0207675_101301928 | Ga0207675_1013019282 | 61 |
| 794 | 3300026118 | Ga0207675_102644636 | Ga0207675_1026446362 | 61 |
| 795 | 3300026121 | Ga0207683_10139086 | Ga0207683_101390862 | 61 |
| 796 | 3300026121 | Ga0207683_11621094 | Ga0207683_116210942 | 61 |
| 797 | 3300026142 | Ga0207698_10000065 | Ga0207698_1000006547 | 61 |
| 798 | 3300026142 | Ga0207698_10160701 | Ga0207698_101607013 | 61 |
| 799 | 3300026142 | Ga0207698_10242796 | Ga0207698_102427962 | 61 |
| 800 | 3300026142 | Ga0207698_10471317 | Ga0207698_104713172 | 61 |
| 801 | 3300026142 | Ga0207698_10985380 | Ga0207698_109853803 | 61 |
| 802 | 3300026142 | Ga0207698_11578763 | Ga0207698_115787632 | 61 |
| 803 | 3300027512 | Ga0209179_1060307 | Ga0209179_10603072 | 61 |
| 804 | 3300027671 | Ga0209588_1012680 | Ga0209588_10126802 | 61 |
| 805 | 3300027671 | Ga0209588_1016448 | Ga0209588_10164483 | 61 |
| 806 | 3300027671 | Ga0209588_1016784 | Ga0209588_10167843 | 61 |
| 807 | 3300027671 | Ga0209588_1036120 | Ga0209588_10361202 | 61 |
| 808 | 3300028016 | Ga0265354_1000540 | Ga0265354_10005403 | 61 |
| 809 | 3300028016 | Ga0265354_1000550 | Ga0265354_10005504 | 61 |
| 810 | 3300028379 | Ga0268266_10318150 | Ga0268266_103181502 | 61 |
| 811 | 3300028379 | Ga0268266_10735083 | Ga0268266_107350832 | 61 |
| 812 | 3300028380 | Ga0268265_10008987 | Ga0268265_100089876 | 61 |
| 813 | 3300028381 | Ga0268264_10002414 | Ga0268264_100024144 | 61 |
| 814 | 3300028381 | Ga0268264_12285767 | Ga0268264_122857672 | 61 |
| 815 | 3300028556 | Ga0265337_1228702 | Ga0265337_12287022 | 61 |
| 816 | 3300028800 | Ga0265338_10668045 | Ga0265338_106680452 | 61 |
| 817 | 3300028800 | Ga0265338_10841360 | Ga0265338_108413602 | 61 |
| 818 | 3300030760 | Ga0265762_1015436 | Ga0265762_10154362 | 61 |
| 819 | 3300030878 | Ga0265770_1028698 | Ga0265770_10286982 | 61 |
| 820 | 3300030879 | Ga0265765_1000615 | Ga0265765_10006155 | 61 |
| 821 | 3300030879 | Ga0265765_1054039 | Ga0265765_10540391 | 61 |
| 822 | 3300031018 | Ga0265773_1005394 | Ga0265773_10053942 | 61 |
| 823 | 3300031090 | Ga0265760_10309186 | Ga0265760_103091862 | 61 |
| 824 | 3300031238 | Ga0265332_10061438 | Ga0265332_100614382 | 61 |
| 825 | 3300031239 | Ga0265328_10076485 | Ga0265328_100764852 | 61 |
| 826 | 3300031240 | Ga0265320_10011528 | Ga0265320_100115287 | 61 |
| 827 | 3300031240 | Ga0265320_10237009 | Ga0265320_102370092 | 61 |
| 828 | 3300031240 | Ga0265320_10392853 | Ga0265320_103928531 | 61 |
| 829 | 3300031242 | Ga0265329_10015332 | Ga0265329_100153324 | 61 |
| 830 | 3300031247 | Ga0265340_10076476 | Ga0265340_100764762 | 61 |
| 831 | 3300031250 | Ga0265331_10002105 | Ga0265331_1000210510 | 61 |
| 832 | 3300031344 | Ga0265316_10006389 | Ga0265316_1000638914 | 61 |
| 833 | 3300031344 | Ga0265316_10007173 | Ga0265316_100071733 | 61 |
| 834 | 3300031344 | Ga0265316_10049086 | Ga0265316_100490862 | 61 |
| 835 | 3300031344 | Ga0265316_11269424 | Ga0265316_112694242 | 61 |
| 836 | 3300031548 | Ga0307408_100051369 | Ga0307408_1000513692 | 61 |
| 837 | 3300031711 | Ga0265314_10003845 | Ga0265314_1000384512 | 61 |
| 838 | 3300031712 | Ga0265342_10191914 | Ga0265342_101919142 | 61 |
| 839 | 3300031731 | Ga0307405_10020293 | Ga0307405_100202935 | 61 |
| 840 | 3300031824 | Ga0307413_10013897 | Ga0307413_100138973 | 61 |
| 841 | 3300031824 | Ga0307413_10154372 | Ga0307413_101543723 | 61 |
| 842 | 3300031852 | Ga0307410_10000364 | Ga0307410_100003649 | 61 |
| 843 | 3300031852 | Ga0307410_10162450 | Ga0307410_101624502 | 61 |
| 844 | 3300031901 | Ga0307406_10140360 | Ga0307406_101403602 | 61 |
| 845 | 3300031903 | Ga0307407_10009343 | Ga0307407_100093432 | 61 |
| 846 | 3300031903 | Ga0307407_10500635 | Ga0307407_105006352 | 61 |
| 847 | 3300031911 | Ga0307412_10146615 | Ga0307412_101466152 | 61 |
| 848 | 3300031995 | Ga0307409_100010224 | Ga0307409_1000102243 | 61 |
| 849 | 3300031995 | Ga0307409_101451085 | Ga0307409_1014510852 | 61 |
| 850 | 3300031995 | Ga0307409_102796888 | Ga0307409_1027968881 | 61 |
| 851 | 3300032002 | Ga0307416_100001048 | Ga0307416_1000010485 | 61 |
| 852 | 3300032002 | Ga0307416_100641409 | Ga0307416_1006414092 | 61 |
| 853 | 3300032004 | Ga0307414_11631032 | Ga0307414_116310322 | 61 |
| 854 | 3300032005 | Ga0307411_10009924 | Ga0307411_100099241 | 61 |
| 855 | 3300032005 | Ga0307411_10819393 | Ga0307411_108193932 | 61 |
| 856 | 3300032005 | Ga0307411_11391500 | Ga0307411_113915002 | 61 |
| 857 | 3300032126 | Ga0307415_100000628 | Ga0307415_1000006287 | 61 |
| 858 | 3300032126 | Ga0307415_100266277 | Ga0307415_1002662771 | 61 |
| 859 | 3300032126 | Ga0307415_100982811 | Ga0307415_1009828112 | 61 |
| 860 | 3300033547 | Ga0316212_1007686 | Ga0316212_10076862 | 61 |
| 861 | 3300033547 | Ga0316212_1031013 | Ga0316212_10310131 | 61 |
| 862 | 3300035083 | Ga0373926_0000611 | Ga0373926_0000611_3392_3577 | 61 |
| 863 | 3300035083 | Ga0373926_0068355 | Ga0373926_0068355_877_1065 | 61 |
| 864 | 3300035086 | Ga0373934_0357297 | Ga0373934_0357297_318_506 | 61 |
| 865 | 3300035089 | Ga0373944_0401689 | Ga0373944_0401689_37_222 | 61 |
| 866 | 3300035111 | Ga0373923_0376838 | Ga0373923_0376838_203_388 | 61 |
| 867 | 3300035111 | Ga0373923_0444072 | Ga0373923_0444072_159_347 | 61 |
| 868 | 3300035117 | Ga0373953_0199119 | Ga0373953_0199119_665_853 | 61 |
| 869 | 3300035118 | Ga0373954_0045616 | Ga0373954_0045616_1459_1644 | 61 |
| 870 | 3300035118 | Ga0373954_0461304 | Ga0373954_0461304_140_328 | 61 |
| 871 | 3300035119 | Ga0373956_0151804 | Ga0373956_0151804_692_877 | 61 |
| 872 | 3300035120 | Ga0373957_0391468 | Ga0373957_0391468_361_546 | 61 |
| 873 | 3300035121 | Ga0373960_0241946 | Ga0373960_0241946_282_467 | 61 |
| 874 | 3300035171 | Ga0373946_0006398 | Ga0373946_0006398_1171_1356 | 61 |
| 875 | 3300035172 | Ga0373955_0180858 | Ga0373955_0180858_352_537 | 61 |
| 876 | 3300035691 | Ga0373931_0048580 | Ga0373931_0048580_332_517 | 61 |
| 877 | 3300035691 | Ga0373931_0187341 | Ga0373931_0187341_550_735 | 61 |
| 878 | 3300035691 | Ga0373931_0620619 | Ga0373931_0620619_415_606 | 61 |
| 879 | 3300035692 | Ga0373935_0310347 | Ga0373935_0310347_339_527 | 61 |
| 880 | 3300035695 | Ga0373927_0000786 | Ga0373927_0000786_11896_12081 | 61 |
| 881 | 3300035695 | Ga0373927_0003818 | Ga0373927_0003818_5604_5792 | 61 |
| 882 | 3300035695 | Ga0373927_0005082 | Ga0373927_0005082_2085_2273 | 61 |
| 883 | 3300035695 | Ga0373927_0099367 | Ga0373927_0099367_415_600 | 61 |
| 884 | 3300035695 | Ga0373927_0189597 | Ga0373927_0189597_628_816 | 61 |
| 885 | 3300035695 | Ga0373927_1040691 | Ga0373927_1040691_239_424 | 61 |
| 886 | 3300035724 | Ga0373933_0309769 | Ga0373933_0309769_48_236 | 61 |
| 887 | 3300035724 | Ga0373933_0691004 | Ga0373933_0691004_37_222 | 61 |
| 888 | 3300035724 | Ga0373933_0875055 | Ga0373933_0875055_205_390 | 61 |
| 889 | 3300035724 | Ga0373933_1135182 | Ga0373933_1135182_279_464 | 61 |
| 890 | 3300035725 | Ga0373947_0016152 | Ga0373947_0016152_3584_3769 | 61 |
| 891 | 3300035725 | Ga0373947_0076883 | Ga0373947_0076883_140_328 | 61 |
| 892 | 3300035725 | Ga0373947_0518013 | Ga0373947_0518013_320_508 | 61 |
| 893 | 3300035725 | Ga0373947_1152399 | Ga0373947_1152399_82_270 | 61 |
| 894 | 3300036401 | Ga0373937_0066395 | Ga0373937_0066395_540_725 | 61 |
| 895 | 3300036401 | Ga0373937_0136201 | Ga0373937_0136201_450_638 | 61 |
| 896 | 3300036401 | Ga0373937_0342388 | Ga0373937_0342388_533_718 | 61 |
| 897 | 3300036401 | Ga0373937_1132494 | Ga0373937_1132494_233_418 | 61 |
| 898 | 3300037068 | Ga0373925_0001038 | Ga0373925_0001038_12337_12522 | 61 |
| 899 | 3300037068 | Ga0373925_0021121 | Ga0373925_0021121_2535_2723 | 61 |
| 900 | 3300037068 | Ga0373925_0325824 | Ga0373925_0325824_200_385 | 61 |
| 901 | 3300037068 | Ga0373925_1045422 | Ga0373925_1045422_387_581 | 61 |
| 902 | 3300037068 | Ga0373925_1648891 | Ga0373925_1648891_169_357 | 61 |
| 903 | 3300037068 | Ga0373925_1694977 | Ga0373925_1694977_206_397 | 61 |
| 904 | 3300037471 | Ga0395905_1743657 | Ga0395905_1743657_253_459 | 61 |
| 905 | 3300037853 | Ga0436364_1532051 | Ga0436364_1532051_370_555 | 61 |
| 906 | 3300039437 | Ga0436365_0370185 | Ga0436365_0370185_406_591 | 61 |
| 907 | 3300039437 | Ga0436365_0815773 | Ga0436365_0815773_1701_1886 | 61 |
| 908 | 3300039437 | Ga0436365_1276255 | Ga0436365_1276255_289_474 | 61 |
| 909 | 3300039438 | Ga0436360_0578704 | Ga0436360_0578704_840_1025 | 61 |
| 910 | 3300039450 | Ga0436363_0572162 | Ga0436363_0572162_21_206 | 61 |
| 911 | 3300039453 | Ga0436362_0648093 | Ga0436362_0648093_295_480 | 61 |
| 912 | 3300039453 | Ga0436362_0752321 | Ga0436362_0752321_654_839 | 61 |
| 913 | 3300039453 | Ga0436362_0821875 | Ga0436362_0821875_549_734 | 61 |
| 914 | 3300041512 | Ga0451853_0563989 | Ga0451853_0563989_223_408 | 61 |
| 915 | 3300041512 | Ga0451853_1646197 | Ga0451853_1646197_129_320 | 61 |
| 916 | 3300042876 | Ga0451577_1058754 | Ga0451577_1058754_499_687 | 61 |
| 917 | 3300044712 | Ga0453684_0784449 | Ga0453684_0784449_531_719 | 61 |
| 918 | 3300044719 | Ga0466971_0285547 | Ga0466971_0285547_255_440 | 61 |
| 919 | 3300045051 | Ga0451576_0197439 | Ga0451576_0197439_1219_1404 | 61 |
| 920 | 3300045051 | Ga0451576_0581604 | Ga0451576_0581604_484_669 | 61 |
| 921 | 3300046462 | Ga0495651_0172470 | Ga0495651_0172470_889_1074 | 61 |
| 922 | 3300046472 | Ga0495580_0002472 | Ga0495580_0002472_4445_4630 | 61 |
| 923 | 3300046472 | Ga0495580_0003322 | Ga0495580_0003322_11274_11459 | 61 |
| 924 | 3300046472 | Ga0495580_0030510 | Ga0495580_0030510_3416_3604 | 61 |
| 925 | 3300046472 | Ga0495580_0074846 | Ga0495580_0074846_156_341 | 61 |
| 926 | 3300046472 | Ga0495580_0095841 | Ga0495580_0095841_834_1019 | 61 |
| 927 | 3300046472 | Ga0495580_0100731 | Ga0495580_0100731_268_453 | 61 |
| 928 | 3300046472 | Ga0495580_0131309 | Ga0495580_0131309_1140_1325 | 61 |
| 929 | 3300046472 | Ga0495580_0203860 | Ga0495580_0203860_469_654 | 61 |
| 930 | 3300046472 | Ga0495580_0524060 | Ga0495580_0524060_349_543 | 61 |
| 931 | 3300046473 | Ga0495582_0408599 | Ga0495582_0408599_579_764 | 61 |
| 932 | 3300046475 | Ga0495639_0229007 | Ga0495639_0229007_468_653 | 61 |
| 933 | 3300046477 | Ga0495664_0144379 | Ga0495664_0144379_553_738 | 61 |
| 934 | 3300046499 | Ga0495594_0442760 | Ga0495594_0442760_53_238 | 61 |
| 935 | 3300046517 | Ga0495630_1472165 | Ga0495630_1472165_111_296 | 61 |
| 936 | 3300046526 | Ga0495666_0007843 | Ga0495666_0007843_1232_1417 | 61 |
| 937 | 3300046526 | Ga0495666_0276428 | Ga0495666_0276428_363_548 | 61 |
| 938 | 3300046528 | Ga0495642_0074780 | Ga0495642_0074780_798_983 | 61 |
| 939 | 3300046536 | Ga0495587_0004260 | Ga0495587_0004260_5273_5458 | 61 |
| 940 | 3300046543 | Ga0495645_0087801 | Ga0495645_0087801_1694_1879 | 61 |
| 941 | 3300046557 | Ga0495622_0426245 | Ga0495622_0426245_180_365 | 61 |
| 942 | 3300046678 | Ga0495599_0809772 | Ga0495599_0809772_231_416 | 61 |
| 943 | 3300046690 | Ga0495624_0130295 | Ga0495624_0130295_582_767 | 61 |
| 944 | 3300047317 | Ga0495604_1013738 | Ga0495604_1013738_75_260 | 61 |
| 945 | 3300047319 | Ga0495674_0381070 | Ga0495674_0381070_741_926 | 61 |
| 946 | 3300047319 | Ga0495674_0885641 | Ga0495674_0885641_18_203 | 61 |
| 947 | 3300047444 | Ga0495675_0843045 | Ga0495675_0843045_138_326 | 61 |
| 948 | 3300047471 | Ga0495684_0208026 | Ga0495684_0208026_810_998 | 61 |
| 949 | 3300048903 | Ga0496100_0392106 | Ga0496100_0392106_420_605 | 61 |
| 950 | 3300048904 | Ga0496101_0115366 | Ga0496101_0115366_1593_1778 | 61 |
| 951 | 3300048905 | Ga0496102_0030578 | Ga0496102_0030578_336_521 | 61 |
| 952 | 3300048905 | Ga0496102_1478544 | Ga0496102_1478544_123_308 | 61 |
| 953 | 3300048907 | Ga0496104_0152457 | Ga0496104_0152457_429_614 | 61 |
| 954 | 3300048908 | Ga0496105_0357345 | Ga0496105_0357345_553_738 | 61 |
| 955 | 3300048912 | Ga0496109_0817441 | Ga0496109_0817441_39_227 | 61 |
| 956 | 3300048912 | Ga0496109_1419701 | Ga0496109_1419701_145_330 | 61 |
| 957 | 3300048915 | Ga0496112_0003406 | Ga0496112_0003406_5490_5675 | 61 |
| 958 | 3300048915 | Ga0496112_0014039 | Ga0496112_0014039_2732_2917 | 61 |
| 959 | 3300048916 | Ga0496113_1324769 | Ga0496113_1324769_102_287 | 61 |
| 960 | 3300048917 | Ga0496114_1165769 | Ga0496114_1165769_187_372 | 61 |
| 961 | 3300048918 | Ga0496115_0568471 | Ga0496115_0568471_545_730 | 61 |
| 962 | 3300050510 | nmdc:mga06r32_572099_c1 | nmdc:mga06r32_572099_c1_451_642 | 61 |
| 963 | 3300050514 | nmdc:mga08x19_166904_c1 | nmdc:mga08x19_166904_c1_895_1080 | 61 |
| 964 | 3300050514 | nmdc:mga08x19_523384_c1 | nmdc:mga08x19_523384_c1_456_644 | 61 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar