F486798

General Info

Members Datasets Scaffolds Average Seq Length
958 365 923 304

Family's Representative Sequence

Representative Sequence 3300032133|Ga0316583_10001730|Ga0316583_100017302
Length 295
Sequence MDPAQVRSYLSGLQEKIVTTLEAFDGKAFRRNDWSRGTALVIEDGEFFERGGVNFSHVTGDNLPASATAHRPELAGRSWEAMGVSLVLHPRNPYCPTSHMNVRFFVATRPGEEPIWWFGGGMDLTPYYGFVEDCVHFHRTCRNALAPFGDDVHPRYKQWCDEYFFLKHRQEPRGIGGIFFDDLNERCFALVRSVGNAFTEAYLPICERRRNLPYGERERDFQAYRRGRYVEFNLVWDRGTLFGLQSGGRTEAILMSLPPIVKWRYDWHPEPGSAEEKLYTDFLPPRDWLVAITPD

Samples

Sample ID Description Type Environment
1 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
2 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
3 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
4 2643221556 Massilia sp. Root1485 Isolate Unclassified
5 2643221638 Duganella sp. Root336D2 Isolate Unclassified
6 2643221645 Massilia sp. Root351 Isolate Unclassified
7 2643221664 Massilia sp. Root418 Isolate Unclassified
8 2643221684 Massilia sp. Root133 Isolate Unclassified
9 2738541280 Massilia sp. GV090 Isolate Unclassified
10 2738541297 Duganella sp. GV083 Isolate Unclassified
11 2738541300 Massilia sp. GV016 Isolate Unclassified
12 2738541357 Duganella sp. GV053 Isolate Unclassified
13 2738543003 Duganella sp. GV066 Isolate Unclassified
14 2738543018 Massilia sp. GV045 Isolate Unclassified
15 2738543026 Duganella sp. GV089 Isolate Unclassified
16 2738543029 Duganella sp. GV039 Isolate Unclassified
17 2738543030 Massilia sp. GV097 Isolate Unclassified
18 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
19 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
20 2821131069 Duganella sp. 1224 Isolate Unclassified
21 2842711865 Duganella sp. R-73148 Isolate Unclassified
22 2857553236 Duganella sp. R-74557 Isolate Unclassified
23 2857558681 Duganella sp. R-74565 Isolate Unclassified
24 2857564685 Duganella sp. R-74599 Isolate Unclassified
25 2904424332 Duganella sp. 1411 Isolate Rhizosphere
26 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
27 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
28 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
29 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
30 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
31 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
32 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
33 2919476304 Duganella sp. 3397 Isolate Unclassified
34 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
35 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
36 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
37 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
38 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
39 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
40 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
41 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
42 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
43 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
44 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
45 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
46 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
47 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
48 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
49 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
50 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
51 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
52 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
53 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
54 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
55 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
56 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
57 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
58 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
59 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
60 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
61 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
62 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
63 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
64 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
65 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
66 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
67 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
68 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
69 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
70 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
71 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
72 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
73 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
92 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
100 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
101 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
124 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
127 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
128 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
130 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
132 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
143 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
193 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
197 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
202 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
205 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
206 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
207 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
210 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
212 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
213 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
214 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
215 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
216 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
217 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
220 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
221 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
222 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
223 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
224 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
227 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
228 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
229 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
230 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
231 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
232 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
233 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
234 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
235 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
236 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
237 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
238 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
239 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
240 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
241 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
242 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
243 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
244 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
245 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
246 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
247 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
248 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
249 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
250 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
251 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
252 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
253 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
254 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
255 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
256 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
257 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
258 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
259 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
260 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
261 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
262 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
263 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
264 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
265 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
266 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
267 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
268 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
269 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
270 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
271 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
272 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
273 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
274 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
275 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
276 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
277 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
278 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
279 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
280 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
281 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
282 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
283 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
284 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
285 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
286 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
287 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
288 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
289 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
290 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
291 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
292 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
293 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
294 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
295 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
296 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
297 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
298 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
299 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
300 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
301 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
302 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
303 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
304 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
305 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
306 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
307 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
308 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
309 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
310 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
311 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
312 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
313 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
314 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
315 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
316 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
317 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
318 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
319 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
320 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
321 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
322 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
323 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
324 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
325 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
326 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
327 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
328 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
329 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
330 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
331 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
332 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
333 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
334 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
335 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
336 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
337 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
338 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
339 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
340 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
341 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
342 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
343 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
344 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
345 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
346 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
347 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
348 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
349 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
350 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
357 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
358 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
359 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
360 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
361 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
362 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
364 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
365 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.24
Metatranscriptomes 0.1
Isolates 3.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.85
Nodule 0.42
Rhizoplane 3.65
Rhizosphere 84.86
Stem 0
Stem Tuber 0
Unclassified 5.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000440 3300002773 Bacteria 24791
2 JGI25150J39212_1008267 3300002774 Bacteria 2046
3 JGI25159J45721_1004567 3300002987 Bacteria 4558
4 rootL2_10009396 3300003322 Bacteria 11472
5 JGI25160J50197_1001196 3300003354 Bacteria 13190
6 Ga0055525_1000009 3300003759 Bacteria 596899
7 Ga0055529_1000528 3300003763 Bacteria 33027
8 Ga0055526_1000031 3300003771 Bacteria 143136
9 Ga0055526_1000353 3300003771 Bacteria 37277
10 Ga0055526_1001071 3300003771 Bacteria 19995
11 Ga0055526_1001617 3300003771 Bacteria 15820
12 Ga0055537_1000344 3300003773 Bacteria 31620
13 Ga0055524_1000015 3300003775 Bacteria 246493
14 Ga0055524_1007464 3300003775 Bacteria 4638
15 Ga0055524_1008902 3300003775 Bacteria 4132
16 Ga0055534_1000310 3300003784 Bacteria 32619
17 Ga0055528_1000124 3300003790 Bacteria 61627
18 Ga0055528_1001071 3300003790 Bacteria 18031
19 Ga0065165_1000050 3300005262 Bacteria 195237
20 Ga0065165_1005080 3300005262 Bacteria 7647
21 Ga0065165_1017345 3300005262 Bacteria 2657
22 Ga0070658_10177107 3300005327 Bacteria 1794
23 Ga0070676_10001315 3300005328 Bacteria 12480
24 Ga0070676_10133772 3300005328 Bacteria 1571
25 Ga0070690_100020510 3300005330 Bacteria 4027
26 Ga0068869_100001107 3300005334 Bacteria 15702
27 Ga0068869_100037903 3300005334 Bacteria 3430
28 Ga0068869_100363850 3300005334 Bacteria 1182
29 Ga0070666_10001383 3300005335 Bacteria 14685
30 Ga0070666_10032555 3300005335 Bacteria 3444
31 Ga0068868_100000331 3300005338 Bacteria 31871
32 Ga0068868_100006875 3300005338 Bacteria 8080
33 Ga0068868_100082789 3300005338 Bacteria 2574
34 Ga0070660_100050275 3300005339 Bacteria 3207
35 Ga0070660_100282411 3300005339 Bacteria 1359
36 Ga0070660_100319704 3300005339 Bacteria 1275
37 Ga0070689_100005627 3300005340 Bacteria 8581
38 Ga0070689_100092781 3300005340 Bacteria 2382
39 Ga0070668_100001693 3300005347 Bacteria 15990
40 Ga0070668_100206874 3300005347 Bacteria 1613
41 Ga0070668_100235032 3300005347 Bacteria 1517
42 Ga0070669_100003085 3300005353 Bacteria 11995
43 Ga0070669_100198677 3300005353 Bacteria 1577
44 Ga0070675_100002186 3300005354 Bacteria 14494
45 Ga0070671_100007917 3300005355 Bacteria 8499
46 Ga0070671_100020363 3300005355 Bacteria 5408
47 Ga0070671_100064393 3300005355 Bacteria 3053
48 Ga0070674_100043797 3300005356 Bacteria 3047
49 Ga0070674_100148059 3300005356 Bacteria 1769
50 Ga0070673_100060014 3300005364 Bacteria 3012
51 Ga0070688_100006552 3300005365 Bacteria 6229
52 Ga0070688_100009264 3300005365 Bacteria 5376
53 Ga0070659_100038837 3300005366 Bacteria 3714
54 Ga0070667_100005247 3300005367 Bacteria 10834
55 Ga0070667_100023680 3300005367 Bacteria 5097
56 Ga0070714_100067850 3300005435 Bacteria 3077
57 Ga0070713_100016566 3300005436 Bacteria 5543
58 Ga0070701_10017080 3300005438 Bacteria 3387
59 Ga0070711_100004558 3300005439 Bacteria 8197
60 Ga0070663_100087510 3300005455 Bacteria 2303
61 Ga0070678_100000798 3300005456 Bacteria 15850
62 Ga0070678_100109488 3300005456 Bacteria 2158
63 Ga0070662_100023990 3300005457 Bacteria 4197
64 Ga0068867_100007157 3300005459 Bacteria 7885
65 Ga0070685_10014464 3300005466 Bacteria 4180
66 Ga0070685_10266534 3300005466 Bacteria 1141
67 Ga0068853_100095955 3300005539 Bacteria 2616
68 Ga0070672_100001410 3300005543 Bacteria 14847
69 Ga0070693_100039090 3300005547 Bacteria 2656
70 Ga0070665_100038140 3300005548 Bacteria 4830
71 Ga0070665_100065246 3300005548 Bacteria 3652
72 Ga0070665_100219112 3300005548 Bacteria 1903
73 Ga0068855_100256773 3300005563 Bacteria 1948
74 Ga0070664_100056056 3300005564 Bacteria 3348
75 Ga0070664_100170171 3300005564 Bacteria 1932
76 Ga0070664_100239926 3300005564 Bacteria 1627
77 Ga0068854_100006043 3300005578 Bacteria 7672
78 Ga0068856_100172908 3300005614 Bacteria 2172
79 Ga0068852_100129539 3300005616 Bacteria 2321
80 Ga0068852_100548403 3300005616 Bacteria 1156
81 Ga0068859_100002774 3300005617 Bacteria 17745
82 Ga0068859_100034777 3300005617 Bacteria 5057
83 Ga0068859_100185696 3300005617 Bacteria 2163
84 Ga0068864_100009230 3300005618 Bacteria 8134
85 Ga0068861_100036870 3300005719 Bacteria 3632
86 Ga0068861_100186646 3300005719 Bacteria 1730
87 Ga0068851_10060445 3300005834 Bacteria 1940
88 Ga0068863_100000926 3300005841 Bacteria 29444
89 Ga0068858_100003386 3300005842 Bacteria 15868
90 Ga0068858_100007106 3300005842 Bacteria 10866
91 Ga0068858_100051445 3300005842 Bacteria 3811
92 Ga0068860_100001199 3300005843 Bacteria 28279
93 Ga0068860_100092271 3300005843 Bacteria 2885
94 Ga0068860_100219055 3300005843 Bacteria 1848
95 Ga0068862_100067366 3300005844 Bacteria 3086
96 Ga0068862_100597577 3300005844 Bacteria 1059
97 Ga0081539_10026170 3300005985 Bacteria 3733
98 Ga0070715_10036954 3300006163 Bacteria 2018
99 Ga0070716_100014032 3300006173 Bacteria 4098
100 Ga0070712_100009811 3300006175 Bacteria 6032
101 Ga0097621_100001144 3300006237 Bacteria 18429
102 Ga0068871_100007416 3300006358 Bacteria 7834
103 Ga0068865_100009861 3300006881 Bacteria 5934
104 Ga0097620_100002773 3300006931 Bacteria 17745
105 Ga0097620_100034777 3300006931 Bacteria 5057
106 Ga0097620_100185700 3300006931 Bacteria 2163
107 Ga0079104_1005366 3300006946 Bacteria 5142
108 Ga0099826_10000003 3300006948 Bacteria 1067817
109 Ga0105244_10005513 3300009036 Bacteria 8398
110 Ga0105240_10080810 3300009093 Bacteria 3997
111 Ga0105240_10396277 3300009093 Bacteria 1556
112 Ga0105245_10027376 3300009098 Bacteria 5022
113 Ga0105247_10052307 3300009101 Bacteria 2518
114 Ga0105243_10150580 3300009148 Bacteria 1995
115 Ga0105243_10358876 3300009148 Bacteria 1341
116 Ga0105241_10003069 3300009174 Bacteria 12453
117 Ga0105241_10118217 3300009174 Bacteria 2131
118 Ga0105242_10042701 3300009176 Bacteria 3664
119 Ga0105248_10002137 3300009177 Bacteria 21876
120 Ga0105248_10032029 3300009177 Bacteria 5874
121 Ga0105237_10014808 3300009545 Bacteria 8139
122 Ga0105238_10000128 3300009551 Bacteria 83216
123 Ga0105238_10552830 3300009551 Bacteria 1156
124 Ga0105249_10134945 3300009553 Bacteria 2360
125 Ga0105239_10035925 3300010375 Bacteria 5440
126 Ga0105239_10153799 3300010375 Bacteria 2568
127 Ga0105246_10039783 3300011119 Bacteria 3170
128 Ga0157371_10000001 3300013102 Bacteria 1162285
129 Ga0157374_10001563 3300013296 Bacteria 19265
130 Ga0157374_10033572 3300013296 Bacteria 4682
131 Ga0157374_10175314 3300013296 Bacteria 2093
132 Ga0157378_10010780 3300013297 Bacteria 7990
133 Ga0157378_10136997 3300013297 Bacteria 2270
134 Ga0157378_10166752 3300013297 Bacteria 2063
135 Ga0157378_10200105 3300013297 Bacteria 1889
136 Ga0163162_10065966 3300013306 Bacteria 3668
137 Ga0157375_10001643 3300013308 Bacteria 19224
138 Ga0157375_10003068 3300013308 Bacteria 14496
139 Ga0157375_10077954 3300013308 Bacteria 3345
140 Ga0163163_10015755 3300014325 Bacteria 7000
141 Ga0163163_10466826 3300014325 Bacteria 1323
142 Ga0157380_10226632 3300014326 Bacteria 1676
143 Ga0157379_10002346 3300014968 Bacteria 15798
144 Ga0157379_10002957 3300014968 Bacteria 14333
145 Ga0157376_10557923 3300014969 Bacteria 1134
146 Ga0182006_1032933 3300015261 Bacteria 2080
147 Ga0182005_1000018 3300015265 Bacteria 324307
148 Ga0163161_10080900 3300017792 Bacteria 2391
149 Ga0213872_10000002 3300021361 Bacteria 554092
150 Ga0213872_10000445 3300021361 Bacteria 33820
151 Ga0213872_10014137 3300021361 Bacteria 3727
152 Ga0213872_10045948 3300021361 Bacteria 1987
153 Ga0213872_10137763 3300021361 Bacteria 1072
154 Ga0209436_100115 3300025208 Bacteria 39587
155 Ga0209563_100015 3300025230 Bacteria 879901
156 Ga0207425_1000006 3300025245 Bacteria 808854
157 Ga0207425_1000105 3300025245 Bacteria 78746
158 Ga0207425_1000643 3300025245 Bacteria 19543
159 Ga0209148_1000298 3300025254 Bacteria 72028
160 Ga0209129_1000090 3300025258 Bacteria 175755
161 Ga0209129_1007993 3300025258 Bacteria 3021
162 Ga0209565_1000006 3300025263 Bacteria 897294
163 Ga0209565_1000701 3300025263 Bacteria 20606
164 Ga0209565_1006379 3300025263 Bacteria 3315
165 Ga0209455_1000051 3300025272 Bacteria 369818
166 Ga0209673_1000004 3300025273 Bacteria 896155
167 Ga0209673_1003116 3300025273 Bacteria 10150
168 Ga0209130_1000065 3300025284 Bacteria 195251
169 Ga0209130_1001125 3300025284 Bacteria 19650
170 Ga0209675_1000006 3300025291 Bacteria 732267
171 Ga0209675_1000696 3300025291 Bacteria 23334
172 Ga0209025_1039319 3300025294 Bacteria 2065
173 Ga0209564_1000006 3300025295 Bacteria 1100927
174 Ga0209564_1000038 3300025295 Bacteria 414357
175 Ga0209564_1000064 3300025295 Bacteria 316431
176 Ga0209564_1012237 3300025295 Bacteria 3759
177 Ga0209758_1000047 3300025297 Bacteria 360971
178 Ga0209758_1002119 3300025297 Bacteria 20944
179 Ga0209050_1000085 3300025298 Bacteria 263219
180 Ga0209050_1000607 3300025298 Bacteria 56864
181 Ga0209050_1013429 3300025298 Bacteria 3636
182 Ga0209256_1000005 3300025299 Bacteria 1315082
183 Ga0209256_1000080 3300025299 Bacteria 224592
184 Ga0209256_1000365 3300025299 Bacteria 72787
185 Ga0209256_1000423 3300025299 Bacteria 66412
186 Ga0207426_1000939 3300025302 Bacteria 28944
187 Ga0209051_1030792 3300025303 Bacteria 2077
188 Ga0209257_1000010 3300025304 Bacteria 1158682
189 Ga0207697_10008739 3300025315 Bacteria 4411
190 Ga0207655_1001393 3300025728 Bacteria 22568
191 Ga0207655_1005668 3300025728 Bacteria 8444
192 Ga0207682_10010099 3300025893 Bacteria 3707
193 Ga0207692_10034351 3300025898 Bacteria 2454
194 Ga0207680_10001994 3300025903 Bacteria 9564
195 Ga0207680_10008458 3300025903 Bacteria 5053
196 Ga0207645_10000241 3300025907 Bacteria 45331
197 Ga0207643_10014852 3300025908 Bacteria 4235
198 Ga0207705_10090074 3300025909 Bacteria 2245
199 Ga0207705_10297130 3300025909 Bacteria 1238
200 Ga0207654_10001747 3300025911 Bacteria 11288
201 Ga0207654_10083523 3300025911 Bacteria 1929
202 Ga0207695_10002390 3300025913 Bacteria 27827
203 Ga0207695_10126941 3300025913 Bacteria 2512
204 Ga0207671_10017201 3300025914 Bacteria 5585
205 Ga0207671_10188751 3300025914 Bacteria 1606
206 Ga0207671_10375100 3300025914 Bacteria 1130
207 Ga0207693_10001075 3300025915 Bacteria 24500
208 Ga0207663_10096916 3300025916 Bacteria 1971
209 Ga0207657_10040736 3300025919 Bacteria 4113
210 Ga0207657_10155290 3300025919 Bacteria 1861
211 Ga0207681_10000854 3300025923 Bacteria 20032
212 Ga0207681_10191714 3300025923 Bacteria 1564
213 Ga0207694_10000845 3300025924 Bacteria 27248
214 Ga0207694_10077396 3300025924 Bacteria 2606
215 Ga0207650_10136839 3300025925 Bacteria 1922
216 Ga0207659_10000360 3300025926 Bacteria 27263
217 Ga0207687_10006368 3300025927 Bacteria 7801
218 Ga0207687_10151995 3300025927 Bacteria 1767
219 Ga0207700_10110504 3300025928 Bacteria 2211
220 Ga0207644_10001134 3300025931 Bacteria 17065
221 Ga0207644_10007005 3300025931 Bacteria 7342
222 Ga0207644_10019257 3300025931 Bacteria 4627
223 Ga0207690_10301835 3300025932 Bacteria 1253
224 Ga0207706_10010737 3300025933 Bacteria 8363
225 Ga0207706_10061898 3300025933 Bacteria 3296
226 Ga0207686_10001787 3300025934 Bacteria 11972
227 Ga0207686_10002503 3300025934 Bacteria 9979
228 Ga0207686_10006141 3300025934 Bacteria 6455
229 Ga0207709_10008577 3300025935 Bacteria 5647
230 Ga0207670_10030426 3300025936 Bacteria 3449
231 Ga0207670_10239855 3300025936 Bacteria 1396
232 Ga0207669_10021494 3300025937 Bacteria 3408
233 Ga0207669_10049715 3300025937 Bacteria 2501
234 Ga0207704_10001298 3300025938 Bacteria 11172
235 Ga0207691_10000368 3300025940 Bacteria 45434
236 Ga0207691_10005465 3300025940 Bacteria 12269
237 Ga0207691_10128155 3300025940 Bacteria 2244
238 Ga0207711_10002097 3300025941 Bacteria 18006
239 Ga0207711_10007086 3300025941 Bacteria 9397
240 Ga0207689_10008074 3300025942 Bacteria 9180
241 Ga0207679_10160074 3300025945 Bacteria 1842
242 Ga0207667_10015504 3300025949 Bacteria 8649
243 Ga0207667_10021146 3300025949 Bacteria 7215
244 Ga0207651_10008735 3300025960 Bacteria 5494
245 Ga0207712_10126994 3300025961 Bacteria 1937
246 Ga0207668_10001355 3300025972 Bacteria 14490
247 Ga0207668_10028645 3300025972 Bacteria 3644
248 Ga0207668_10236949 3300025972 Bacteria 1474
249 Ga0207658_10001026 3300025986 Bacteria 22730
250 Ga0207658_10021933 3300025986 Bacteria 4440
251 Ga0207658_10249656 3300025986 Bacteria 1507
252 Ga0207677_10000445 3300026023 Bacteria 28010
253 Ga0207677_10000770 3300026023 Bacteria 18440
254 Ga0207703_10002365 3300026035 Bacteria 16410
255 Ga0207703_10004139 3300026035 Bacteria 11964
256 Ga0207703_10142257 3300026035 Bacteria 2083
257 Ga0207703_10243699 3300026035 Bacteria 1617
258 Ga0207639_10075092 3300026041 Bacteria 2657
259 Ga0207639_10271506 3300026041 Bacteria 1488
260 Ga0207678_10003137 3300026067 Bacteria 14957
261 Ga0207678_10375439 3300026067 Bacteria 1229
262 Ga0207702_10118852 3300026078 Bacteria 2362
263 Ga0207641_10000735 3300026088 Bacteria 35180
264 Ga0207648_10000089 3300026089 Bacteria 86359
265 Ga0207648_10005123 3300026089 Bacteria 13277
266 Ga0207648_10065744 3300026089 Bacteria 3162
267 Ga0207676_10024266 3300026095 Bacteria 4485
268 Ga0207676_10040388 3300026095 Bacteria 3575
269 Ga0207683_10000325 3300026121 Bacteria 43393
270 Ga0207683_10017560 3300026121 Bacteria 6100
271 Ga0207698_10551847 3300026142 Bacteria 1129
272 Ga0207698_10610796 3300026142 Bacteria 1076
273 Ga0209281_1007150 3300027111 Bacteria 2821
274 Ga0209969_1002384 3300027360 Bacteria 2597
275 Ga0209967_1002888 3300027364 Bacteria 2247
276 Ga0209995_1001642 3300027471 Bacteria 3474
277 Ga0209282_1000002 3300027666 Bacteria 1067825
278 Ga0209974_10011016 3300027876 Bacteria 3044
279 Ga0268266_10049672 3300028379 Bacteria 3598
280 Ga0268266_10084049 3300028379 Bacteria 2779
281 Ga0268266_10310808 3300028379 Bacteria 1473
282 Ga0268265_10030585 3300028380 Bacteria 3880
283 Ga0268264_10007381 3300028381 Bacteria 9182
284 Ga0268264_10032054 3300028381 Bacteria 4312
285 Ga0268264_10218693 3300028381 Bacteria 1753
286 Ga0316181_1122411 3300030744 Bacteria 1727
287 Ga0265316_10082703 3300031344 Bacteria 2460
288 Ga0307408_100007876 3300031548 Bacteria 7044
289 Ga0307408_100043196 3300031548 Bacteria 3206
290 Ga0307508_10015009 3300031616 Bacteria 7062
291 Ga0316575_10005640 3300031665 Bacteria 4467
292 Ga0316576_10022273 3300031727 Bacteria 4398
293 Ga0307518_10143660 3300031838 Bacteria 1660
294 Ga0307416_100113396 3300032002 Bacteria 2395
295 Ga0316583_10001730 3300032133 Bacteria 7412
296 Ga0316593_10003127 3300032168 Bacteria 4059
297 Ga0373953_0002218 3300035117 Bacteria 5828
298 Ga0373956_0072839 3300035119 Bacteria 1569
299 Ga0373956_0087898 3300035119 Bacteria 1432
300 Ga0373946_0175447 3300035171 Bacteria 1014
301 Ga0316574_0004167 3300035398 Bacteria 7536
302 Ga0373931_0126268 3300035691 Bacteria 1467
303 Ga0373927_0031043 3300035695 Bacteria 3485
304 Ga0373933_0018138 3300035724 Bacteria 3954
305 Ga0373937_0041306 3300036401 Bacteria 4206
306 Ga0316582_0038410 3300036647 Bacteria 2975
307 Ga0316584_0028450 3300036712 Bacteria 4122
308 Ga0395899_0000141 3300037312 Bacteria 109773
309 Ga0395899_0004028 3300037312 Bacteria 11586
310 Ga0395899_0010706 3300037312 Bacteria 7029
311 Ga0395899_0023526 3300037312 Bacteria 4664
312 Ga0395899_0067119 3300037312 Bacteria 2632
313 Ga0395900_0000931 3300037418 Bacteria 38293
314 Ga0395900_0010308 3300037418 Bacteria 9562
315 Ga0395900_0017608 3300037418 Bacteria 7291
316 Ga0395900_0025668 3300037418 Bacteria 6031
317 Ga0395900_0026208 3300037418 Bacteria 5969
318 Ga0395900_0059676 3300037418 Bacteria 3927
319 Ga0395900_0072612 3300037418 Bacteria 3537
320 Ga0395900_0092912 3300037418 Bacteria 3099
321 Ga0395900_0115884 3300037418 Bacteria 2749
322 Ga0395900_0188808 3300037418 Bacteria 2091
323 Ga0395900_0364293 3300037418 Bacteria 1416
324 Ga0395900_0394428 3300037418 Bacteria 1349
325 Ga0395898_0019806 3300037466 Bacteria 6842
326 Ga0395898_0053522 3300037466 Bacteria 3942
327 Ga0395898_0090996 3300037466 Bacteria 2935
328 Ga0395898_0140183 3300037466 Bacteria 2315
329 Ga0395898_0223464 3300037466 Bacteria 1796
330 Ga0395905_0022278 3300037471 Bacteria 5994
331 Ga0395905_0075356 3300037471 Bacteria 3162
332 Ga0395905_0077736 3300037471 Bacteria 3109
333 Ga0395905_0145899 3300037471 Bacteria 2226
334 Ga0395905_0154759 3300037471 Bacteria 2156
335 Ga0395901_0000073 3300038443 Bacteria 139769
336 Ga0395901_0011675 3300038443 Bacteria 8899
337 Ga0395901_0027144 3300038443 Bacteria 5881
338 Ga0395901_0118509 3300038443 Bacteria 2781
339 Ga0395901_0124851 3300038443 Bacteria 2704
340 Ga0436361_0009247 3300039447 Bacteria 10517
341 Ga0436361_0066851 3300039447 Bacteria 36436
342 Ga0436361_0464259 3300039447 Bacteria 1817
343 Ga0436361_0723519 3300039447 Bacteria 39014
344 Ga0436361_1051860 3300039447 Bacteria 1520
345 Ga0436361_1215186 3300039447 Bacteria 4374
346 Ga0439465_0071992 3300041413 Bacteria 1160
347 Ga0439448_0000618 3300042005 Bacteria 8368
348 Ga0439449_0012815 3300042007 Bacteria 3152
349 Ga0439455_0000720 3300042012 Bacteria 4914
350 Ga0439455_0017695 3300042012 Bacteria 1664
351 Ga0450904_001280 3300042139 Bacteria 3700
352 Ga0451577_0012494 3300042876 Bacteria 7972
353 Ga0451577_0111565 3300042876 Bacteria 2447
354 Ga0466969_0049147 3300044656 Bacteria 2082
355 Ga0466972_0002165 3300044658 Bacteria 9644
356 Ga0466982_0102547 3300044672 Bacteria 1772
357 Ga0466965_0005989 3300044683 Bacteria 5493
358 Ga0466965_0018625 3300044683 Bacteria 3330
359 Ga0466965_0049445 3300044683 Bacteria 2084
360 Ga0466965_0103249 3300044683 Bacteria 1459
361 Ga0466966_0005054 3300044684 Bacteria 8668
362 Ga0466964_0005017 3300044706 Bacteria 4894
363 Ga0466964_0016497 3300044706 Bacteria 2820
364 Ga0453684_0001170 3300044712 Bacteria 81366
365 Ga0466968_0004913 3300044735 Bacteria 5003
366 Ga0466957_0000115 3300044842 Bacteria 33097
367 Ga0466957_0043321 3300044842 Bacteria 2725
368 Ga0466957_0091847 3300044842 Bacteria 1903
369 Ga0466959_0005620 3300045049 Bacteria 8622
370 Ga0451576_0034641 3300045051 Bacteria 5362
371 Ga0451576_0035992 3300045051 Bacteria 5251
372 Ga0451576_0306482 3300045051 Bacteria 1661
373 Ga0466967_0010104 3300045976 Bacteria 7054
374 Ga0466967_0097150 3300045976 Bacteria 2688
375 Ga0466967_0284104 3300045976 Bacteria 1588
376 Ga0495617_000002 3300046452 Bacteria 710121
377 Ga0495617_000007 3300046452 Bacteria 369986
378 Ga0495617_005082 3300046452 Bacteria 4708
379 Ga0495617_029597 3300046452 Bacteria 1841
380 Ga0495627_000006 3300046453 Bacteria 581750
381 Ga0495627_001506 3300046453 Bacteria 13413
382 Ga0495627_005062 3300046453 Bacteria 5386
383 Ga0495627_018958 3300046453 Bacteria 2313
384 Ga0495603_0041037 3300046455 Bacteria 2768
385 Ga0495590_0000004 3300046457 Bacteria 402091
386 Ga0495590_0000007 3300046457 Bacteria 331108
387 Ga0495590_0010883 3300046457 Bacteria 3408
388 Ga0495590_0056733 3300046457 Bacteria 1369
389 Ga0495591_000062 3300046458 Bacteria 124615
390 Ga0495591_009009 3300046458 Bacteria 4015
391 Ga0495629_0066316 3300046459 Bacteria 2519
392 Ga0495629_0066865 3300046459 Bacteria 2508
393 Ga0495638_0000023 3300046460 Bacteria 363063
394 Ga0495638_0001662 3300046460 Bacteria 19666
395 Ga0495638_0005843 3300046460 Bacteria 9049
396 Ga0495638_0062217 3300046460 Bacteria 2304
397 Ga0495638_0130392 3300046460 Bacteria 1477
398 Ga0495653_0000207 3300046463 Bacteria 47378
399 Ga0495653_0025531 3300046463 Bacteria 4745
400 Ga0495653_0030532 3300046463 Bacteria 4291
401 Ga0495653_0084536 3300046463 Bacteria 2337
402 Ga0495653_0085475 3300046463 Bacteria 2320
403 Ga0495650_0000769 3300046471 Bacteria 39602
404 Ga0495650_0001207 3300046471 Bacteria 27239
405 Ga0495650_0002253 3300046471 Bacteria 16122
406 Ga0495650_0003039 3300046471 Bacteria 12659
407 Ga0495650_0003455 3300046471 Bacteria 11514
408 Ga0495650_0031742 3300046471 Bacteria 2372
409 Ga0495580_0008499 3300046472 Bacteria 8162
410 Ga0495582_0021915 3300046473 Bacteria 3495
411 Ga0495605_0000063 3300046474 Bacteria 140789
412 Ga0495605_0000174 3300046474 Bacteria 81340
413 Ga0495605_0001463 3300046474 Bacteria 15423
414 Ga0495605_0008808 3300046474 Bacteria 5692
415 Ga0495605_0009267 3300046474 Bacteria 5532
416 Ga0495605_0015996 3300046474 Bacteria 4070
417 Ga0495605_0024268 3300046474 Bacteria 3175
418 Ga0495605_0034912 3300046474 Bacteria 2543
419 Ga0495605_0079164 3300046474 Bacteria 1539
420 Ga0495605_0147499 3300046474 Bacteria 1052
421 Ga0495584_0000010 3300046491 Bacteria 225095
422 Ga0495584_0001432 3300046491 Bacteria 14361
423 Ga0495584_0003242 3300046491 Bacteria 9023
424 Ga0495584_0003373 3300046491 Bacteria 8826
425 Ga0495584_0011566 3300046491 Bacteria 4519
426 Ga0495584_0013554 3300046491 Bacteria 4161
427 Ga0495584_0026860 3300046491 Bacteria 2917
428 Ga0495584_0031526 3300046491 Bacteria 2683
429 Ga0495584_0112658 3300046491 Bacteria 1376
430 Ga0495584_0160244 3300046491 Bacteria 1143
431 Ga0495585_0000006 3300046492 Bacteria 320556
432 Ga0495585_0000592 3300046492 Bacteria 33996
433 Ga0495585_0001217 3300046492 Bacteria 20847
434 Ga0495585_0002703 3300046492 Bacteria 12422
435 Ga0495585_0002955 3300046492 Bacteria 11739
436 Ga0495585_0003583 3300046492 Bacteria 10422
437 Ga0495585_0005077 3300046492 Bacteria 8388
438 Ga0495585_0005691 3300046492 Bacteria 7822
439 Ga0495585_0006007 3300046492 Bacteria 7598
440 Ga0495585_0014015 3300046492 Bacteria 4681
441 Ga0495585_0016934 3300046492 Bacteria 4220
442 Ga0495585_0018950 3300046492 Bacteria 3970
443 Ga0495585_0022375 3300046492 Bacteria 3628
444 Ga0495585_0030974 3300046492 Bacteria 3040
445 Ga0495585_0043853 3300046492 Bacteria 2500
446 Ga0495585_0052966 3300046492 Bacteria 2246
447 Ga0495585_0069795 3300046492 Bacteria 1917
448 Ga0495585_0193990 3300046492 Bacteria 1037
449 Ga0495585_0198054 3300046492 Bacteria 1024
450 Ga0495594_0003275 3300046499 Bacteria 8383
451 Ga0495594_0010522 3300046499 Bacteria 4798
452 Ga0495594_0026451 3300046499 Bacteria 3121
453 Ga0495596_0000130 3300046500 Bacteria 51970
454 Ga0495596_0000217 3300046500 Bacteria 39881
455 Ga0495596_0005367 3300046500 Bacteria 6064
456 Ga0495596_0006498 3300046500 Bacteria 5368
457 Ga0495596_0006913 3300046500 Bacteria 5169
458 Ga0495596_0009275 3300046500 Bacteria 4333
459 Ga0495596_0012662 3300046500 Bacteria 3603
460 Ga0495596_0013081 3300046500 Bacteria 3532
461 Ga0495596_0024539 3300046500 Bacteria 2440
462 Ga0495596_0047213 3300046500 Bacteria 1690
463 Ga0495607_0002839 3300046501 Bacteria 13749
464 Ga0495607_0003658 3300046501 Bacteria 11669
465 Ga0495607_0006211 3300046501 Bacteria 8430
466 Ga0495607_0006855 3300046501 Bacteria 7945
467 Ga0495607_0006952 3300046501 Bacteria 7885
468 Ga0495607_0015837 3300046501 Bacteria 4876
469 Ga0495607_0026420 3300046501 Bacteria 3603
470 Ga0495607_0030511 3300046501 Bacteria 3308
471 Ga0495607_0046410 3300046501 Bacteria 2551
472 Ga0495607_0085712 3300046501 Bacteria 1720
473 Ga0495607_0094933 3300046501 Bacteria 1608
474 Ga0495607_0154182 3300046501 Bacteria 1173
475 Ga0495583_0000084 3300046506 Bacteria 165375
476 Ga0495583_0000330 3300046506 Bacteria 74846
477 Ga0495583_0001063 3300046506 Bacteria 30689
478 Ga0495583_0001091 3300046506 Bacteria 30075
479 Ga0495583_0001851 3300046506 Bacteria 19718
480 Ga0495583_0002627 3300046506 Bacteria 15018
481 Ga0495583_0003369 3300046506 Bacteria 12283
482 Ga0495583_0003430 3300046506 Bacteria 12072
483 Ga0495583_0018264 3300046506 Bacteria 3695
484 Ga0495583_0023407 3300046506 Bacteria 3125
485 Ga0495583_0026989 3300046506 Bacteria 2839
486 Ga0495583_0028565 3300046506 Bacteria 2740
487 Ga0495583_0036094 3300046506 Bacteria 2354
488 Ga0495583_0041811 3300046506 Bacteria 2144
489 Ga0495606_0000024 3300046507 Bacteria 262080
490 Ga0495606_0000037 3300046507 Bacteria 231282
491 Ga0495606_0000146 3300046507 Bacteria 122515
492 Ga0495606_0009349 3300046507 Bacteria 8307
493 Ga0495606_0016464 3300046507 Bacteria 5634
494 Ga0495606_0020128 3300046507 Bacteria 4933
495 Ga0495606_0022863 3300046507 Bacteria 4542
496 Ga0495606_0052216 3300046507 Bacteria 2660
497 Ga0495606_0094651 3300046507 Bacteria 1830
498 Ga0495606_0096413 3300046507 Bacteria 1809
499 Ga0495606_0109586 3300046507 Bacteria 1667
500 Ga0495610_0000004 3300046512 Bacteria 1006135
501 Ga0495610_0001723 3300046512 Bacteria 19165
502 Ga0495610_0008063 3300046512 Bacteria 6889
503 Ga0495616_0000081 3300046513 Bacteria 80720
504 Ga0495616_0000396 3300046513 Bacteria 33637
505 Ga0495616_0003472 3300046513 Bacteria 10084
506 Ga0495616_0004198 3300046513 Bacteria 9131
507 Ga0495616_0005391 3300046513 Bacteria 7879
508 Ga0495616_0011083 3300046513 Bacteria 5180
509 Ga0495616_0011302 3300046513 Bacteria 5124
510 Ga0495616_0011906 3300046513 Bacteria 4956
511 Ga0495616_0017489 3300046513 Bacteria 3955
512 Ga0495616_0035044 3300046513 Bacteria 2600
513 Ga0495616_0037407 3300046513 Bacteria 2497
514 Ga0495616_0037415 3300046513 Bacteria 2496
515 Ga0495616_0061482 3300046513 Bacteria 1842
516 Ga0495616_0064367 3300046513 Bacteria 1789
517 Ga0495616_0080170 3300046513 Bacteria 1563
518 Ga0495616_0114530 3300046513 Bacteria 1250
519 Ga0495620_0008818 3300046515 Bacteria 5395
520 Ga0495631_0000208 3300046518 Bacteria 40242
521 Ga0495631_0002880 3300046518 Bacteria 9542
522 Ga0495631_0003153 3300046518 Bacteria 9070
523 Ga0495631_0010249 3300046518 Bacteria 4645
524 Ga0495631_0012668 3300046518 Bacteria 4111
525 Ga0495631_0014078 3300046518 Bacteria 3866
526 Ga0495631_0015079 3300046518 Bacteria 3713
527 Ga0495631_0016308 3300046518 Bacteria 3545
528 Ga0495631_0018869 3300046518 Bacteria 3241
529 Ga0495631_0032919 3300046518 Bacteria 2332
530 Ga0495631_0040204 3300046518 Bacteria 2072
531 Ga0495631_0040556 3300046518 Bacteria 2062
532 Ga0495632_0000071 3300046519 Bacteria 105606
533 Ga0495632_0001714 3300046519 Bacteria 17823
534 Ga0495632_0003038 3300046519 Bacteria 12224
535 Ga0495632_0006355 3300046519 Bacteria 7622
536 Ga0495632_0006805 3300046519 Bacteria 7295
537 Ga0495632_0009584 3300046519 Bacteria 5822
538 Ga0495632_0069961 3300046519 Bacteria 1689
539 Ga0495637_0000335 3300046520 Bacteria 36417
540 Ga0495637_0001186 3300046520 Bacteria 15859
541 Ga0495637_0012354 3300046520 Bacteria 4087
542 Ga0495643_0000098 3300046522 Bacteria 145645
543 Ga0495643_0000196 3300046522 Bacteria 95989
544 Ga0495643_0000211 3300046522 Bacteria 89358
545 Ga0495643_0000756 3300046522 Bacteria 36370
546 Ga0495643_0008541 3300046522 Bacteria 6468
547 Ga0495643_0029275 3300046522 Bacteria 3082
548 Ga0495643_0037775 3300046522 Bacteria 2646
549 Ga0495643_0045120 3300046522 Bacteria 2393
550 Ga0495643_0061843 3300046522 Bacteria 1984
551 Ga0495643_0067119 3300046522 Bacteria 1891
552 Ga0495643_0105440 3300046522 Bacteria 1439
553 Ga0495644_0002322 3300046523 Bacteria 7607
554 Ga0495644_0004209 3300046523 Bacteria 5652
555 Ga0495644_0006256 3300046523 Bacteria 4623
556 Ga0495644_0008001 3300046523 Bacteria 4067
557 Ga0495644_0008405 3300046523 Bacteria 3976
558 Ga0495644_0022412 3300046523 Bacteria 2407
559 Ga0495644_0025668 3300046523 Bacteria 2236
560 Ga0495644_0028983 3300046523 Bacteria 2093
561 Ga0495648_0000007 3300046524 Bacteria 347305
562 Ga0495648_0000877 3300046524 Bacteria 31708
563 Ga0495648_0005051 3300046524 Bacteria 11081
564 Ga0495648_0006058 3300046524 Bacteria 9922
565 Ga0495648_0019005 3300046524 Bacteria 4846
566 Ga0495648_0020402 3300046524 Bacteria 4623
567 Ga0495648_0020616 3300046524 Bacteria 4590
568 Ga0495648_0031438 3300046524 Bacteria 3494
569 Ga0495648_0034402 3300046524 Bacteria 3297
570 Ga0495648_0041161 3300046524 Bacteria 2921
571 Ga0495648_0071964 3300046524 Bacteria 2002
572 Ga0495663_0001857 3300046525 Bacteria 6513
573 Ga0495663_0003406 3300046525 Bacteria 4589
574 Ga0495663_0038003 3300046525 Bacteria 1454
575 Ga0495666_0003041 3300046526 Bacteria 8427
576 Ga0495666_0006057 3300046526 Bacteria 6091
577 Ga0495666_0079244 3300046526 Bacteria 1555
578 Ga0495666_0085481 3300046526 Bacteria 1490
579 Ga0495642_0000887 3300046528 Bacteria 14120
580 Ga0495642_0000985 3300046528 Bacteria 13253
581 Ga0495642_0003070 3300046528 Bacteria 6641
582 Ga0495642_0026533 3300046528 Bacteria 2301
583 Ga0495642_0037239 3300046528 Bacteria 1968
584 Ga0495642_0040689 3300046528 Bacteria 1888
585 Ga0495642_0049049 3300046528 Bacteria 1733
586 Ga0495642_0083734 3300046528 Bacteria 1345
587 Ga0495652_0005305 3300046529 Bacteria 12153
588 Ga0495654_0000004 3300046530 Bacteria 515304
589 Ga0495654_0003968 3300046530 Bacteria 8913
590 Ga0495654_0019568 3300046530 Bacteria 3540
591 Ga0495654_0039859 3300046530 Bacteria 2343
592 Ga0495654_0044161 3300046530 Bacteria 2205
593 Ga0495586_0019531 3300046535 Bacteria 3608
594 Ga0495586_0024795 3300046535 Bacteria 3207
595 Ga0495586_0053279 3300046535 Bacteria 2191
596 Ga0495587_0031578 3300046536 Bacteria 3205
597 Ga0495587_0046094 3300046536 Bacteria 2588
598 Ga0495609_0000002 3300046538 Bacteria 739816
599 Ga0495609_0000639 3300046538 Bacteria 27254
600 Ga0495609_0001564 3300046538 Bacteria 14971
601 Ga0495609_0001669 3300046538 Bacteria 14418
602 Ga0495609_0003140 3300046538 Bacteria 9635
603 Ga0495609_0006038 3300046538 Bacteria 6240
604 Ga0495609_0006189 3300046538 Bacteria 6153
605 Ga0495609_0014941 3300046538 Bacteria 3642
606 Ga0495609_0021118 3300046538 Bacteria 3003
607 Ga0495609_0025038 3300046538 Bacteria 2736
608 Ga0495609_0028187 3300046538 Bacteria 2563
609 Ga0495609_0047034 3300046538 Bacteria 1931
610 Ga0495621_0010741 3300046539 Bacteria 2812
611 Ga0495597_0000022 3300046542 Bacteria 150986
612 Ga0495597_0000063 3300046542 Bacteria 91471
613 Ga0495597_0001454 3300046542 Bacteria 16953
614 Ga0495597_0002183 3300046542 Bacteria 12849
615 Ga0495597_0002996 3300046542 Bacteria 10192
616 Ga0495597_0003329 3300046542 Bacteria 9474
617 Ga0495597_0005005 3300046542 Bacteria 7110
618 Ga0495597_0018781 3300046542 Bacteria 3240
619 Ga0495597_0031766 3300046542 Bacteria 2399
620 Ga0495597_0041585 3300046542 Bacteria 2052
621 Ga0495645_0015082 3300046543 Bacteria 5491
622 Ga0495645_0226136 3300046543 Bacteria 1256
623 Ga0495622_0000003 3300046557 Bacteria 268681
624 Ga0495622_0000432 3300046557 Bacteria 27458
625 Ga0495633_0000045 3300046558 Bacteria 169729
626 Ga0495633_0000449 3300046558 Bacteria 42373
627 Ga0495633_0004052 3300046558 Bacteria 9470
628 Ga0495633_0009799 3300046558 Bacteria 5265
629 Ga0495633_0013705 3300046558 Bacteria 4263
630 Ga0495633_0019683 3300046558 Bacteria 3409
631 Ga0495667_0054843 3300046559 Bacteria 2622
632 Ga0495667_0148660 3300046559 Bacteria 1508
633 Ga0495656_0000811 3300046615 Bacteria 10078
634 Ga0495656_0026162 3300046615 Bacteria 2320
635 Ga0495656_0075785 3300046615 Bacteria 1506
636 Ga0495668_0000051 3300046616 Bacteria 214532
637 Ga0495668_0000158 3300046616 Bacteria 103075
638 Ga0495668_0000205 3300046616 Bacteria 86295
639 Ga0495668_0002645 3300046616 Bacteria 14395
640 Ga0495668_0002726 3300046616 Bacteria 14151
641 Ga0495668_0002953 3300046616 Bacteria 13379
642 Ga0495668_0003351 3300046616 Bacteria 12079
643 Ga0495668_0019105 3300046616 Bacteria 3954
644 Ga0495668_0020227 3300046616 Bacteria 3829
645 Ga0495668_0027474 3300046616 Bacteria 3224
646 Ga0495668_0029158 3300046616 Bacteria 3119
647 Ga0495668_0031609 3300046616 Bacteria 2983
648 Ga0495668_0039156 3300046616 Bacteria 2647
649 Ga0495668_0062028 3300046616 Bacteria 2060
650 Ga0495668_0099299 3300046616 Bacteria 1592
651 Ga0495634_0024910 3300046642 Bacteria 4194
652 Ga0495634_0047968 3300046642 Bacteria 2877
653 Ga0495611_0001035 3300046648 Bacteria 14726
654 Ga0495611_0017608 3300046648 Bacteria 3057
655 Ga0495611_0025422 3300046648 Bacteria 2580
656 Ga0495611_0033011 3300046648 Bacteria 2283
657 Ga0495611_0038673 3300046648 Bacteria 2122
658 Ga0495611_0076165 3300046648 Bacteria 1537
659 Ga0495625_0000073 3300046660 Bacteria 165197
660 Ga0495625_0006264 3300046660 Bacteria 10644
661 Ga0495625_0011301 3300046660 Bacteria 7289
662 Ga0495625_0014579 3300046660 Bacteria 6265
663 Ga0495625_0066845 3300046660 Bacteria 2531
664 Ga0495625_0097982 3300046660 Bacteria 2017
665 Ga0495625_0136449 3300046660 Bacteria 1658
666 Ga0495625_0246006 3300046660 Bacteria 1162
667 Ga0495635_0071582 3300046663 Bacteria 2376
668 Ga0495635_0095315 3300046663 Bacteria 2034
669 Ga0495659_0001130 3300046664 Bacteria 9275
670 Ga0495659_0004753 3300046664 Bacteria 4275
671 Ga0495659_0007009 3300046664 Bacteria 3569
672 Ga0495659_0010884 3300046664 Bacteria 2929
673 Ga0495661_0000204 3300046665 Bacteria 68851
674 Ga0495661_0000742 3300046665 Bacteria 31731
675 Ga0495661_0002628 3300046665 Bacteria 13759
676 Ga0495661_0004658 3300046665 Bacteria 9854
677 Ga0495661_0007123 3300046665 Bacteria 7808
678 Ga0495661_0010529 3300046665 Bacteria 6306
679 Ga0495661_0012729 3300046665 Bacteria 5677
680 Ga0495661_0014610 3300046665 Bacteria 5258
681 Ga0495661_0017638 3300046665 Bacteria 4710
682 Ga0495661_0023518 3300046665 Bacteria 3999
683 Ga0495661_0040943 3300046665 Bacteria 2869
684 Ga0495661_0041898 3300046665 Bacteria 2828
685 Ga0495661_0049073 3300046665 Bacteria 2561
686 Ga0495661_0069149 3300046665 Bacteria 2069
687 Ga0495661_0078658 3300046665 Bacteria 1907
688 Ga0495661_0120858 3300046665 Bacteria 1447
689 Ga0495661_0176140 3300046665 Bacteria 1136
690 Ga0495661_0195441 3300046665 Bacteria 1062
691 Ga0495588_0000208 3300046674 Bacteria 57550
692 Ga0495588_0008870 3300046674 Bacteria 4626
693 Ga0495588_0027443 3300046674 Bacteria 2845
694 Ga0495588_0028931 3300046674 Bacteria 2777
695 Ga0495588_0035988 3300046674 Bacteria 2510
696 Ga0495588_0065893 3300046674 Bacteria 1879
697 Ga0495588_0083285 3300046674 Bacteria 1671
698 Ga0495623_0071918 3300046679 Bacteria 2151
699 Ga0495669_0000036 3300046684 Bacteria 95830
700 Ga0495669_0001068 3300046684 Bacteria 11411
701 Ga0495669_0006172 3300046684 Bacteria 4998
702 Ga0495669_0023940 3300046684 Bacteria 2660
703 Ga0495669_0030484 3300046684 Bacteria 2367
704 Ga0495669_0035605 3300046684 Bacteria 2198
705 Ga0495669_0038080 3300046684 Bacteria 2129
706 Ga0495669_0128909 3300046684 Bacteria 1190
707 Ga0495669_0182878 3300046684 Bacteria 999
708 Ga0495613_0100062 3300046689 Bacteria 2094
709 Ga0495624_0040296 3300046690 Bacteria 2991
710 Ga0495670_0002278 3300046691 Bacteria 9465
711 Ga0495670_0007920 3300046691 Bacteria 5223
712 Ga0495670_0010375 3300046691 Bacteria 4575
713 Ga0495670_0030924 3300046691 Bacteria 2659
714 Ga0495670_0134069 3300046691 Bacteria 1292
715 Ga0495671_0000260 3300046692 Bacteria 44754
716 Ga0495671_0002020 3300046692 Bacteria 13021
717 Ga0495671_0002900 3300046692 Bacteria 10695
718 Ga0495671_0007787 3300046692 Bacteria 6067
719 Ga0495671_0012088 3300046692 Bacteria 4719
720 Ga0495671_0029802 3300046692 Bacteria 2799
721 Ga0495671_0052594 3300046692 Bacteria 2024
722 Ga0495671_0173180 3300046692 Bacteria 1049
723 Ga0495649_0001404 3300046694 Bacteria 18182
724 Ga0495649_0013231 3300046694 Bacteria 4765
725 Ga0495649_0017449 3300046694 Bacteria 4049
726 Ga0495649_0019332 3300046694 Bacteria 3828
727 Ga0495649_0024659 3300046694 Bacteria 3353
728 Ga0495649_0026315 3300046694 Bacteria 3236
729 Ga0495649_0029601 3300046694 Bacteria 3028
730 Ga0495649_0059997 3300046694 Bacteria 2047
731 Ga0495649_0170834 3300046694 Bacteria 1137
732 Ga0495589_0000275 3300046794 Bacteria 41938
733 Ga0495589_0000491 3300046794 Bacteria 28250
734 Ga0495589_0002663 3300046794 Bacteria 9873
735 Ga0495589_0006649 3300046794 Bacteria 6091
736 Ga0495589_0008429 3300046794 Bacteria 5386
737 Ga0495589_0017104 3300046794 Bacteria 3725
738 Ga0495589_0023929 3300046794 Bacteria 3106
739 Ga0495589_0034332 3300046794 Bacteria 2547
740 Ga0495589_0036400 3300046794 Bacteria 2467
741 Ga0495589_0042928 3300046794 Bacteria 2252
742 Ga0495589_0067607 3300046794 Bacteria 1748
743 Ga0495600_0041084 3300046809 Bacteria 3013
744 Ga0495660_0000322 3300046810 Bacteria 42498
745 Ga0495660_0000715 3300046810 Bacteria 25390
746 Ga0495660_0009527 3300046810 Bacteria 5661
747 Ga0495660_0012028 3300046810 Bacteria 5019
748 Ga0495660_0013960 3300046810 Bacteria 4656
749 Ga0495660_0023202 3300046810 Bacteria 3540
750 Ga0495660_0035893 3300046810 Bacteria 2767
751 Ga0495660_0048997 3300046810 Bacteria 2308
752 Ga0495660_0079088 3300046810 Bacteria 1727
753 Ga0495660_0153607 3300046810 Bacteria 1134
754 Ga0495581_0007747 3300047315 Bacteria 6214
755 Ga0495581_0019112 3300047315 Bacteria 3977
756 Ga0495581_0034899 3300047315 Bacteria 2910
757 Ga0495581_0249754 3300047315 Bacteria 1037
758 Ga0495604_0027320 3300047317 Bacteria 4540
759 Ga0495604_0170738 3300047317 Bacteria 1529
760 Ga0495636_0004977 3300047318 Bacteria 5211
761 Ga0495636_0010303 3300047318 Bacteria 3689
762 Ga0495636_0040058 3300047318 Bacteria 1941
763 Ga0495674_0004003 3300047319 Bacteria 14272
764 Ga0495672_0000041 3300047320 Bacteria 267545
765 Ga0495672_0000184 3300047320 Bacteria 91103
766 Ga0495672_0000588 3300047320 Bacteria 41086
767 Ga0495672_0001324 3300047320 Bacteria 24612
768 Ga0495672_0003105 3300047320 Bacteria 14503
769 Ga0495672_0017522 3300047320 Bacteria 4790
770 Ga0495672_0095019 3300047320 Bacteria 1628
771 Ga0495676_0030259 3300047321 Bacteria 4599
772 Ga0495676_0146864 3300047321 Bacteria 1683
773 Ga0495680_0251230 3300047322 Bacteria 1253
774 Ga0495683_0000180 3300047323 Bacteria 62230
775 Ga0495683_0002116 3300047323 Bacteria 12278
776 Ga0495683_0005648 3300047323 Bacteria 6924
777 Ga0495683_0027845 3300047323 Bacteria 2889
778 Ga0495683_0031464 3300047323 Bacteria 2704
779 Ga0495683_0055562 3300047323 Bacteria 1970
780 Ga0495683_0091610 3300047323 Bacteria 1472
781 Ga0495687_000049 3300047443 Bacteria 205432
782 Ga0495687_000075 3300047443 Bacteria 152218
783 Ga0495687_000482 3300047443 Bacteria 48392
784 Ga0495687_000605 3300047443 Bacteria 41942
785 Ga0495687_000703 3300047443 Bacteria 37295
786 Ga0495687_001553 3300047443 Bacteria 20874
787 Ga0495687_009992 3300047443 Bacteria 5245
788 Ga0495675_0004311 3300047444 Bacteria 8606
789 Ga0495675_0064599 3300047444 Bacteria 2315
790 Ga0495675_0103143 3300047444 Bacteria 1783
791 Ga0495677_0000103 3300047445 Bacteria 41927
792 Ga0495677_0000916 3300047445 Bacteria 11880
793 Ga0495677_0001365 3300047445 Bacteria 9761
794 Ga0495677_0003071 3300047445 Bacteria 6491
795 Ga0495677_0003608 3300047445 Bacteria 6002
796 Ga0495677_0011044 3300047445 Bacteria 3309
797 Ga0495677_0024836 3300047445 Bacteria 2174
798 Ga0495677_0027735 3300047445 Bacteria 2054
799 Ga0495677_0030217 3300047445 Bacteria 1971
800 Ga0495677_0035728 3300047445 Bacteria 1813
801 Ga0495677_0045368 3300047445 Bacteria 1612
802 Ga0495679_006905 3300047446 Bacteria 4816
803 Ga0495679_010897 3300047446 Bacteria 3542
804 Ga0495679_047930 3300047446 Bacteria 1294
805 Ga0495685_000314 3300047447 Bacteria 15766
806 Ga0495685_013222 3300047447 Bacteria 2800
807 Ga0495685_036536 3300047447 Bacteria 1686
808 Ga0495673_0000017 3300047469 Bacteria 574970
809 Ga0495673_0000027 3300047469 Bacteria 475440
810 Ga0495673_0040655 3300047469 Bacteria 2098
811 Ga0495681_0000120 3300047470 Bacteria 69257
812 Ga0495681_0001681 3300047470 Bacteria 16398
813 Ga0495681_0004115 3300047470 Bacteria 10001
814 Ga0495681_0004617 3300047470 Bacteria 9357
815 Ga0495681_0043023 3300047470 Bacteria 2181
816 Ga0495681_0067172 3300047470 Bacteria 1635
817 Ga0495681_0100449 3300047470 Bacteria 1265
818 Ga0495684_0159642 3300047471 Bacteria 1682
819 Ga0495686_0000400 3300047472 Bacteria 68842
820 Ga0495686_0002027 3300047472 Bacteria 19979
821 Ga0495686_0002626 3300047472 Bacteria 16639
822 Ga0495686_0006856 3300047472 Bacteria 8630
823 Ga0495686_0012955 3300047472 Bacteria 5811
824 Ga0495686_0061230 3300047472 Bacteria 2338
825 Ga0495686_0108909 3300047472 Bacteria 1663
826 Ga0495593_0051773 3300047673 Bacteria 2171
827 Ga0495602_0006598 3300048088 Bacteria 12162
828 Ga0495614_0026838 3300048089 Bacteria 2483
829 Ga0495626_0000111 3300048091 Bacteria 105401
830 Ga0495626_0000447 3300048091 Bacteria 41983
831 Ga0495626_0000466 3300048091 Bacteria 41284
832 Ga0495626_0003091 3300048091 Bacteria 10913
833 Ga0495626_0004056 3300048091 Bacteria 9125
834 Ga0495626_0011509 3300048091 Bacteria 4679
835 Ga0495626_0012385 3300048091 Bacteria 4472
836 Ga0495626_0014030 3300048091 Bacteria 4145
837 Ga0495626_0021491 3300048091 Bacteria 3202
838 Ga0495626_0025900 3300048091 Bacteria 2863
839 Ga0495626_0031204 3300048091 Bacteria 2566
840 Ga0495626_0033046 3300048091 Bacteria 2480
841 Ga0495626_0063706 3300048091 Bacteria 1671
842 Ga0495626_0087024 3300048091 Bacteria 1379
843 Ga0495626_0088607 3300048091 Bacteria 1363
844 Ga0495626_0107154 3300048091 Bacteria 1213
845 Ga0496100_0049129 3300048903 Bacteria 2726
846 Ga0496100_0066685 3300048903 Bacteria 2388
847 Ga0496100_0130000 3300048903 Bacteria 1773
848 Ga0496100_0139290 3300048903 Bacteria 1717
849 Ga0496101_0003310 3300048904 Bacteria 10020
850 Ga0496101_0068638 3300048904 Bacteria 2592
851 Ga0496102_0000695 3300048905 Bacteria 33460
852 Ga0496102_0002110 3300048905 Bacteria 17093
853 Ga0496102_0107754 3300048905 Bacteria 2594
854 Ga0496102_0124418 3300048905 Bacteria 2410
855 Ga0496102_0216816 3300048905 Bacteria 1804
856 Ga0496103_0138234 3300048906 Bacteria 1557
857 Ga0496104_0094034 3300048907 Bacteria 2867
858 Ga0496105_0035710 3300048908 Bacteria 4092
859 Ga0496107_0037849 3300048910 Bacteria 3463
860 Ga0496107_0197477 3300048910 Bacteria 1495
861 Ga0496108_0142252 3300048911 Bacteria 2067
862 Ga0496109_0027815 3300048912 Bacteria 5053
863 Ga0496109_0194036 3300048912 Bacteria 1908
864 Ga0496110_0000115 3300048913 Bacteria 44117
865 Ga0496110_0005697 3300048913 Bacteria 9782
866 Ga0496110_0027332 3300048913 Bacteria 4891
867 Ga0496110_0085136 3300048913 Bacteria 2822
868 Ga0496110_0571567 3300048913 Bacteria 1027
869 Ga0496112_0003510 3300048915 Bacteria 12994
870 Ga0496112_0115725 3300048915 Bacteria 2652
871 Ga0496113_0004495 3300048916 Bacteria 8585
872 Ga0496113_0004780 3300048916 Bacteria 8367
873 Ga0496114_0019265 3300048917 Bacteria 5529
874 Ga0496114_0031081 3300048917 Bacteria 4393
875 Ga0496114_0572523 3300048917 Bacteria 997
876 Ga0496115_0006309 3300048918 Bacteria 8677
877 Ga0496115_0068407 3300048918 Bacteria 2875
878 Ga0496115_0194782 3300048918 Bacteria 1674
879 Ga0496115_0260149 3300048918 Bacteria 1427
880 Ga0496116_0102625 3300048919 Bacteria 1704
881 Ga0496121_0088460 3300048924 Bacteria 2428
882 Ga0496122_0000169 3300048925 Bacteria 155380
883 Ga0496122_0005065 3300048925 Bacteria 15917
884 Ga0496122_0043701 3300048925 Bacteria 3507
885 Ga0496122_0081748 3300048925 Bacteria 2247
886 Ga0496122_0147630 3300048925 Bacteria 1458
887 Ga0496123_0001570 3300048926 Bacteria 31269
888 Ga0496123_0015729 3300048926 Bacteria 6189
889 Ga0496123_0090097 3300048926 Bacteria 1825
890 Ga0496124_0003298 3300048927 Bacteria 19899
891 Ga0496124_0036446 3300048927 Bacteria 4289
892 Ga0496124_0061129 3300048927 Bacteria 3158
893 Ga0496124_0092766 3300048927 Bacteria 2459
894 Ga0496124_0120874 3300048927 Bacteria 2093
895 Ga0496125_0005514 3300048928 Bacteria 14021
896 Ga0496125_0083230 3300048928 Bacteria 2435
897 Ga0496126_0011339 3300048929 Bacteria 9241
898 Ga0495678_000056 3300049459 Bacteria 149598
899 Ga0495678_000445 3300049459 Bacteria 41172
900 Ga0495678_001377 3300049459 Bacteria 19384
901 Ga0495678_001405 3300049459 Bacteria 19063
902 Ga0495678_001532 3300049459 Bacteria 17853
903 Ga0495678_009979 3300049459 Bacteria 4647
904 Ga0495678_010676 3300049459 Bacteria 4443
905 Ga0495678_028860 3300049459 Bacteria 2335
906 Ga0495682_0001837 3300049460 Bacteria 10663
907 Ga0495682_0014320 3300049460 Bacteria 3009
908 Ga0501032_0042640 3300049569 Bacteria 3077
909 Ga0501033_0000310 3300049570 Bacteria 46064
910 Ga0501034_0276220 3300049571 Bacteria 1620
911 Ga0501046_0001350 3300049580 Bacteria 23760
912 Ga0501047_0060157 3300049581 Bacteria 3666
913 Ga0501047_0168356 3300049581 Bacteria 2061
914 Ga0501048_0087851 3300049582 Bacteria 2193
915 Ga0501070_0152393 3300049586 Bacteria 1907
916 Ga0501230_004770 3300049667 Bacteria 1884
917 Ga0501238_009067 3300049671 Bacteria 1315
918 Ga0501249_005296 3300049679 Bacteria 2637
919 Ga0501080_0247908 3300049742 Bacteria 1624
920 Ga0501269_001829 3300049766 Bacteria 2699
921 Ga0501035_0000681 3300049822 Bacteria 37186
922 Ga0501044_0018545 3300049823 Bacteria 7456
923 nmdc:mga03683_5929_c2 3300050489 Bacteria 3678

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032133 Ga0316583_10001730 Ga0316583_100017302 291
2 3300044842 Ga0466957_0043321 Ga0466957_0043321_853_1731 291
3 3300048917 Ga0496114_0572523 Ga0496114_0572523_54_941 295
4 3300048927 Ga0496124_0092766 Ga0496124_0092766_352_1239 295
5 3300005844 Ga0068862_100597577 Ga0068862_1005975772 296
6 3300021361 Ga0213872_10000445 Ga0213872_1000044526 297
7 3300021361 Ga0213872_10014137 Ga0213872_100141372 297
8 3300039447 Ga0436361_0009247 Ga0436361_0009247_4022_4918 297
9 3300039447 Ga0436361_0723519 Ga0436361_0723519_4909_5847 297
10 3300039447 Ga0436361_1215186 Ga0436361_1215186_780_1676 297
11 3300005338 Ga0068868_100006875 Ga0068868_1000068754 298
12 3300005353 Ga0070669_100198677 Ga0070669_1001986772 298
13 3300005355 Ga0070671_100020363 Ga0070671_1000203637 298
14 3300005367 Ga0070667_100023680 Ga0070667_1000236804 298
15 3300005435 Ga0070714_100067850 Ga0070714_1000678502 298
16 3300005842 Ga0068858_100051445 Ga0068858_1000514455 298
17 3300005985 Ga0081539_10026170 Ga0081539_100261704 298
18 3300013296 Ga0157374_10175314 Ga0157374_101753142 298
19 3300013297 Ga0157378_10010780 Ga0157378_100107808 298
20 3300013308 Ga0157375_10003068 Ga0157375_1000306810 298
21 3300014968 Ga0157379_10002346 Ga0157379_1000234611 298
22 3300014969 Ga0157376_10557923 Ga0157376_105579232 298
23 3300025931 Ga0207644_10001134 Ga0207644_1000113411 298
24 3300026035 Ga0207703_10142257 Ga0207703_101422572 298
25 3300026035 Ga0207703_10243699 Ga0207703_102436993 298
26 3300026067 Ga0207678_10003137 Ga0207678_100031372 298
27 3300027360 Ga0209969_1002384 Ga0209969_10023842 298
28 3300027364 Ga0209967_1002888 Ga0209967_10028882 298
29 3300027471 Ga0209995_1001642 Ga0209995_10016423 298
30 3300027876 Ga0209974_10011016 Ga0209974_100110162 298
31 3300028379 Ga0268266_10310808 Ga0268266_103108082 298
32 3300031344 Ga0265316_10082703 Ga0265316_100827032 298
33 3300031616 Ga0307508_10015009 Ga0307508_100150099 298
34 3300035119 Ga0373956_0072839 Ga0373956_0072839_128_1024 298
35 3300042876 Ga0451577_0111565 Ga0451577_0111565_1005_1901 298
36 3300003322 rootL2_10009396 rootL2_1000939610 299
37 3300005330 Ga0070690_100020510 Ga0070690_1000205105 299
38 3300005334 Ga0068869_100037903 Ga0068869_1000379032 299
39 3300005335 Ga0070666_10032555 Ga0070666_100325552 299
40 3300005338 Ga0068868_100082789 Ga0068868_1000827893 299
41 3300005340 Ga0070689_100005627 Ga0070689_1000056276 299
42 3300005355 Ga0070671_100064393 Ga0070671_1000643933 299
43 3300005356 Ga0070674_100043797 Ga0070674_1000437971 299
44 3300005364 Ga0070673_100060014 Ga0070673_1000600142 299
45 3300005365 Ga0070688_100006552 Ga0070688_1000065525 299
46 3300005436 Ga0070713_100016566 Ga0070713_1000165665 299
47 3300005438 Ga0070701_10017080 Ga0070701_100170802 299
48 3300005439 Ga0070711_100004558 Ga0070711_1000045585 299
49 3300005455 Ga0070663_100087510 Ga0070663_1000875102 299
50 3300005456 Ga0070678_100109488 Ga0070678_1001094882 299
51 3300005457 Ga0070662_100023990 Ga0070662_1000239906 299
52 3300005466 Ga0070685_10014464 Ga0070685_100144645 299
53 3300005547 Ga0070693_100039090 Ga0070693_1000390903 299
54 3300005548 Ga0070665_100065246 Ga0070665_1000652463 299
55 3300005614 Ga0068856_100172908 Ga0068856_1001729083 299
56 3300005617 Ga0068859_100002774 Ga0068859_10000277412 299
57 3300005618 Ga0068864_100009230 Ga0068864_1000092304 299
58 3300005842 Ga0068858_100007106 Ga0068858_1000071062 299
59 3300006163 Ga0070715_10036954 Ga0070715_100369542 299
60 3300006173 Ga0070716_100014032 Ga0070716_1000140325 299
61 3300006175 Ga0070712_100009811 Ga0070712_1000098113 299
62 3300006931 Ga0097620_100002773 Ga0097620_10000277312 299
63 3300009098 Ga0105245_10027376 Ga0105245_100273764 299
64 3300009101 Ga0105247_10052307 Ga0105247_100523072 299
65 3300009148 Ga0105243_10358876 Ga0105243_103588762 299
66 3300009174 Ga0105241_10118217 Ga0105241_101182172 299
67 3300009177 Ga0105248_10032029 Ga0105248_100320296 299
68 3300009551 Ga0105238_10552830 Ga0105238_105528302 299
69 3300011119 Ga0105246_10039783 Ga0105246_100397832 299
70 3300013296 Ga0157374_10001563 Ga0157374_100015639 299
71 3300013297 Ga0157378_10166752 Ga0157378_101667522 299
72 3300013306 Ga0163162_10065966 Ga0163162_100659663 299
73 3300013308 Ga0157375_10077954 Ga0157375_100779545 299
74 3300014325 Ga0163163_10015755 Ga0163163_100157554 299
75 3300014968 Ga0157379_10002957 Ga0157379_1000295710 299
76 3300017792 Ga0163161_10080900 Ga0163161_100809002 299
77 3300025898 Ga0207692_10034351 Ga0207692_100343514 299
78 3300025903 Ga0207680_10008458 Ga0207680_100084586 299
79 3300025908 Ga0207643_10014852 Ga0207643_100148522 299
80 3300025911 Ga0207654_10083523 Ga0207654_100835232 299
81 3300025914 Ga0207671_10375100 Ga0207671_103751001 299
82 3300025915 Ga0207693_10001075 Ga0207693_1000107521 299
83 3300025916 Ga0207663_10096916 Ga0207663_100969162 299
84 3300025927 Ga0207687_10006368 Ga0207687_100063686 299
85 3300025928 Ga0207700_10110504 Ga0207700_101105043 299
86 3300025931 Ga0207644_10019257 Ga0207644_100192573 299
87 3300025933 Ga0207706_10010737 Ga0207706_100107373 299
88 3300025934 Ga0207686_10001787 Ga0207686_1000178710 299
89 3300025934 Ga0207686_10002503 Ga0207686_1000250310 299
90 3300025936 Ga0207670_10239855 Ga0207670_102398552 299
91 3300025937 Ga0207669_10049715 Ga0207669_100497153 299
92 3300025941 Ga0207711_10002097 Ga0207711_1000209715 299
93 3300025986 Ga0207658_10249656 Ga0207658_102496562 299
94 3300026023 Ga0207677_10000445 Ga0207677_1000044510 299
95 3300026035 Ga0207703_10004139 Ga0207703_100041398 299
96 3300026041 Ga0207639_10271506 Ga0207639_102715062 299
97 3300026067 Ga0207678_10375439 Ga0207678_103754392 299
98 3300026078 Ga0207702_10118852 Ga0207702_101188522 299
99 3300026089 Ga0207648_10005123 Ga0207648_100051239 299
100 3300026095 Ga0207676_10040388 Ga0207676_100403883 299
101 3300026121 Ga0207683_10017560 Ga0207683_100175604 299
102 3300026142 Ga0207698_10610796 Ga0207698_106107961 299
103 3300028381 Ga0268264_10032054 Ga0268264_100320544 299
104 3300035117 Ga0373953_0002218 Ga0373953_0002218_2728_3762 299
105 3300035119 Ga0373956_0087898 Ga0373956_0087898_240_1151 299
106 3300035171 Ga0373946_0175447 Ga0373946_0175447_74_985 299
107 3300035691 Ga0373931_0126268 Ga0373931_0126268_128_1027 299
108 3300035695 Ga0373927_0031043 Ga0373927_0031043_2224_3135 299
109 3300035724 Ga0373933_0018138 Ga0373933_0018138_649_1683 299
110 3300036401 Ga0373937_0041306 Ga0373937_0041306_643_1677 299
111 3300045051 Ga0451576_0306482 Ga0451576_0306482_676_1575 299
112 3300046459 Ga0495629_0066865 Ga0495629_0066865_355_1263 299
113 3300046463 Ga0495653_0084536 Ga0495653_0084536_1307_2218 299
114 3300046473 Ga0495582_0021915 Ga0495582_0021915_580_1488 299
115 3300046526 Ga0495666_0085481 Ga0495666_0085481_55_966 299
116 3300046539 Ga0495621_0010741 Ga0495621_0010741_1232_2143 299
117 3300046543 Ga0495645_0015082 Ga0495645_0015082_475_1383 299
118 3300046559 Ga0495667_0054843 Ga0495667_0054843_306_1217 299
119 3300046642 Ga0495634_0047968 Ga0495634_0047968_404_1312 299
120 3300046663 Ga0495635_0095315 Ga0495635_0095315_20_928 299
121 3300046664 Ga0495659_0010884 Ga0495659_0010884_583_1494 299
122 3300046674 Ga0495588_0083285 Ga0495588_0083285_708_1619 299
123 3300047471 Ga0495684_0159642 Ga0495684_0159642_120_1031 299
124 3300048903 Ga0496100_0049129 Ga0496100_0049129_74_1108 299
125 3300048904 Ga0496101_0068638 Ga0496101_0068638_773_1684 299
126 3300048907 Ga0496104_0094034 Ga0496104_0094034_207_1118 299
127 3300048908 Ga0496105_0035710 Ga0496105_0035710_2367_3278 299
128 3300048910 Ga0496107_0037849 Ga0496107_0037849_478_1389 299
129 3300048912 Ga0496109_0194036 Ga0496109_0194036_860_1888 299
130 3300048915 Ga0496112_0003510 Ga0496112_0003510_10870_11781 299
131 3300048917 Ga0496114_0019265 Ga0496114_0019265_1026_2060 299
132 3300048918 Ga0496115_0068407 Ga0496115_0068407_986_1897 299
133 iso_pu_bacteria 2643221554 2643787618 299
134 iso_pu_bacteria 2643221556 2643797951 299
135 iso_pu_bacteria 2643221638 2644213499 299
136 iso_pu_bacteria 2643221645 2644250983 299
137 iso_pu_bacteria 2643221664 2644356401 299
138 iso_pu_bacteria 2643221684 2644473130 299
139 iso_pu_bacteria 2738541280 2738738957 299
140 iso_pu_bacteria 2738541300 2738844859 299
141 iso_pu_bacteria 2738543018 2739276376 299
142 iso_pu_bacteria 2738543030 2739345100 299
143 iso_pu_bacteria 2808606418 2809144416 299
144 iso_pu_bacteria 8047673197 8047677947 299
145 3300005328 Ga0070676_10001315 Ga0070676_100013159 300
146 3300005334 Ga0068869_100001107 Ga0068869_1000011076 300
147 3300005335 Ga0070666_10001383 Ga0070666_1000138312 300
148 3300005338 Ga0068868_100000331 Ga0068868_10000033120 300
149 3300005340 Ga0070689_100092781 Ga0070689_1000927812 300
150 3300005347 Ga0070668_100001693 Ga0070668_1000016939 300
151 3300005353 Ga0070669_100003085 Ga0070669_1000030855 300
152 3300005354 Ga0070675_100002186 Ga0070675_1000021864 300
153 3300005355 Ga0070671_100007917 Ga0070671_1000079178 300
154 3300005365 Ga0070688_100009264 Ga0070688_1000092647 300
155 3300005367 Ga0070667_100005247 Ga0070667_1000052475 300
156 3300005456 Ga0070678_100000798 Ga0070678_10000079810 300
157 3300005459 Ga0068867_100007157 Ga0068867_1000071577 300
158 3300005466 Ga0070685_10266534 Ga0070685_102665341 300
159 3300005539 Ga0068853_100095955 Ga0068853_1000959554 300
160 3300005543 Ga0070672_100001410 Ga0070672_1000014109 300
161 3300005548 Ga0070665_100038140 Ga0070665_1000381402 300
162 3300005616 Ga0068852_100548403 Ga0068852_1005484032 300
163 3300005617 Ga0068859_100034777 Ga0068859_1000347777 300
164 3300005617 Ga0068859_100185696 Ga0068859_1001856963 300
165 3300005719 Ga0068861_100036870 Ga0068861_1000368705 300
166 3300005841 Ga0068863_100000926 Ga0068863_1000009269 300
167 3300005842 Ga0068858_100003386 Ga0068858_1000033869 300
168 3300005843 Ga0068860_100001199 Ga0068860_10000119921 300
169 3300005843 Ga0068860_100092271 Ga0068860_1000922713 300
170 3300005843 Ga0068860_100219055 Ga0068860_1002190552 300
171 3300005844 Ga0068862_100067366 Ga0068862_1000673663 300
172 3300006237 Ga0097621_100001144 Ga0097621_1000011449 300
173 3300006358 Ga0068871_100007416 Ga0068871_1000074163 300
174 3300006881 Ga0068865_100009861 Ga0068865_1000098614 300
175 3300006931 Ga0097620_100034777 Ga0097620_1000347777 300
176 3300006931 Ga0097620_100185700 Ga0097620_1001857002 300
177 3300009148 Ga0105243_10150580 Ga0105243_101505803 300
178 3300009177 Ga0105248_10002137 Ga0105248_1000213710 300
179 3300009553 Ga0105249_10134945 Ga0105249_101349453 300
180 3300013296 Ga0157374_10033572 Ga0157374_100335724 300
181 3300013297 Ga0157378_10200105 Ga0157378_102001053 300
182 3300013308 Ga0157375_10001643 Ga0157375_100016439 300
183 3300014325 Ga0163163_10466826 Ga0163163_104668262 300
184 3300025315 Ga0207697_10008739 Ga0207697_100087395 300
185 3300025893 Ga0207682_10010099 Ga0207682_100100992 300
186 3300025903 Ga0207680_10001994 Ga0207680_100019949 300
187 3300025907 Ga0207645_10000241 Ga0207645_1000024139 300
188 3300025923 Ga0207681_10000854 Ga0207681_100008548 300
189 3300025925 Ga0207650_10136839 Ga0207650_101368392 300
190 3300025926 Ga0207659_10000360 Ga0207659_1000036019 300
191 3300025931 Ga0207644_10007005 Ga0207644_100070058 300
192 3300025936 Ga0207670_10030426 Ga0207670_100304263 300
193 3300025937 Ga0207669_10021494 Ga0207669_100214943 300
194 3300025938 Ga0207704_10001298 Ga0207704_100012989 300
195 3300025940 Ga0207691_10000368 Ga0207691_1000036839 300
196 3300025941 Ga0207711_10007086 Ga0207711_100070867 300
197 3300025942 Ga0207689_10008074 Ga0207689_100080748 300
198 3300025960 Ga0207651_10008735 Ga0207651_100087352 300
199 3300025961 Ga0207712_10126994 Ga0207712_101269942 300
200 3300025972 Ga0207668_10001355 Ga0207668_100013559 300
201 3300025986 Ga0207658_10001026 Ga0207658_1000102616 300
202 3300026023 Ga0207677_10000770 Ga0207677_1000077011 300
203 3300026035 Ga0207703_10002365 Ga0207703_100023655 300
204 3300026041 Ga0207639_10075092 Ga0207639_100750924 300
205 3300026088 Ga0207641_10000735 Ga0207641_1000073527 300
206 3300026089 Ga0207648_10000089 Ga0207648_100000899 300
207 3300026095 Ga0207676_10024266 Ga0207676_100242662 300
208 3300026121 Ga0207683_10000325 Ga0207683_1000032527 300
209 3300026142 Ga0207698_10551847 Ga0207698_105518472 300
210 3300028380 Ga0268265_10030585 Ga0268265_100305853 300
211 3300028381 Ga0268264_10007381 Ga0268264_100073819 300
212 3300028381 Ga0268264_10218693 Ga0268264_102186932 300
213 3300045051 Ga0451576_0034641 Ga0451576_0034641_4065_4967 300
214 3300045051 Ga0451576_0035992 Ga0451576_0035992_612_1514 300
215 3300046501 Ga0495607_0006952 Ga0495607_0006952_4760_5671 300
216 3300046558 Ga0495633_0019683 Ga0495633_0019683_1744_2655 300
217 3300048903 Ga0496100_0130000 Ga0496100_0130000_487_1395 300
218 3300048910 Ga0496107_0197477 Ga0496107_0197477_11_919 300
219 3300048913 Ga0496110_0085136 Ga0496110_0085136_1233_2141 300
220 3300048917 Ga0496114_0031081 Ga0496114_0031081_20_928 300
221 3300048919 Ga0496116_0102625 Ga0496116_0102625_546_1457 300
222 iso_pu_bacteria 2521172590 2521559462 300
223 iso_pu_bacteria 2551306416 2553007169 300
224 iso_pu_bacteria 2738541297 2738825328 300
225 iso_pu_bacteria 2738541357 2739149125 300
226 iso_pu_bacteria 2738543003 2739191044 300
227 iso_pu_bacteria 2738543026 2739317521 300
228 iso_pu_bacteria 2738543029 2739335762 300
229 iso_pu_bacteria 2818991449 2819616304 300
230 iso_pu_bacteria 2821131069 2821133915 300
231 iso_pu_bacteria 2842711865 2842716612 300
232 iso_pu_bacteria 2857553236 2857554010 300
233 iso_pu_bacteria 2857558681 2857563693 300
234 iso_pu_bacteria 2857564685 2857565708 300
235 iso_pu_bacteria 2904424332 2904429238 300
236 iso_pu_bacteria 2904439833 2904443054 300
237 iso_pu_bacteria 2904530477 2904532795 300
238 iso_pu_bacteria 2904584206 2904585353 300
239 iso_pu_bacteria 2904589729 2904593702 300
240 iso_pu_bacteria 2904601388 2904604152 300
241 iso_pu_bacteria 2919046199 2919047888 300
242 iso_pu_bacteria 2919079590 2919081620 300
243 iso_pu_bacteria 2923510766 2923513203 300
244 3300005578 Ga0068854_100006043 Ga0068854_1000060434 301
245 3300005834 Ga0068851_10060445 Ga0068851_100604453 301
246 3300009093 Ga0105240_10080810 Ga0105240_100808104 301
247 3300009545 Ga0105237_10014808 Ga0105237_100148085 301
248 3300009551 Ga0105238_10000128 Ga0105238_1000012846 301
249 3300010375 Ga0105239_10035925 Ga0105239_100359256 301
250 3300015261 Ga0182006_1032933 Ga0182006_10329332 301
251 3300025913 Ga0207695_10002390 Ga0207695_1000239013 301
252 3300025914 Ga0207671_10017201 Ga0207671_100172014 301
253 3300025914 Ga0207671_10188751 Ga0207671_101887512 301
254 3300025924 Ga0207694_10000845 Ga0207694_100008455 301
255 3300025949 Ga0207667_10021146 Ga0207667_100211462 301
256 3300031665 Ga0316575_10005640 Ga0316575_100056403 301
257 3300031727 Ga0316576_10022273 Ga0316576_100222733 301
258 3300035398 Ga0316574_0004167 Ga0316574_0004167_4494_5402 301
259 3300038443 Ga0395901_0011675 Ga0395901_0011675_995_1927 301
260 3300042876 Ga0451577_0012494 Ga0451577_0012494_332_1237 301
261 3300044672 Ga0466982_0102547 Ga0466982_0102547_447_1355 301
262 3300044712 Ga0453684_0001170 Ga0453684_0001170_8520_9425 301
263 3300048913 Ga0496110_0027332 Ga0496110_0027332_2383_3294 301
264 3300002987 JGI25159J45721_1004567 JGI25159J45721_10045676 302
265 3300003759 Ga0055525_1000009 Ga0055525_1000009163 302
266 3300003771 Ga0055526_1000031 Ga0055526_1000031125 302
267 3300003771 Ga0055526_1000353 Ga0055526_100035318 302
268 3300005262 Ga0065165_1000050 Ga0065165_1000050164 302
269 3300005262 Ga0065165_1005080 Ga0065165_10050804 302
270 3300005262 Ga0065165_1017345 Ga0065165_10173452 302
271 3300005327 Ga0070658_10177107 Ga0070658_101771072 302
272 3300005328 Ga0070676_10133772 Ga0070676_101337721 302
273 3300005334 Ga0068869_100363850 Ga0068869_1003638501 302
274 3300005339 Ga0070660_100050275 Ga0070660_1000502752 302
275 3300005339 Ga0070660_100282411 Ga0070660_1002824111 302
276 3300005339 Ga0070660_100319704 Ga0070660_1003197041 302
277 3300005347 Ga0070668_100206874 Ga0070668_1002068742 302
278 3300005347 Ga0070668_100235032 Ga0070668_1002350322 302
279 3300005356 Ga0070674_100148059 Ga0070674_1001480592 302
280 3300005366 Ga0070659_100038837 Ga0070659_1000388373 302
281 3300005548 Ga0070665_100219112 Ga0070665_1002191121 302
282 3300005563 Ga0068855_100256773 Ga0068855_1002567732 302
283 3300005564 Ga0070664_100056056 Ga0070664_1000560562 302
284 3300005564 Ga0070664_100170171 Ga0070664_1001701711 302
285 3300005564 Ga0070664_100239926 Ga0070664_1002399262 302
286 3300005616 Ga0068852_100129539 Ga0068852_1001295392 302
287 3300005719 Ga0068861_100186646 Ga0068861_1001866462 302
288 3300009036 Ga0105244_10005513 Ga0105244_100055134 302
289 3300009174 Ga0105241_10003069 Ga0105241_100030699 302
290 3300009176 Ga0105242_10042701 Ga0105242_100427013 302
291 3300010375 Ga0105239_10153799 Ga0105239_101537992 302
292 3300013102 Ga0157371_10000001 Ga0157371_10000001748 302
293 3300013297 Ga0157378_10136997 Ga0157378_101369973 302
294 3300014326 Ga0157380_10226632 Ga0157380_102266322 302
295 3300025230 Ga0209563_100015 Ga0209563_100015278 302
296 3300025254 Ga0209148_1000298 Ga0209148_10002982 302
297 3300025284 Ga0209130_1000065 Ga0209130_1000065163 302
298 3300025295 Ga0209564_1000038 Ga0209564_1000038219 302
299 3300025728 Ga0207655_1005668 Ga0207655_10056684 302
300 3300025909 Ga0207705_10090074 Ga0207705_100900742 302
301 3300025909 Ga0207705_10297130 Ga0207705_102971301 302
302 3300025911 Ga0207654_10001747 Ga0207654_100017475 302
303 3300025913 Ga0207695_10126941 Ga0207695_101269412 302
304 3300025919 Ga0207657_10040736 Ga0207657_100407363 302
305 3300025919 Ga0207657_10155290 Ga0207657_101552901 302
306 3300025923 Ga0207681_10191714 Ga0207681_101917142 302
307 3300025924 Ga0207694_10077396 Ga0207694_100773962 302
308 3300025927 Ga0207687_10151995 Ga0207687_101519951 302
309 3300025932 Ga0207690_10301835 Ga0207690_103018352 302
310 3300025933 Ga0207706_10061898 Ga0207706_100618982 302
311 3300025934 Ga0207686_10006141 Ga0207686_100061413 302
312 3300025935 Ga0207709_10008577 Ga0207709_100085774 302
313 3300025940 Ga0207691_10005465 Ga0207691_100054653 302
314 3300025940 Ga0207691_10128155 Ga0207691_101281551 302
315 3300025945 Ga0207679_10160074 Ga0207679_101600742 302
316 3300025949 Ga0207667_10015504 Ga0207667_100155043 302
317 3300025972 Ga0207668_10028645 Ga0207668_100286452 302
318 3300025972 Ga0207668_10236949 Ga0207668_102369492 302
319 3300025986 Ga0207658_10021933 Ga0207658_100219333 302
320 3300026089 Ga0207648_10065744 Ga0207648_100657445 302
321 3300028379 Ga0268266_10049672 Ga0268266_100496724 302
322 3300028379 Ga0268266_10084049 Ga0268266_100840492 302
323 3300031838 Ga0307518_10143660 Ga0307518_101436601 302
324 3300032168 Ga0316593_10003127 Ga0316593_100031272 302
325 3300036647 Ga0316582_0038410 Ga0316582_0038410_896_1807 302
326 3300037312 Ga0395899_0000141 Ga0395899_0000141_83674_84585 302
327 3300037312 Ga0395899_0004028 Ga0395899_0004028_9061_9972 302
328 3300037312 Ga0395899_0010706 Ga0395899_0010706_4275_5186 302
329 3300037312 Ga0395899_0023526 Ga0395899_0023526_1899_2810 302
330 3300037312 Ga0395899_0067119 Ga0395899_0067119_420_1331 302
331 3300037418 Ga0395900_0000931 Ga0395900_0000931_3246_4157 302
332 3300037418 Ga0395900_0010308 Ga0395900_0010308_1506_2417 302
333 3300037418 Ga0395900_0017608 Ga0395900_0017608_1705_2616 302
334 3300037418 Ga0395900_0025668 Ga0395900_0025668_858_1769 302
335 3300037418 Ga0395900_0026208 Ga0395900_0026208_4275_5186 302
336 3300037418 Ga0395900_0059676 Ga0395900_0059676_395_1306 302
337 3300037418 Ga0395900_0072612 Ga0395900_0072612_1918_2829 302
338 3300037418 Ga0395900_0092912 Ga0395900_0092912_1480_2391 302
339 3300037418 Ga0395900_0115884 Ga0395900_0115884_716_1627 302
340 3300037418 Ga0395900_0188808 Ga0395900_0188808_349_1260 302
341 3300037418 Ga0395900_0364293 Ga0395900_0364293_95_1006 302
342 3300037418 Ga0395900_0394428 Ga0395900_0394428_11_922 302
343 3300037466 Ga0395898_0019806 Ga0395898_0019806_722_1633 302
344 3300037466 Ga0395898_0053522 Ga0395898_0053522_702_1613 302
345 3300037466 Ga0395898_0090996 Ga0395898_0090996_772_1683 302
346 3300037466 Ga0395898_0140183 Ga0395898_0140183_53_964 302
347 3300037466 Ga0395898_0223464 Ga0395898_0223464_280_1191 302
348 3300037471 Ga0395905_0022278 Ga0395905_0022278_1898_2809 302
349 3300037471 Ga0395905_0075356 Ga0395905_0075356_1706_2617 302
350 3300037471 Ga0395905_0077736 Ga0395905_0077736_1941_2852 302
351 3300037471 Ga0395905_0145899 Ga0395905_0145899_691_1602 302
352 3300037471 Ga0395905_0154759 Ga0395905_0154759_444_1355 302
353 3300038443 Ga0395901_0000073 Ga0395901_0000073_8423_9334 302
354 3300038443 Ga0395901_0027144 Ga0395901_0027144_715_1626 302
355 3300038443 Ga0395901_0118509 Ga0395901_0118509_820_1731 302
356 3300038443 Ga0395901_0124851 Ga0395901_0124851_259_1170 302
357 3300041413 Ga0439465_0071992 Ga0439465_0071992_36_947 302
358 3300042005 Ga0439448_0000618 Ga0439448_0000618_1875_2786 302
359 3300042007 Ga0439449_0012815 Ga0439449_0012815_1922_2833 302
360 3300042012 Ga0439455_0000720 Ga0439455_0000720_3262_4173 302
361 3300042012 Ga0439455_0017695 Ga0439455_0017695_148_1059 302
362 3300042139 Ga0450904_001280 Ga0450904_001280_162_1073 302
363 3300044656 Ga0466969_0049147 Ga0466969_0049147_584_1495 302
364 3300044658 Ga0466972_0002165 Ga0466972_0002165_5276_6187 302
365 3300044683 Ga0466965_0005989 Ga0466965_0005989_3853_4764 302
366 3300044683 Ga0466965_0018625 Ga0466965_0018625_2343_3254 302
367 3300044683 Ga0466965_0049445 Ga0466965_0049445_330_1241 302
368 3300044683 Ga0466965_0103249 Ga0466965_0103249_46_1014 302
369 3300044684 Ga0466966_0005054 Ga0466966_0005054_531_1442 302
370 3300044706 Ga0466964_0005017 Ga0466964_0005017_3374_4285 302
371 3300044706 Ga0466964_0016497 Ga0466964_0016497_450_1445 302
372 3300044735 Ga0466968_0004913 Ga0466968_0004913_399_1310 302
373 3300044842 Ga0466957_0000115 Ga0466957_0000115_14150_15061 302
374 3300044842 Ga0466957_0091847 Ga0466957_0091847_808_1719 302
375 3300045049 Ga0466959_0005620 Ga0466959_0005620_4442_5353 302
376 3300045976 Ga0466967_0010104 Ga0466967_0010104_3313_4224 302
377 3300045976 Ga0466967_0097150 Ga0466967_0097150_730_1695 302
378 3300045976 Ga0466967_0284104 Ga0466967_0284104_642_1553 302
379 3300046452 Ga0495617_000002 Ga0495617_000002_450146_451057 302
380 3300046452 Ga0495617_005082 Ga0495617_005082_3359_4270 302
381 3300046452 Ga0495617_029597 Ga0495617_029597_789_1700 302
382 3300046453 Ga0495627_001506 Ga0495627_001506_4575_5486 302
383 3300046453 Ga0495627_005062 Ga0495627_005062_818_1729 302
384 3300046455 Ga0495603_0041037 Ga0495603_0041037_22_933 302
385 3300046457 Ga0495590_0000007 Ga0495590_0000007_222469_223380 302
386 3300046457 Ga0495590_0010883 Ga0495590_0010883_127_1038 302
387 3300046457 Ga0495590_0056733 Ga0495590_0056733_437_1348 302
388 3300046458 Ga0495591_000062 Ga0495591_000062_119113_120024 302
389 3300046458 Ga0495591_009009 Ga0495591_009009_2740_3651 302
390 3300046459 Ga0495629_0066316 Ga0495629_0066316_1153_2064 302
391 3300046460 Ga0495638_0005843 Ga0495638_0005843_2478_3389 302
392 3300046463 Ga0495653_0025531 Ga0495653_0025531_3450_4361 302
393 3300046463 Ga0495653_0030532 Ga0495653_0030532_1703_2614 302
394 3300046463 Ga0495653_0085475 Ga0495653_0085475_450_1361 302
395 3300046471 Ga0495650_0002253 Ga0495650_0002253_9211_10134 302
396 3300046471 Ga0495650_0003039 Ga0495650_0003039_3857_4768 302
397 3300046471 Ga0495650_0031742 Ga0495650_0031742_819_1730 302
398 3300046472 Ga0495580_0008499 Ga0495580_0008499_5807_6718 302
399 3300046474 Ga0495605_0000063 Ga0495605_0000063_125426_126337 302
400 3300046474 Ga0495605_0001463 Ga0495605_0001463_12090_13001 302
401 3300046474 Ga0495605_0008808 Ga0495605_0008808_846_1757 302
402 3300046474 Ga0495605_0009267 Ga0495605_0009267_901_1812 302
403 3300046474 Ga0495605_0015996 Ga0495605_0015996_936_1847 302
404 3300046474 Ga0495605_0024268 Ga0495605_0024268_1270_2181 302
405 3300046474 Ga0495605_0034912 Ga0495605_0034912_791_1702 302
406 3300046474 Ga0495605_0079164 Ga0495605_0079164_544_1455 302
407 3300046491 Ga0495584_0000010 Ga0495584_0000010_82907_83818 302
408 3300046491 Ga0495584_0001432 Ga0495584_0001432_10099_11010 302
409 3300046491 Ga0495584_0003242 Ga0495584_0003242_3635_4546 302
410 3300046491 Ga0495584_0003373 Ga0495584_0003373_2963_3874 302
411 3300046491 Ga0495584_0011566 Ga0495584_0011566_2231_3229 302
412 3300046491 Ga0495584_0026860 Ga0495584_0026860_538_1449 302
413 3300046491 Ga0495584_0031526 Ga0495584_0031526_1009_1920 302
414 3300046491 Ga0495584_0112658 Ga0495584_0112658_170_1081 302
415 3300046491 Ga0495584_0160244 Ga0495584_0160244_23_934 302
416 3300046492 Ga0495585_0000006 Ga0495585_0000006_92986_93897 302
417 3300046492 Ga0495585_0000592 Ga0495585_0000592_32302_33213 302
418 3300046492 Ga0495585_0001217 Ga0495585_0001217_18437_19348 302
419 3300046492 Ga0495585_0002703 Ga0495585_0002703_7833_8744 302
420 3300046492 Ga0495585_0002955 Ga0495585_0002955_3778_4689 302
421 3300046492 Ga0495585_0003583 Ga0495585_0003583_9398_10309 302
422 3300046492 Ga0495585_0005077 Ga0495585_0005077_2693_3604 302
423 3300046492 Ga0495585_0006007 Ga0495585_0006007_692_1603 302
424 3300046492 Ga0495585_0014015 Ga0495585_0014015_1410_2321 302
425 3300046492 Ga0495585_0016934 Ga0495585_0016934_1950_2861 302
426 3300046492 Ga0495585_0018950 Ga0495585_0018950_2325_3236 302
427 3300046492 Ga0495585_0022375 Ga0495585_0022375_1848_2759 302
428 3300046492 Ga0495585_0043853 Ga0495585_0043853_976_1887 302
429 3300046492 Ga0495585_0052966 Ga0495585_0052966_615_1526 302
430 3300046492 Ga0495585_0193990 Ga0495585_0193990_16_927 302
431 3300046492 Ga0495585_0198054 Ga0495585_0198054_77_988 302
432 3300046499 Ga0495594_0003275 Ga0495594_0003275_2252_3160 302
433 3300046499 Ga0495594_0010522 Ga0495594_0010522_3252_4163 302
434 3300046499 Ga0495594_0026451 Ga0495594_0026451_1824_2735 302
435 3300046500 Ga0495596_0000130 Ga0495596_0000130_50875_51786 302
436 3300046500 Ga0495596_0000217 Ga0495596_0000217_12248_13159 302
437 3300046500 Ga0495596_0005367 Ga0495596_0005367_613_1524 302
438 3300046500 Ga0495596_0006498 Ga0495596_0006498_1467_2378 302
439 3300046500 Ga0495596_0006913 Ga0495596_0006913_3505_4416 302
440 3300046500 Ga0495596_0009275 Ga0495596_0009275_873_1784 302
441 3300046500 Ga0495596_0012662 Ga0495596_0012662_2223_3134 302
442 3300046500 Ga0495596_0013081 Ga0495596_0013081_1036_1947 302
443 3300046500 Ga0495596_0024539 Ga0495596_0024539_727_1638 302
444 3300046500 Ga0495596_0047213 Ga0495596_0047213_52_963 302
445 3300046501 Ga0495607_0002839 Ga0495607_0002839_10070_10981 302
446 3300046501 Ga0495607_0003658 Ga0495607_0003658_9454_10365 302
447 3300046501 Ga0495607_0006211 Ga0495607_0006211_4550_5461 302
448 3300046501 Ga0495607_0006855 Ga0495607_0006855_3098_4009 302
449 3300046501 Ga0495607_0015837 Ga0495607_0015837_834_1745 302
450 3300046501 Ga0495607_0030511 Ga0495607_0030511_2382_3293 302
451 3300046501 Ga0495607_0046410 Ga0495607_0046410_723_1634 302
452 3300046501 Ga0495607_0085712 Ga0495607_0085712_605_1516 302
453 3300046501 Ga0495607_0094933 Ga0495607_0094933_666_1577 302
454 3300046501 Ga0495607_0154182 Ga0495607_0154182_205_1116 302
455 3300046506 Ga0495583_0000084 Ga0495583_0000084_114454_115365 302
456 3300046506 Ga0495583_0001063 Ga0495583_0001063_1172_2083 302
457 3300046506 Ga0495583_0001851 Ga0495583_0001851_222_1133 302
458 3300046506 Ga0495583_0002627 Ga0495583_0002627_4493_5404 302
459 3300046506 Ga0495583_0003369 Ga0495583_0003369_3734_4645 302
460 3300046506 Ga0495583_0003430 Ga0495583_0003430_667_1578 302
461 3300046506 Ga0495583_0018264 Ga0495583_0018264_1660_2571 302
462 3300046506 Ga0495583_0023407 Ga0495583_0023407_1238_2149 302
463 3300046506 Ga0495583_0026989 Ga0495583_0026989_1116_2027 302
464 3300046506 Ga0495583_0028565 Ga0495583_0028565_977_1888 302
465 3300046506 Ga0495583_0036094 Ga0495583_0036094_516_1427 302
466 3300046507 Ga0495606_0016464 Ga0495606_0016464_1881_2792 302
467 3300046507 Ga0495606_0020128 Ga0495606_0020128_3868_4779 302
468 3300046507 Ga0495606_0022863 Ga0495606_0022863_27_938 302
469 3300046507 Ga0495606_0052216 Ga0495606_0052216_764_1675 302
470 3300046507 Ga0495606_0094651 Ga0495606_0094651_756_1667 302
471 3300046507 Ga0495606_0096413 Ga0495606_0096413_818_1729 302
472 3300046507 Ga0495606_0109586 Ga0495606_0109586_22_933 302
473 3300046512 Ga0495610_0001723 Ga0495610_0001723_16709_17620 302
474 3300046513 Ga0495616_0000081 Ga0495616_0000081_43730_44641 302
475 3300046513 Ga0495616_0000396 Ga0495616_0000396_31313_32224 302
476 3300046513 Ga0495616_0003472 Ga0495616_0003472_1589_2500 302
477 3300046513 Ga0495616_0004198 Ga0495616_0004198_368_1279 302
478 3300046513 Ga0495616_0005391 Ga0495616_0005391_6469_7380 302
479 3300046513 Ga0495616_0011083 Ga0495616_0011083_926_1837 302
480 3300046513 Ga0495616_0011302 Ga0495616_0011302_2634_3545 302
481 3300046513 Ga0495616_0017489 Ga0495616_0017489_736_1647 302
482 3300046513 Ga0495616_0035044 Ga0495616_0035044_784_1695 302
483 3300046513 Ga0495616_0037407 Ga0495616_0037407_678_1589 302
484 3300046513 Ga0495616_0037415 Ga0495616_0037415_1508_2419 302
485 3300046513 Ga0495616_0061482 Ga0495616_0061482_439_1350 302
486 3300046513 Ga0495616_0080170 Ga0495616_0080170_640_1551 302
487 3300046513 Ga0495616_0114530 Ga0495616_0114530_57_968 302
488 3300046515 Ga0495620_0008818 Ga0495620_0008818_1245_2156 302
489 3300046518 Ga0495631_0000208 Ga0495631_0000208_7833_8744 302
490 3300046518 Ga0495631_0002880 Ga0495631_0002880_8105_9016 302
491 3300046518 Ga0495631_0003153 Ga0495631_0003153_1592_2503 302
492 3300046518 Ga0495631_0010249 Ga0495631_0010249_295_1206 302
493 3300046518 Ga0495631_0012668 Ga0495631_0012668_1630_2541 302
494 3300046518 Ga0495631_0014078 Ga0495631_0014078_721_1632 302
495 3300046518 Ga0495631_0015079 Ga0495631_0015079_625_1536 302
496 3300046518 Ga0495631_0016308 Ga0495631_0016308_1350_2261 302
497 3300046518 Ga0495631_0018869 Ga0495631_0018869_138_1049 302
498 3300046518 Ga0495631_0032919 Ga0495631_0032919_1130_2041 302
499 3300046518 Ga0495631_0040204 Ga0495631_0040204_743_1654 302
500 3300046518 Ga0495631_0040556 Ga0495631_0040556_47_958 302
501 3300046519 Ga0495632_0000071 Ga0495632_0000071_7926_8837 302
502 3300046519 Ga0495632_0001714 Ga0495632_0001714_16097_17008 302
503 3300046519 Ga0495632_0003038 Ga0495632_0003038_3788_4699 302
504 3300046519 Ga0495632_0006355 Ga0495632_0006355_2997_3908 302
505 3300046519 Ga0495632_0006805 Ga0495632_0006805_5298_6209 302
506 3300046519 Ga0495632_0009584 Ga0495632_0009584_3312_4223 302
507 3300046520 Ga0495637_0000335 Ga0495637_0000335_36_947 302
508 3300046520 Ga0495637_0001186 Ga0495637_0001186_4536_5447 302
509 3300046520 Ga0495637_0012354 Ga0495637_0012354_2640_3551 302
510 3300046522 Ga0495643_0000196 Ga0495643_0000196_47384_48295 302
511 3300046522 Ga0495643_0000756 Ga0495643_0000756_27680_28591 302
512 3300046522 Ga0495643_0008541 Ga0495643_0008541_3474_4385 302
513 3300046522 Ga0495643_0029275 Ga0495643_0029275_604_1515 302
514 3300046522 Ga0495643_0037775 Ga0495643_0037775_369_1280 302
515 3300046522 Ga0495643_0045120 Ga0495643_0045120_453_1364 302
516 3300046522 Ga0495643_0067119 Ga0495643_0067119_82_993 302
517 3300046522 Ga0495643_0105440 Ga0495643_0105440_502_1413 302
518 3300046523 Ga0495644_0002322 Ga0495644_0002322_784_1695 302
519 3300046523 Ga0495644_0004209 Ga0495644_0004209_63_974 302
520 3300046523 Ga0495644_0008001 Ga0495644_0008001_318_1229 302
521 3300046523 Ga0495644_0008405 Ga0495644_0008405_706_1617 302
522 3300046523 Ga0495644_0025668 Ga0495644_0025668_649_1560 302
523 3300046523 Ga0495644_0028983 Ga0495644_0028983_556_1467 302
524 3300046524 Ga0495648_0000007 Ga0495648_0000007_104291_105202 302
525 3300046524 Ga0495648_0005051 Ga0495648_0005051_6335_7246 302
526 3300046524 Ga0495648_0006058 Ga0495648_0006058_1008_1919 302
527 3300046524 Ga0495648_0019005 Ga0495648_0019005_1135_2046 302
528 3300046524 Ga0495648_0020402 Ga0495648_0020402_2690_3601 302
529 3300046524 Ga0495648_0020616 Ga0495648_0020616_2810_3721 302
530 3300046524 Ga0495648_0041161 Ga0495648_0041161_649_1560 302
531 3300046524 Ga0495648_0071964 Ga0495648_0071964_354_1265 302
532 3300046525 Ga0495663_0001857 Ga0495663_0001857_1880_2791 302
533 3300046525 Ga0495663_0003406 Ga0495663_0003406_992_1903 302
534 3300046526 Ga0495666_0003041 Ga0495666_0003041_2837_3748 302
535 3300046526 Ga0495666_0006057 Ga0495666_0006057_2298_3209 302
536 3300046526 Ga0495666_0079244 Ga0495666_0079244_183_1091 302
537 3300046528 Ga0495642_0000887 Ga0495642_0000887_9930_10841 302
538 3300046528 Ga0495642_0000985 Ga0495642_0000985_6812_7783 302
539 3300046528 Ga0495642_0003070 Ga0495642_0003070_2414_3325 302
540 3300046528 Ga0495642_0026533 Ga0495642_0026533_957_1868 302
541 3300046528 Ga0495642_0037239 Ga0495642_0037239_606_1517 302
542 3300046528 Ga0495642_0040689 Ga0495642_0040689_456_1367 302
543 3300046528 Ga0495642_0049049 Ga0495642_0049049_195_1106 302
544 3300046528 Ga0495642_0083734 Ga0495642_0083734_377_1288 302
545 3300046529 Ga0495652_0005305 Ga0495652_0005305_8605_9516 302
546 3300046530 Ga0495654_0000004 Ga0495654_0000004_310999_311910 302
547 3300046530 Ga0495654_0003968 Ga0495654_0003968_7259_8170 302
548 3300046530 Ga0495654_0019568 Ga0495654_0019568_2597_3508 302
549 3300046530 Ga0495654_0039859 Ga0495654_0039859_813_1724 302
550 3300046535 Ga0495586_0019531 Ga0495586_0019531_1958_2869 302
551 3300046535 Ga0495586_0024795 Ga0495586_0024795_434_1345 302
552 3300046535 Ga0495586_0053279 Ga0495586_0053279_325_1236 302
553 3300046536 Ga0495587_0031578 Ga0495587_0031578_249_1160 302
554 3300046536 Ga0495587_0046094 Ga0495587_0046094_944_1855 302
555 3300046538 Ga0495609_0000002 Ga0495609_0000002_221271_222182 302
556 3300046538 Ga0495609_0000639 Ga0495609_0000639_7651_8562 302
557 3300046538 Ga0495609_0001669 Ga0495609_0001669_11377_12288 302
558 3300046538 Ga0495609_0006189 Ga0495609_0006189_1999_2910 302
559 3300046538 Ga0495609_0014941 Ga0495609_0014941_2166_3077 302
560 3300046538 Ga0495609_0021118 Ga0495609_0021118_933_1844 302
561 3300046538 Ga0495609_0025038 Ga0495609_0025038_833_1744 302
562 3300046538 Ga0495609_0028187 Ga0495609_0028187_1496_2407 302
563 3300046538 Ga0495609_0047034 Ga0495609_0047034_322_1233 302
564 3300046542 Ga0495597_0000063 Ga0495597_0000063_13840_14751 302
565 3300046542 Ga0495597_0001454 Ga0495597_0001454_2098_3009 302
566 3300046542 Ga0495597_0002996 Ga0495597_0002996_1090_2001 302
567 3300046542 Ga0495597_0003329 Ga0495597_0003329_654_1652 302
568 3300046542 Ga0495597_0005005 Ga0495597_0005005_3064_3975 302
569 3300046542 Ga0495597_0018781 Ga0495597_0018781_1907_2818 302
570 3300046542 Ga0495597_0031766 Ga0495597_0031766_1251_2159 302
571 3300046542 Ga0495597_0041585 Ga0495597_0041585_684_1598 302
572 3300046543 Ga0495645_0226136 Ga0495645_0226136_273_1184 302
573 3300046558 Ga0495633_0004052 Ga0495633_0004052_968_1879 302
574 3300046558 Ga0495633_0009799 Ga0495633_0009799_3607_4518 302
575 3300046558 Ga0495633_0013705 Ga0495633_0013705_1858_2769 302
576 3300046559 Ga0495667_0148660 Ga0495667_0148660_440_1351 302
577 3300046615 Ga0495656_0000811 Ga0495656_0000811_773_1684 302
578 3300046615 Ga0495656_0026162 Ga0495656_0026162_1382_2293 302
579 3300046615 Ga0495656_0075785 Ga0495656_0075785_101_1012 302
580 3300046616 Ga0495668_0002726 Ga0495668_0002726_5155_6066 302
581 3300046616 Ga0495668_0002953 Ga0495668_0002953_4575_5486 302
582 3300046616 Ga0495668_0003351 Ga0495668_0003351_255_1166 302
583 3300046616 Ga0495668_0019105 Ga0495668_0019105_566_1489 302
584 3300046616 Ga0495668_0020227 Ga0495668_0020227_706_1704 302
585 3300046616 Ga0495668_0027474 Ga0495668_0027474_1689_2600 302
586 3300046616 Ga0495668_0031609 Ga0495668_0031609_1294_2205 302
587 3300046616 Ga0495668_0039156 Ga0495668_0039156_1006_1917 302
588 3300046616 Ga0495668_0062028 Ga0495668_0062028_441_1352 302
589 3300046616 Ga0495668_0099299 Ga0495668_0099299_500_1411 302
590 3300046642 Ga0495634_0024910 Ga0495634_0024910_2115_3026 302
591 3300046648 Ga0495611_0001035 Ga0495611_0001035_3757_4668 302
592 3300046648 Ga0495611_0017608 Ga0495611_0017608_1025_1936 302
593 3300046648 Ga0495611_0025422 Ga0495611_0025422_739_1650 302
594 3300046648 Ga0495611_0033011 Ga0495611_0033011_26_937 302
595 3300046648 Ga0495611_0038673 Ga0495611_0038673_981_1892 302
596 3300046648 Ga0495611_0076165 Ga0495611_0076165_611_1522 302
597 3300046660 Ga0495625_0014579 Ga0495625_0014579_2203_3114 302
598 3300046660 Ga0495625_0066845 Ga0495625_0066845_908_1819 302
599 3300046660 Ga0495625_0136449 Ga0495625_0136449_289_1200 302
600 3300046660 Ga0495625_0246006 Ga0495625_0246006_166_1077 302
601 3300046663 Ga0495635_0071582 Ga0495635_0071582_750_1661 302
602 3300046664 Ga0495659_0001130 Ga0495659_0001130_81_992 302
603 3300046664 Ga0495659_0004753 Ga0495659_0004753_3311_4222 302
604 3300046665 Ga0495661_0000204 Ga0495661_0000204_29933_30844 302
605 3300046665 Ga0495661_0000742 Ga0495661_0000742_29807_30718 302
606 3300046665 Ga0495661_0002628 Ga0495661_0002628_1952_2863 302
607 3300046665 Ga0495661_0004658 Ga0495661_0004658_8209_9120 302
608 3300046665 Ga0495661_0007123 Ga0495661_0007123_954_1865 302
609 3300046665 Ga0495661_0010529 Ga0495661_0010529_2772_3683 302
610 3300046665 Ga0495661_0012729 Ga0495661_0012729_3525_4436 302
611 3300046665 Ga0495661_0014610 Ga0495661_0014610_3741_4652 302
612 3300046665 Ga0495661_0017638 Ga0495661_0017638_3545_4456 302
613 3300046665 Ga0495661_0023518 Ga0495661_0023518_1041_1952 302
614 3300046665 Ga0495661_0040943 Ga0495661_0040943_1294_2205 302
615 3300046665 Ga0495661_0041898 Ga0495661_0041898_1874_2785 302
616 3300046665 Ga0495661_0049073 Ga0495661_0049073_342_1253 302
617 3300046665 Ga0495661_0069149 Ga0495661_0069149_1147_2058 302
618 3300046665 Ga0495661_0078658 Ga0495661_0078658_26_937 302
619 3300046665 Ga0495661_0120858 Ga0495661_0120858_148_1059 302
620 3300046665 Ga0495661_0176140 Ga0495661_0176140_210_1121 302
621 3300046665 Ga0495661_0195441 Ga0495661_0195441_137_1048 302
622 3300046674 Ga0495588_0000208 Ga0495588_0000208_30215_31126 302
623 3300046674 Ga0495588_0008870 Ga0495588_0008870_3081_3992 302
624 3300046674 Ga0495588_0027443 Ga0495588_0027443_1422_2333 302
625 3300046674 Ga0495588_0028931 Ga0495588_0028931_907_1818 302
626 3300046674 Ga0495588_0035988 Ga0495588_0035988_1300_2211 302
627 3300046674 Ga0495588_0065893 Ga0495588_0065893_337_1248 302
628 3300046679 Ga0495623_0071918 Ga0495623_0071918_925_1836 302
629 3300046684 Ga0495669_0000036 Ga0495669_0000036_79291_80202 302
630 3300046684 Ga0495669_0001068 Ga0495669_0001068_9438_10349 302
631 3300046684 Ga0495669_0006172 Ga0495669_0006172_1623_2534 302
632 3300046684 Ga0495669_0023940 Ga0495669_0023940_732_1643 302
633 3300046684 Ga0495669_0030484 Ga0495669_0030484_756_1667 302
634 3300046684 Ga0495669_0035605 Ga0495669_0035605_902_1813 302
635 3300046684 Ga0495669_0038080 Ga0495669_0038080_390_1301 302
636 3300046684 Ga0495669_0128909 Ga0495669_0128909_54_965 302
637 3300046684 Ga0495669_0182878 Ga0495669_0182878_60_971 302
638 3300046689 Ga0495613_0100062 Ga0495613_0100062_452_1363 302
639 3300046690 Ga0495624_0040296 Ga0495624_0040296_211_1122 302
640 3300046691 Ga0495670_0002278 Ga0495670_0002278_6307_7218 302
641 3300046691 Ga0495670_0007920 Ga0495670_0007920_823_1734 302
642 3300046691 Ga0495670_0030924 Ga0495670_0030924_1291_2202 302
643 3300046691 Ga0495670_0134069 Ga0495670_0134069_359_1270 302
644 3300046692 Ga0495671_0000260 Ga0495671_0000260_90_1001 302
645 3300046692 Ga0495671_0002020 Ga0495671_0002020_7765_8676 302
646 3300046692 Ga0495671_0007787 Ga0495671_0007787_297_1208 302
647 3300046692 Ga0495671_0012088 Ga0495671_0012088_1055_1966 302
648 3300046692 Ga0495671_0029802 Ga0495671_0029802_847_1758 302
649 3300046692 Ga0495671_0052594 Ga0495671_0052594_409_1320 302
650 3300046694 Ga0495649_0001404 Ga0495649_0001404_2036_2947 302
651 3300046694 Ga0495649_0017449 Ga0495649_0017449_1117_2028 302
652 3300046694 Ga0495649_0019332 Ga0495649_0019332_903_1814 302
653 3300046694 Ga0495649_0026315 Ga0495649_0026315_828_1739 302
654 3300046694 Ga0495649_0029601 Ga0495649_0029601_902_1813 302
655 3300046694 Ga0495649_0059997 Ga0495649_0059997_1088_1999 302
656 3300046694 Ga0495649_0170834 Ga0495649_0170834_131_1042 302
657 3300046794 Ga0495589_0000275 Ga0495589_0000275_38504_39415 302
658 3300046794 Ga0495589_0000491 Ga0495589_0000491_12887_13798 302
659 3300046794 Ga0495589_0002663 Ga0495589_0002663_8230_9141 302
660 3300046794 Ga0495589_0006649 Ga0495589_0006649_4754_5665 302
661 3300046794 Ga0495589_0008429 Ga0495589_0008429_3741_4652 302
662 3300046794 Ga0495589_0017104 Ga0495589_0017104_675_1673 302
663 3300046794 Ga0495589_0023929 Ga0495589_0023929_1172_2083 302
664 3300046794 Ga0495589_0034332 Ga0495589_0034332_851_1762 302
665 3300046794 Ga0495589_0036400 Ga0495589_0036400_870_1781 302
666 3300046794 Ga0495589_0042928 Ga0495589_0042928_735_1646 302
667 3300046794 Ga0495589_0067607 Ga0495589_0067607_802_1713 302
668 3300046809 Ga0495600_0041084 Ga0495600_0041084_1057_1968 302
669 3300046810 Ga0495660_0000322 Ga0495660_0000322_20593_21504 302
670 3300046810 Ga0495660_0000715 Ga0495660_0000715_472_1383 302
671 3300046810 Ga0495660_0009527 Ga0495660_0009527_1083_1994 302
672 3300046810 Ga0495660_0013960 Ga0495660_0013960_3611_4522 302
673 3300046810 Ga0495660_0048997 Ga0495660_0048997_706_1617 302
674 3300046810 Ga0495660_0079088 Ga0495660_0079088_38_949 302
675 3300046810 Ga0495660_0153607 Ga0495660_0153607_107_1018 302
676 3300047315 Ga0495581_0007747 Ga0495581_0007747_5088_5999 302
677 3300047315 Ga0495581_0019112 Ga0495581_0019112_244_1155 302
678 3300047315 Ga0495581_0034899 Ga0495581_0034899_1742_2650 302
679 3300047315 Ga0495581_0249754 Ga0495581_0249754_56_964 302
680 3300047317 Ga0495604_0027320 Ga0495604_0027320_518_1429 302
681 3300047317 Ga0495604_0170738 Ga0495604_0170738_50_961 302
682 3300047318 Ga0495636_0004977 Ga0495636_0004977_165_1076 302
683 3300047318 Ga0495636_0040058 Ga0495636_0040058_242_1153 302
684 3300047319 Ga0495674_0004003 Ga0495674_0004003_1281_2192 302
685 3300047320 Ga0495672_0000041 Ga0495672_0000041_2784_3695 302
686 3300047320 Ga0495672_0000184 Ga0495672_0000184_18556_19467 302
687 3300047320 Ga0495672_0001324 Ga0495672_0001324_14133_15044 302
688 3300047320 Ga0495672_0003105 Ga0495672_0003105_1477_2388 302
689 3300047320 Ga0495672_0017522 Ga0495672_0017522_3490_4488 302
690 3300047321 Ga0495676_0030259 Ga0495676_0030259_3515_4426 302
691 3300047321 Ga0495676_0146864 Ga0495676_0146864_29_937 302
692 3300047322 Ga0495680_0251230 Ga0495680_0251230_26_934 302
693 3300047323 Ga0495683_0000180 Ga0495683_0000180_61284_62195 302
694 3300047323 Ga0495683_0002116 Ga0495683_0002116_10025_10936 302
695 3300047323 Ga0495683_0005648 Ga0495683_0005648_502_1413 302
696 3300047323 Ga0495683_0031464 Ga0495683_0031464_561_1472 302
697 3300047323 Ga0495683_0055562 Ga0495683_0055562_432_1343 302
698 3300047323 Ga0495683_0091610 Ga0495683_0091610_441_1352 302
699 3300047443 Ga0495687_000049 Ga0495687_000049_88639_89550 302
700 3300047443 Ga0495687_000075 Ga0495687_000075_792_1703 302
701 3300047443 Ga0495687_000482 Ga0495687_000482_46495_47406 302
702 3300047443 Ga0495687_000605 Ga0495687_000605_38529_39440 302
703 3300047443 Ga0495687_009992 Ga0495687_009992_1641_2552 302
704 3300047444 Ga0495675_0004311 Ga0495675_0004311_6141_7052 302
705 3300047444 Ga0495675_0064599 Ga0495675_0064599_389_1297 302
706 3300047444 Ga0495675_0103143 Ga0495675_0103143_843_1754 302
707 3300047445 Ga0495677_0000103 Ga0495677_0000103_38504_39415 302
708 3300047445 Ga0495677_0000916 Ga0495677_0000916_4499_5410 302
709 3300047445 Ga0495677_0001365 Ga0495677_0001365_4209_5120 302
710 3300047445 Ga0495677_0003071 Ga0495677_0003071_2079_2990 302
711 3300047445 Ga0495677_0003608 Ga0495677_0003608_3372_4283 302
712 3300047445 Ga0495677_0011044 Ga0495677_0011044_1081_1992 302
713 3300047445 Ga0495677_0024836 Ga0495677_0024836_852_1763 302
714 3300047445 Ga0495677_0027735 Ga0495677_0027735_34_945 302
715 3300047445 Ga0495677_0030217 Ga0495677_0030217_1036_1947 302
716 3300047445 Ga0495677_0035728 Ga0495677_0035728_836_1747 302
717 3300047445 Ga0495677_0045368 Ga0495677_0045368_48_1019 302
718 3300047446 Ga0495679_006905 Ga0495679_006905_2968_3879 302
719 3300047446 Ga0495679_010897 Ga0495679_010897_470_1381 302
720 3300047446 Ga0495679_047930 Ga0495679_047930_368_1279 302
721 3300047447 Ga0495685_013222 Ga0495685_013222_599_1510 302
722 3300047470 Ga0495681_0000120 Ga0495681_0000120_36653_37564 302
723 3300047470 Ga0495681_0001681 Ga0495681_0001681_4413_5324 302
724 3300047470 Ga0495681_0004115 Ga0495681_0004115_7521_8432 302
725 3300047470 Ga0495681_0004617 Ga0495681_0004617_2850_3761 302
726 3300047470 Ga0495681_0043023 Ga0495681_0043023_311_1222 302
727 3300047470 Ga0495681_0100449 Ga0495681_0100449_27_938 302
728 3300047472 Ga0495686_0000400 Ga0495686_0000400_65217_66128 302
729 3300047472 Ga0495686_0006856 Ga0495686_0006856_1610_2533 302
730 3300047472 Ga0495686_0012955 Ga0495686_0012955_4490_5401 302
731 3300047673 Ga0495593_0051773 Ga0495593_0051773_777_1685 302
732 3300048088 Ga0495602_0006598 Ga0495602_0006598_1244_2155 302
733 3300048089 Ga0495614_0026838 Ga0495614_0026838_1175_2083 302
734 3300048091 Ga0495626_0000111 Ga0495626_0000111_90883_91794 302
735 3300048091 Ga0495626_0000447 Ga0495626_0000447_9469_10380 302
736 3300048091 Ga0495626_0000466 Ga0495626_0000466_2480_3391 302
737 3300048091 Ga0495626_0003091 Ga0495626_0003091_7855_8766 302
738 3300048091 Ga0495626_0004056 Ga0495626_0004056_6690_7601 302
739 3300048091 Ga0495626_0011509 Ga0495626_0011509_233_1144 302
740 3300048091 Ga0495626_0012385 Ga0495626_0012385_1956_2867 302
741 3300048091 Ga0495626_0014030 Ga0495626_0014030_2562_3473 302
742 3300048091 Ga0495626_0021491 Ga0495626_0021491_390_1301 302
743 3300048091 Ga0495626_0025900 Ga0495626_0025900_694_1605 302
744 3300048091 Ga0495626_0031204 Ga0495626_0031204_750_1661 302
745 3300048091 Ga0495626_0033046 Ga0495626_0033046_831_1742 302
746 3300048091 Ga0495626_0063706 Ga0495626_0063706_21_932 302
747 3300048091 Ga0495626_0087024 Ga0495626_0087024_361_1272 302
748 3300048091 Ga0495626_0088607 Ga0495626_0088607_342_1253 302
749 3300048091 Ga0495626_0107154 Ga0495626_0107154_202_1113 302
750 3300048903 Ga0496100_0139290 Ga0496100_0139290_242_1153 302
751 3300048904 Ga0496101_0003310 Ga0496101_0003310_4091_5002 302
752 3300048905 Ga0496102_0000695 Ga0496102_0000695_26112_27023 302
753 3300048905 Ga0496102_0002110 Ga0496102_0002110_7521_8432 302
754 3300048905 Ga0496102_0107754 Ga0496102_0107754_909_1820 302
755 3300048905 Ga0496102_0124418 Ga0496102_0124418_471_1382 302
756 3300048905 Ga0496102_0216816 Ga0496102_0216816_596_1690 302
757 3300048906 Ga0496103_0138234 Ga0496103_0138234_541_1452 302
758 3300048911 Ga0496108_0142252 Ga0496108_0142252_893_1804 302
759 3300048912 Ga0496109_0027815 Ga0496109_0027815_1016_1927 302
760 3300048913 Ga0496110_0000115 Ga0496110_0000115_9727_10638 302
761 3300048913 Ga0496110_0005697 Ga0496110_0005697_7861_8772 302
762 3300048913 Ga0496110_0571567 Ga0496110_0571567_101_1012 302
763 3300048915 Ga0496112_0115725 Ga0496112_0115725_620_1531 302
764 3300048916 Ga0496113_0004495 Ga0496113_0004495_673_1584 302
765 3300048916 Ga0496113_0004780 Ga0496113_0004780_1144_2055 302
766 3300048918 Ga0496115_0006309 Ga0496115_0006309_6920_7831 302
767 3300048918 Ga0496115_0194782 Ga0496115_0194782_408_1319 302
768 3300048918 Ga0496115_0260149 Ga0496115_0260149_111_1022 302
769 3300048925 Ga0496122_0000169 Ga0496122_0000169_104616_105527 302
770 3300048925 Ga0496122_0005065 Ga0496122_0005065_13507_14418 302
771 3300048925 Ga0496122_0081748 Ga0496122_0081748_503_1414 302
772 3300048925 Ga0496122_0147630 Ga0496122_0147630_34_957 302
773 3300048926 Ga0496123_0001570 Ga0496123_0001570_197_1108 302
774 3300048926 Ga0496123_0015729 Ga0496123_0015729_2621_3532 302
775 3300048926 Ga0496123_0090097 Ga0496123_0090097_131_1042 302
776 3300048927 Ga0496124_0003298 Ga0496124_0003298_18250_19161 302
777 3300048927 Ga0496124_0036446 Ga0496124_0036446_2774_3685 302
778 3300048927 Ga0496124_0061129 Ga0496124_0061129_1988_2899 302
779 3300048928 Ga0496125_0005514 Ga0496125_0005514_6448_7359 302
780 3300048928 Ga0496125_0083230 Ga0496125_0083230_967_1878 302
781 3300049459 Ga0495678_000056 Ga0495678_000056_138427_139338 302
782 3300049459 Ga0495678_001377 Ga0495678_001377_8162_9073 302
783 3300049459 Ga0495678_001405 Ga0495678_001405_9899_10810 302
784 3300049459 Ga0495678_010676 Ga0495678_010676_2603_3514 302
785 3300049459 Ga0495678_028860 Ga0495678_028860_1381_2292 302
786 3300049460 Ga0495682_0001837 Ga0495682_0001837_1591_2502 302
787 3300049460 Ga0495682_0014320 Ga0495682_0014320_484_1395 302
788 3300049571 Ga0501034_0276220 Ga0501034_0276220_657_1568 302
789 3300049667 Ga0501230_004770 Ga0501230_004770_725_1636 302
790 3300049822 Ga0501035_0000681 Ga0501035_0000681_7609_8520 302
791 3300002773 JGI25152J39213_1000440 JGI25152J39213_100044024 303
792 3300002774 JGI25150J39212_1008267 JGI25150J39212_10082672 303
793 3300003354 JGI25160J50197_1001196 JGI25160J50197_10011967 303
794 3300003763 Ga0055529_1000528 Ga0055529_100052813 303
795 3300003771 Ga0055526_1001071 Ga0055526_100107114 303
796 3300003771 Ga0055526_1001617 Ga0055526_100161712 303
797 3300003773 Ga0055537_1000344 Ga0055537_100034415 303
798 3300003775 Ga0055524_1000015 Ga0055524_100001520 303
799 3300003775 Ga0055524_1007464 Ga0055524_10074642 303
800 3300003775 Ga0055524_1008902 Ga0055524_10089025 303
801 3300003784 Ga0055534_1000310 Ga0055534_100031015 303
802 3300003790 Ga0055528_1000124 Ga0055528_100012412 303
803 3300003790 Ga0055528_1001071 Ga0055528_10010714 303
804 3300006946 Ga0079104_1005366 Ga0079104_10053662 303
805 3300006948 Ga0099826_10000003 Ga0099826_10000003390 303
806 3300009093 Ga0105240_10396277 Ga0105240_103962772 303
807 3300015265 Ga0182005_1000018 Ga0182005_100001885 303
808 3300021361 Ga0213872_10000002 Ga0213872_10000002373 303
809 3300021361 Ga0213872_10045948 Ga0213872_100459482 303
810 3300021361 Ga0213872_10137763 Ga0213872_101377631 303
811 3300025208 Ga0209436_100115 Ga0209436_10011518 303
812 3300025245 Ga0207425_1000006 Ga0207425_100000624 303
813 3300025245 Ga0207425_1000105 Ga0207425_10001053 303
814 3300025245 Ga0207425_1000643 Ga0207425_100064313 303
815 3300025258 Ga0209129_1000090 Ga0209129_100009024 303
816 3300025258 Ga0209129_1007993 Ga0209129_10079932 303
817 3300025263 Ga0209565_1000006 Ga0209565_1000006104 303
818 3300025263 Ga0209565_1000701 Ga0209565_10007016 303
819 3300025263 Ga0209565_1006379 Ga0209565_10063793 303
820 3300025272 Ga0209455_1000051 Ga0209455_1000051312 303
821 3300025273 Ga0209673_1000004 Ga0209673_1000004725 303
822 3300025273 Ga0209673_1003116 Ga0209673_10031162 303
823 3300025284 Ga0209130_1001125 Ga0209130_10011258 303
824 3300025291 Ga0209675_1000006 Ga0209675_1000006103 303
825 3300025291 Ga0209675_1000696 Ga0209675_100069617 303
826 3300025294 Ga0209025_1039319 Ga0209025_10393192 303
827 3300025295 Ga0209564_1000006 Ga0209564_1000006301 303
828 3300025295 Ga0209564_1000064 Ga0209564_1000064174 303
829 3300025295 Ga0209564_1012237 Ga0209564_10122373 303
830 3300025297 Ga0209758_1000047 Ga0209758_1000047316 303
831 3300025297 Ga0209758_1002119 Ga0209758_10021198 303
832 3300025298 Ga0209050_1000085 Ga0209050_100008584 303
833 3300025298 Ga0209050_1000607 Ga0209050_100060736 303
834 3300025298 Ga0209050_1013429 Ga0209050_10134293 303
835 3300025299 Ga0209256_1000005 Ga0209256_100000521 303
836 3300025299 Ga0209256_1000080 Ga0209256_1000080111 303
837 3300025299 Ga0209256_1000365 Ga0209256_10003652 303
838 3300025299 Ga0209256_1000423 Ga0209256_100042349 303
839 3300025302 Ga0207426_1000939 Ga0207426_100093915 303
840 3300025303 Ga0209051_1030792 Ga0209051_10307922 303
841 3300025304 Ga0209257_1000010 Ga0209257_1000010807 303
842 3300025728 Ga0207655_1001393 Ga0207655_10013934 303
843 3300027111 Ga0209281_1007150 Ga0209281_10071503 303
844 3300027666 Ga0209282_1000002 Ga0209282_1000002608 303
845 3300030744 Ga0316181_1122411 Ga0316181_11224112 303
846 3300031548 Ga0307408_100007876 Ga0307408_1000078762 303
847 3300031548 Ga0307408_100043196 Ga0307408_1000431963 303
848 3300032002 Ga0307416_100113396 Ga0307416_1001133961 303
849 3300036712 Ga0316584_0028450 Ga0316584_0028450_3069_3986 303
850 3300039447 Ga0436361_0066851 Ga0436361_0066851_16016_16927 303
851 3300039447 Ga0436361_0464259 Ga0436361_0464259_788_1699 303
852 3300039447 Ga0436361_1051860 Ga0436361_1051860_594_1505 303
853 3300046452 Ga0495617_000007 Ga0495617_000007_165149_166072 303
854 3300046453 Ga0495627_000006 Ga0495627_000006_232321_233235 303
855 3300046453 Ga0495627_018958 Ga0495627_018958_405_1328 303
856 3300046457 Ga0495590_0000004 Ga0495590_0000004_164080_164994 303
857 3300046460 Ga0495638_0000023 Ga0495638_0000023_205235_206149 303
858 3300046460 Ga0495638_0001662 Ga0495638_0001662_14374_15291 303
859 3300046460 Ga0495638_0062217 Ga0495638_0062217_712_1626 303
860 3300046460 Ga0495638_0130392 Ga0495638_0130392_511_1434 303
861 3300046463 Ga0495653_0000207 Ga0495653_0000207_45024_45953 303
862 3300046471 Ga0495650_0000769 Ga0495650_0000769_29391_30305 303
863 3300046471 Ga0495650_0001207 Ga0495650_0001207_443_1366 303
864 3300046471 Ga0495650_0003455 Ga0495650_0003455_3342_4256 303
865 3300046474 Ga0495605_0000174 Ga0495605_0000174_75575_76498 303
866 3300046474 Ga0495605_0147499 Ga0495605_0147499_85_1002 303
867 3300046491 Ga0495584_0013554 Ga0495584_0013554_3045_3971 303
868 3300046492 Ga0495585_0005691 Ga0495585_0005691_6231_7154 303
869 3300046492 Ga0495585_0030974 Ga0495585_0030974_455_1372 303
870 3300046492 Ga0495585_0069795 Ga0495585_0069795_608_1525 303
871 3300046501 Ga0495607_0026420 Ga0495607_0026420_97_1011 303
872 3300046506 Ga0495583_0000330 Ga0495583_0000330_4010_4927 303
873 3300046506 Ga0495583_0001091 Ga0495583_0001091_21624_22538 303
874 3300046506 Ga0495583_0041811 Ga0495583_0041811_241_1152 303
875 3300046507 Ga0495606_0000024 Ga0495606_0000024_255055_255981 303
876 3300046507 Ga0495606_0000037 Ga0495606_0000037_15018_15932 303
877 3300046507 Ga0495606_0000146 Ga0495606_0000146_117175_118104 303
878 3300046507 Ga0495606_0009349 Ga0495606_0009349_707_1621 303
879 3300046512 Ga0495610_0000004 Ga0495610_0000004_586722_587645 303
880 3300046512 Ga0495610_0008063 Ga0495610_0008063_3410_4324 303
881 3300046513 Ga0495616_0011906 Ga0495616_0011906_3573_4568 303
882 3300046513 Ga0495616_0064367 Ga0495616_0064367_258_1169 303
883 3300046519 Ga0495632_0069961 Ga0495632_0069961_97_1011 303
884 3300046522 Ga0495643_0000098 Ga0495643_0000098_133394_134308 303
885 3300046522 Ga0495643_0000211 Ga0495643_0000211_783_1697 303
886 3300046522 Ga0495643_0061843 Ga0495643_0061843_902_1816 303
887 3300046523 Ga0495644_0006256 Ga0495644_0006256_3642_4559 303
888 3300046523 Ga0495644_0022412 Ga0495644_0022412_555_1469 303
889 3300046524 Ga0495648_0000877 Ga0495648_0000877_5290_6207 303
890 3300046524 Ga0495648_0031438 Ga0495648_0031438_1111_2025 303
891 3300046524 Ga0495648_0034402 Ga0495648_0034402_345_1268 303
892 3300046525 Ga0495663_0038003 Ga0495663_0038003_60_971 303
893 3300046530 Ga0495654_0044161 Ga0495654_0044161_691_1614 303
894 3300046538 Ga0495609_0001564 Ga0495609_0001564_7107_8024 303
895 3300046538 Ga0495609_0003140 Ga0495609_0003140_3856_4770 303
896 3300046538 Ga0495609_0006038 Ga0495609_0006038_4047_4973 303
897 3300046542 Ga0495597_0000022 Ga0495597_0000022_12764_13678 303
898 3300046542 Ga0495597_0002183 Ga0495597_0002183_2996_3910 303
899 3300046557 Ga0495622_0000003 Ga0495622_0000003_186517_187431 303
900 3300046557 Ga0495622_0000432 Ga0495622_0000432_7829_8743 303
901 3300046558 Ga0495633_0000045 Ga0495633_0000045_96877_97791 303
902 3300046558 Ga0495633_0000449 Ga0495633_0000449_13330_14244 303
903 3300046616 Ga0495668_0000051 Ga0495668_0000051_128696_129622 303
904 3300046616 Ga0495668_0000158 Ga0495668_0000158_32105_33019 303
905 3300046616 Ga0495668_0000205 Ga0495668_0000205_37447_38361 303
906 3300046616 Ga0495668_0002645 Ga0495668_0002645_3609_4532 303
907 3300046616 Ga0495668_0029158 Ga0495668_0029158_88_1014 303
908 3300046660 Ga0495625_0000073 Ga0495625_0000073_148120_149034 303
909 3300046660 Ga0495625_0006264 Ga0495625_0006264_9043_9957 303
910 3300046660 Ga0495625_0011301 Ga0495625_0011301_192_1118 303
911 3300046660 Ga0495625_0097982 Ga0495625_0097982_380_1294 303
912 3300046664 Ga0495659_0007009 Ga0495659_0007009_700_1626 303
913 3300046691 Ga0495670_0010375 Ga0495670_0010375_3504_4421 303
914 3300046692 Ga0495671_0002900 Ga0495671_0002900_723_1646 303
915 3300046692 Ga0495671_0173180 Ga0495671_0173180_91_1017 303
916 3300046694 Ga0495649_0013231 Ga0495649_0013231_1732_2658 303
917 3300046694 Ga0495649_0024659 Ga0495649_0024659_1727_2641 303
918 3300046810 Ga0495660_0012028 Ga0495660_0012028_1162_2085 303
919 3300046810 Ga0495660_0023202 Ga0495660_0023202_877_1791 303
920 3300046810 Ga0495660_0035893 Ga0495660_0035893_782_1696 303
921 3300047318 Ga0495636_0010303 Ga0495636_0010303_1031_1957 303
922 3300047320 Ga0495672_0000588 Ga0495672_0000588_28872_29786 303
923 3300047320 Ga0495672_0095019 Ga0495672_0095019_259_1176 303
924 3300047323 Ga0495683_0027845 Ga0495683_0027845_1652_2569 303
925 3300047443 Ga0495687_000703 Ga0495687_000703_27502_28416 303
926 3300047443 Ga0495687_001553 Ga0495687_001553_2005_2919 303
927 3300047447 Ga0495685_000314 Ga0495685_000314_1239_2156 303
928 3300047447 Ga0495685_036536 Ga0495685_036536_200_1126 303
929 3300047469 Ga0495673_0000017 Ga0495673_0000017_259502_260425 303
930 3300047469 Ga0495673_0000027 Ga0495673_0000027_78566_79492 303
931 3300047469 Ga0495673_0040655 Ga0495673_0040655_292_1209 303
932 3300047470 Ga0495681_0067172 Ga0495681_0067172_316_1230 303
933 3300047472 Ga0495686_0002027 Ga0495686_0002027_17010_17921 303
934 3300047472 Ga0495686_0002626 Ga0495686_0002626_12193_13107 303
935 3300047472 Ga0495686_0061230 Ga0495686_0061230_409_1323 303
936 3300047472 Ga0495686_0108909 Ga0495686_0108909_656_1579 303
937 3300048903 Ga0496100_0066685 Ga0496100_0066685_1410_2321 303
938 3300048924 Ga0496121_0088460 Ga0496121_0088460_697_1611 303
939 3300048925 Ga0496122_0043701 Ga0496122_0043701_620_1543 303
940 3300048927 Ga0496124_0120874 Ga0496124_0120874_794_1708 303
941 3300048929 Ga0496126_0011339 Ga0496126_0011339_7631_8557 303
942 3300049459 Ga0495678_000445 Ga0495678_000445_11383_12297 303
943 3300049459 Ga0495678_001532 Ga0495678_001532_14427_15341 303
944 3300049459 Ga0495678_009979 Ga0495678_009979_3648_4565 303
945 3300049569 Ga0501032_0042640 Ga0501032_0042640_624_1568 303
946 3300049570 Ga0501033_0000310 Ga0501033_0000310_7415_8359 303
947 3300049580 Ga0501046_0001350 Ga0501046_0001350_22363_23307 303
948 3300049581 Ga0501047_0060157 Ga0501047_0060157_1523_2467 303
949 3300049581 Ga0501047_0168356 Ga0501047_0168356_952_1869 303
950 3300049582 Ga0501048_0087851 Ga0501048_0087851_57_1001 303
951 3300049586 Ga0501070_0152393 Ga0501070_0152393_581_1525 303
952 3300049671 Ga0501238_009067 Ga0501238_009067_151_1065 303
953 3300049679 Ga0501249_005296 Ga0501249_005296_687_1601 303
954 3300049742 Ga0501080_0247908 Ga0501080_0247908_76_1020 303
955 3300049766 Ga0501269_001829 Ga0501269_001829_1077_1991 303
956 3300049823 Ga0501044_0018545 Ga0501044_0018545_3010_3954 303
957 3300050489 nmdc:mga03683_5929_c2 nmdc:mga03683_5929_c2_408_1322 303
958 iso_pu_bacteria 2919476304 2919481036 303

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01218

Coprogen_oxidas

Coproporphyrinogen III oxidase

5

288

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8t7w-assembly1.cif.gz_A crystal structure of oxygen-dependent coproporphyrinogen-iii oxidase (hemf) from klebsiella aerogenes 0.9809 4 300
2qt8-assembly1.cif.gz_A coproporphyrinogen iii oxidase from leishmania major 0.9803 7 300
1vju-assembly1.cif.gz_A coproporphyrinogen iii oxidase from leishmania major 0.9778 7 300
3ejo-assembly1.cif.gz_A coproporphyrinogen iii oxidase from leishmania donovani 0.9777 7 300
3dwr-assembly1.cif.gz_B leishmania major coproporphyrinogen iii oxidase with bound ligand 0.977 7 300
ID Description Score Start End Superfamily
3dwsA00 Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic 0.9768 7 300 3.40.1500.10
3dwsA00 Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic 0.9541 7 300 3.40.1500.10
af_Q7XPL2_53_398_3.40.1500.10 Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic 0.9446 1 301 3.40.1500.10
af_Q7XPL2_53_398_3.40.1500.10 Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic 0.9355 1 301 3.40.1500.10
af_Q9UTE2_2_312_3.40.1500.10 Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic 0.9328 1 300 3.40.1500.10
ID Description Score Start End GO Terms
AF-A0A3B9PMB0-F1-model_v4 coproporphyrinogen oxidase (EC 1.3.3.3) 0.9925 4 107 GO:0004109
GO:0005737
GO:0006782
AF-A0A4V5RJJ9-F1-model_v4 coproporphyrinogen oxidase (EC 1.3.3.3) 0.9898 131 251 GO:0004109
GO:0005737
GO:0006782
AF-A0A523GL91-F1-model_v4 Oxygen-dependent coproporphyrinogen-III oxidase (CPO) (Coprogen oxidase) (Coproporphyrinogenase) (EC 1.3.3.3) 0.9873 4 300 GO:0004109
GO:0005737
GO:0006782
GO:0042803
GO:0046872
AF-A0A837WWI8-F1-model_v4 deleted 0.9862 4 116
AF-A0A2S5NPS2-F1-model_v4 coproporphyrinogen oxidase (EC 1.3.3.3) 0.9852 3 263 GO:0004109
GO:0005737
GO:0006782

Feature Viewer

pLDDT pTM Quality
90.85 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map