F486798
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 958 | 365 | 923 | 304 |
Family's Representative Sequence
| Representative Sequence | 3300032133|Ga0316583_10001730|Ga0316583_100017302 |
| Length | 295 |
| Sequence | MDPAQVRSYLSGLQEKIVTTLEAFDGKAFRRNDWSRGTALVIEDGEFFERGGVNFSHVTGDNLPASATAHRPELAGRSWEAMGVSLVLHPRNPYCPTSHMNVRFFVATRPGEEPIWWFGGGMDLTPYYGFVEDCVHFHRTCRNALAPFGDDVHPRYKQWCDEYFFLKHRQEPRGIGGIFFDDLNERCFALVRSVGNAFTEAYLPICERRRNLPYGERERDFQAYRRGRYVEFNLVWDRGTLFGLQSGGRTEAILMSLPPIVKWRYDWHPEPGSAEEKLYTDFLPPRDWLVAITPD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 2 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 3 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 4 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 5 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 6 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 7 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 8 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 9 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 10 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 11 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 12 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 13 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 14 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 15 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 16 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 17 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 18 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 19 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 20 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 21 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 22 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 23 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 24 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 25 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 26 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 27 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 28 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 29 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 30 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 31 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 32 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 33 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 34 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 35 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 36 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 37 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 38 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 39 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 40 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 41 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 42 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 43 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 44 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 45 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 46 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 47 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 48 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 52 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 54 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 63 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 73 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 79 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 86 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 87 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 88 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 89 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 90 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 91 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 92 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 100 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 101 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 127 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 193 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 197 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 202 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 203 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 204 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 205 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 206 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 207 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 208 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 209 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 210 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 214 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 215 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 216 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 217 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 218 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 220 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 221 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 222 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 223 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 224 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 225 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 226 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 227 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 228 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 229 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 230 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 231 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 232 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 233 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 234 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 235 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 236 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 237 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 238 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 239 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 240 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 241 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 242 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 243 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 244 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 245 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 330 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 331 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 332 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 333 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 334 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 337 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 338 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 339 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 340 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 341 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 342 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 343 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 344 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 345 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 346 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 347 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 348 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 358 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 359 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 360 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 362 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 365 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.24 |
| Metatranscriptomes | 0.1 |
| Isolates | 3.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.85 |
| Nodule | 0.42 |
| Rhizoplane | 3.65 |
| Rhizosphere | 84.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1000440 | 3300002773 | Bacteria | 24791 |
| 2 | JGI25150J39212_1008267 | 3300002774 | Bacteria | 2046 |
| 3 | JGI25159J45721_1004567 | 3300002987 | Bacteria | 4558 |
| 4 | rootL2_10009396 | 3300003322 | Bacteria | 11472 |
| 5 | JGI25160J50197_1001196 | 3300003354 | Bacteria | 13190 |
| 6 | Ga0055525_1000009 | 3300003759 | Bacteria | 596899 |
| 7 | Ga0055529_1000528 | 3300003763 | Bacteria | 33027 |
| 8 | Ga0055526_1000031 | 3300003771 | Bacteria | 143136 |
| 9 | Ga0055526_1000353 | 3300003771 | Bacteria | 37277 |
| 10 | Ga0055526_1001071 | 3300003771 | Bacteria | 19995 |
| 11 | Ga0055526_1001617 | 3300003771 | Bacteria | 15820 |
| 12 | Ga0055537_1000344 | 3300003773 | Bacteria | 31620 |
| 13 | Ga0055524_1000015 | 3300003775 | Bacteria | 246493 |
| 14 | Ga0055524_1007464 | 3300003775 | Bacteria | 4638 |
| 15 | Ga0055524_1008902 | 3300003775 | Bacteria | 4132 |
| 16 | Ga0055534_1000310 | 3300003784 | Bacteria | 32619 |
| 17 | Ga0055528_1000124 | 3300003790 | Bacteria | 61627 |
| 18 | Ga0055528_1001071 | 3300003790 | Bacteria | 18031 |
| 19 | Ga0065165_1000050 | 3300005262 | Bacteria | 195237 |
| 20 | Ga0065165_1005080 | 3300005262 | Bacteria | 7647 |
| 21 | Ga0065165_1017345 | 3300005262 | Bacteria | 2657 |
| 22 | Ga0070658_10177107 | 3300005327 | Bacteria | 1794 |
| 23 | Ga0070676_10001315 | 3300005328 | Bacteria | 12480 |
| 24 | Ga0070676_10133772 | 3300005328 | Bacteria | 1571 |
| 25 | Ga0070690_100020510 | 3300005330 | Bacteria | 4027 |
| 26 | Ga0068869_100001107 | 3300005334 | Bacteria | 15702 |
| 27 | Ga0068869_100037903 | 3300005334 | Bacteria | 3430 |
| 28 | Ga0068869_100363850 | 3300005334 | Bacteria | 1182 |
| 29 | Ga0070666_10001383 | 3300005335 | Bacteria | 14685 |
| 30 | Ga0070666_10032555 | 3300005335 | Bacteria | 3444 |
| 31 | Ga0068868_100000331 | 3300005338 | Bacteria | 31871 |
| 32 | Ga0068868_100006875 | 3300005338 | Bacteria | 8080 |
| 33 | Ga0068868_100082789 | 3300005338 | Bacteria | 2574 |
| 34 | Ga0070660_100050275 | 3300005339 | Bacteria | 3207 |
| 35 | Ga0070660_100282411 | 3300005339 | Bacteria | 1359 |
| 36 | Ga0070660_100319704 | 3300005339 | Bacteria | 1275 |
| 37 | Ga0070689_100005627 | 3300005340 | Bacteria | 8581 |
| 38 | Ga0070689_100092781 | 3300005340 | Bacteria | 2382 |
| 39 | Ga0070668_100001693 | 3300005347 | Bacteria | 15990 |
| 40 | Ga0070668_100206874 | 3300005347 | Bacteria | 1613 |
| 41 | Ga0070668_100235032 | 3300005347 | Bacteria | 1517 |
| 42 | Ga0070669_100003085 | 3300005353 | Bacteria | 11995 |
| 43 | Ga0070669_100198677 | 3300005353 | Bacteria | 1577 |
| 44 | Ga0070675_100002186 | 3300005354 | Bacteria | 14494 |
| 45 | Ga0070671_100007917 | 3300005355 | Bacteria | 8499 |
| 46 | Ga0070671_100020363 | 3300005355 | Bacteria | 5408 |
| 47 | Ga0070671_100064393 | 3300005355 | Bacteria | 3053 |
| 48 | Ga0070674_100043797 | 3300005356 | Bacteria | 3047 |
| 49 | Ga0070674_100148059 | 3300005356 | Bacteria | 1769 |
| 50 | Ga0070673_100060014 | 3300005364 | Bacteria | 3012 |
| 51 | Ga0070688_100006552 | 3300005365 | Bacteria | 6229 |
| 52 | Ga0070688_100009264 | 3300005365 | Bacteria | 5376 |
| 53 | Ga0070659_100038837 | 3300005366 | Bacteria | 3714 |
| 54 | Ga0070667_100005247 | 3300005367 | Bacteria | 10834 |
| 55 | Ga0070667_100023680 | 3300005367 | Bacteria | 5097 |
| 56 | Ga0070714_100067850 | 3300005435 | Bacteria | 3077 |
| 57 | Ga0070713_100016566 | 3300005436 | Bacteria | 5543 |
| 58 | Ga0070701_10017080 | 3300005438 | Bacteria | 3387 |
| 59 | Ga0070711_100004558 | 3300005439 | Bacteria | 8197 |
| 60 | Ga0070663_100087510 | 3300005455 | Bacteria | 2303 |
| 61 | Ga0070678_100000798 | 3300005456 | Bacteria | 15850 |
| 62 | Ga0070678_100109488 | 3300005456 | Bacteria | 2158 |
| 63 | Ga0070662_100023990 | 3300005457 | Bacteria | 4197 |
| 64 | Ga0068867_100007157 | 3300005459 | Bacteria | 7885 |
| 65 | Ga0070685_10014464 | 3300005466 | Bacteria | 4180 |
| 66 | Ga0070685_10266534 | 3300005466 | Bacteria | 1141 |
| 67 | Ga0068853_100095955 | 3300005539 | Bacteria | 2616 |
| 68 | Ga0070672_100001410 | 3300005543 | Bacteria | 14847 |
| 69 | Ga0070693_100039090 | 3300005547 | Bacteria | 2656 |
| 70 | Ga0070665_100038140 | 3300005548 | Bacteria | 4830 |
| 71 | Ga0070665_100065246 | 3300005548 | Bacteria | 3652 |
| 72 | Ga0070665_100219112 | 3300005548 | Bacteria | 1903 |
| 73 | Ga0068855_100256773 | 3300005563 | Bacteria | 1948 |
| 74 | Ga0070664_100056056 | 3300005564 | Bacteria | 3348 |
| 75 | Ga0070664_100170171 | 3300005564 | Bacteria | 1932 |
| 76 | Ga0070664_100239926 | 3300005564 | Bacteria | 1627 |
| 77 | Ga0068854_100006043 | 3300005578 | Bacteria | 7672 |
| 78 | Ga0068856_100172908 | 3300005614 | Bacteria | 2172 |
| 79 | Ga0068852_100129539 | 3300005616 | Bacteria | 2321 |
| 80 | Ga0068852_100548403 | 3300005616 | Bacteria | 1156 |
| 81 | Ga0068859_100002774 | 3300005617 | Bacteria | 17745 |
| 82 | Ga0068859_100034777 | 3300005617 | Bacteria | 5057 |
| 83 | Ga0068859_100185696 | 3300005617 | Bacteria | 2163 |
| 84 | Ga0068864_100009230 | 3300005618 | Bacteria | 8134 |
| 85 | Ga0068861_100036870 | 3300005719 | Bacteria | 3632 |
| 86 | Ga0068861_100186646 | 3300005719 | Bacteria | 1730 |
| 87 | Ga0068851_10060445 | 3300005834 | Bacteria | 1940 |
| 88 | Ga0068863_100000926 | 3300005841 | Bacteria | 29444 |
| 89 | Ga0068858_100003386 | 3300005842 | Bacteria | 15868 |
| 90 | Ga0068858_100007106 | 3300005842 | Bacteria | 10866 |
| 91 | Ga0068858_100051445 | 3300005842 | Bacteria | 3811 |
| 92 | Ga0068860_100001199 | 3300005843 | Bacteria | 28279 |
| 93 | Ga0068860_100092271 | 3300005843 | Bacteria | 2885 |
| 94 | Ga0068860_100219055 | 3300005843 | Bacteria | 1848 |
| 95 | Ga0068862_100067366 | 3300005844 | Bacteria | 3086 |
| 96 | Ga0068862_100597577 | 3300005844 | Bacteria | 1059 |
| 97 | Ga0081539_10026170 | 3300005985 | Bacteria | 3733 |
| 98 | Ga0070715_10036954 | 3300006163 | Bacteria | 2018 |
| 99 | Ga0070716_100014032 | 3300006173 | Bacteria | 4098 |
| 100 | Ga0070712_100009811 | 3300006175 | Bacteria | 6032 |
| 101 | Ga0097621_100001144 | 3300006237 | Bacteria | 18429 |
| 102 | Ga0068871_100007416 | 3300006358 | Bacteria | 7834 |
| 103 | Ga0068865_100009861 | 3300006881 | Bacteria | 5934 |
| 104 | Ga0097620_100002773 | 3300006931 | Bacteria | 17745 |
| 105 | Ga0097620_100034777 | 3300006931 | Bacteria | 5057 |
| 106 | Ga0097620_100185700 | 3300006931 | Bacteria | 2163 |
| 107 | Ga0079104_1005366 | 3300006946 | Bacteria | 5142 |
| 108 | Ga0099826_10000003 | 3300006948 | Bacteria | 1067817 |
| 109 | Ga0105244_10005513 | 3300009036 | Bacteria | 8398 |
| 110 | Ga0105240_10080810 | 3300009093 | Bacteria | 3997 |
| 111 | Ga0105240_10396277 | 3300009093 | Bacteria | 1556 |
| 112 | Ga0105245_10027376 | 3300009098 | Bacteria | 5022 |
| 113 | Ga0105247_10052307 | 3300009101 | Bacteria | 2518 |
| 114 | Ga0105243_10150580 | 3300009148 | Bacteria | 1995 |
| 115 | Ga0105243_10358876 | 3300009148 | Bacteria | 1341 |
| 116 | Ga0105241_10003069 | 3300009174 | Bacteria | 12453 |
| 117 | Ga0105241_10118217 | 3300009174 | Bacteria | 2131 |
| 118 | Ga0105242_10042701 | 3300009176 | Bacteria | 3664 |
| 119 | Ga0105248_10002137 | 3300009177 | Bacteria | 21876 |
| 120 | Ga0105248_10032029 | 3300009177 | Bacteria | 5874 |
| 121 | Ga0105237_10014808 | 3300009545 | Bacteria | 8139 |
| 122 | Ga0105238_10000128 | 3300009551 | Bacteria | 83216 |
| 123 | Ga0105238_10552830 | 3300009551 | Bacteria | 1156 |
| 124 | Ga0105249_10134945 | 3300009553 | Bacteria | 2360 |
| 125 | Ga0105239_10035925 | 3300010375 | Bacteria | 5440 |
| 126 | Ga0105239_10153799 | 3300010375 | Bacteria | 2568 |
| 127 | Ga0105246_10039783 | 3300011119 | Bacteria | 3170 |
| 128 | Ga0157371_10000001 | 3300013102 | Bacteria | 1162285 |
| 129 | Ga0157374_10001563 | 3300013296 | Bacteria | 19265 |
| 130 | Ga0157374_10033572 | 3300013296 | Bacteria | 4682 |
| 131 | Ga0157374_10175314 | 3300013296 | Bacteria | 2093 |
| 132 | Ga0157378_10010780 | 3300013297 | Bacteria | 7990 |
| 133 | Ga0157378_10136997 | 3300013297 | Bacteria | 2270 |
| 134 | Ga0157378_10166752 | 3300013297 | Bacteria | 2063 |
| 135 | Ga0157378_10200105 | 3300013297 | Bacteria | 1889 |
| 136 | Ga0163162_10065966 | 3300013306 | Bacteria | 3668 |
| 137 | Ga0157375_10001643 | 3300013308 | Bacteria | 19224 |
| 138 | Ga0157375_10003068 | 3300013308 | Bacteria | 14496 |
| 139 | Ga0157375_10077954 | 3300013308 | Bacteria | 3345 |
| 140 | Ga0163163_10015755 | 3300014325 | Bacteria | 7000 |
| 141 | Ga0163163_10466826 | 3300014325 | Bacteria | 1323 |
| 142 | Ga0157380_10226632 | 3300014326 | Bacteria | 1676 |
| 143 | Ga0157379_10002346 | 3300014968 | Bacteria | 15798 |
| 144 | Ga0157379_10002957 | 3300014968 | Bacteria | 14333 |
| 145 | Ga0157376_10557923 | 3300014969 | Bacteria | 1134 |
| 146 | Ga0182006_1032933 | 3300015261 | Bacteria | 2080 |
| 147 | Ga0182005_1000018 | 3300015265 | Bacteria | 324307 |
| 148 | Ga0163161_10080900 | 3300017792 | Bacteria | 2391 |
| 149 | Ga0213872_10000002 | 3300021361 | Bacteria | 554092 |
| 150 | Ga0213872_10000445 | 3300021361 | Bacteria | 33820 |
| 151 | Ga0213872_10014137 | 3300021361 | Bacteria | 3727 |
| 152 | Ga0213872_10045948 | 3300021361 | Bacteria | 1987 |
| 153 | Ga0213872_10137763 | 3300021361 | Bacteria | 1072 |
| 154 | Ga0209436_100115 | 3300025208 | Bacteria | 39587 |
| 155 | Ga0209563_100015 | 3300025230 | Bacteria | 879901 |
| 156 | Ga0207425_1000006 | 3300025245 | Bacteria | 808854 |
| 157 | Ga0207425_1000105 | 3300025245 | Bacteria | 78746 |
| 158 | Ga0207425_1000643 | 3300025245 | Bacteria | 19543 |
| 159 | Ga0209148_1000298 | 3300025254 | Bacteria | 72028 |
| 160 | Ga0209129_1000090 | 3300025258 | Bacteria | 175755 |
| 161 | Ga0209129_1007993 | 3300025258 | Bacteria | 3021 |
| 162 | Ga0209565_1000006 | 3300025263 | Bacteria | 897294 |
| 163 | Ga0209565_1000701 | 3300025263 | Bacteria | 20606 |
| 164 | Ga0209565_1006379 | 3300025263 | Bacteria | 3315 |
| 165 | Ga0209455_1000051 | 3300025272 | Bacteria | 369818 |
| 166 | Ga0209673_1000004 | 3300025273 | Bacteria | 896155 |
| 167 | Ga0209673_1003116 | 3300025273 | Bacteria | 10150 |
| 168 | Ga0209130_1000065 | 3300025284 | Bacteria | 195251 |
| 169 | Ga0209130_1001125 | 3300025284 | Bacteria | 19650 |
| 170 | Ga0209675_1000006 | 3300025291 | Bacteria | 732267 |
| 171 | Ga0209675_1000696 | 3300025291 | Bacteria | 23334 |
| 172 | Ga0209025_1039319 | 3300025294 | Bacteria | 2065 |
| 173 | Ga0209564_1000006 | 3300025295 | Bacteria | 1100927 |
| 174 | Ga0209564_1000038 | 3300025295 | Bacteria | 414357 |
| 175 | Ga0209564_1000064 | 3300025295 | Bacteria | 316431 |
| 176 | Ga0209564_1012237 | 3300025295 | Bacteria | 3759 |
| 177 | Ga0209758_1000047 | 3300025297 | Bacteria | 360971 |
| 178 | Ga0209758_1002119 | 3300025297 | Bacteria | 20944 |
| 179 | Ga0209050_1000085 | 3300025298 | Bacteria | 263219 |
| 180 | Ga0209050_1000607 | 3300025298 | Bacteria | 56864 |
| 181 | Ga0209050_1013429 | 3300025298 | Bacteria | 3636 |
| 182 | Ga0209256_1000005 | 3300025299 | Bacteria | 1315082 |
| 183 | Ga0209256_1000080 | 3300025299 | Bacteria | 224592 |
| 184 | Ga0209256_1000365 | 3300025299 | Bacteria | 72787 |
| 185 | Ga0209256_1000423 | 3300025299 | Bacteria | 66412 |
| 186 | Ga0207426_1000939 | 3300025302 | Bacteria | 28944 |
| 187 | Ga0209051_1030792 | 3300025303 | Bacteria | 2077 |
| 188 | Ga0209257_1000010 | 3300025304 | Bacteria | 1158682 |
| 189 | Ga0207697_10008739 | 3300025315 | Bacteria | 4411 |
| 190 | Ga0207655_1001393 | 3300025728 | Bacteria | 22568 |
| 191 | Ga0207655_1005668 | 3300025728 | Bacteria | 8444 |
| 192 | Ga0207682_10010099 | 3300025893 | Bacteria | 3707 |
| 193 | Ga0207692_10034351 | 3300025898 | Bacteria | 2454 |
| 194 | Ga0207680_10001994 | 3300025903 | Bacteria | 9564 |
| 195 | Ga0207680_10008458 | 3300025903 | Bacteria | 5053 |
| 196 | Ga0207645_10000241 | 3300025907 | Bacteria | 45331 |
| 197 | Ga0207643_10014852 | 3300025908 | Bacteria | 4235 |
| 198 | Ga0207705_10090074 | 3300025909 | Bacteria | 2245 |
| 199 | Ga0207705_10297130 | 3300025909 | Bacteria | 1238 |
| 200 | Ga0207654_10001747 | 3300025911 | Bacteria | 11288 |
| 201 | Ga0207654_10083523 | 3300025911 | Bacteria | 1929 |
| 202 | Ga0207695_10002390 | 3300025913 | Bacteria | 27827 |
| 203 | Ga0207695_10126941 | 3300025913 | Bacteria | 2512 |
| 204 | Ga0207671_10017201 | 3300025914 | Bacteria | 5585 |
| 205 | Ga0207671_10188751 | 3300025914 | Bacteria | 1606 |
| 206 | Ga0207671_10375100 | 3300025914 | Bacteria | 1130 |
| 207 | Ga0207693_10001075 | 3300025915 | Bacteria | 24500 |
| 208 | Ga0207663_10096916 | 3300025916 | Bacteria | 1971 |
| 209 | Ga0207657_10040736 | 3300025919 | Bacteria | 4113 |
| 210 | Ga0207657_10155290 | 3300025919 | Bacteria | 1861 |
| 211 | Ga0207681_10000854 | 3300025923 | Bacteria | 20032 |
| 212 | Ga0207681_10191714 | 3300025923 | Bacteria | 1564 |
| 213 | Ga0207694_10000845 | 3300025924 | Bacteria | 27248 |
| 214 | Ga0207694_10077396 | 3300025924 | Bacteria | 2606 |
| 215 | Ga0207650_10136839 | 3300025925 | Bacteria | 1922 |
| 216 | Ga0207659_10000360 | 3300025926 | Bacteria | 27263 |
| 217 | Ga0207687_10006368 | 3300025927 | Bacteria | 7801 |
| 218 | Ga0207687_10151995 | 3300025927 | Bacteria | 1767 |
| 219 | Ga0207700_10110504 | 3300025928 | Bacteria | 2211 |
| 220 | Ga0207644_10001134 | 3300025931 | Bacteria | 17065 |
| 221 | Ga0207644_10007005 | 3300025931 | Bacteria | 7342 |
| 222 | Ga0207644_10019257 | 3300025931 | Bacteria | 4627 |
| 223 | Ga0207690_10301835 | 3300025932 | Bacteria | 1253 |
| 224 | Ga0207706_10010737 | 3300025933 | Bacteria | 8363 |
| 225 | Ga0207706_10061898 | 3300025933 | Bacteria | 3296 |
| 226 | Ga0207686_10001787 | 3300025934 | Bacteria | 11972 |
| 227 | Ga0207686_10002503 | 3300025934 | Bacteria | 9979 |
| 228 | Ga0207686_10006141 | 3300025934 | Bacteria | 6455 |
| 229 | Ga0207709_10008577 | 3300025935 | Bacteria | 5647 |
| 230 | Ga0207670_10030426 | 3300025936 | Bacteria | 3449 |
| 231 | Ga0207670_10239855 | 3300025936 | Bacteria | 1396 |
| 232 | Ga0207669_10021494 | 3300025937 | Bacteria | 3408 |
| 233 | Ga0207669_10049715 | 3300025937 | Bacteria | 2501 |
| 234 | Ga0207704_10001298 | 3300025938 | Bacteria | 11172 |
| 235 | Ga0207691_10000368 | 3300025940 | Bacteria | 45434 |
| 236 | Ga0207691_10005465 | 3300025940 | Bacteria | 12269 |
| 237 | Ga0207691_10128155 | 3300025940 | Bacteria | 2244 |
| 238 | Ga0207711_10002097 | 3300025941 | Bacteria | 18006 |
| 239 | Ga0207711_10007086 | 3300025941 | Bacteria | 9397 |
| 240 | Ga0207689_10008074 | 3300025942 | Bacteria | 9180 |
| 241 | Ga0207679_10160074 | 3300025945 | Bacteria | 1842 |
| 242 | Ga0207667_10015504 | 3300025949 | Bacteria | 8649 |
| 243 | Ga0207667_10021146 | 3300025949 | Bacteria | 7215 |
| 244 | Ga0207651_10008735 | 3300025960 | Bacteria | 5494 |
| 245 | Ga0207712_10126994 | 3300025961 | Bacteria | 1937 |
| 246 | Ga0207668_10001355 | 3300025972 | Bacteria | 14490 |
| 247 | Ga0207668_10028645 | 3300025972 | Bacteria | 3644 |
| 248 | Ga0207668_10236949 | 3300025972 | Bacteria | 1474 |
| 249 | Ga0207658_10001026 | 3300025986 | Bacteria | 22730 |
| 250 | Ga0207658_10021933 | 3300025986 | Bacteria | 4440 |
| 251 | Ga0207658_10249656 | 3300025986 | Bacteria | 1507 |
| 252 | Ga0207677_10000445 | 3300026023 | Bacteria | 28010 |
| 253 | Ga0207677_10000770 | 3300026023 | Bacteria | 18440 |
| 254 | Ga0207703_10002365 | 3300026035 | Bacteria | 16410 |
| 255 | Ga0207703_10004139 | 3300026035 | Bacteria | 11964 |
| 256 | Ga0207703_10142257 | 3300026035 | Bacteria | 2083 |
| 257 | Ga0207703_10243699 | 3300026035 | Bacteria | 1617 |
| 258 | Ga0207639_10075092 | 3300026041 | Bacteria | 2657 |
| 259 | Ga0207639_10271506 | 3300026041 | Bacteria | 1488 |
| 260 | Ga0207678_10003137 | 3300026067 | Bacteria | 14957 |
| 261 | Ga0207678_10375439 | 3300026067 | Bacteria | 1229 |
| 262 | Ga0207702_10118852 | 3300026078 | Bacteria | 2362 |
| 263 | Ga0207641_10000735 | 3300026088 | Bacteria | 35180 |
| 264 | Ga0207648_10000089 | 3300026089 | Bacteria | 86359 |
| 265 | Ga0207648_10005123 | 3300026089 | Bacteria | 13277 |
| 266 | Ga0207648_10065744 | 3300026089 | Bacteria | 3162 |
| 267 | Ga0207676_10024266 | 3300026095 | Bacteria | 4485 |
| 268 | Ga0207676_10040388 | 3300026095 | Bacteria | 3575 |
| 269 | Ga0207683_10000325 | 3300026121 | Bacteria | 43393 |
| 270 | Ga0207683_10017560 | 3300026121 | Bacteria | 6100 |
| 271 | Ga0207698_10551847 | 3300026142 | Bacteria | 1129 |
| 272 | Ga0207698_10610796 | 3300026142 | Bacteria | 1076 |
| 273 | Ga0209281_1007150 | 3300027111 | Bacteria | 2821 |
| 274 | Ga0209969_1002384 | 3300027360 | Bacteria | 2597 |
| 275 | Ga0209967_1002888 | 3300027364 | Bacteria | 2247 |
| 276 | Ga0209995_1001642 | 3300027471 | Bacteria | 3474 |
| 277 | Ga0209282_1000002 | 3300027666 | Bacteria | 1067825 |
| 278 | Ga0209974_10011016 | 3300027876 | Bacteria | 3044 |
| 279 | Ga0268266_10049672 | 3300028379 | Bacteria | 3598 |
| 280 | Ga0268266_10084049 | 3300028379 | Bacteria | 2779 |
| 281 | Ga0268266_10310808 | 3300028379 | Bacteria | 1473 |
| 282 | Ga0268265_10030585 | 3300028380 | Bacteria | 3880 |
| 283 | Ga0268264_10007381 | 3300028381 | Bacteria | 9182 |
| 284 | Ga0268264_10032054 | 3300028381 | Bacteria | 4312 |
| 285 | Ga0268264_10218693 | 3300028381 | Bacteria | 1753 |
| 286 | Ga0316181_1122411 | 3300030744 | Bacteria | 1727 |
| 287 | Ga0265316_10082703 | 3300031344 | Bacteria | 2460 |
| 288 | Ga0307408_100007876 | 3300031548 | Bacteria | 7044 |
| 289 | Ga0307408_100043196 | 3300031548 | Bacteria | 3206 |
| 290 | Ga0307508_10015009 | 3300031616 | Bacteria | 7062 |
| 291 | Ga0316575_10005640 | 3300031665 | Bacteria | 4467 |
| 292 | Ga0316576_10022273 | 3300031727 | Bacteria | 4398 |
| 293 | Ga0307518_10143660 | 3300031838 | Bacteria | 1660 |
| 294 | Ga0307416_100113396 | 3300032002 | Bacteria | 2395 |
| 295 | Ga0316583_10001730 | 3300032133 | Bacteria | 7412 |
| 296 | Ga0316593_10003127 | 3300032168 | Bacteria | 4059 |
| 297 | Ga0373953_0002218 | 3300035117 | Bacteria | 5828 |
| 298 | Ga0373956_0072839 | 3300035119 | Bacteria | 1569 |
| 299 | Ga0373956_0087898 | 3300035119 | Bacteria | 1432 |
| 300 | Ga0373946_0175447 | 3300035171 | Bacteria | 1014 |
| 301 | Ga0316574_0004167 | 3300035398 | Bacteria | 7536 |
| 302 | Ga0373931_0126268 | 3300035691 | Bacteria | 1467 |
| 303 | Ga0373927_0031043 | 3300035695 | Bacteria | 3485 |
| 304 | Ga0373933_0018138 | 3300035724 | Bacteria | 3954 |
| 305 | Ga0373937_0041306 | 3300036401 | Bacteria | 4206 |
| 306 | Ga0316582_0038410 | 3300036647 | Bacteria | 2975 |
| 307 | Ga0316584_0028450 | 3300036712 | Bacteria | 4122 |
| 308 | Ga0395899_0000141 | 3300037312 | Bacteria | 109773 |
| 309 | Ga0395899_0004028 | 3300037312 | Bacteria | 11586 |
| 310 | Ga0395899_0010706 | 3300037312 | Bacteria | 7029 |
| 311 | Ga0395899_0023526 | 3300037312 | Bacteria | 4664 |
| 312 | Ga0395899_0067119 | 3300037312 | Bacteria | 2632 |
| 313 | Ga0395900_0000931 | 3300037418 | Bacteria | 38293 |
| 314 | Ga0395900_0010308 | 3300037418 | Bacteria | 9562 |
| 315 | Ga0395900_0017608 | 3300037418 | Bacteria | 7291 |
| 316 | Ga0395900_0025668 | 3300037418 | Bacteria | 6031 |
| 317 | Ga0395900_0026208 | 3300037418 | Bacteria | 5969 |
| 318 | Ga0395900_0059676 | 3300037418 | Bacteria | 3927 |
| 319 | Ga0395900_0072612 | 3300037418 | Bacteria | 3537 |
| 320 | Ga0395900_0092912 | 3300037418 | Bacteria | 3099 |
| 321 | Ga0395900_0115884 | 3300037418 | Bacteria | 2749 |
| 322 | Ga0395900_0188808 | 3300037418 | Bacteria | 2091 |
| 323 | Ga0395900_0364293 | 3300037418 | Bacteria | 1416 |
| 324 | Ga0395900_0394428 | 3300037418 | Bacteria | 1349 |
| 325 | Ga0395898_0019806 | 3300037466 | Bacteria | 6842 |
| 326 | Ga0395898_0053522 | 3300037466 | Bacteria | 3942 |
| 327 | Ga0395898_0090996 | 3300037466 | Bacteria | 2935 |
| 328 | Ga0395898_0140183 | 3300037466 | Bacteria | 2315 |
| 329 | Ga0395898_0223464 | 3300037466 | Bacteria | 1796 |
| 330 | Ga0395905_0022278 | 3300037471 | Bacteria | 5994 |
| 331 | Ga0395905_0075356 | 3300037471 | Bacteria | 3162 |
| 332 | Ga0395905_0077736 | 3300037471 | Bacteria | 3109 |
| 333 | Ga0395905_0145899 | 3300037471 | Bacteria | 2226 |
| 334 | Ga0395905_0154759 | 3300037471 | Bacteria | 2156 |
| 335 | Ga0395901_0000073 | 3300038443 | Bacteria | 139769 |
| 336 | Ga0395901_0011675 | 3300038443 | Bacteria | 8899 |
| 337 | Ga0395901_0027144 | 3300038443 | Bacteria | 5881 |
| 338 | Ga0395901_0118509 | 3300038443 | Bacteria | 2781 |
| 339 | Ga0395901_0124851 | 3300038443 | Bacteria | 2704 |
| 340 | Ga0436361_0009247 | 3300039447 | Bacteria | 10517 |
| 341 | Ga0436361_0066851 | 3300039447 | Bacteria | 36436 |
| 342 | Ga0436361_0464259 | 3300039447 | Bacteria | 1817 |
| 343 | Ga0436361_0723519 | 3300039447 | Bacteria | 39014 |
| 344 | Ga0436361_1051860 | 3300039447 | Bacteria | 1520 |
| 345 | Ga0436361_1215186 | 3300039447 | Bacteria | 4374 |
| 346 | Ga0439465_0071992 | 3300041413 | Bacteria | 1160 |
| 347 | Ga0439448_0000618 | 3300042005 | Bacteria | 8368 |
| 348 | Ga0439449_0012815 | 3300042007 | Bacteria | 3152 |
| 349 | Ga0439455_0000720 | 3300042012 | Bacteria | 4914 |
| 350 | Ga0439455_0017695 | 3300042012 | Bacteria | 1664 |
| 351 | Ga0450904_001280 | 3300042139 | Bacteria | 3700 |
| 352 | Ga0451577_0012494 | 3300042876 | Bacteria | 7972 |
| 353 | Ga0451577_0111565 | 3300042876 | Bacteria | 2447 |
| 354 | Ga0466969_0049147 | 3300044656 | Bacteria | 2082 |
| 355 | Ga0466972_0002165 | 3300044658 | Bacteria | 9644 |
| 356 | Ga0466982_0102547 | 3300044672 | Bacteria | 1772 |
| 357 | Ga0466965_0005989 | 3300044683 | Bacteria | 5493 |
| 358 | Ga0466965_0018625 | 3300044683 | Bacteria | 3330 |
| 359 | Ga0466965_0049445 | 3300044683 | Bacteria | 2084 |
| 360 | Ga0466965_0103249 | 3300044683 | Bacteria | 1459 |
| 361 | Ga0466966_0005054 | 3300044684 | Bacteria | 8668 |
| 362 | Ga0466964_0005017 | 3300044706 | Bacteria | 4894 |
| 363 | Ga0466964_0016497 | 3300044706 | Bacteria | 2820 |
| 364 | Ga0453684_0001170 | 3300044712 | Bacteria | 81366 |
| 365 | Ga0466968_0004913 | 3300044735 | Bacteria | 5003 |
| 366 | Ga0466957_0000115 | 3300044842 | Bacteria | 33097 |
| 367 | Ga0466957_0043321 | 3300044842 | Bacteria | 2725 |
| 368 | Ga0466957_0091847 | 3300044842 | Bacteria | 1903 |
| 369 | Ga0466959_0005620 | 3300045049 | Bacteria | 8622 |
| 370 | Ga0451576_0034641 | 3300045051 | Bacteria | 5362 |
| 371 | Ga0451576_0035992 | 3300045051 | Bacteria | 5251 |
| 372 | Ga0451576_0306482 | 3300045051 | Bacteria | 1661 |
| 373 | Ga0466967_0010104 | 3300045976 | Bacteria | 7054 |
| 374 | Ga0466967_0097150 | 3300045976 | Bacteria | 2688 |
| 375 | Ga0466967_0284104 | 3300045976 | Bacteria | 1588 |
| 376 | Ga0495617_000002 | 3300046452 | Bacteria | 710121 |
| 377 | Ga0495617_000007 | 3300046452 | Bacteria | 369986 |
| 378 | Ga0495617_005082 | 3300046452 | Bacteria | 4708 |
| 379 | Ga0495617_029597 | 3300046452 | Bacteria | 1841 |
| 380 | Ga0495627_000006 | 3300046453 | Bacteria | 581750 |
| 381 | Ga0495627_001506 | 3300046453 | Bacteria | 13413 |
| 382 | Ga0495627_005062 | 3300046453 | Bacteria | 5386 |
| 383 | Ga0495627_018958 | 3300046453 | Bacteria | 2313 |
| 384 | Ga0495603_0041037 | 3300046455 | Bacteria | 2768 |
| 385 | Ga0495590_0000004 | 3300046457 | Bacteria | 402091 |
| 386 | Ga0495590_0000007 | 3300046457 | Bacteria | 331108 |
| 387 | Ga0495590_0010883 | 3300046457 | Bacteria | 3408 |
| 388 | Ga0495590_0056733 | 3300046457 | Bacteria | 1369 |
| 389 | Ga0495591_000062 | 3300046458 | Bacteria | 124615 |
| 390 | Ga0495591_009009 | 3300046458 | Bacteria | 4015 |
| 391 | Ga0495629_0066316 | 3300046459 | Bacteria | 2519 |
| 392 | Ga0495629_0066865 | 3300046459 | Bacteria | 2508 |
| 393 | Ga0495638_0000023 | 3300046460 | Bacteria | 363063 |
| 394 | Ga0495638_0001662 | 3300046460 | Bacteria | 19666 |
| 395 | Ga0495638_0005843 | 3300046460 | Bacteria | 9049 |
| 396 | Ga0495638_0062217 | 3300046460 | Bacteria | 2304 |
| 397 | Ga0495638_0130392 | 3300046460 | Bacteria | 1477 |
| 398 | Ga0495653_0000207 | 3300046463 | Bacteria | 47378 |
| 399 | Ga0495653_0025531 | 3300046463 | Bacteria | 4745 |
| 400 | Ga0495653_0030532 | 3300046463 | Bacteria | 4291 |
| 401 | Ga0495653_0084536 | 3300046463 | Bacteria | 2337 |
| 402 | Ga0495653_0085475 | 3300046463 | Bacteria | 2320 |
| 403 | Ga0495650_0000769 | 3300046471 | Bacteria | 39602 |
| 404 | Ga0495650_0001207 | 3300046471 | Bacteria | 27239 |
| 405 | Ga0495650_0002253 | 3300046471 | Bacteria | 16122 |
| 406 | Ga0495650_0003039 | 3300046471 | Bacteria | 12659 |
| 407 | Ga0495650_0003455 | 3300046471 | Bacteria | 11514 |
| 408 | Ga0495650_0031742 | 3300046471 | Bacteria | 2372 |
| 409 | Ga0495580_0008499 | 3300046472 | Bacteria | 8162 |
| 410 | Ga0495582_0021915 | 3300046473 | Bacteria | 3495 |
| 411 | Ga0495605_0000063 | 3300046474 | Bacteria | 140789 |
| 412 | Ga0495605_0000174 | 3300046474 | Bacteria | 81340 |
| 413 | Ga0495605_0001463 | 3300046474 | Bacteria | 15423 |
| 414 | Ga0495605_0008808 | 3300046474 | Bacteria | 5692 |
| 415 | Ga0495605_0009267 | 3300046474 | Bacteria | 5532 |
| 416 | Ga0495605_0015996 | 3300046474 | Bacteria | 4070 |
| 417 | Ga0495605_0024268 | 3300046474 | Bacteria | 3175 |
| 418 | Ga0495605_0034912 | 3300046474 | Bacteria | 2543 |
| 419 | Ga0495605_0079164 | 3300046474 | Bacteria | 1539 |
| 420 | Ga0495605_0147499 | 3300046474 | Bacteria | 1052 |
| 421 | Ga0495584_0000010 | 3300046491 | Bacteria | 225095 |
| 422 | Ga0495584_0001432 | 3300046491 | Bacteria | 14361 |
| 423 | Ga0495584_0003242 | 3300046491 | Bacteria | 9023 |
| 424 | Ga0495584_0003373 | 3300046491 | Bacteria | 8826 |
| 425 | Ga0495584_0011566 | 3300046491 | Bacteria | 4519 |
| 426 | Ga0495584_0013554 | 3300046491 | Bacteria | 4161 |
| 427 | Ga0495584_0026860 | 3300046491 | Bacteria | 2917 |
| 428 | Ga0495584_0031526 | 3300046491 | Bacteria | 2683 |
| 429 | Ga0495584_0112658 | 3300046491 | Bacteria | 1376 |
| 430 | Ga0495584_0160244 | 3300046491 | Bacteria | 1143 |
| 431 | Ga0495585_0000006 | 3300046492 | Bacteria | 320556 |
| 432 | Ga0495585_0000592 | 3300046492 | Bacteria | 33996 |
| 433 | Ga0495585_0001217 | 3300046492 | Bacteria | 20847 |
| 434 | Ga0495585_0002703 | 3300046492 | Bacteria | 12422 |
| 435 | Ga0495585_0002955 | 3300046492 | Bacteria | 11739 |
| 436 | Ga0495585_0003583 | 3300046492 | Bacteria | 10422 |
| 437 | Ga0495585_0005077 | 3300046492 | Bacteria | 8388 |
| 438 | Ga0495585_0005691 | 3300046492 | Bacteria | 7822 |
| 439 | Ga0495585_0006007 | 3300046492 | Bacteria | 7598 |
| 440 | Ga0495585_0014015 | 3300046492 | Bacteria | 4681 |
| 441 | Ga0495585_0016934 | 3300046492 | Bacteria | 4220 |
| 442 | Ga0495585_0018950 | 3300046492 | Bacteria | 3970 |
| 443 | Ga0495585_0022375 | 3300046492 | Bacteria | 3628 |
| 444 | Ga0495585_0030974 | 3300046492 | Bacteria | 3040 |
| 445 | Ga0495585_0043853 | 3300046492 | Bacteria | 2500 |
| 446 | Ga0495585_0052966 | 3300046492 | Bacteria | 2246 |
| 447 | Ga0495585_0069795 | 3300046492 | Bacteria | 1917 |
| 448 | Ga0495585_0193990 | 3300046492 | Bacteria | 1037 |
| 449 | Ga0495585_0198054 | 3300046492 | Bacteria | 1024 |
| 450 | Ga0495594_0003275 | 3300046499 | Bacteria | 8383 |
| 451 | Ga0495594_0010522 | 3300046499 | Bacteria | 4798 |
| 452 | Ga0495594_0026451 | 3300046499 | Bacteria | 3121 |
| 453 | Ga0495596_0000130 | 3300046500 | Bacteria | 51970 |
| 454 | Ga0495596_0000217 | 3300046500 | Bacteria | 39881 |
| 455 | Ga0495596_0005367 | 3300046500 | Bacteria | 6064 |
| 456 | Ga0495596_0006498 | 3300046500 | Bacteria | 5368 |
| 457 | Ga0495596_0006913 | 3300046500 | Bacteria | 5169 |
| 458 | Ga0495596_0009275 | 3300046500 | Bacteria | 4333 |
| 459 | Ga0495596_0012662 | 3300046500 | Bacteria | 3603 |
| 460 | Ga0495596_0013081 | 3300046500 | Bacteria | 3532 |
| 461 | Ga0495596_0024539 | 3300046500 | Bacteria | 2440 |
| 462 | Ga0495596_0047213 | 3300046500 | Bacteria | 1690 |
| 463 | Ga0495607_0002839 | 3300046501 | Bacteria | 13749 |
| 464 | Ga0495607_0003658 | 3300046501 | Bacteria | 11669 |
| 465 | Ga0495607_0006211 | 3300046501 | Bacteria | 8430 |
| 466 | Ga0495607_0006855 | 3300046501 | Bacteria | 7945 |
| 467 | Ga0495607_0006952 | 3300046501 | Bacteria | 7885 |
| 468 | Ga0495607_0015837 | 3300046501 | Bacteria | 4876 |
| 469 | Ga0495607_0026420 | 3300046501 | Bacteria | 3603 |
| 470 | Ga0495607_0030511 | 3300046501 | Bacteria | 3308 |
| 471 | Ga0495607_0046410 | 3300046501 | Bacteria | 2551 |
| 472 | Ga0495607_0085712 | 3300046501 | Bacteria | 1720 |
| 473 | Ga0495607_0094933 | 3300046501 | Bacteria | 1608 |
| 474 | Ga0495607_0154182 | 3300046501 | Bacteria | 1173 |
| 475 | Ga0495583_0000084 | 3300046506 | Bacteria | 165375 |
| 476 | Ga0495583_0000330 | 3300046506 | Bacteria | 74846 |
| 477 | Ga0495583_0001063 | 3300046506 | Bacteria | 30689 |
| 478 | Ga0495583_0001091 | 3300046506 | Bacteria | 30075 |
| 479 | Ga0495583_0001851 | 3300046506 | Bacteria | 19718 |
| 480 | Ga0495583_0002627 | 3300046506 | Bacteria | 15018 |
| 481 | Ga0495583_0003369 | 3300046506 | Bacteria | 12283 |
| 482 | Ga0495583_0003430 | 3300046506 | Bacteria | 12072 |
| 483 | Ga0495583_0018264 | 3300046506 | Bacteria | 3695 |
| 484 | Ga0495583_0023407 | 3300046506 | Bacteria | 3125 |
| 485 | Ga0495583_0026989 | 3300046506 | Bacteria | 2839 |
| 486 | Ga0495583_0028565 | 3300046506 | Bacteria | 2740 |
| 487 | Ga0495583_0036094 | 3300046506 | Bacteria | 2354 |
| 488 | Ga0495583_0041811 | 3300046506 | Bacteria | 2144 |
| 489 | Ga0495606_0000024 | 3300046507 | Bacteria | 262080 |
| 490 | Ga0495606_0000037 | 3300046507 | Bacteria | 231282 |
| 491 | Ga0495606_0000146 | 3300046507 | Bacteria | 122515 |
| 492 | Ga0495606_0009349 | 3300046507 | Bacteria | 8307 |
| 493 | Ga0495606_0016464 | 3300046507 | Bacteria | 5634 |
| 494 | Ga0495606_0020128 | 3300046507 | Bacteria | 4933 |
| 495 | Ga0495606_0022863 | 3300046507 | Bacteria | 4542 |
| 496 | Ga0495606_0052216 | 3300046507 | Bacteria | 2660 |
| 497 | Ga0495606_0094651 | 3300046507 | Bacteria | 1830 |
| 498 | Ga0495606_0096413 | 3300046507 | Bacteria | 1809 |
| 499 | Ga0495606_0109586 | 3300046507 | Bacteria | 1667 |
| 500 | Ga0495610_0000004 | 3300046512 | Bacteria | 1006135 |
| 501 | Ga0495610_0001723 | 3300046512 | Bacteria | 19165 |
| 502 | Ga0495610_0008063 | 3300046512 | Bacteria | 6889 |
| 503 | Ga0495616_0000081 | 3300046513 | Bacteria | 80720 |
| 504 | Ga0495616_0000396 | 3300046513 | Bacteria | 33637 |
| 505 | Ga0495616_0003472 | 3300046513 | Bacteria | 10084 |
| 506 | Ga0495616_0004198 | 3300046513 | Bacteria | 9131 |
| 507 | Ga0495616_0005391 | 3300046513 | Bacteria | 7879 |
| 508 | Ga0495616_0011083 | 3300046513 | Bacteria | 5180 |
| 509 | Ga0495616_0011302 | 3300046513 | Bacteria | 5124 |
| 510 | Ga0495616_0011906 | 3300046513 | Bacteria | 4956 |
| 511 | Ga0495616_0017489 | 3300046513 | Bacteria | 3955 |
| 512 | Ga0495616_0035044 | 3300046513 | Bacteria | 2600 |
| 513 | Ga0495616_0037407 | 3300046513 | Bacteria | 2497 |
| 514 | Ga0495616_0037415 | 3300046513 | Bacteria | 2496 |
| 515 | Ga0495616_0061482 | 3300046513 | Bacteria | 1842 |
| 516 | Ga0495616_0064367 | 3300046513 | Bacteria | 1789 |
| 517 | Ga0495616_0080170 | 3300046513 | Bacteria | 1563 |
| 518 | Ga0495616_0114530 | 3300046513 | Bacteria | 1250 |
| 519 | Ga0495620_0008818 | 3300046515 | Bacteria | 5395 |
| 520 | Ga0495631_0000208 | 3300046518 | Bacteria | 40242 |
| 521 | Ga0495631_0002880 | 3300046518 | Bacteria | 9542 |
| 522 | Ga0495631_0003153 | 3300046518 | Bacteria | 9070 |
| 523 | Ga0495631_0010249 | 3300046518 | Bacteria | 4645 |
| 524 | Ga0495631_0012668 | 3300046518 | Bacteria | 4111 |
| 525 | Ga0495631_0014078 | 3300046518 | Bacteria | 3866 |
| 526 | Ga0495631_0015079 | 3300046518 | Bacteria | 3713 |
| 527 | Ga0495631_0016308 | 3300046518 | Bacteria | 3545 |
| 528 | Ga0495631_0018869 | 3300046518 | Bacteria | 3241 |
| 529 | Ga0495631_0032919 | 3300046518 | Bacteria | 2332 |
| 530 | Ga0495631_0040204 | 3300046518 | Bacteria | 2072 |
| 531 | Ga0495631_0040556 | 3300046518 | Bacteria | 2062 |
| 532 | Ga0495632_0000071 | 3300046519 | Bacteria | 105606 |
| 533 | Ga0495632_0001714 | 3300046519 | Bacteria | 17823 |
| 534 | Ga0495632_0003038 | 3300046519 | Bacteria | 12224 |
| 535 | Ga0495632_0006355 | 3300046519 | Bacteria | 7622 |
| 536 | Ga0495632_0006805 | 3300046519 | Bacteria | 7295 |
| 537 | Ga0495632_0009584 | 3300046519 | Bacteria | 5822 |
| 538 | Ga0495632_0069961 | 3300046519 | Bacteria | 1689 |
| 539 | Ga0495637_0000335 | 3300046520 | Bacteria | 36417 |
| 540 | Ga0495637_0001186 | 3300046520 | Bacteria | 15859 |
| 541 | Ga0495637_0012354 | 3300046520 | Bacteria | 4087 |
| 542 | Ga0495643_0000098 | 3300046522 | Bacteria | 145645 |
| 543 | Ga0495643_0000196 | 3300046522 | Bacteria | 95989 |
| 544 | Ga0495643_0000211 | 3300046522 | Bacteria | 89358 |
| 545 | Ga0495643_0000756 | 3300046522 | Bacteria | 36370 |
| 546 | Ga0495643_0008541 | 3300046522 | Bacteria | 6468 |
| 547 | Ga0495643_0029275 | 3300046522 | Bacteria | 3082 |
| 548 | Ga0495643_0037775 | 3300046522 | Bacteria | 2646 |
| 549 | Ga0495643_0045120 | 3300046522 | Bacteria | 2393 |
| 550 | Ga0495643_0061843 | 3300046522 | Bacteria | 1984 |
| 551 | Ga0495643_0067119 | 3300046522 | Bacteria | 1891 |
| 552 | Ga0495643_0105440 | 3300046522 | Bacteria | 1439 |
| 553 | Ga0495644_0002322 | 3300046523 | Bacteria | 7607 |
| 554 | Ga0495644_0004209 | 3300046523 | Bacteria | 5652 |
| 555 | Ga0495644_0006256 | 3300046523 | Bacteria | 4623 |
| 556 | Ga0495644_0008001 | 3300046523 | Bacteria | 4067 |
| 557 | Ga0495644_0008405 | 3300046523 | Bacteria | 3976 |
| 558 | Ga0495644_0022412 | 3300046523 | Bacteria | 2407 |
| 559 | Ga0495644_0025668 | 3300046523 | Bacteria | 2236 |
| 560 | Ga0495644_0028983 | 3300046523 | Bacteria | 2093 |
| 561 | Ga0495648_0000007 | 3300046524 | Bacteria | 347305 |
| 562 | Ga0495648_0000877 | 3300046524 | Bacteria | 31708 |
| 563 | Ga0495648_0005051 | 3300046524 | Bacteria | 11081 |
| 564 | Ga0495648_0006058 | 3300046524 | Bacteria | 9922 |
| 565 | Ga0495648_0019005 | 3300046524 | Bacteria | 4846 |
| 566 | Ga0495648_0020402 | 3300046524 | Bacteria | 4623 |
| 567 | Ga0495648_0020616 | 3300046524 | Bacteria | 4590 |
| 568 | Ga0495648_0031438 | 3300046524 | Bacteria | 3494 |
| 569 | Ga0495648_0034402 | 3300046524 | Bacteria | 3297 |
| 570 | Ga0495648_0041161 | 3300046524 | Bacteria | 2921 |
| 571 | Ga0495648_0071964 | 3300046524 | Bacteria | 2002 |
| 572 | Ga0495663_0001857 | 3300046525 | Bacteria | 6513 |
| 573 | Ga0495663_0003406 | 3300046525 | Bacteria | 4589 |
| 574 | Ga0495663_0038003 | 3300046525 | Bacteria | 1454 |
| 575 | Ga0495666_0003041 | 3300046526 | Bacteria | 8427 |
| 576 | Ga0495666_0006057 | 3300046526 | Bacteria | 6091 |
| 577 | Ga0495666_0079244 | 3300046526 | Bacteria | 1555 |
| 578 | Ga0495666_0085481 | 3300046526 | Bacteria | 1490 |
| 579 | Ga0495642_0000887 | 3300046528 | Bacteria | 14120 |
| 580 | Ga0495642_0000985 | 3300046528 | Bacteria | 13253 |
| 581 | Ga0495642_0003070 | 3300046528 | Bacteria | 6641 |
| 582 | Ga0495642_0026533 | 3300046528 | Bacteria | 2301 |
| 583 | Ga0495642_0037239 | 3300046528 | Bacteria | 1968 |
| 584 | Ga0495642_0040689 | 3300046528 | Bacteria | 1888 |
| 585 | Ga0495642_0049049 | 3300046528 | Bacteria | 1733 |
| 586 | Ga0495642_0083734 | 3300046528 | Bacteria | 1345 |
| 587 | Ga0495652_0005305 | 3300046529 | Bacteria | 12153 |
| 588 | Ga0495654_0000004 | 3300046530 | Bacteria | 515304 |
| 589 | Ga0495654_0003968 | 3300046530 | Bacteria | 8913 |
| 590 | Ga0495654_0019568 | 3300046530 | Bacteria | 3540 |
| 591 | Ga0495654_0039859 | 3300046530 | Bacteria | 2343 |
| 592 | Ga0495654_0044161 | 3300046530 | Bacteria | 2205 |
| 593 | Ga0495586_0019531 | 3300046535 | Bacteria | 3608 |
| 594 | Ga0495586_0024795 | 3300046535 | Bacteria | 3207 |
| 595 | Ga0495586_0053279 | 3300046535 | Bacteria | 2191 |
| 596 | Ga0495587_0031578 | 3300046536 | Bacteria | 3205 |
| 597 | Ga0495587_0046094 | 3300046536 | Bacteria | 2588 |
| 598 | Ga0495609_0000002 | 3300046538 | Bacteria | 739816 |
| 599 | Ga0495609_0000639 | 3300046538 | Bacteria | 27254 |
| 600 | Ga0495609_0001564 | 3300046538 | Bacteria | 14971 |
| 601 | Ga0495609_0001669 | 3300046538 | Bacteria | 14418 |
| 602 | Ga0495609_0003140 | 3300046538 | Bacteria | 9635 |
| 603 | Ga0495609_0006038 | 3300046538 | Bacteria | 6240 |
| 604 | Ga0495609_0006189 | 3300046538 | Bacteria | 6153 |
| 605 | Ga0495609_0014941 | 3300046538 | Bacteria | 3642 |
| 606 | Ga0495609_0021118 | 3300046538 | Bacteria | 3003 |
| 607 | Ga0495609_0025038 | 3300046538 | Bacteria | 2736 |
| 608 | Ga0495609_0028187 | 3300046538 | Bacteria | 2563 |
| 609 | Ga0495609_0047034 | 3300046538 | Bacteria | 1931 |
| 610 | Ga0495621_0010741 | 3300046539 | Bacteria | 2812 |
| 611 | Ga0495597_0000022 | 3300046542 | Bacteria | 150986 |
| 612 | Ga0495597_0000063 | 3300046542 | Bacteria | 91471 |
| 613 | Ga0495597_0001454 | 3300046542 | Bacteria | 16953 |
| 614 | Ga0495597_0002183 | 3300046542 | Bacteria | 12849 |
| 615 | Ga0495597_0002996 | 3300046542 | Bacteria | 10192 |
| 616 | Ga0495597_0003329 | 3300046542 | Bacteria | 9474 |
| 617 | Ga0495597_0005005 | 3300046542 | Bacteria | 7110 |
| 618 | Ga0495597_0018781 | 3300046542 | Bacteria | 3240 |
| 619 | Ga0495597_0031766 | 3300046542 | Bacteria | 2399 |
| 620 | Ga0495597_0041585 | 3300046542 | Bacteria | 2052 |
| 621 | Ga0495645_0015082 | 3300046543 | Bacteria | 5491 |
| 622 | Ga0495645_0226136 | 3300046543 | Bacteria | 1256 |
| 623 | Ga0495622_0000003 | 3300046557 | Bacteria | 268681 |
| 624 | Ga0495622_0000432 | 3300046557 | Bacteria | 27458 |
| 625 | Ga0495633_0000045 | 3300046558 | Bacteria | 169729 |
| 626 | Ga0495633_0000449 | 3300046558 | Bacteria | 42373 |
| 627 | Ga0495633_0004052 | 3300046558 | Bacteria | 9470 |
| 628 | Ga0495633_0009799 | 3300046558 | Bacteria | 5265 |
| 629 | Ga0495633_0013705 | 3300046558 | Bacteria | 4263 |
| 630 | Ga0495633_0019683 | 3300046558 | Bacteria | 3409 |
| 631 | Ga0495667_0054843 | 3300046559 | Bacteria | 2622 |
| 632 | Ga0495667_0148660 | 3300046559 | Bacteria | 1508 |
| 633 | Ga0495656_0000811 | 3300046615 | Bacteria | 10078 |
| 634 | Ga0495656_0026162 | 3300046615 | Bacteria | 2320 |
| 635 | Ga0495656_0075785 | 3300046615 | Bacteria | 1506 |
| 636 | Ga0495668_0000051 | 3300046616 | Bacteria | 214532 |
| 637 | Ga0495668_0000158 | 3300046616 | Bacteria | 103075 |
| 638 | Ga0495668_0000205 | 3300046616 | Bacteria | 86295 |
| 639 | Ga0495668_0002645 | 3300046616 | Bacteria | 14395 |
| 640 | Ga0495668_0002726 | 3300046616 | Bacteria | 14151 |
| 641 | Ga0495668_0002953 | 3300046616 | Bacteria | 13379 |
| 642 | Ga0495668_0003351 | 3300046616 | Bacteria | 12079 |
| 643 | Ga0495668_0019105 | 3300046616 | Bacteria | 3954 |
| 644 | Ga0495668_0020227 | 3300046616 | Bacteria | 3829 |
| 645 | Ga0495668_0027474 | 3300046616 | Bacteria | 3224 |
| 646 | Ga0495668_0029158 | 3300046616 | Bacteria | 3119 |
| 647 | Ga0495668_0031609 | 3300046616 | Bacteria | 2983 |
| 648 | Ga0495668_0039156 | 3300046616 | Bacteria | 2647 |
| 649 | Ga0495668_0062028 | 3300046616 | Bacteria | 2060 |
| 650 | Ga0495668_0099299 | 3300046616 | Bacteria | 1592 |
| 651 | Ga0495634_0024910 | 3300046642 | Bacteria | 4194 |
| 652 | Ga0495634_0047968 | 3300046642 | Bacteria | 2877 |
| 653 | Ga0495611_0001035 | 3300046648 | Bacteria | 14726 |
| 654 | Ga0495611_0017608 | 3300046648 | Bacteria | 3057 |
| 655 | Ga0495611_0025422 | 3300046648 | Bacteria | 2580 |
| 656 | Ga0495611_0033011 | 3300046648 | Bacteria | 2283 |
| 657 | Ga0495611_0038673 | 3300046648 | Bacteria | 2122 |
| 658 | Ga0495611_0076165 | 3300046648 | Bacteria | 1537 |
| 659 | Ga0495625_0000073 | 3300046660 | Bacteria | 165197 |
| 660 | Ga0495625_0006264 | 3300046660 | Bacteria | 10644 |
| 661 | Ga0495625_0011301 | 3300046660 | Bacteria | 7289 |
| 662 | Ga0495625_0014579 | 3300046660 | Bacteria | 6265 |
| 663 | Ga0495625_0066845 | 3300046660 | Bacteria | 2531 |
| 664 | Ga0495625_0097982 | 3300046660 | Bacteria | 2017 |
| 665 | Ga0495625_0136449 | 3300046660 | Bacteria | 1658 |
| 666 | Ga0495625_0246006 | 3300046660 | Bacteria | 1162 |
| 667 | Ga0495635_0071582 | 3300046663 | Bacteria | 2376 |
| 668 | Ga0495635_0095315 | 3300046663 | Bacteria | 2034 |
| 669 | Ga0495659_0001130 | 3300046664 | Bacteria | 9275 |
| 670 | Ga0495659_0004753 | 3300046664 | Bacteria | 4275 |
| 671 | Ga0495659_0007009 | 3300046664 | Bacteria | 3569 |
| 672 | Ga0495659_0010884 | 3300046664 | Bacteria | 2929 |
| 673 | Ga0495661_0000204 | 3300046665 | Bacteria | 68851 |
| 674 | Ga0495661_0000742 | 3300046665 | Bacteria | 31731 |
| 675 | Ga0495661_0002628 | 3300046665 | Bacteria | 13759 |
| 676 | Ga0495661_0004658 | 3300046665 | Bacteria | 9854 |
| 677 | Ga0495661_0007123 | 3300046665 | Bacteria | 7808 |
| 678 | Ga0495661_0010529 | 3300046665 | Bacteria | 6306 |
| 679 | Ga0495661_0012729 | 3300046665 | Bacteria | 5677 |
| 680 | Ga0495661_0014610 | 3300046665 | Bacteria | 5258 |
| 681 | Ga0495661_0017638 | 3300046665 | Bacteria | 4710 |
| 682 | Ga0495661_0023518 | 3300046665 | Bacteria | 3999 |
| 683 | Ga0495661_0040943 | 3300046665 | Bacteria | 2869 |
| 684 | Ga0495661_0041898 | 3300046665 | Bacteria | 2828 |
| 685 | Ga0495661_0049073 | 3300046665 | Bacteria | 2561 |
| 686 | Ga0495661_0069149 | 3300046665 | Bacteria | 2069 |
| 687 | Ga0495661_0078658 | 3300046665 | Bacteria | 1907 |
| 688 | Ga0495661_0120858 | 3300046665 | Bacteria | 1447 |
| 689 | Ga0495661_0176140 | 3300046665 | Bacteria | 1136 |
| 690 | Ga0495661_0195441 | 3300046665 | Bacteria | 1062 |
| 691 | Ga0495588_0000208 | 3300046674 | Bacteria | 57550 |
| 692 | Ga0495588_0008870 | 3300046674 | Bacteria | 4626 |
| 693 | Ga0495588_0027443 | 3300046674 | Bacteria | 2845 |
| 694 | Ga0495588_0028931 | 3300046674 | Bacteria | 2777 |
| 695 | Ga0495588_0035988 | 3300046674 | Bacteria | 2510 |
| 696 | Ga0495588_0065893 | 3300046674 | Bacteria | 1879 |
| 697 | Ga0495588_0083285 | 3300046674 | Bacteria | 1671 |
| 698 | Ga0495623_0071918 | 3300046679 | Bacteria | 2151 |
| 699 | Ga0495669_0000036 | 3300046684 | Bacteria | 95830 |
| 700 | Ga0495669_0001068 | 3300046684 | Bacteria | 11411 |
| 701 | Ga0495669_0006172 | 3300046684 | Bacteria | 4998 |
| 702 | Ga0495669_0023940 | 3300046684 | Bacteria | 2660 |
| 703 | Ga0495669_0030484 | 3300046684 | Bacteria | 2367 |
| 704 | Ga0495669_0035605 | 3300046684 | Bacteria | 2198 |
| 705 | Ga0495669_0038080 | 3300046684 | Bacteria | 2129 |
| 706 | Ga0495669_0128909 | 3300046684 | Bacteria | 1190 |
| 707 | Ga0495669_0182878 | 3300046684 | Bacteria | 999 |
| 708 | Ga0495613_0100062 | 3300046689 | Bacteria | 2094 |
| 709 | Ga0495624_0040296 | 3300046690 | Bacteria | 2991 |
| 710 | Ga0495670_0002278 | 3300046691 | Bacteria | 9465 |
| 711 | Ga0495670_0007920 | 3300046691 | Bacteria | 5223 |
| 712 | Ga0495670_0010375 | 3300046691 | Bacteria | 4575 |
| 713 | Ga0495670_0030924 | 3300046691 | Bacteria | 2659 |
| 714 | Ga0495670_0134069 | 3300046691 | Bacteria | 1292 |
| 715 | Ga0495671_0000260 | 3300046692 | Bacteria | 44754 |
| 716 | Ga0495671_0002020 | 3300046692 | Bacteria | 13021 |
| 717 | Ga0495671_0002900 | 3300046692 | Bacteria | 10695 |
| 718 | Ga0495671_0007787 | 3300046692 | Bacteria | 6067 |
| 719 | Ga0495671_0012088 | 3300046692 | Bacteria | 4719 |
| 720 | Ga0495671_0029802 | 3300046692 | Bacteria | 2799 |
| 721 | Ga0495671_0052594 | 3300046692 | Bacteria | 2024 |
| 722 | Ga0495671_0173180 | 3300046692 | Bacteria | 1049 |
| 723 | Ga0495649_0001404 | 3300046694 | Bacteria | 18182 |
| 724 | Ga0495649_0013231 | 3300046694 | Bacteria | 4765 |
| 725 | Ga0495649_0017449 | 3300046694 | Bacteria | 4049 |
| 726 | Ga0495649_0019332 | 3300046694 | Bacteria | 3828 |
| 727 | Ga0495649_0024659 | 3300046694 | Bacteria | 3353 |
| 728 | Ga0495649_0026315 | 3300046694 | Bacteria | 3236 |
| 729 | Ga0495649_0029601 | 3300046694 | Bacteria | 3028 |
| 730 | Ga0495649_0059997 | 3300046694 | Bacteria | 2047 |
| 731 | Ga0495649_0170834 | 3300046694 | Bacteria | 1137 |
| 732 | Ga0495589_0000275 | 3300046794 | Bacteria | 41938 |
| 733 | Ga0495589_0000491 | 3300046794 | Bacteria | 28250 |
| 734 | Ga0495589_0002663 | 3300046794 | Bacteria | 9873 |
| 735 | Ga0495589_0006649 | 3300046794 | Bacteria | 6091 |
| 736 | Ga0495589_0008429 | 3300046794 | Bacteria | 5386 |
| 737 | Ga0495589_0017104 | 3300046794 | Bacteria | 3725 |
| 738 | Ga0495589_0023929 | 3300046794 | Bacteria | 3106 |
| 739 | Ga0495589_0034332 | 3300046794 | Bacteria | 2547 |
| 740 | Ga0495589_0036400 | 3300046794 | Bacteria | 2467 |
| 741 | Ga0495589_0042928 | 3300046794 | Bacteria | 2252 |
| 742 | Ga0495589_0067607 | 3300046794 | Bacteria | 1748 |
| 743 | Ga0495600_0041084 | 3300046809 | Bacteria | 3013 |
| 744 | Ga0495660_0000322 | 3300046810 | Bacteria | 42498 |
| 745 | Ga0495660_0000715 | 3300046810 | Bacteria | 25390 |
| 746 | Ga0495660_0009527 | 3300046810 | Bacteria | 5661 |
| 747 | Ga0495660_0012028 | 3300046810 | Bacteria | 5019 |
| 748 | Ga0495660_0013960 | 3300046810 | Bacteria | 4656 |
| 749 | Ga0495660_0023202 | 3300046810 | Bacteria | 3540 |
| 750 | Ga0495660_0035893 | 3300046810 | Bacteria | 2767 |
| 751 | Ga0495660_0048997 | 3300046810 | Bacteria | 2308 |
| 752 | Ga0495660_0079088 | 3300046810 | Bacteria | 1727 |
| 753 | Ga0495660_0153607 | 3300046810 | Bacteria | 1134 |
| 754 | Ga0495581_0007747 | 3300047315 | Bacteria | 6214 |
| 755 | Ga0495581_0019112 | 3300047315 | Bacteria | 3977 |
| 756 | Ga0495581_0034899 | 3300047315 | Bacteria | 2910 |
| 757 | Ga0495581_0249754 | 3300047315 | Bacteria | 1037 |
| 758 | Ga0495604_0027320 | 3300047317 | Bacteria | 4540 |
| 759 | Ga0495604_0170738 | 3300047317 | Bacteria | 1529 |
| 760 | Ga0495636_0004977 | 3300047318 | Bacteria | 5211 |
| 761 | Ga0495636_0010303 | 3300047318 | Bacteria | 3689 |
| 762 | Ga0495636_0040058 | 3300047318 | Bacteria | 1941 |
| 763 | Ga0495674_0004003 | 3300047319 | Bacteria | 14272 |
| 764 | Ga0495672_0000041 | 3300047320 | Bacteria | 267545 |
| 765 | Ga0495672_0000184 | 3300047320 | Bacteria | 91103 |
| 766 | Ga0495672_0000588 | 3300047320 | Bacteria | 41086 |
| 767 | Ga0495672_0001324 | 3300047320 | Bacteria | 24612 |
| 768 | Ga0495672_0003105 | 3300047320 | Bacteria | 14503 |
| 769 | Ga0495672_0017522 | 3300047320 | Bacteria | 4790 |
| 770 | Ga0495672_0095019 | 3300047320 | Bacteria | 1628 |
| 771 | Ga0495676_0030259 | 3300047321 | Bacteria | 4599 |
| 772 | Ga0495676_0146864 | 3300047321 | Bacteria | 1683 |
| 773 | Ga0495680_0251230 | 3300047322 | Bacteria | 1253 |
| 774 | Ga0495683_0000180 | 3300047323 | Bacteria | 62230 |
| 775 | Ga0495683_0002116 | 3300047323 | Bacteria | 12278 |
| 776 | Ga0495683_0005648 | 3300047323 | Bacteria | 6924 |
| 777 | Ga0495683_0027845 | 3300047323 | Bacteria | 2889 |
| 778 | Ga0495683_0031464 | 3300047323 | Bacteria | 2704 |
| 779 | Ga0495683_0055562 | 3300047323 | Bacteria | 1970 |
| 780 | Ga0495683_0091610 | 3300047323 | Bacteria | 1472 |
| 781 | Ga0495687_000049 | 3300047443 | Bacteria | 205432 |
| 782 | Ga0495687_000075 | 3300047443 | Bacteria | 152218 |
| 783 | Ga0495687_000482 | 3300047443 | Bacteria | 48392 |
| 784 | Ga0495687_000605 | 3300047443 | Bacteria | 41942 |
| 785 | Ga0495687_000703 | 3300047443 | Bacteria | 37295 |
| 786 | Ga0495687_001553 | 3300047443 | Bacteria | 20874 |
| 787 | Ga0495687_009992 | 3300047443 | Bacteria | 5245 |
| 788 | Ga0495675_0004311 | 3300047444 | Bacteria | 8606 |
| 789 | Ga0495675_0064599 | 3300047444 | Bacteria | 2315 |
| 790 | Ga0495675_0103143 | 3300047444 | Bacteria | 1783 |
| 791 | Ga0495677_0000103 | 3300047445 | Bacteria | 41927 |
| 792 | Ga0495677_0000916 | 3300047445 | Bacteria | 11880 |
| 793 | Ga0495677_0001365 | 3300047445 | Bacteria | 9761 |
| 794 | Ga0495677_0003071 | 3300047445 | Bacteria | 6491 |
| 795 | Ga0495677_0003608 | 3300047445 | Bacteria | 6002 |
| 796 | Ga0495677_0011044 | 3300047445 | Bacteria | 3309 |
| 797 | Ga0495677_0024836 | 3300047445 | Bacteria | 2174 |
| 798 | Ga0495677_0027735 | 3300047445 | Bacteria | 2054 |
| 799 | Ga0495677_0030217 | 3300047445 | Bacteria | 1971 |
| 800 | Ga0495677_0035728 | 3300047445 | Bacteria | 1813 |
| 801 | Ga0495677_0045368 | 3300047445 | Bacteria | 1612 |
| 802 | Ga0495679_006905 | 3300047446 | Bacteria | 4816 |
| 803 | Ga0495679_010897 | 3300047446 | Bacteria | 3542 |
| 804 | Ga0495679_047930 | 3300047446 | Bacteria | 1294 |
| 805 | Ga0495685_000314 | 3300047447 | Bacteria | 15766 |
| 806 | Ga0495685_013222 | 3300047447 | Bacteria | 2800 |
| 807 | Ga0495685_036536 | 3300047447 | Bacteria | 1686 |
| 808 | Ga0495673_0000017 | 3300047469 | Bacteria | 574970 |
| 809 | Ga0495673_0000027 | 3300047469 | Bacteria | 475440 |
| 810 | Ga0495673_0040655 | 3300047469 | Bacteria | 2098 |
| 811 | Ga0495681_0000120 | 3300047470 | Bacteria | 69257 |
| 812 | Ga0495681_0001681 | 3300047470 | Bacteria | 16398 |
| 813 | Ga0495681_0004115 | 3300047470 | Bacteria | 10001 |
| 814 | Ga0495681_0004617 | 3300047470 | Bacteria | 9357 |
| 815 | Ga0495681_0043023 | 3300047470 | Bacteria | 2181 |
| 816 | Ga0495681_0067172 | 3300047470 | Bacteria | 1635 |
| 817 | Ga0495681_0100449 | 3300047470 | Bacteria | 1265 |
| 818 | Ga0495684_0159642 | 3300047471 | Bacteria | 1682 |
| 819 | Ga0495686_0000400 | 3300047472 | Bacteria | 68842 |
| 820 | Ga0495686_0002027 | 3300047472 | Bacteria | 19979 |
| 821 | Ga0495686_0002626 | 3300047472 | Bacteria | 16639 |
| 822 | Ga0495686_0006856 | 3300047472 | Bacteria | 8630 |
| 823 | Ga0495686_0012955 | 3300047472 | Bacteria | 5811 |
| 824 | Ga0495686_0061230 | 3300047472 | Bacteria | 2338 |
| 825 | Ga0495686_0108909 | 3300047472 | Bacteria | 1663 |
| 826 | Ga0495593_0051773 | 3300047673 | Bacteria | 2171 |
| 827 | Ga0495602_0006598 | 3300048088 | Bacteria | 12162 |
| 828 | Ga0495614_0026838 | 3300048089 | Bacteria | 2483 |
| 829 | Ga0495626_0000111 | 3300048091 | Bacteria | 105401 |
| 830 | Ga0495626_0000447 | 3300048091 | Bacteria | 41983 |
| 831 | Ga0495626_0000466 | 3300048091 | Bacteria | 41284 |
| 832 | Ga0495626_0003091 | 3300048091 | Bacteria | 10913 |
| 833 | Ga0495626_0004056 | 3300048091 | Bacteria | 9125 |
| 834 | Ga0495626_0011509 | 3300048091 | Bacteria | 4679 |
| 835 | Ga0495626_0012385 | 3300048091 | Bacteria | 4472 |
| 836 | Ga0495626_0014030 | 3300048091 | Bacteria | 4145 |
| 837 | Ga0495626_0021491 | 3300048091 | Bacteria | 3202 |
| 838 | Ga0495626_0025900 | 3300048091 | Bacteria | 2863 |
| 839 | Ga0495626_0031204 | 3300048091 | Bacteria | 2566 |
| 840 | Ga0495626_0033046 | 3300048091 | Bacteria | 2480 |
| 841 | Ga0495626_0063706 | 3300048091 | Bacteria | 1671 |
| 842 | Ga0495626_0087024 | 3300048091 | Bacteria | 1379 |
| 843 | Ga0495626_0088607 | 3300048091 | Bacteria | 1363 |
| 844 | Ga0495626_0107154 | 3300048091 | Bacteria | 1213 |
| 845 | Ga0496100_0049129 | 3300048903 | Bacteria | 2726 |
| 846 | Ga0496100_0066685 | 3300048903 | Bacteria | 2388 |
| 847 | Ga0496100_0130000 | 3300048903 | Bacteria | 1773 |
| 848 | Ga0496100_0139290 | 3300048903 | Bacteria | 1717 |
| 849 | Ga0496101_0003310 | 3300048904 | Bacteria | 10020 |
| 850 | Ga0496101_0068638 | 3300048904 | Bacteria | 2592 |
| 851 | Ga0496102_0000695 | 3300048905 | Bacteria | 33460 |
| 852 | Ga0496102_0002110 | 3300048905 | Bacteria | 17093 |
| 853 | Ga0496102_0107754 | 3300048905 | Bacteria | 2594 |
| 854 | Ga0496102_0124418 | 3300048905 | Bacteria | 2410 |
| 855 | Ga0496102_0216816 | 3300048905 | Bacteria | 1804 |
| 856 | Ga0496103_0138234 | 3300048906 | Bacteria | 1557 |
| 857 | Ga0496104_0094034 | 3300048907 | Bacteria | 2867 |
| 858 | Ga0496105_0035710 | 3300048908 | Bacteria | 4092 |
| 859 | Ga0496107_0037849 | 3300048910 | Bacteria | 3463 |
| 860 | Ga0496107_0197477 | 3300048910 | Bacteria | 1495 |
| 861 | Ga0496108_0142252 | 3300048911 | Bacteria | 2067 |
| 862 | Ga0496109_0027815 | 3300048912 | Bacteria | 5053 |
| 863 | Ga0496109_0194036 | 3300048912 | Bacteria | 1908 |
| 864 | Ga0496110_0000115 | 3300048913 | Bacteria | 44117 |
| 865 | Ga0496110_0005697 | 3300048913 | Bacteria | 9782 |
| 866 | Ga0496110_0027332 | 3300048913 | Bacteria | 4891 |
| 867 | Ga0496110_0085136 | 3300048913 | Bacteria | 2822 |
| 868 | Ga0496110_0571567 | 3300048913 | Bacteria | 1027 |
| 869 | Ga0496112_0003510 | 3300048915 | Bacteria | 12994 |
| 870 | Ga0496112_0115725 | 3300048915 | Bacteria | 2652 |
| 871 | Ga0496113_0004495 | 3300048916 | Bacteria | 8585 |
| 872 | Ga0496113_0004780 | 3300048916 | Bacteria | 8367 |
| 873 | Ga0496114_0019265 | 3300048917 | Bacteria | 5529 |
| 874 | Ga0496114_0031081 | 3300048917 | Bacteria | 4393 |
| 875 | Ga0496114_0572523 | 3300048917 | Bacteria | 997 |
| 876 | Ga0496115_0006309 | 3300048918 | Bacteria | 8677 |
| 877 | Ga0496115_0068407 | 3300048918 | Bacteria | 2875 |
| 878 | Ga0496115_0194782 | 3300048918 | Bacteria | 1674 |
| 879 | Ga0496115_0260149 | 3300048918 | Bacteria | 1427 |
| 880 | Ga0496116_0102625 | 3300048919 | Bacteria | 1704 |
| 881 | Ga0496121_0088460 | 3300048924 | Bacteria | 2428 |
| 882 | Ga0496122_0000169 | 3300048925 | Bacteria | 155380 |
| 883 | Ga0496122_0005065 | 3300048925 | Bacteria | 15917 |
| 884 | Ga0496122_0043701 | 3300048925 | Bacteria | 3507 |
| 885 | Ga0496122_0081748 | 3300048925 | Bacteria | 2247 |
| 886 | Ga0496122_0147630 | 3300048925 | Bacteria | 1458 |
| 887 | Ga0496123_0001570 | 3300048926 | Bacteria | 31269 |
| 888 | Ga0496123_0015729 | 3300048926 | Bacteria | 6189 |
| 889 | Ga0496123_0090097 | 3300048926 | Bacteria | 1825 |
| 890 | Ga0496124_0003298 | 3300048927 | Bacteria | 19899 |
| 891 | Ga0496124_0036446 | 3300048927 | Bacteria | 4289 |
| 892 | Ga0496124_0061129 | 3300048927 | Bacteria | 3158 |
| 893 | Ga0496124_0092766 | 3300048927 | Bacteria | 2459 |
| 894 | Ga0496124_0120874 | 3300048927 | Bacteria | 2093 |
| 895 | Ga0496125_0005514 | 3300048928 | Bacteria | 14021 |
| 896 | Ga0496125_0083230 | 3300048928 | Bacteria | 2435 |
| 897 | Ga0496126_0011339 | 3300048929 | Bacteria | 9241 |
| 898 | Ga0495678_000056 | 3300049459 | Bacteria | 149598 |
| 899 | Ga0495678_000445 | 3300049459 | Bacteria | 41172 |
| 900 | Ga0495678_001377 | 3300049459 | Bacteria | 19384 |
| 901 | Ga0495678_001405 | 3300049459 | Bacteria | 19063 |
| 902 | Ga0495678_001532 | 3300049459 | Bacteria | 17853 |
| 903 | Ga0495678_009979 | 3300049459 | Bacteria | 4647 |
| 904 | Ga0495678_010676 | 3300049459 | Bacteria | 4443 |
| 905 | Ga0495678_028860 | 3300049459 | Bacteria | 2335 |
| 906 | Ga0495682_0001837 | 3300049460 | Bacteria | 10663 |
| 907 | Ga0495682_0014320 | 3300049460 | Bacteria | 3009 |
| 908 | Ga0501032_0042640 | 3300049569 | Bacteria | 3077 |
| 909 | Ga0501033_0000310 | 3300049570 | Bacteria | 46064 |
| 910 | Ga0501034_0276220 | 3300049571 | Bacteria | 1620 |
| 911 | Ga0501046_0001350 | 3300049580 | Bacteria | 23760 |
| 912 | Ga0501047_0060157 | 3300049581 | Bacteria | 3666 |
| 913 | Ga0501047_0168356 | 3300049581 | Bacteria | 2061 |
| 914 | Ga0501048_0087851 | 3300049582 | Bacteria | 2193 |
| 915 | Ga0501070_0152393 | 3300049586 | Bacteria | 1907 |
| 916 | Ga0501230_004770 | 3300049667 | Bacteria | 1884 |
| 917 | Ga0501238_009067 | 3300049671 | Bacteria | 1315 |
| 918 | Ga0501249_005296 | 3300049679 | Bacteria | 2637 |
| 919 | Ga0501080_0247908 | 3300049742 | Bacteria | 1624 |
| 920 | Ga0501269_001829 | 3300049766 | Bacteria | 2699 |
| 921 | Ga0501035_0000681 | 3300049822 | Bacteria | 37186 |
| 922 | Ga0501044_0018545 | 3300049823 | Bacteria | 7456 |
| 923 | nmdc:mga03683_5929_c2 | 3300050489 | Bacteria | 3678 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300032133 | Ga0316583_10001730 | Ga0316583_100017302 | 291 |
| 2 | 3300044842 | Ga0466957_0043321 | Ga0466957_0043321_853_1731 | 291 |
| 3 | 3300048917 | Ga0496114_0572523 | Ga0496114_0572523_54_941 | 295 |
| 4 | 3300048927 | Ga0496124_0092766 | Ga0496124_0092766_352_1239 | 295 |
| 5 | 3300005844 | Ga0068862_100597577 | Ga0068862_1005975772 | 296 |
| 6 | 3300021361 | Ga0213872_10000445 | Ga0213872_1000044526 | 297 |
| 7 | 3300021361 | Ga0213872_10014137 | Ga0213872_100141372 | 297 |
| 8 | 3300039447 | Ga0436361_0009247 | Ga0436361_0009247_4022_4918 | 297 |
| 9 | 3300039447 | Ga0436361_0723519 | Ga0436361_0723519_4909_5847 | 297 |
| 10 | 3300039447 | Ga0436361_1215186 | Ga0436361_1215186_780_1676 | 297 |
| 11 | 3300005338 | Ga0068868_100006875 | Ga0068868_1000068754 | 298 |
| 12 | 3300005353 | Ga0070669_100198677 | Ga0070669_1001986772 | 298 |
| 13 | 3300005355 | Ga0070671_100020363 | Ga0070671_1000203637 | 298 |
| 14 | 3300005367 | Ga0070667_100023680 | Ga0070667_1000236804 | 298 |
| 15 | 3300005435 | Ga0070714_100067850 | Ga0070714_1000678502 | 298 |
| 16 | 3300005842 | Ga0068858_100051445 | Ga0068858_1000514455 | 298 |
| 17 | 3300005985 | Ga0081539_10026170 | Ga0081539_100261704 | 298 |
| 18 | 3300013296 | Ga0157374_10175314 | Ga0157374_101753142 | 298 |
| 19 | 3300013297 | Ga0157378_10010780 | Ga0157378_100107808 | 298 |
| 20 | 3300013308 | Ga0157375_10003068 | Ga0157375_1000306810 | 298 |
| 21 | 3300014968 | Ga0157379_10002346 | Ga0157379_1000234611 | 298 |
| 22 | 3300014969 | Ga0157376_10557923 | Ga0157376_105579232 | 298 |
| 23 | 3300025931 | Ga0207644_10001134 | Ga0207644_1000113411 | 298 |
| 24 | 3300026035 | Ga0207703_10142257 | Ga0207703_101422572 | 298 |
| 25 | 3300026035 | Ga0207703_10243699 | Ga0207703_102436993 | 298 |
| 26 | 3300026067 | Ga0207678_10003137 | Ga0207678_100031372 | 298 |
| 27 | 3300027360 | Ga0209969_1002384 | Ga0209969_10023842 | 298 |
| 28 | 3300027364 | Ga0209967_1002888 | Ga0209967_10028882 | 298 |
| 29 | 3300027471 | Ga0209995_1001642 | Ga0209995_10016423 | 298 |
| 30 | 3300027876 | Ga0209974_10011016 | Ga0209974_100110162 | 298 |
| 31 | 3300028379 | Ga0268266_10310808 | Ga0268266_103108082 | 298 |
| 32 | 3300031344 | Ga0265316_10082703 | Ga0265316_100827032 | 298 |
| 33 | 3300031616 | Ga0307508_10015009 | Ga0307508_100150099 | 298 |
| 34 | 3300035119 | Ga0373956_0072839 | Ga0373956_0072839_128_1024 | 298 |
| 35 | 3300042876 | Ga0451577_0111565 | Ga0451577_0111565_1005_1901 | 298 |
| 36 | 3300003322 | rootL2_10009396 | rootL2_1000939610 | 299 |
| 37 | 3300005330 | Ga0070690_100020510 | Ga0070690_1000205105 | 299 |
| 38 | 3300005334 | Ga0068869_100037903 | Ga0068869_1000379032 | 299 |
| 39 | 3300005335 | Ga0070666_10032555 | Ga0070666_100325552 | 299 |
| 40 | 3300005338 | Ga0068868_100082789 | Ga0068868_1000827893 | 299 |
| 41 | 3300005340 | Ga0070689_100005627 | Ga0070689_1000056276 | 299 |
| 42 | 3300005355 | Ga0070671_100064393 | Ga0070671_1000643933 | 299 |
| 43 | 3300005356 | Ga0070674_100043797 | Ga0070674_1000437971 | 299 |
| 44 | 3300005364 | Ga0070673_100060014 | Ga0070673_1000600142 | 299 |
| 45 | 3300005365 | Ga0070688_100006552 | Ga0070688_1000065525 | 299 |
| 46 | 3300005436 | Ga0070713_100016566 | Ga0070713_1000165665 | 299 |
| 47 | 3300005438 | Ga0070701_10017080 | Ga0070701_100170802 | 299 |
| 48 | 3300005439 | Ga0070711_100004558 | Ga0070711_1000045585 | 299 |
| 49 | 3300005455 | Ga0070663_100087510 | Ga0070663_1000875102 | 299 |
| 50 | 3300005456 | Ga0070678_100109488 | Ga0070678_1001094882 | 299 |
| 51 | 3300005457 | Ga0070662_100023990 | Ga0070662_1000239906 | 299 |
| 52 | 3300005466 | Ga0070685_10014464 | Ga0070685_100144645 | 299 |
| 53 | 3300005547 | Ga0070693_100039090 | Ga0070693_1000390903 | 299 |
| 54 | 3300005548 | Ga0070665_100065246 | Ga0070665_1000652463 | 299 |
| 55 | 3300005614 | Ga0068856_100172908 | Ga0068856_1001729083 | 299 |
| 56 | 3300005617 | Ga0068859_100002774 | Ga0068859_10000277412 | 299 |
| 57 | 3300005618 | Ga0068864_100009230 | Ga0068864_1000092304 | 299 |
| 58 | 3300005842 | Ga0068858_100007106 | Ga0068858_1000071062 | 299 |
| 59 | 3300006163 | Ga0070715_10036954 | Ga0070715_100369542 | 299 |
| 60 | 3300006173 | Ga0070716_100014032 | Ga0070716_1000140325 | 299 |
| 61 | 3300006175 | Ga0070712_100009811 | Ga0070712_1000098113 | 299 |
| 62 | 3300006931 | Ga0097620_100002773 | Ga0097620_10000277312 | 299 |
| 63 | 3300009098 | Ga0105245_10027376 | Ga0105245_100273764 | 299 |
| 64 | 3300009101 | Ga0105247_10052307 | Ga0105247_100523072 | 299 |
| 65 | 3300009148 | Ga0105243_10358876 | Ga0105243_103588762 | 299 |
| 66 | 3300009174 | Ga0105241_10118217 | Ga0105241_101182172 | 299 |
| 67 | 3300009177 | Ga0105248_10032029 | Ga0105248_100320296 | 299 |
| 68 | 3300009551 | Ga0105238_10552830 | Ga0105238_105528302 | 299 |
| 69 | 3300011119 | Ga0105246_10039783 | Ga0105246_100397832 | 299 |
| 70 | 3300013296 | Ga0157374_10001563 | Ga0157374_100015639 | 299 |
| 71 | 3300013297 | Ga0157378_10166752 | Ga0157378_101667522 | 299 |
| 72 | 3300013306 | Ga0163162_10065966 | Ga0163162_100659663 | 299 |
| 73 | 3300013308 | Ga0157375_10077954 | Ga0157375_100779545 | 299 |
| 74 | 3300014325 | Ga0163163_10015755 | Ga0163163_100157554 | 299 |
| 75 | 3300014968 | Ga0157379_10002957 | Ga0157379_1000295710 | 299 |
| 76 | 3300017792 | Ga0163161_10080900 | Ga0163161_100809002 | 299 |
| 77 | 3300025898 | Ga0207692_10034351 | Ga0207692_100343514 | 299 |
| 78 | 3300025903 | Ga0207680_10008458 | Ga0207680_100084586 | 299 |
| 79 | 3300025908 | Ga0207643_10014852 | Ga0207643_100148522 | 299 |
| 80 | 3300025911 | Ga0207654_10083523 | Ga0207654_100835232 | 299 |
| 81 | 3300025914 | Ga0207671_10375100 | Ga0207671_103751001 | 299 |
| 82 | 3300025915 | Ga0207693_10001075 | Ga0207693_1000107521 | 299 |
| 83 | 3300025916 | Ga0207663_10096916 | Ga0207663_100969162 | 299 |
| 84 | 3300025927 | Ga0207687_10006368 | Ga0207687_100063686 | 299 |
| 85 | 3300025928 | Ga0207700_10110504 | Ga0207700_101105043 | 299 |
| 86 | 3300025931 | Ga0207644_10019257 | Ga0207644_100192573 | 299 |
| 87 | 3300025933 | Ga0207706_10010737 | Ga0207706_100107373 | 299 |
| 88 | 3300025934 | Ga0207686_10001787 | Ga0207686_1000178710 | 299 |
| 89 | 3300025934 | Ga0207686_10002503 | Ga0207686_1000250310 | 299 |
| 90 | 3300025936 | Ga0207670_10239855 | Ga0207670_102398552 | 299 |
| 91 | 3300025937 | Ga0207669_10049715 | Ga0207669_100497153 | 299 |
| 92 | 3300025941 | Ga0207711_10002097 | Ga0207711_1000209715 | 299 |
| 93 | 3300025986 | Ga0207658_10249656 | Ga0207658_102496562 | 299 |
| 94 | 3300026023 | Ga0207677_10000445 | Ga0207677_1000044510 | 299 |
| 95 | 3300026035 | Ga0207703_10004139 | Ga0207703_100041398 | 299 |
| 96 | 3300026041 | Ga0207639_10271506 | Ga0207639_102715062 | 299 |
| 97 | 3300026067 | Ga0207678_10375439 | Ga0207678_103754392 | 299 |
| 98 | 3300026078 | Ga0207702_10118852 | Ga0207702_101188522 | 299 |
| 99 | 3300026089 | Ga0207648_10005123 | Ga0207648_100051239 | 299 |
| 100 | 3300026095 | Ga0207676_10040388 | Ga0207676_100403883 | 299 |
| 101 | 3300026121 | Ga0207683_10017560 | Ga0207683_100175604 | 299 |
| 102 | 3300026142 | Ga0207698_10610796 | Ga0207698_106107961 | 299 |
| 103 | 3300028381 | Ga0268264_10032054 | Ga0268264_100320544 | 299 |
| 104 | 3300035117 | Ga0373953_0002218 | Ga0373953_0002218_2728_3762 | 299 |
| 105 | 3300035119 | Ga0373956_0087898 | Ga0373956_0087898_240_1151 | 299 |
| 106 | 3300035171 | Ga0373946_0175447 | Ga0373946_0175447_74_985 | 299 |
| 107 | 3300035691 | Ga0373931_0126268 | Ga0373931_0126268_128_1027 | 299 |
| 108 | 3300035695 | Ga0373927_0031043 | Ga0373927_0031043_2224_3135 | 299 |
| 109 | 3300035724 | Ga0373933_0018138 | Ga0373933_0018138_649_1683 | 299 |
| 110 | 3300036401 | Ga0373937_0041306 | Ga0373937_0041306_643_1677 | 299 |
| 111 | 3300045051 | Ga0451576_0306482 | Ga0451576_0306482_676_1575 | 299 |
| 112 | 3300046459 | Ga0495629_0066865 | Ga0495629_0066865_355_1263 | 299 |
| 113 | 3300046463 | Ga0495653_0084536 | Ga0495653_0084536_1307_2218 | 299 |
| 114 | 3300046473 | Ga0495582_0021915 | Ga0495582_0021915_580_1488 | 299 |
| 115 | 3300046526 | Ga0495666_0085481 | Ga0495666_0085481_55_966 | 299 |
| 116 | 3300046539 | Ga0495621_0010741 | Ga0495621_0010741_1232_2143 | 299 |
| 117 | 3300046543 | Ga0495645_0015082 | Ga0495645_0015082_475_1383 | 299 |
| 118 | 3300046559 | Ga0495667_0054843 | Ga0495667_0054843_306_1217 | 299 |
| 119 | 3300046642 | Ga0495634_0047968 | Ga0495634_0047968_404_1312 | 299 |
| 120 | 3300046663 | Ga0495635_0095315 | Ga0495635_0095315_20_928 | 299 |
| 121 | 3300046664 | Ga0495659_0010884 | Ga0495659_0010884_583_1494 | 299 |
| 122 | 3300046674 | Ga0495588_0083285 | Ga0495588_0083285_708_1619 | 299 |
| 123 | 3300047471 | Ga0495684_0159642 | Ga0495684_0159642_120_1031 | 299 |
| 124 | 3300048903 | Ga0496100_0049129 | Ga0496100_0049129_74_1108 | 299 |
| 125 | 3300048904 | Ga0496101_0068638 | Ga0496101_0068638_773_1684 | 299 |
| 126 | 3300048907 | Ga0496104_0094034 | Ga0496104_0094034_207_1118 | 299 |
| 127 | 3300048908 | Ga0496105_0035710 | Ga0496105_0035710_2367_3278 | 299 |
| 128 | 3300048910 | Ga0496107_0037849 | Ga0496107_0037849_478_1389 | 299 |
| 129 | 3300048912 | Ga0496109_0194036 | Ga0496109_0194036_860_1888 | 299 |
| 130 | 3300048915 | Ga0496112_0003510 | Ga0496112_0003510_10870_11781 | 299 |
| 131 | 3300048917 | Ga0496114_0019265 | Ga0496114_0019265_1026_2060 | 299 |
| 132 | 3300048918 | Ga0496115_0068407 | Ga0496115_0068407_986_1897 | 299 |
| 133 | iso_pu_bacteria | 2643221554 | 2643787618 | 299 |
| 134 | iso_pu_bacteria | 2643221556 | 2643797951 | 299 |
| 135 | iso_pu_bacteria | 2643221638 | 2644213499 | 299 |
| 136 | iso_pu_bacteria | 2643221645 | 2644250983 | 299 |
| 137 | iso_pu_bacteria | 2643221664 | 2644356401 | 299 |
| 138 | iso_pu_bacteria | 2643221684 | 2644473130 | 299 |
| 139 | iso_pu_bacteria | 2738541280 | 2738738957 | 299 |
| 140 | iso_pu_bacteria | 2738541300 | 2738844859 | 299 |
| 141 | iso_pu_bacteria | 2738543018 | 2739276376 | 299 |
| 142 | iso_pu_bacteria | 2738543030 | 2739345100 | 299 |
| 143 | iso_pu_bacteria | 2808606418 | 2809144416 | 299 |
| 144 | iso_pu_bacteria | 8047673197 | 8047677947 | 299 |
| 145 | 3300005328 | Ga0070676_10001315 | Ga0070676_100013159 | 300 |
| 146 | 3300005334 | Ga0068869_100001107 | Ga0068869_1000011076 | 300 |
| 147 | 3300005335 | Ga0070666_10001383 | Ga0070666_1000138312 | 300 |
| 148 | 3300005338 | Ga0068868_100000331 | Ga0068868_10000033120 | 300 |
| 149 | 3300005340 | Ga0070689_100092781 | Ga0070689_1000927812 | 300 |
| 150 | 3300005347 | Ga0070668_100001693 | Ga0070668_1000016939 | 300 |
| 151 | 3300005353 | Ga0070669_100003085 | Ga0070669_1000030855 | 300 |
| 152 | 3300005354 | Ga0070675_100002186 | Ga0070675_1000021864 | 300 |
| 153 | 3300005355 | Ga0070671_100007917 | Ga0070671_1000079178 | 300 |
| 154 | 3300005365 | Ga0070688_100009264 | Ga0070688_1000092647 | 300 |
| 155 | 3300005367 | Ga0070667_100005247 | Ga0070667_1000052475 | 300 |
| 156 | 3300005456 | Ga0070678_100000798 | Ga0070678_10000079810 | 300 |
| 157 | 3300005459 | Ga0068867_100007157 | Ga0068867_1000071577 | 300 |
| 158 | 3300005466 | Ga0070685_10266534 | Ga0070685_102665341 | 300 |
| 159 | 3300005539 | Ga0068853_100095955 | Ga0068853_1000959554 | 300 |
| 160 | 3300005543 | Ga0070672_100001410 | Ga0070672_1000014109 | 300 |
| 161 | 3300005548 | Ga0070665_100038140 | Ga0070665_1000381402 | 300 |
| 162 | 3300005616 | Ga0068852_100548403 | Ga0068852_1005484032 | 300 |
| 163 | 3300005617 | Ga0068859_100034777 | Ga0068859_1000347777 | 300 |
| 164 | 3300005617 | Ga0068859_100185696 | Ga0068859_1001856963 | 300 |
| 165 | 3300005719 | Ga0068861_100036870 | Ga0068861_1000368705 | 300 |
| 166 | 3300005841 | Ga0068863_100000926 | Ga0068863_1000009269 | 300 |
| 167 | 3300005842 | Ga0068858_100003386 | Ga0068858_1000033869 | 300 |
| 168 | 3300005843 | Ga0068860_100001199 | Ga0068860_10000119921 | 300 |
| 169 | 3300005843 | Ga0068860_100092271 | Ga0068860_1000922713 | 300 |
| 170 | 3300005843 | Ga0068860_100219055 | Ga0068860_1002190552 | 300 |
| 171 | 3300005844 | Ga0068862_100067366 | Ga0068862_1000673663 | 300 |
| 172 | 3300006237 | Ga0097621_100001144 | Ga0097621_1000011449 | 300 |
| 173 | 3300006358 | Ga0068871_100007416 | Ga0068871_1000074163 | 300 |
| 174 | 3300006881 | Ga0068865_100009861 | Ga0068865_1000098614 | 300 |
| 175 | 3300006931 | Ga0097620_100034777 | Ga0097620_1000347777 | 300 |
| 176 | 3300006931 | Ga0097620_100185700 | Ga0097620_1001857002 | 300 |
| 177 | 3300009148 | Ga0105243_10150580 | Ga0105243_101505803 | 300 |
| 178 | 3300009177 | Ga0105248_10002137 | Ga0105248_1000213710 | 300 |
| 179 | 3300009553 | Ga0105249_10134945 | Ga0105249_101349453 | 300 |
| 180 | 3300013296 | Ga0157374_10033572 | Ga0157374_100335724 | 300 |
| 181 | 3300013297 | Ga0157378_10200105 | Ga0157378_102001053 | 300 |
| 182 | 3300013308 | Ga0157375_10001643 | Ga0157375_100016439 | 300 |
| 183 | 3300014325 | Ga0163163_10466826 | Ga0163163_104668262 | 300 |
| 184 | 3300025315 | Ga0207697_10008739 | Ga0207697_100087395 | 300 |
| 185 | 3300025893 | Ga0207682_10010099 | Ga0207682_100100992 | 300 |
| 186 | 3300025903 | Ga0207680_10001994 | Ga0207680_100019949 | 300 |
| 187 | 3300025907 | Ga0207645_10000241 | Ga0207645_1000024139 | 300 |
| 188 | 3300025923 | Ga0207681_10000854 | Ga0207681_100008548 | 300 |
| 189 | 3300025925 | Ga0207650_10136839 | Ga0207650_101368392 | 300 |
| 190 | 3300025926 | Ga0207659_10000360 | Ga0207659_1000036019 | 300 |
| 191 | 3300025931 | Ga0207644_10007005 | Ga0207644_100070058 | 300 |
| 192 | 3300025936 | Ga0207670_10030426 | Ga0207670_100304263 | 300 |
| 193 | 3300025937 | Ga0207669_10021494 | Ga0207669_100214943 | 300 |
| 194 | 3300025938 | Ga0207704_10001298 | Ga0207704_100012989 | 300 |
| 195 | 3300025940 | Ga0207691_10000368 | Ga0207691_1000036839 | 300 |
| 196 | 3300025941 | Ga0207711_10007086 | Ga0207711_100070867 | 300 |
| 197 | 3300025942 | Ga0207689_10008074 | Ga0207689_100080748 | 300 |
| 198 | 3300025960 | Ga0207651_10008735 | Ga0207651_100087352 | 300 |
| 199 | 3300025961 | Ga0207712_10126994 | Ga0207712_101269942 | 300 |
| 200 | 3300025972 | Ga0207668_10001355 | Ga0207668_100013559 | 300 |
| 201 | 3300025986 | Ga0207658_10001026 | Ga0207658_1000102616 | 300 |
| 202 | 3300026023 | Ga0207677_10000770 | Ga0207677_1000077011 | 300 |
| 203 | 3300026035 | Ga0207703_10002365 | Ga0207703_100023655 | 300 |
| 204 | 3300026041 | Ga0207639_10075092 | Ga0207639_100750924 | 300 |
| 205 | 3300026088 | Ga0207641_10000735 | Ga0207641_1000073527 | 300 |
| 206 | 3300026089 | Ga0207648_10000089 | Ga0207648_100000899 | 300 |
| 207 | 3300026095 | Ga0207676_10024266 | Ga0207676_100242662 | 300 |
| 208 | 3300026121 | Ga0207683_10000325 | Ga0207683_1000032527 | 300 |
| 209 | 3300026142 | Ga0207698_10551847 | Ga0207698_105518472 | 300 |
| 210 | 3300028380 | Ga0268265_10030585 | Ga0268265_100305853 | 300 |
| 211 | 3300028381 | Ga0268264_10007381 | Ga0268264_100073819 | 300 |
| 212 | 3300028381 | Ga0268264_10218693 | Ga0268264_102186932 | 300 |
| 213 | 3300045051 | Ga0451576_0034641 | Ga0451576_0034641_4065_4967 | 300 |
| 214 | 3300045051 | Ga0451576_0035992 | Ga0451576_0035992_612_1514 | 300 |
| 215 | 3300046501 | Ga0495607_0006952 | Ga0495607_0006952_4760_5671 | 300 |
| 216 | 3300046558 | Ga0495633_0019683 | Ga0495633_0019683_1744_2655 | 300 |
| 217 | 3300048903 | Ga0496100_0130000 | Ga0496100_0130000_487_1395 | 300 |
| 218 | 3300048910 | Ga0496107_0197477 | Ga0496107_0197477_11_919 | 300 |
| 219 | 3300048913 | Ga0496110_0085136 | Ga0496110_0085136_1233_2141 | 300 |
| 220 | 3300048917 | Ga0496114_0031081 | Ga0496114_0031081_20_928 | 300 |
| 221 | 3300048919 | Ga0496116_0102625 | Ga0496116_0102625_546_1457 | 300 |
| 222 | iso_pu_bacteria | 2521172590 | 2521559462 | 300 |
| 223 | iso_pu_bacteria | 2551306416 | 2553007169 | 300 |
| 224 | iso_pu_bacteria | 2738541297 | 2738825328 | 300 |
| 225 | iso_pu_bacteria | 2738541357 | 2739149125 | 300 |
| 226 | iso_pu_bacteria | 2738543003 | 2739191044 | 300 |
| 227 | iso_pu_bacteria | 2738543026 | 2739317521 | 300 |
| 228 | iso_pu_bacteria | 2738543029 | 2739335762 | 300 |
| 229 | iso_pu_bacteria | 2818991449 | 2819616304 | 300 |
| 230 | iso_pu_bacteria | 2821131069 | 2821133915 | 300 |
| 231 | iso_pu_bacteria | 2842711865 | 2842716612 | 300 |
| 232 | iso_pu_bacteria | 2857553236 | 2857554010 | 300 |
| 233 | iso_pu_bacteria | 2857558681 | 2857563693 | 300 |
| 234 | iso_pu_bacteria | 2857564685 | 2857565708 | 300 |
| 235 | iso_pu_bacteria | 2904424332 | 2904429238 | 300 |
| 236 | iso_pu_bacteria | 2904439833 | 2904443054 | 300 |
| 237 | iso_pu_bacteria | 2904530477 | 2904532795 | 300 |
| 238 | iso_pu_bacteria | 2904584206 | 2904585353 | 300 |
| 239 | iso_pu_bacteria | 2904589729 | 2904593702 | 300 |
| 240 | iso_pu_bacteria | 2904601388 | 2904604152 | 300 |
| 241 | iso_pu_bacteria | 2919046199 | 2919047888 | 300 |
| 242 | iso_pu_bacteria | 2919079590 | 2919081620 | 300 |
| 243 | iso_pu_bacteria | 2923510766 | 2923513203 | 300 |
| 244 | 3300005578 | Ga0068854_100006043 | Ga0068854_1000060434 | 301 |
| 245 | 3300005834 | Ga0068851_10060445 | Ga0068851_100604453 | 301 |
| 246 | 3300009093 | Ga0105240_10080810 | Ga0105240_100808104 | 301 |
| 247 | 3300009545 | Ga0105237_10014808 | Ga0105237_100148085 | 301 |
| 248 | 3300009551 | Ga0105238_10000128 | Ga0105238_1000012846 | 301 |
| 249 | 3300010375 | Ga0105239_10035925 | Ga0105239_100359256 | 301 |
| 250 | 3300015261 | Ga0182006_1032933 | Ga0182006_10329332 | 301 |
| 251 | 3300025913 | Ga0207695_10002390 | Ga0207695_1000239013 | 301 |
| 252 | 3300025914 | Ga0207671_10017201 | Ga0207671_100172014 | 301 |
| 253 | 3300025914 | Ga0207671_10188751 | Ga0207671_101887512 | 301 |
| 254 | 3300025924 | Ga0207694_10000845 | Ga0207694_100008455 | 301 |
| 255 | 3300025949 | Ga0207667_10021146 | Ga0207667_100211462 | 301 |
| 256 | 3300031665 | Ga0316575_10005640 | Ga0316575_100056403 | 301 |
| 257 | 3300031727 | Ga0316576_10022273 | Ga0316576_100222733 | 301 |
| 258 | 3300035398 | Ga0316574_0004167 | Ga0316574_0004167_4494_5402 | 301 |
| 259 | 3300038443 | Ga0395901_0011675 | Ga0395901_0011675_995_1927 | 301 |
| 260 | 3300042876 | Ga0451577_0012494 | Ga0451577_0012494_332_1237 | 301 |
| 261 | 3300044672 | Ga0466982_0102547 | Ga0466982_0102547_447_1355 | 301 |
| 262 | 3300044712 | Ga0453684_0001170 | Ga0453684_0001170_8520_9425 | 301 |
| 263 | 3300048913 | Ga0496110_0027332 | Ga0496110_0027332_2383_3294 | 301 |
| 264 | 3300002987 | JGI25159J45721_1004567 | JGI25159J45721_10045676 | 302 |
| 265 | 3300003759 | Ga0055525_1000009 | Ga0055525_1000009163 | 302 |
| 266 | 3300003771 | Ga0055526_1000031 | Ga0055526_1000031125 | 302 |
| 267 | 3300003771 | Ga0055526_1000353 | Ga0055526_100035318 | 302 |
| 268 | 3300005262 | Ga0065165_1000050 | Ga0065165_1000050164 | 302 |
| 269 | 3300005262 | Ga0065165_1005080 | Ga0065165_10050804 | 302 |
| 270 | 3300005262 | Ga0065165_1017345 | Ga0065165_10173452 | 302 |
| 271 | 3300005327 | Ga0070658_10177107 | Ga0070658_101771072 | 302 |
| 272 | 3300005328 | Ga0070676_10133772 | Ga0070676_101337721 | 302 |
| 273 | 3300005334 | Ga0068869_100363850 | Ga0068869_1003638501 | 302 |
| 274 | 3300005339 | Ga0070660_100050275 | Ga0070660_1000502752 | 302 |
| 275 | 3300005339 | Ga0070660_100282411 | Ga0070660_1002824111 | 302 |
| 276 | 3300005339 | Ga0070660_100319704 | Ga0070660_1003197041 | 302 |
| 277 | 3300005347 | Ga0070668_100206874 | Ga0070668_1002068742 | 302 |
| 278 | 3300005347 | Ga0070668_100235032 | Ga0070668_1002350322 | 302 |
| 279 | 3300005356 | Ga0070674_100148059 | Ga0070674_1001480592 | 302 |
| 280 | 3300005366 | Ga0070659_100038837 | Ga0070659_1000388373 | 302 |
| 281 | 3300005548 | Ga0070665_100219112 | Ga0070665_1002191121 | 302 |
| 282 | 3300005563 | Ga0068855_100256773 | Ga0068855_1002567732 | 302 |
| 283 | 3300005564 | Ga0070664_100056056 | Ga0070664_1000560562 | 302 |
| 284 | 3300005564 | Ga0070664_100170171 | Ga0070664_1001701711 | 302 |
| 285 | 3300005564 | Ga0070664_100239926 | Ga0070664_1002399262 | 302 |
| 286 | 3300005616 | Ga0068852_100129539 | Ga0068852_1001295392 | 302 |
| 287 | 3300005719 | Ga0068861_100186646 | Ga0068861_1001866462 | 302 |
| 288 | 3300009036 | Ga0105244_10005513 | Ga0105244_100055134 | 302 |
| 289 | 3300009174 | Ga0105241_10003069 | Ga0105241_100030699 | 302 |
| 290 | 3300009176 | Ga0105242_10042701 | Ga0105242_100427013 | 302 |
| 291 | 3300010375 | Ga0105239_10153799 | Ga0105239_101537992 | 302 |
| 292 | 3300013102 | Ga0157371_10000001 | Ga0157371_10000001748 | 302 |
| 293 | 3300013297 | Ga0157378_10136997 | Ga0157378_101369973 | 302 |
| 294 | 3300014326 | Ga0157380_10226632 | Ga0157380_102266322 | 302 |
| 295 | 3300025230 | Ga0209563_100015 | Ga0209563_100015278 | 302 |
| 296 | 3300025254 | Ga0209148_1000298 | Ga0209148_10002982 | 302 |
| 297 | 3300025284 | Ga0209130_1000065 | Ga0209130_1000065163 | 302 |
| 298 | 3300025295 | Ga0209564_1000038 | Ga0209564_1000038219 | 302 |
| 299 | 3300025728 | Ga0207655_1005668 | Ga0207655_10056684 | 302 |
| 300 | 3300025909 | Ga0207705_10090074 | Ga0207705_100900742 | 302 |
| 301 | 3300025909 | Ga0207705_10297130 | Ga0207705_102971301 | 302 |
| 302 | 3300025911 | Ga0207654_10001747 | Ga0207654_100017475 | 302 |
| 303 | 3300025913 | Ga0207695_10126941 | Ga0207695_101269412 | 302 |
| 304 | 3300025919 | Ga0207657_10040736 | Ga0207657_100407363 | 302 |
| 305 | 3300025919 | Ga0207657_10155290 | Ga0207657_101552901 | 302 |
| 306 | 3300025923 | Ga0207681_10191714 | Ga0207681_101917142 | 302 |
| 307 | 3300025924 | Ga0207694_10077396 | Ga0207694_100773962 | 302 |
| 308 | 3300025927 | Ga0207687_10151995 | Ga0207687_101519951 | 302 |
| 309 | 3300025932 | Ga0207690_10301835 | Ga0207690_103018352 | 302 |
| 310 | 3300025933 | Ga0207706_10061898 | Ga0207706_100618982 | 302 |
| 311 | 3300025934 | Ga0207686_10006141 | Ga0207686_100061413 | 302 |
| 312 | 3300025935 | Ga0207709_10008577 | Ga0207709_100085774 | 302 |
| 313 | 3300025940 | Ga0207691_10005465 | Ga0207691_100054653 | 302 |
| 314 | 3300025940 | Ga0207691_10128155 | Ga0207691_101281551 | 302 |
| 315 | 3300025945 | Ga0207679_10160074 | Ga0207679_101600742 | 302 |
| 316 | 3300025949 | Ga0207667_10015504 | Ga0207667_100155043 | 302 |
| 317 | 3300025972 | Ga0207668_10028645 | Ga0207668_100286452 | 302 |
| 318 | 3300025972 | Ga0207668_10236949 | Ga0207668_102369492 | 302 |
| 319 | 3300025986 | Ga0207658_10021933 | Ga0207658_100219333 | 302 |
| 320 | 3300026089 | Ga0207648_10065744 | Ga0207648_100657445 | 302 |
| 321 | 3300028379 | Ga0268266_10049672 | Ga0268266_100496724 | 302 |
| 322 | 3300028379 | Ga0268266_10084049 | Ga0268266_100840492 | 302 |
| 323 | 3300031838 | Ga0307518_10143660 | Ga0307518_101436601 | 302 |
| 324 | 3300032168 | Ga0316593_10003127 | Ga0316593_100031272 | 302 |
| 325 | 3300036647 | Ga0316582_0038410 | Ga0316582_0038410_896_1807 | 302 |
| 326 | 3300037312 | Ga0395899_0000141 | Ga0395899_0000141_83674_84585 | 302 |
| 327 | 3300037312 | Ga0395899_0004028 | Ga0395899_0004028_9061_9972 | 302 |
| 328 | 3300037312 | Ga0395899_0010706 | Ga0395899_0010706_4275_5186 | 302 |
| 329 | 3300037312 | Ga0395899_0023526 | Ga0395899_0023526_1899_2810 | 302 |
| 330 | 3300037312 | Ga0395899_0067119 | Ga0395899_0067119_420_1331 | 302 |
| 331 | 3300037418 | Ga0395900_0000931 | Ga0395900_0000931_3246_4157 | 302 |
| 332 | 3300037418 | Ga0395900_0010308 | Ga0395900_0010308_1506_2417 | 302 |
| 333 | 3300037418 | Ga0395900_0017608 | Ga0395900_0017608_1705_2616 | 302 |
| 334 | 3300037418 | Ga0395900_0025668 | Ga0395900_0025668_858_1769 | 302 |
| 335 | 3300037418 | Ga0395900_0026208 | Ga0395900_0026208_4275_5186 | 302 |
| 336 | 3300037418 | Ga0395900_0059676 | Ga0395900_0059676_395_1306 | 302 |
| 337 | 3300037418 | Ga0395900_0072612 | Ga0395900_0072612_1918_2829 | 302 |
| 338 | 3300037418 | Ga0395900_0092912 | Ga0395900_0092912_1480_2391 | 302 |
| 339 | 3300037418 | Ga0395900_0115884 | Ga0395900_0115884_716_1627 | 302 |
| 340 | 3300037418 | Ga0395900_0188808 | Ga0395900_0188808_349_1260 | 302 |
| 341 | 3300037418 | Ga0395900_0364293 | Ga0395900_0364293_95_1006 | 302 |
| 342 | 3300037418 | Ga0395900_0394428 | Ga0395900_0394428_11_922 | 302 |
| 343 | 3300037466 | Ga0395898_0019806 | Ga0395898_0019806_722_1633 | 302 |
| 344 | 3300037466 | Ga0395898_0053522 | Ga0395898_0053522_702_1613 | 302 |
| 345 | 3300037466 | Ga0395898_0090996 | Ga0395898_0090996_772_1683 | 302 |
| 346 | 3300037466 | Ga0395898_0140183 | Ga0395898_0140183_53_964 | 302 |
| 347 | 3300037466 | Ga0395898_0223464 | Ga0395898_0223464_280_1191 | 302 |
| 348 | 3300037471 | Ga0395905_0022278 | Ga0395905_0022278_1898_2809 | 302 |
| 349 | 3300037471 | Ga0395905_0075356 | Ga0395905_0075356_1706_2617 | 302 |
| 350 | 3300037471 | Ga0395905_0077736 | Ga0395905_0077736_1941_2852 | 302 |
| 351 | 3300037471 | Ga0395905_0145899 | Ga0395905_0145899_691_1602 | 302 |
| 352 | 3300037471 | Ga0395905_0154759 | Ga0395905_0154759_444_1355 | 302 |
| 353 | 3300038443 | Ga0395901_0000073 | Ga0395901_0000073_8423_9334 | 302 |
| 354 | 3300038443 | Ga0395901_0027144 | Ga0395901_0027144_715_1626 | 302 |
| 355 | 3300038443 | Ga0395901_0118509 | Ga0395901_0118509_820_1731 | 302 |
| 356 | 3300038443 | Ga0395901_0124851 | Ga0395901_0124851_259_1170 | 302 |
| 357 | 3300041413 | Ga0439465_0071992 | Ga0439465_0071992_36_947 | 302 |
| 358 | 3300042005 | Ga0439448_0000618 | Ga0439448_0000618_1875_2786 | 302 |
| 359 | 3300042007 | Ga0439449_0012815 | Ga0439449_0012815_1922_2833 | 302 |
| 360 | 3300042012 | Ga0439455_0000720 | Ga0439455_0000720_3262_4173 | 302 |
| 361 | 3300042012 | Ga0439455_0017695 | Ga0439455_0017695_148_1059 | 302 |
| 362 | 3300042139 | Ga0450904_001280 | Ga0450904_001280_162_1073 | 302 |
| 363 | 3300044656 | Ga0466969_0049147 | Ga0466969_0049147_584_1495 | 302 |
| 364 | 3300044658 | Ga0466972_0002165 | Ga0466972_0002165_5276_6187 | 302 |
| 365 | 3300044683 | Ga0466965_0005989 | Ga0466965_0005989_3853_4764 | 302 |
| 366 | 3300044683 | Ga0466965_0018625 | Ga0466965_0018625_2343_3254 | 302 |
| 367 | 3300044683 | Ga0466965_0049445 | Ga0466965_0049445_330_1241 | 302 |
| 368 | 3300044683 | Ga0466965_0103249 | Ga0466965_0103249_46_1014 | 302 |
| 369 | 3300044684 | Ga0466966_0005054 | Ga0466966_0005054_531_1442 | 302 |
| 370 | 3300044706 | Ga0466964_0005017 | Ga0466964_0005017_3374_4285 | 302 |
| 371 | 3300044706 | Ga0466964_0016497 | Ga0466964_0016497_450_1445 | 302 |
| 372 | 3300044735 | Ga0466968_0004913 | Ga0466968_0004913_399_1310 | 302 |
| 373 | 3300044842 | Ga0466957_0000115 | Ga0466957_0000115_14150_15061 | 302 |
| 374 | 3300044842 | Ga0466957_0091847 | Ga0466957_0091847_808_1719 | 302 |
| 375 | 3300045049 | Ga0466959_0005620 | Ga0466959_0005620_4442_5353 | 302 |
| 376 | 3300045976 | Ga0466967_0010104 | Ga0466967_0010104_3313_4224 | 302 |
| 377 | 3300045976 | Ga0466967_0097150 | Ga0466967_0097150_730_1695 | 302 |
| 378 | 3300045976 | Ga0466967_0284104 | Ga0466967_0284104_642_1553 | 302 |
| 379 | 3300046452 | Ga0495617_000002 | Ga0495617_000002_450146_451057 | 302 |
| 380 | 3300046452 | Ga0495617_005082 | Ga0495617_005082_3359_4270 | 302 |
| 381 | 3300046452 | Ga0495617_029597 | Ga0495617_029597_789_1700 | 302 |
| 382 | 3300046453 | Ga0495627_001506 | Ga0495627_001506_4575_5486 | 302 |
| 383 | 3300046453 | Ga0495627_005062 | Ga0495627_005062_818_1729 | 302 |
| 384 | 3300046455 | Ga0495603_0041037 | Ga0495603_0041037_22_933 | 302 |
| 385 | 3300046457 | Ga0495590_0000007 | Ga0495590_0000007_222469_223380 | 302 |
| 386 | 3300046457 | Ga0495590_0010883 | Ga0495590_0010883_127_1038 | 302 |
| 387 | 3300046457 | Ga0495590_0056733 | Ga0495590_0056733_437_1348 | 302 |
| 388 | 3300046458 | Ga0495591_000062 | Ga0495591_000062_119113_120024 | 302 |
| 389 | 3300046458 | Ga0495591_009009 | Ga0495591_009009_2740_3651 | 302 |
| 390 | 3300046459 | Ga0495629_0066316 | Ga0495629_0066316_1153_2064 | 302 |
| 391 | 3300046460 | Ga0495638_0005843 | Ga0495638_0005843_2478_3389 | 302 |
| 392 | 3300046463 | Ga0495653_0025531 | Ga0495653_0025531_3450_4361 | 302 |
| 393 | 3300046463 | Ga0495653_0030532 | Ga0495653_0030532_1703_2614 | 302 |
| 394 | 3300046463 | Ga0495653_0085475 | Ga0495653_0085475_450_1361 | 302 |
| 395 | 3300046471 | Ga0495650_0002253 | Ga0495650_0002253_9211_10134 | 302 |
| 396 | 3300046471 | Ga0495650_0003039 | Ga0495650_0003039_3857_4768 | 302 |
| 397 | 3300046471 | Ga0495650_0031742 | Ga0495650_0031742_819_1730 | 302 |
| 398 | 3300046472 | Ga0495580_0008499 | Ga0495580_0008499_5807_6718 | 302 |
| 399 | 3300046474 | Ga0495605_0000063 | Ga0495605_0000063_125426_126337 | 302 |
| 400 | 3300046474 | Ga0495605_0001463 | Ga0495605_0001463_12090_13001 | 302 |
| 401 | 3300046474 | Ga0495605_0008808 | Ga0495605_0008808_846_1757 | 302 |
| 402 | 3300046474 | Ga0495605_0009267 | Ga0495605_0009267_901_1812 | 302 |
| 403 | 3300046474 | Ga0495605_0015996 | Ga0495605_0015996_936_1847 | 302 |
| 404 | 3300046474 | Ga0495605_0024268 | Ga0495605_0024268_1270_2181 | 302 |
| 405 | 3300046474 | Ga0495605_0034912 | Ga0495605_0034912_791_1702 | 302 |
| 406 | 3300046474 | Ga0495605_0079164 | Ga0495605_0079164_544_1455 | 302 |
| 407 | 3300046491 | Ga0495584_0000010 | Ga0495584_0000010_82907_83818 | 302 |
| 408 | 3300046491 | Ga0495584_0001432 | Ga0495584_0001432_10099_11010 | 302 |
| 409 | 3300046491 | Ga0495584_0003242 | Ga0495584_0003242_3635_4546 | 302 |
| 410 | 3300046491 | Ga0495584_0003373 | Ga0495584_0003373_2963_3874 | 302 |
| 411 | 3300046491 | Ga0495584_0011566 | Ga0495584_0011566_2231_3229 | 302 |
| 412 | 3300046491 | Ga0495584_0026860 | Ga0495584_0026860_538_1449 | 302 |
| 413 | 3300046491 | Ga0495584_0031526 | Ga0495584_0031526_1009_1920 | 302 |
| 414 | 3300046491 | Ga0495584_0112658 | Ga0495584_0112658_170_1081 | 302 |
| 415 | 3300046491 | Ga0495584_0160244 | Ga0495584_0160244_23_934 | 302 |
| 416 | 3300046492 | Ga0495585_0000006 | Ga0495585_0000006_92986_93897 | 302 |
| 417 | 3300046492 | Ga0495585_0000592 | Ga0495585_0000592_32302_33213 | 302 |
| 418 | 3300046492 | Ga0495585_0001217 | Ga0495585_0001217_18437_19348 | 302 |
| 419 | 3300046492 | Ga0495585_0002703 | Ga0495585_0002703_7833_8744 | 302 |
| 420 | 3300046492 | Ga0495585_0002955 | Ga0495585_0002955_3778_4689 | 302 |
| 421 | 3300046492 | Ga0495585_0003583 | Ga0495585_0003583_9398_10309 | 302 |
| 422 | 3300046492 | Ga0495585_0005077 | Ga0495585_0005077_2693_3604 | 302 |
| 423 | 3300046492 | Ga0495585_0006007 | Ga0495585_0006007_692_1603 | 302 |
| 424 | 3300046492 | Ga0495585_0014015 | Ga0495585_0014015_1410_2321 | 302 |
| 425 | 3300046492 | Ga0495585_0016934 | Ga0495585_0016934_1950_2861 | 302 |
| 426 | 3300046492 | Ga0495585_0018950 | Ga0495585_0018950_2325_3236 | 302 |
| 427 | 3300046492 | Ga0495585_0022375 | Ga0495585_0022375_1848_2759 | 302 |
| 428 | 3300046492 | Ga0495585_0043853 | Ga0495585_0043853_976_1887 | 302 |
| 429 | 3300046492 | Ga0495585_0052966 | Ga0495585_0052966_615_1526 | 302 |
| 430 | 3300046492 | Ga0495585_0193990 | Ga0495585_0193990_16_927 | 302 |
| 431 | 3300046492 | Ga0495585_0198054 | Ga0495585_0198054_77_988 | 302 |
| 432 | 3300046499 | Ga0495594_0003275 | Ga0495594_0003275_2252_3160 | 302 |
| 433 | 3300046499 | Ga0495594_0010522 | Ga0495594_0010522_3252_4163 | 302 |
| 434 | 3300046499 | Ga0495594_0026451 | Ga0495594_0026451_1824_2735 | 302 |
| 435 | 3300046500 | Ga0495596_0000130 | Ga0495596_0000130_50875_51786 | 302 |
| 436 | 3300046500 | Ga0495596_0000217 | Ga0495596_0000217_12248_13159 | 302 |
| 437 | 3300046500 | Ga0495596_0005367 | Ga0495596_0005367_613_1524 | 302 |
| 438 | 3300046500 | Ga0495596_0006498 | Ga0495596_0006498_1467_2378 | 302 |
| 439 | 3300046500 | Ga0495596_0006913 | Ga0495596_0006913_3505_4416 | 302 |
| 440 | 3300046500 | Ga0495596_0009275 | Ga0495596_0009275_873_1784 | 302 |
| 441 | 3300046500 | Ga0495596_0012662 | Ga0495596_0012662_2223_3134 | 302 |
| 442 | 3300046500 | Ga0495596_0013081 | Ga0495596_0013081_1036_1947 | 302 |
| 443 | 3300046500 | Ga0495596_0024539 | Ga0495596_0024539_727_1638 | 302 |
| 444 | 3300046500 | Ga0495596_0047213 | Ga0495596_0047213_52_963 | 302 |
| 445 | 3300046501 | Ga0495607_0002839 | Ga0495607_0002839_10070_10981 | 302 |
| 446 | 3300046501 | Ga0495607_0003658 | Ga0495607_0003658_9454_10365 | 302 |
| 447 | 3300046501 | Ga0495607_0006211 | Ga0495607_0006211_4550_5461 | 302 |
| 448 | 3300046501 | Ga0495607_0006855 | Ga0495607_0006855_3098_4009 | 302 |
| 449 | 3300046501 | Ga0495607_0015837 | Ga0495607_0015837_834_1745 | 302 |
| 450 | 3300046501 | Ga0495607_0030511 | Ga0495607_0030511_2382_3293 | 302 |
| 451 | 3300046501 | Ga0495607_0046410 | Ga0495607_0046410_723_1634 | 302 |
| 452 | 3300046501 | Ga0495607_0085712 | Ga0495607_0085712_605_1516 | 302 |
| 453 | 3300046501 | Ga0495607_0094933 | Ga0495607_0094933_666_1577 | 302 |
| 454 | 3300046501 | Ga0495607_0154182 | Ga0495607_0154182_205_1116 | 302 |
| 455 | 3300046506 | Ga0495583_0000084 | Ga0495583_0000084_114454_115365 | 302 |
| 456 | 3300046506 | Ga0495583_0001063 | Ga0495583_0001063_1172_2083 | 302 |
| 457 | 3300046506 | Ga0495583_0001851 | Ga0495583_0001851_222_1133 | 302 |
| 458 | 3300046506 | Ga0495583_0002627 | Ga0495583_0002627_4493_5404 | 302 |
| 459 | 3300046506 | Ga0495583_0003369 | Ga0495583_0003369_3734_4645 | 302 |
| 460 | 3300046506 | Ga0495583_0003430 | Ga0495583_0003430_667_1578 | 302 |
| 461 | 3300046506 | Ga0495583_0018264 | Ga0495583_0018264_1660_2571 | 302 |
| 462 | 3300046506 | Ga0495583_0023407 | Ga0495583_0023407_1238_2149 | 302 |
| 463 | 3300046506 | Ga0495583_0026989 | Ga0495583_0026989_1116_2027 | 302 |
| 464 | 3300046506 | Ga0495583_0028565 | Ga0495583_0028565_977_1888 | 302 |
| 465 | 3300046506 | Ga0495583_0036094 | Ga0495583_0036094_516_1427 | 302 |
| 466 | 3300046507 | Ga0495606_0016464 | Ga0495606_0016464_1881_2792 | 302 |
| 467 | 3300046507 | Ga0495606_0020128 | Ga0495606_0020128_3868_4779 | 302 |
| 468 | 3300046507 | Ga0495606_0022863 | Ga0495606_0022863_27_938 | 302 |
| 469 | 3300046507 | Ga0495606_0052216 | Ga0495606_0052216_764_1675 | 302 |
| 470 | 3300046507 | Ga0495606_0094651 | Ga0495606_0094651_756_1667 | 302 |
| 471 | 3300046507 | Ga0495606_0096413 | Ga0495606_0096413_818_1729 | 302 |
| 472 | 3300046507 | Ga0495606_0109586 | Ga0495606_0109586_22_933 | 302 |
| 473 | 3300046512 | Ga0495610_0001723 | Ga0495610_0001723_16709_17620 | 302 |
| 474 | 3300046513 | Ga0495616_0000081 | Ga0495616_0000081_43730_44641 | 302 |
| 475 | 3300046513 | Ga0495616_0000396 | Ga0495616_0000396_31313_32224 | 302 |
| 476 | 3300046513 | Ga0495616_0003472 | Ga0495616_0003472_1589_2500 | 302 |
| 477 | 3300046513 | Ga0495616_0004198 | Ga0495616_0004198_368_1279 | 302 |
| 478 | 3300046513 | Ga0495616_0005391 | Ga0495616_0005391_6469_7380 | 302 |
| 479 | 3300046513 | Ga0495616_0011083 | Ga0495616_0011083_926_1837 | 302 |
| 480 | 3300046513 | Ga0495616_0011302 | Ga0495616_0011302_2634_3545 | 302 |
| 481 | 3300046513 | Ga0495616_0017489 | Ga0495616_0017489_736_1647 | 302 |
| 482 | 3300046513 | Ga0495616_0035044 | Ga0495616_0035044_784_1695 | 302 |
| 483 | 3300046513 | Ga0495616_0037407 | Ga0495616_0037407_678_1589 | 302 |
| 484 | 3300046513 | Ga0495616_0037415 | Ga0495616_0037415_1508_2419 | 302 |
| 485 | 3300046513 | Ga0495616_0061482 | Ga0495616_0061482_439_1350 | 302 |
| 486 | 3300046513 | Ga0495616_0080170 | Ga0495616_0080170_640_1551 | 302 |
| 487 | 3300046513 | Ga0495616_0114530 | Ga0495616_0114530_57_968 | 302 |
| 488 | 3300046515 | Ga0495620_0008818 | Ga0495620_0008818_1245_2156 | 302 |
| 489 | 3300046518 | Ga0495631_0000208 | Ga0495631_0000208_7833_8744 | 302 |
| 490 | 3300046518 | Ga0495631_0002880 | Ga0495631_0002880_8105_9016 | 302 |
| 491 | 3300046518 | Ga0495631_0003153 | Ga0495631_0003153_1592_2503 | 302 |
| 492 | 3300046518 | Ga0495631_0010249 | Ga0495631_0010249_295_1206 | 302 |
| 493 | 3300046518 | Ga0495631_0012668 | Ga0495631_0012668_1630_2541 | 302 |
| 494 | 3300046518 | Ga0495631_0014078 | Ga0495631_0014078_721_1632 | 302 |
| 495 | 3300046518 | Ga0495631_0015079 | Ga0495631_0015079_625_1536 | 302 |
| 496 | 3300046518 | Ga0495631_0016308 | Ga0495631_0016308_1350_2261 | 302 |
| 497 | 3300046518 | Ga0495631_0018869 | Ga0495631_0018869_138_1049 | 302 |
| 498 | 3300046518 | Ga0495631_0032919 | Ga0495631_0032919_1130_2041 | 302 |
| 499 | 3300046518 | Ga0495631_0040204 | Ga0495631_0040204_743_1654 | 302 |
| 500 | 3300046518 | Ga0495631_0040556 | Ga0495631_0040556_47_958 | 302 |
| 501 | 3300046519 | Ga0495632_0000071 | Ga0495632_0000071_7926_8837 | 302 |
| 502 | 3300046519 | Ga0495632_0001714 | Ga0495632_0001714_16097_17008 | 302 |
| 503 | 3300046519 | Ga0495632_0003038 | Ga0495632_0003038_3788_4699 | 302 |
| 504 | 3300046519 | Ga0495632_0006355 | Ga0495632_0006355_2997_3908 | 302 |
| 505 | 3300046519 | Ga0495632_0006805 | Ga0495632_0006805_5298_6209 | 302 |
| 506 | 3300046519 | Ga0495632_0009584 | Ga0495632_0009584_3312_4223 | 302 |
| 507 | 3300046520 | Ga0495637_0000335 | Ga0495637_0000335_36_947 | 302 |
| 508 | 3300046520 | Ga0495637_0001186 | Ga0495637_0001186_4536_5447 | 302 |
| 509 | 3300046520 | Ga0495637_0012354 | Ga0495637_0012354_2640_3551 | 302 |
| 510 | 3300046522 | Ga0495643_0000196 | Ga0495643_0000196_47384_48295 | 302 |
| 511 | 3300046522 | Ga0495643_0000756 | Ga0495643_0000756_27680_28591 | 302 |
| 512 | 3300046522 | Ga0495643_0008541 | Ga0495643_0008541_3474_4385 | 302 |
| 513 | 3300046522 | Ga0495643_0029275 | Ga0495643_0029275_604_1515 | 302 |
| 514 | 3300046522 | Ga0495643_0037775 | Ga0495643_0037775_369_1280 | 302 |
| 515 | 3300046522 | Ga0495643_0045120 | Ga0495643_0045120_453_1364 | 302 |
| 516 | 3300046522 | Ga0495643_0067119 | Ga0495643_0067119_82_993 | 302 |
| 517 | 3300046522 | Ga0495643_0105440 | Ga0495643_0105440_502_1413 | 302 |
| 518 | 3300046523 | Ga0495644_0002322 | Ga0495644_0002322_784_1695 | 302 |
| 519 | 3300046523 | Ga0495644_0004209 | Ga0495644_0004209_63_974 | 302 |
| 520 | 3300046523 | Ga0495644_0008001 | Ga0495644_0008001_318_1229 | 302 |
| 521 | 3300046523 | Ga0495644_0008405 | Ga0495644_0008405_706_1617 | 302 |
| 522 | 3300046523 | Ga0495644_0025668 | Ga0495644_0025668_649_1560 | 302 |
| 523 | 3300046523 | Ga0495644_0028983 | Ga0495644_0028983_556_1467 | 302 |
| 524 | 3300046524 | Ga0495648_0000007 | Ga0495648_0000007_104291_105202 | 302 |
| 525 | 3300046524 | Ga0495648_0005051 | Ga0495648_0005051_6335_7246 | 302 |
| 526 | 3300046524 | Ga0495648_0006058 | Ga0495648_0006058_1008_1919 | 302 |
| 527 | 3300046524 | Ga0495648_0019005 | Ga0495648_0019005_1135_2046 | 302 |
| 528 | 3300046524 | Ga0495648_0020402 | Ga0495648_0020402_2690_3601 | 302 |
| 529 | 3300046524 | Ga0495648_0020616 | Ga0495648_0020616_2810_3721 | 302 |
| 530 | 3300046524 | Ga0495648_0041161 | Ga0495648_0041161_649_1560 | 302 |
| 531 | 3300046524 | Ga0495648_0071964 | Ga0495648_0071964_354_1265 | 302 |
| 532 | 3300046525 | Ga0495663_0001857 | Ga0495663_0001857_1880_2791 | 302 |
| 533 | 3300046525 | Ga0495663_0003406 | Ga0495663_0003406_992_1903 | 302 |
| 534 | 3300046526 | Ga0495666_0003041 | Ga0495666_0003041_2837_3748 | 302 |
| 535 | 3300046526 | Ga0495666_0006057 | Ga0495666_0006057_2298_3209 | 302 |
| 536 | 3300046526 | Ga0495666_0079244 | Ga0495666_0079244_183_1091 | 302 |
| 537 | 3300046528 | Ga0495642_0000887 | Ga0495642_0000887_9930_10841 | 302 |
| 538 | 3300046528 | Ga0495642_0000985 | Ga0495642_0000985_6812_7783 | 302 |
| 539 | 3300046528 | Ga0495642_0003070 | Ga0495642_0003070_2414_3325 | 302 |
| 540 | 3300046528 | Ga0495642_0026533 | Ga0495642_0026533_957_1868 | 302 |
| 541 | 3300046528 | Ga0495642_0037239 | Ga0495642_0037239_606_1517 | 302 |
| 542 | 3300046528 | Ga0495642_0040689 | Ga0495642_0040689_456_1367 | 302 |
| 543 | 3300046528 | Ga0495642_0049049 | Ga0495642_0049049_195_1106 | 302 |
| 544 | 3300046528 | Ga0495642_0083734 | Ga0495642_0083734_377_1288 | 302 |
| 545 | 3300046529 | Ga0495652_0005305 | Ga0495652_0005305_8605_9516 | 302 |
| 546 | 3300046530 | Ga0495654_0000004 | Ga0495654_0000004_310999_311910 | 302 |
| 547 | 3300046530 | Ga0495654_0003968 | Ga0495654_0003968_7259_8170 | 302 |
| 548 | 3300046530 | Ga0495654_0019568 | Ga0495654_0019568_2597_3508 | 302 |
| 549 | 3300046530 | Ga0495654_0039859 | Ga0495654_0039859_813_1724 | 302 |
| 550 | 3300046535 | Ga0495586_0019531 | Ga0495586_0019531_1958_2869 | 302 |
| 551 | 3300046535 | Ga0495586_0024795 | Ga0495586_0024795_434_1345 | 302 |
| 552 | 3300046535 | Ga0495586_0053279 | Ga0495586_0053279_325_1236 | 302 |
| 553 | 3300046536 | Ga0495587_0031578 | Ga0495587_0031578_249_1160 | 302 |
| 554 | 3300046536 | Ga0495587_0046094 | Ga0495587_0046094_944_1855 | 302 |
| 555 | 3300046538 | Ga0495609_0000002 | Ga0495609_0000002_221271_222182 | 302 |
| 556 | 3300046538 | Ga0495609_0000639 | Ga0495609_0000639_7651_8562 | 302 |
| 557 | 3300046538 | Ga0495609_0001669 | Ga0495609_0001669_11377_12288 | 302 |
| 558 | 3300046538 | Ga0495609_0006189 | Ga0495609_0006189_1999_2910 | 302 |
| 559 | 3300046538 | Ga0495609_0014941 | Ga0495609_0014941_2166_3077 | 302 |
| 560 | 3300046538 | Ga0495609_0021118 | Ga0495609_0021118_933_1844 | 302 |
| 561 | 3300046538 | Ga0495609_0025038 | Ga0495609_0025038_833_1744 | 302 |
| 562 | 3300046538 | Ga0495609_0028187 | Ga0495609_0028187_1496_2407 | 302 |
| 563 | 3300046538 | Ga0495609_0047034 | Ga0495609_0047034_322_1233 | 302 |
| 564 | 3300046542 | Ga0495597_0000063 | Ga0495597_0000063_13840_14751 | 302 |
| 565 | 3300046542 | Ga0495597_0001454 | Ga0495597_0001454_2098_3009 | 302 |
| 566 | 3300046542 | Ga0495597_0002996 | Ga0495597_0002996_1090_2001 | 302 |
| 567 | 3300046542 | Ga0495597_0003329 | Ga0495597_0003329_654_1652 | 302 |
| 568 | 3300046542 | Ga0495597_0005005 | Ga0495597_0005005_3064_3975 | 302 |
| 569 | 3300046542 | Ga0495597_0018781 | Ga0495597_0018781_1907_2818 | 302 |
| 570 | 3300046542 | Ga0495597_0031766 | Ga0495597_0031766_1251_2159 | 302 |
| 571 | 3300046542 | Ga0495597_0041585 | Ga0495597_0041585_684_1598 | 302 |
| 572 | 3300046543 | Ga0495645_0226136 | Ga0495645_0226136_273_1184 | 302 |
| 573 | 3300046558 | Ga0495633_0004052 | Ga0495633_0004052_968_1879 | 302 |
| 574 | 3300046558 | Ga0495633_0009799 | Ga0495633_0009799_3607_4518 | 302 |
| 575 | 3300046558 | Ga0495633_0013705 | Ga0495633_0013705_1858_2769 | 302 |
| 576 | 3300046559 | Ga0495667_0148660 | Ga0495667_0148660_440_1351 | 302 |
| 577 | 3300046615 | Ga0495656_0000811 | Ga0495656_0000811_773_1684 | 302 |
| 578 | 3300046615 | Ga0495656_0026162 | Ga0495656_0026162_1382_2293 | 302 |
| 579 | 3300046615 | Ga0495656_0075785 | Ga0495656_0075785_101_1012 | 302 |
| 580 | 3300046616 | Ga0495668_0002726 | Ga0495668_0002726_5155_6066 | 302 |
| 581 | 3300046616 | Ga0495668_0002953 | Ga0495668_0002953_4575_5486 | 302 |
| 582 | 3300046616 | Ga0495668_0003351 | Ga0495668_0003351_255_1166 | 302 |
| 583 | 3300046616 | Ga0495668_0019105 | Ga0495668_0019105_566_1489 | 302 |
| 584 | 3300046616 | Ga0495668_0020227 | Ga0495668_0020227_706_1704 | 302 |
| 585 | 3300046616 | Ga0495668_0027474 | Ga0495668_0027474_1689_2600 | 302 |
| 586 | 3300046616 | Ga0495668_0031609 | Ga0495668_0031609_1294_2205 | 302 |
| 587 | 3300046616 | Ga0495668_0039156 | Ga0495668_0039156_1006_1917 | 302 |
| 588 | 3300046616 | Ga0495668_0062028 | Ga0495668_0062028_441_1352 | 302 |
| 589 | 3300046616 | Ga0495668_0099299 | Ga0495668_0099299_500_1411 | 302 |
| 590 | 3300046642 | Ga0495634_0024910 | Ga0495634_0024910_2115_3026 | 302 |
| 591 | 3300046648 | Ga0495611_0001035 | Ga0495611_0001035_3757_4668 | 302 |
| 592 | 3300046648 | Ga0495611_0017608 | Ga0495611_0017608_1025_1936 | 302 |
| 593 | 3300046648 | Ga0495611_0025422 | Ga0495611_0025422_739_1650 | 302 |
| 594 | 3300046648 | Ga0495611_0033011 | Ga0495611_0033011_26_937 | 302 |
| 595 | 3300046648 | Ga0495611_0038673 | Ga0495611_0038673_981_1892 | 302 |
| 596 | 3300046648 | Ga0495611_0076165 | Ga0495611_0076165_611_1522 | 302 |
| 597 | 3300046660 | Ga0495625_0014579 | Ga0495625_0014579_2203_3114 | 302 |
| 598 | 3300046660 | Ga0495625_0066845 | Ga0495625_0066845_908_1819 | 302 |
| 599 | 3300046660 | Ga0495625_0136449 | Ga0495625_0136449_289_1200 | 302 |
| 600 | 3300046660 | Ga0495625_0246006 | Ga0495625_0246006_166_1077 | 302 |
| 601 | 3300046663 | Ga0495635_0071582 | Ga0495635_0071582_750_1661 | 302 |
| 602 | 3300046664 | Ga0495659_0001130 | Ga0495659_0001130_81_992 | 302 |
| 603 | 3300046664 | Ga0495659_0004753 | Ga0495659_0004753_3311_4222 | 302 |
| 604 | 3300046665 | Ga0495661_0000204 | Ga0495661_0000204_29933_30844 | 302 |
| 605 | 3300046665 | Ga0495661_0000742 | Ga0495661_0000742_29807_30718 | 302 |
| 606 | 3300046665 | Ga0495661_0002628 | Ga0495661_0002628_1952_2863 | 302 |
| 607 | 3300046665 | Ga0495661_0004658 | Ga0495661_0004658_8209_9120 | 302 |
| 608 | 3300046665 | Ga0495661_0007123 | Ga0495661_0007123_954_1865 | 302 |
| 609 | 3300046665 | Ga0495661_0010529 | Ga0495661_0010529_2772_3683 | 302 |
| 610 | 3300046665 | Ga0495661_0012729 | Ga0495661_0012729_3525_4436 | 302 |
| 611 | 3300046665 | Ga0495661_0014610 | Ga0495661_0014610_3741_4652 | 302 |
| 612 | 3300046665 | Ga0495661_0017638 | Ga0495661_0017638_3545_4456 | 302 |
| 613 | 3300046665 | Ga0495661_0023518 | Ga0495661_0023518_1041_1952 | 302 |
| 614 | 3300046665 | Ga0495661_0040943 | Ga0495661_0040943_1294_2205 | 302 |
| 615 | 3300046665 | Ga0495661_0041898 | Ga0495661_0041898_1874_2785 | 302 |
| 616 | 3300046665 | Ga0495661_0049073 | Ga0495661_0049073_342_1253 | 302 |
| 617 | 3300046665 | Ga0495661_0069149 | Ga0495661_0069149_1147_2058 | 302 |
| 618 | 3300046665 | Ga0495661_0078658 | Ga0495661_0078658_26_937 | 302 |
| 619 | 3300046665 | Ga0495661_0120858 | Ga0495661_0120858_148_1059 | 302 |
| 620 | 3300046665 | Ga0495661_0176140 | Ga0495661_0176140_210_1121 | 302 |
| 621 | 3300046665 | Ga0495661_0195441 | Ga0495661_0195441_137_1048 | 302 |
| 622 | 3300046674 | Ga0495588_0000208 | Ga0495588_0000208_30215_31126 | 302 |
| 623 | 3300046674 | Ga0495588_0008870 | Ga0495588_0008870_3081_3992 | 302 |
| 624 | 3300046674 | Ga0495588_0027443 | Ga0495588_0027443_1422_2333 | 302 |
| 625 | 3300046674 | Ga0495588_0028931 | Ga0495588_0028931_907_1818 | 302 |
| 626 | 3300046674 | Ga0495588_0035988 | Ga0495588_0035988_1300_2211 | 302 |
| 627 | 3300046674 | Ga0495588_0065893 | Ga0495588_0065893_337_1248 | 302 |
| 628 | 3300046679 | Ga0495623_0071918 | Ga0495623_0071918_925_1836 | 302 |
| 629 | 3300046684 | Ga0495669_0000036 | Ga0495669_0000036_79291_80202 | 302 |
| 630 | 3300046684 | Ga0495669_0001068 | Ga0495669_0001068_9438_10349 | 302 |
| 631 | 3300046684 | Ga0495669_0006172 | Ga0495669_0006172_1623_2534 | 302 |
| 632 | 3300046684 | Ga0495669_0023940 | Ga0495669_0023940_732_1643 | 302 |
| 633 | 3300046684 | Ga0495669_0030484 | Ga0495669_0030484_756_1667 | 302 |
| 634 | 3300046684 | Ga0495669_0035605 | Ga0495669_0035605_902_1813 | 302 |
| 635 | 3300046684 | Ga0495669_0038080 | Ga0495669_0038080_390_1301 | 302 |
| 636 | 3300046684 | Ga0495669_0128909 | Ga0495669_0128909_54_965 | 302 |
| 637 | 3300046684 | Ga0495669_0182878 | Ga0495669_0182878_60_971 | 302 |
| 638 | 3300046689 | Ga0495613_0100062 | Ga0495613_0100062_452_1363 | 302 |
| 639 | 3300046690 | Ga0495624_0040296 | Ga0495624_0040296_211_1122 | 302 |
| 640 | 3300046691 | Ga0495670_0002278 | Ga0495670_0002278_6307_7218 | 302 |
| 641 | 3300046691 | Ga0495670_0007920 | Ga0495670_0007920_823_1734 | 302 |
| 642 | 3300046691 | Ga0495670_0030924 | Ga0495670_0030924_1291_2202 | 302 |
| 643 | 3300046691 | Ga0495670_0134069 | Ga0495670_0134069_359_1270 | 302 |
| 644 | 3300046692 | Ga0495671_0000260 | Ga0495671_0000260_90_1001 | 302 |
| 645 | 3300046692 | Ga0495671_0002020 | Ga0495671_0002020_7765_8676 | 302 |
| 646 | 3300046692 | Ga0495671_0007787 | Ga0495671_0007787_297_1208 | 302 |
| 647 | 3300046692 | Ga0495671_0012088 | Ga0495671_0012088_1055_1966 | 302 |
| 648 | 3300046692 | Ga0495671_0029802 | Ga0495671_0029802_847_1758 | 302 |
| 649 | 3300046692 | Ga0495671_0052594 | Ga0495671_0052594_409_1320 | 302 |
| 650 | 3300046694 | Ga0495649_0001404 | Ga0495649_0001404_2036_2947 | 302 |
| 651 | 3300046694 | Ga0495649_0017449 | Ga0495649_0017449_1117_2028 | 302 |
| 652 | 3300046694 | Ga0495649_0019332 | Ga0495649_0019332_903_1814 | 302 |
| 653 | 3300046694 | Ga0495649_0026315 | Ga0495649_0026315_828_1739 | 302 |
| 654 | 3300046694 | Ga0495649_0029601 | Ga0495649_0029601_902_1813 | 302 |
| 655 | 3300046694 | Ga0495649_0059997 | Ga0495649_0059997_1088_1999 | 302 |
| 656 | 3300046694 | Ga0495649_0170834 | Ga0495649_0170834_131_1042 | 302 |
| 657 | 3300046794 | Ga0495589_0000275 | Ga0495589_0000275_38504_39415 | 302 |
| 658 | 3300046794 | Ga0495589_0000491 | Ga0495589_0000491_12887_13798 | 302 |
| 659 | 3300046794 | Ga0495589_0002663 | Ga0495589_0002663_8230_9141 | 302 |
| 660 | 3300046794 | Ga0495589_0006649 | Ga0495589_0006649_4754_5665 | 302 |
| 661 | 3300046794 | Ga0495589_0008429 | Ga0495589_0008429_3741_4652 | 302 |
| 662 | 3300046794 | Ga0495589_0017104 | Ga0495589_0017104_675_1673 | 302 |
| 663 | 3300046794 | Ga0495589_0023929 | Ga0495589_0023929_1172_2083 | 302 |
| 664 | 3300046794 | Ga0495589_0034332 | Ga0495589_0034332_851_1762 | 302 |
| 665 | 3300046794 | Ga0495589_0036400 | Ga0495589_0036400_870_1781 | 302 |
| 666 | 3300046794 | Ga0495589_0042928 | Ga0495589_0042928_735_1646 | 302 |
| 667 | 3300046794 | Ga0495589_0067607 | Ga0495589_0067607_802_1713 | 302 |
| 668 | 3300046809 | Ga0495600_0041084 | Ga0495600_0041084_1057_1968 | 302 |
| 669 | 3300046810 | Ga0495660_0000322 | Ga0495660_0000322_20593_21504 | 302 |
| 670 | 3300046810 | Ga0495660_0000715 | Ga0495660_0000715_472_1383 | 302 |
| 671 | 3300046810 | Ga0495660_0009527 | Ga0495660_0009527_1083_1994 | 302 |
| 672 | 3300046810 | Ga0495660_0013960 | Ga0495660_0013960_3611_4522 | 302 |
| 673 | 3300046810 | Ga0495660_0048997 | Ga0495660_0048997_706_1617 | 302 |
| 674 | 3300046810 | Ga0495660_0079088 | Ga0495660_0079088_38_949 | 302 |
| 675 | 3300046810 | Ga0495660_0153607 | Ga0495660_0153607_107_1018 | 302 |
| 676 | 3300047315 | Ga0495581_0007747 | Ga0495581_0007747_5088_5999 | 302 |
| 677 | 3300047315 | Ga0495581_0019112 | Ga0495581_0019112_244_1155 | 302 |
| 678 | 3300047315 | Ga0495581_0034899 | Ga0495581_0034899_1742_2650 | 302 |
| 679 | 3300047315 | Ga0495581_0249754 | Ga0495581_0249754_56_964 | 302 |
| 680 | 3300047317 | Ga0495604_0027320 | Ga0495604_0027320_518_1429 | 302 |
| 681 | 3300047317 | Ga0495604_0170738 | Ga0495604_0170738_50_961 | 302 |
| 682 | 3300047318 | Ga0495636_0004977 | Ga0495636_0004977_165_1076 | 302 |
| 683 | 3300047318 | Ga0495636_0040058 | Ga0495636_0040058_242_1153 | 302 |
| 684 | 3300047319 | Ga0495674_0004003 | Ga0495674_0004003_1281_2192 | 302 |
| 685 | 3300047320 | Ga0495672_0000041 | Ga0495672_0000041_2784_3695 | 302 |
| 686 | 3300047320 | Ga0495672_0000184 | Ga0495672_0000184_18556_19467 | 302 |
| 687 | 3300047320 | Ga0495672_0001324 | Ga0495672_0001324_14133_15044 | 302 |
| 688 | 3300047320 | Ga0495672_0003105 | Ga0495672_0003105_1477_2388 | 302 |
| 689 | 3300047320 | Ga0495672_0017522 | Ga0495672_0017522_3490_4488 | 302 |
| 690 | 3300047321 | Ga0495676_0030259 | Ga0495676_0030259_3515_4426 | 302 |
| 691 | 3300047321 | Ga0495676_0146864 | Ga0495676_0146864_29_937 | 302 |
| 692 | 3300047322 | Ga0495680_0251230 | Ga0495680_0251230_26_934 | 302 |
| 693 | 3300047323 | Ga0495683_0000180 | Ga0495683_0000180_61284_62195 | 302 |
| 694 | 3300047323 | Ga0495683_0002116 | Ga0495683_0002116_10025_10936 | 302 |
| 695 | 3300047323 | Ga0495683_0005648 | Ga0495683_0005648_502_1413 | 302 |
| 696 | 3300047323 | Ga0495683_0031464 | Ga0495683_0031464_561_1472 | 302 |
| 697 | 3300047323 | Ga0495683_0055562 | Ga0495683_0055562_432_1343 | 302 |
| 698 | 3300047323 | Ga0495683_0091610 | Ga0495683_0091610_441_1352 | 302 |
| 699 | 3300047443 | Ga0495687_000049 | Ga0495687_000049_88639_89550 | 302 |
| 700 | 3300047443 | Ga0495687_000075 | Ga0495687_000075_792_1703 | 302 |
| 701 | 3300047443 | Ga0495687_000482 | Ga0495687_000482_46495_47406 | 302 |
| 702 | 3300047443 | Ga0495687_000605 | Ga0495687_000605_38529_39440 | 302 |
| 703 | 3300047443 | Ga0495687_009992 | Ga0495687_009992_1641_2552 | 302 |
| 704 | 3300047444 | Ga0495675_0004311 | Ga0495675_0004311_6141_7052 | 302 |
| 705 | 3300047444 | Ga0495675_0064599 | Ga0495675_0064599_389_1297 | 302 |
| 706 | 3300047444 | Ga0495675_0103143 | Ga0495675_0103143_843_1754 | 302 |
| 707 | 3300047445 | Ga0495677_0000103 | Ga0495677_0000103_38504_39415 | 302 |
| 708 | 3300047445 | Ga0495677_0000916 | Ga0495677_0000916_4499_5410 | 302 |
| 709 | 3300047445 | Ga0495677_0001365 | Ga0495677_0001365_4209_5120 | 302 |
| 710 | 3300047445 | Ga0495677_0003071 | Ga0495677_0003071_2079_2990 | 302 |
| 711 | 3300047445 | Ga0495677_0003608 | Ga0495677_0003608_3372_4283 | 302 |
| 712 | 3300047445 | Ga0495677_0011044 | Ga0495677_0011044_1081_1992 | 302 |
| 713 | 3300047445 | Ga0495677_0024836 | Ga0495677_0024836_852_1763 | 302 |
| 714 | 3300047445 | Ga0495677_0027735 | Ga0495677_0027735_34_945 | 302 |
| 715 | 3300047445 | Ga0495677_0030217 | Ga0495677_0030217_1036_1947 | 302 |
| 716 | 3300047445 | Ga0495677_0035728 | Ga0495677_0035728_836_1747 | 302 |
| 717 | 3300047445 | Ga0495677_0045368 | Ga0495677_0045368_48_1019 | 302 |
| 718 | 3300047446 | Ga0495679_006905 | Ga0495679_006905_2968_3879 | 302 |
| 719 | 3300047446 | Ga0495679_010897 | Ga0495679_010897_470_1381 | 302 |
| 720 | 3300047446 | Ga0495679_047930 | Ga0495679_047930_368_1279 | 302 |
| 721 | 3300047447 | Ga0495685_013222 | Ga0495685_013222_599_1510 | 302 |
| 722 | 3300047470 | Ga0495681_0000120 | Ga0495681_0000120_36653_37564 | 302 |
| 723 | 3300047470 | Ga0495681_0001681 | Ga0495681_0001681_4413_5324 | 302 |
| 724 | 3300047470 | Ga0495681_0004115 | Ga0495681_0004115_7521_8432 | 302 |
| 725 | 3300047470 | Ga0495681_0004617 | Ga0495681_0004617_2850_3761 | 302 |
| 726 | 3300047470 | Ga0495681_0043023 | Ga0495681_0043023_311_1222 | 302 |
| 727 | 3300047470 | Ga0495681_0100449 | Ga0495681_0100449_27_938 | 302 |
| 728 | 3300047472 | Ga0495686_0000400 | Ga0495686_0000400_65217_66128 | 302 |
| 729 | 3300047472 | Ga0495686_0006856 | Ga0495686_0006856_1610_2533 | 302 |
| 730 | 3300047472 | Ga0495686_0012955 | Ga0495686_0012955_4490_5401 | 302 |
| 731 | 3300047673 | Ga0495593_0051773 | Ga0495593_0051773_777_1685 | 302 |
| 732 | 3300048088 | Ga0495602_0006598 | Ga0495602_0006598_1244_2155 | 302 |
| 733 | 3300048089 | Ga0495614_0026838 | Ga0495614_0026838_1175_2083 | 302 |
| 734 | 3300048091 | Ga0495626_0000111 | Ga0495626_0000111_90883_91794 | 302 |
| 735 | 3300048091 | Ga0495626_0000447 | Ga0495626_0000447_9469_10380 | 302 |
| 736 | 3300048091 | Ga0495626_0000466 | Ga0495626_0000466_2480_3391 | 302 |
| 737 | 3300048091 | Ga0495626_0003091 | Ga0495626_0003091_7855_8766 | 302 |
| 738 | 3300048091 | Ga0495626_0004056 | Ga0495626_0004056_6690_7601 | 302 |
| 739 | 3300048091 | Ga0495626_0011509 | Ga0495626_0011509_233_1144 | 302 |
| 740 | 3300048091 | Ga0495626_0012385 | Ga0495626_0012385_1956_2867 | 302 |
| 741 | 3300048091 | Ga0495626_0014030 | Ga0495626_0014030_2562_3473 | 302 |
| 742 | 3300048091 | Ga0495626_0021491 | Ga0495626_0021491_390_1301 | 302 |
| 743 | 3300048091 | Ga0495626_0025900 | Ga0495626_0025900_694_1605 | 302 |
| 744 | 3300048091 | Ga0495626_0031204 | Ga0495626_0031204_750_1661 | 302 |
| 745 | 3300048091 | Ga0495626_0033046 | Ga0495626_0033046_831_1742 | 302 |
| 746 | 3300048091 | Ga0495626_0063706 | Ga0495626_0063706_21_932 | 302 |
| 747 | 3300048091 | Ga0495626_0087024 | Ga0495626_0087024_361_1272 | 302 |
| 748 | 3300048091 | Ga0495626_0088607 | Ga0495626_0088607_342_1253 | 302 |
| 749 | 3300048091 | Ga0495626_0107154 | Ga0495626_0107154_202_1113 | 302 |
| 750 | 3300048903 | Ga0496100_0139290 | Ga0496100_0139290_242_1153 | 302 |
| 751 | 3300048904 | Ga0496101_0003310 | Ga0496101_0003310_4091_5002 | 302 |
| 752 | 3300048905 | Ga0496102_0000695 | Ga0496102_0000695_26112_27023 | 302 |
| 753 | 3300048905 | Ga0496102_0002110 | Ga0496102_0002110_7521_8432 | 302 |
| 754 | 3300048905 | Ga0496102_0107754 | Ga0496102_0107754_909_1820 | 302 |
| 755 | 3300048905 | Ga0496102_0124418 | Ga0496102_0124418_471_1382 | 302 |
| 756 | 3300048905 | Ga0496102_0216816 | Ga0496102_0216816_596_1690 | 302 |
| 757 | 3300048906 | Ga0496103_0138234 | Ga0496103_0138234_541_1452 | 302 |
| 758 | 3300048911 | Ga0496108_0142252 | Ga0496108_0142252_893_1804 | 302 |
| 759 | 3300048912 | Ga0496109_0027815 | Ga0496109_0027815_1016_1927 | 302 |
| 760 | 3300048913 | Ga0496110_0000115 | Ga0496110_0000115_9727_10638 | 302 |
| 761 | 3300048913 | Ga0496110_0005697 | Ga0496110_0005697_7861_8772 | 302 |
| 762 | 3300048913 | Ga0496110_0571567 | Ga0496110_0571567_101_1012 | 302 |
| 763 | 3300048915 | Ga0496112_0115725 | Ga0496112_0115725_620_1531 | 302 |
| 764 | 3300048916 | Ga0496113_0004495 | Ga0496113_0004495_673_1584 | 302 |
| 765 | 3300048916 | Ga0496113_0004780 | Ga0496113_0004780_1144_2055 | 302 |
| 766 | 3300048918 | Ga0496115_0006309 | Ga0496115_0006309_6920_7831 | 302 |
| 767 | 3300048918 | Ga0496115_0194782 | Ga0496115_0194782_408_1319 | 302 |
| 768 | 3300048918 | Ga0496115_0260149 | Ga0496115_0260149_111_1022 | 302 |
| 769 | 3300048925 | Ga0496122_0000169 | Ga0496122_0000169_104616_105527 | 302 |
| 770 | 3300048925 | Ga0496122_0005065 | Ga0496122_0005065_13507_14418 | 302 |
| 771 | 3300048925 | Ga0496122_0081748 | Ga0496122_0081748_503_1414 | 302 |
| 772 | 3300048925 | Ga0496122_0147630 | Ga0496122_0147630_34_957 | 302 |
| 773 | 3300048926 | Ga0496123_0001570 | Ga0496123_0001570_197_1108 | 302 |
| 774 | 3300048926 | Ga0496123_0015729 | Ga0496123_0015729_2621_3532 | 302 |
| 775 | 3300048926 | Ga0496123_0090097 | Ga0496123_0090097_131_1042 | 302 |
| 776 | 3300048927 | Ga0496124_0003298 | Ga0496124_0003298_18250_19161 | 302 |
| 777 | 3300048927 | Ga0496124_0036446 | Ga0496124_0036446_2774_3685 | 302 |
| 778 | 3300048927 | Ga0496124_0061129 | Ga0496124_0061129_1988_2899 | 302 |
| 779 | 3300048928 | Ga0496125_0005514 | Ga0496125_0005514_6448_7359 | 302 |
| 780 | 3300048928 | Ga0496125_0083230 | Ga0496125_0083230_967_1878 | 302 |
| 781 | 3300049459 | Ga0495678_000056 | Ga0495678_000056_138427_139338 | 302 |
| 782 | 3300049459 | Ga0495678_001377 | Ga0495678_001377_8162_9073 | 302 |
| 783 | 3300049459 | Ga0495678_001405 | Ga0495678_001405_9899_10810 | 302 |
| 784 | 3300049459 | Ga0495678_010676 | Ga0495678_010676_2603_3514 | 302 |
| 785 | 3300049459 | Ga0495678_028860 | Ga0495678_028860_1381_2292 | 302 |
| 786 | 3300049460 | Ga0495682_0001837 | Ga0495682_0001837_1591_2502 | 302 |
| 787 | 3300049460 | Ga0495682_0014320 | Ga0495682_0014320_484_1395 | 302 |
| 788 | 3300049571 | Ga0501034_0276220 | Ga0501034_0276220_657_1568 | 302 |
| 789 | 3300049667 | Ga0501230_004770 | Ga0501230_004770_725_1636 | 302 |
| 790 | 3300049822 | Ga0501035_0000681 | Ga0501035_0000681_7609_8520 | 302 |
| 791 | 3300002773 | JGI25152J39213_1000440 | JGI25152J39213_100044024 | 303 |
| 792 | 3300002774 | JGI25150J39212_1008267 | JGI25150J39212_10082672 | 303 |
| 793 | 3300003354 | JGI25160J50197_1001196 | JGI25160J50197_10011967 | 303 |
| 794 | 3300003763 | Ga0055529_1000528 | Ga0055529_100052813 | 303 |
| 795 | 3300003771 | Ga0055526_1001071 | Ga0055526_100107114 | 303 |
| 796 | 3300003771 | Ga0055526_1001617 | Ga0055526_100161712 | 303 |
| 797 | 3300003773 | Ga0055537_1000344 | Ga0055537_100034415 | 303 |
| 798 | 3300003775 | Ga0055524_1000015 | Ga0055524_100001520 | 303 |
| 799 | 3300003775 | Ga0055524_1007464 | Ga0055524_10074642 | 303 |
| 800 | 3300003775 | Ga0055524_1008902 | Ga0055524_10089025 | 303 |
| 801 | 3300003784 | Ga0055534_1000310 | Ga0055534_100031015 | 303 |
| 802 | 3300003790 | Ga0055528_1000124 | Ga0055528_100012412 | 303 |
| 803 | 3300003790 | Ga0055528_1001071 | Ga0055528_10010714 | 303 |
| 804 | 3300006946 | Ga0079104_1005366 | Ga0079104_10053662 | 303 |
| 805 | 3300006948 | Ga0099826_10000003 | Ga0099826_10000003390 | 303 |
| 806 | 3300009093 | Ga0105240_10396277 | Ga0105240_103962772 | 303 |
| 807 | 3300015265 | Ga0182005_1000018 | Ga0182005_100001885 | 303 |
| 808 | 3300021361 | Ga0213872_10000002 | Ga0213872_10000002373 | 303 |
| 809 | 3300021361 | Ga0213872_10045948 | Ga0213872_100459482 | 303 |
| 810 | 3300021361 | Ga0213872_10137763 | Ga0213872_101377631 | 303 |
| 811 | 3300025208 | Ga0209436_100115 | Ga0209436_10011518 | 303 |
| 812 | 3300025245 | Ga0207425_1000006 | Ga0207425_100000624 | 303 |
| 813 | 3300025245 | Ga0207425_1000105 | Ga0207425_10001053 | 303 |
| 814 | 3300025245 | Ga0207425_1000643 | Ga0207425_100064313 | 303 |
| 815 | 3300025258 | Ga0209129_1000090 | Ga0209129_100009024 | 303 |
| 816 | 3300025258 | Ga0209129_1007993 | Ga0209129_10079932 | 303 |
| 817 | 3300025263 | Ga0209565_1000006 | Ga0209565_1000006104 | 303 |
| 818 | 3300025263 | Ga0209565_1000701 | Ga0209565_10007016 | 303 |
| 819 | 3300025263 | Ga0209565_1006379 | Ga0209565_10063793 | 303 |
| 820 | 3300025272 | Ga0209455_1000051 | Ga0209455_1000051312 | 303 |
| 821 | 3300025273 | Ga0209673_1000004 | Ga0209673_1000004725 | 303 |
| 822 | 3300025273 | Ga0209673_1003116 | Ga0209673_10031162 | 303 |
| 823 | 3300025284 | Ga0209130_1001125 | Ga0209130_10011258 | 303 |
| 824 | 3300025291 | Ga0209675_1000006 | Ga0209675_1000006103 | 303 |
| 825 | 3300025291 | Ga0209675_1000696 | Ga0209675_100069617 | 303 |
| 826 | 3300025294 | Ga0209025_1039319 | Ga0209025_10393192 | 303 |
| 827 | 3300025295 | Ga0209564_1000006 | Ga0209564_1000006301 | 303 |
| 828 | 3300025295 | Ga0209564_1000064 | Ga0209564_1000064174 | 303 |
| 829 | 3300025295 | Ga0209564_1012237 | Ga0209564_10122373 | 303 |
| 830 | 3300025297 | Ga0209758_1000047 | Ga0209758_1000047316 | 303 |
| 831 | 3300025297 | Ga0209758_1002119 | Ga0209758_10021198 | 303 |
| 832 | 3300025298 | Ga0209050_1000085 | Ga0209050_100008584 | 303 |
| 833 | 3300025298 | Ga0209050_1000607 | Ga0209050_100060736 | 303 |
| 834 | 3300025298 | Ga0209050_1013429 | Ga0209050_10134293 | 303 |
| 835 | 3300025299 | Ga0209256_1000005 | Ga0209256_100000521 | 303 |
| 836 | 3300025299 | Ga0209256_1000080 | Ga0209256_1000080111 | 303 |
| 837 | 3300025299 | Ga0209256_1000365 | Ga0209256_10003652 | 303 |
| 838 | 3300025299 | Ga0209256_1000423 | Ga0209256_100042349 | 303 |
| 839 | 3300025302 | Ga0207426_1000939 | Ga0207426_100093915 | 303 |
| 840 | 3300025303 | Ga0209051_1030792 | Ga0209051_10307922 | 303 |
| 841 | 3300025304 | Ga0209257_1000010 | Ga0209257_1000010807 | 303 |
| 842 | 3300025728 | Ga0207655_1001393 | Ga0207655_10013934 | 303 |
| 843 | 3300027111 | Ga0209281_1007150 | Ga0209281_10071503 | 303 |
| 844 | 3300027666 | Ga0209282_1000002 | Ga0209282_1000002608 | 303 |
| 845 | 3300030744 | Ga0316181_1122411 | Ga0316181_11224112 | 303 |
| 846 | 3300031548 | Ga0307408_100007876 | Ga0307408_1000078762 | 303 |
| 847 | 3300031548 | Ga0307408_100043196 | Ga0307408_1000431963 | 303 |
| 848 | 3300032002 | Ga0307416_100113396 | Ga0307416_1001133961 | 303 |
| 849 | 3300036712 | Ga0316584_0028450 | Ga0316584_0028450_3069_3986 | 303 |
| 850 | 3300039447 | Ga0436361_0066851 | Ga0436361_0066851_16016_16927 | 303 |
| 851 | 3300039447 | Ga0436361_0464259 | Ga0436361_0464259_788_1699 | 303 |
| 852 | 3300039447 | Ga0436361_1051860 | Ga0436361_1051860_594_1505 | 303 |
| 853 | 3300046452 | Ga0495617_000007 | Ga0495617_000007_165149_166072 | 303 |
| 854 | 3300046453 | Ga0495627_000006 | Ga0495627_000006_232321_233235 | 303 |
| 855 | 3300046453 | Ga0495627_018958 | Ga0495627_018958_405_1328 | 303 |
| 856 | 3300046457 | Ga0495590_0000004 | Ga0495590_0000004_164080_164994 | 303 |
| 857 | 3300046460 | Ga0495638_0000023 | Ga0495638_0000023_205235_206149 | 303 |
| 858 | 3300046460 | Ga0495638_0001662 | Ga0495638_0001662_14374_15291 | 303 |
| 859 | 3300046460 | Ga0495638_0062217 | Ga0495638_0062217_712_1626 | 303 |
| 860 | 3300046460 | Ga0495638_0130392 | Ga0495638_0130392_511_1434 | 303 |
| 861 | 3300046463 | Ga0495653_0000207 | Ga0495653_0000207_45024_45953 | 303 |
| 862 | 3300046471 | Ga0495650_0000769 | Ga0495650_0000769_29391_30305 | 303 |
| 863 | 3300046471 | Ga0495650_0001207 | Ga0495650_0001207_443_1366 | 303 |
| 864 | 3300046471 | Ga0495650_0003455 | Ga0495650_0003455_3342_4256 | 303 |
| 865 | 3300046474 | Ga0495605_0000174 | Ga0495605_0000174_75575_76498 | 303 |
| 866 | 3300046474 | Ga0495605_0147499 | Ga0495605_0147499_85_1002 | 303 |
| 867 | 3300046491 | Ga0495584_0013554 | Ga0495584_0013554_3045_3971 | 303 |
| 868 | 3300046492 | Ga0495585_0005691 | Ga0495585_0005691_6231_7154 | 303 |
| 869 | 3300046492 | Ga0495585_0030974 | Ga0495585_0030974_455_1372 | 303 |
| 870 | 3300046492 | Ga0495585_0069795 | Ga0495585_0069795_608_1525 | 303 |
| 871 | 3300046501 | Ga0495607_0026420 | Ga0495607_0026420_97_1011 | 303 |
| 872 | 3300046506 | Ga0495583_0000330 | Ga0495583_0000330_4010_4927 | 303 |
| 873 | 3300046506 | Ga0495583_0001091 | Ga0495583_0001091_21624_22538 | 303 |
| 874 | 3300046506 | Ga0495583_0041811 | Ga0495583_0041811_241_1152 | 303 |
| 875 | 3300046507 | Ga0495606_0000024 | Ga0495606_0000024_255055_255981 | 303 |
| 876 | 3300046507 | Ga0495606_0000037 | Ga0495606_0000037_15018_15932 | 303 |
| 877 | 3300046507 | Ga0495606_0000146 | Ga0495606_0000146_117175_118104 | 303 |
| 878 | 3300046507 | Ga0495606_0009349 | Ga0495606_0009349_707_1621 | 303 |
| 879 | 3300046512 | Ga0495610_0000004 | Ga0495610_0000004_586722_587645 | 303 |
| 880 | 3300046512 | Ga0495610_0008063 | Ga0495610_0008063_3410_4324 | 303 |
| 881 | 3300046513 | Ga0495616_0011906 | Ga0495616_0011906_3573_4568 | 303 |
| 882 | 3300046513 | Ga0495616_0064367 | Ga0495616_0064367_258_1169 | 303 |
| 883 | 3300046519 | Ga0495632_0069961 | Ga0495632_0069961_97_1011 | 303 |
| 884 | 3300046522 | Ga0495643_0000098 | Ga0495643_0000098_133394_134308 | 303 |
| 885 | 3300046522 | Ga0495643_0000211 | Ga0495643_0000211_783_1697 | 303 |
| 886 | 3300046522 | Ga0495643_0061843 | Ga0495643_0061843_902_1816 | 303 |
| 887 | 3300046523 | Ga0495644_0006256 | Ga0495644_0006256_3642_4559 | 303 |
| 888 | 3300046523 | Ga0495644_0022412 | Ga0495644_0022412_555_1469 | 303 |
| 889 | 3300046524 | Ga0495648_0000877 | Ga0495648_0000877_5290_6207 | 303 |
| 890 | 3300046524 | Ga0495648_0031438 | Ga0495648_0031438_1111_2025 | 303 |
| 891 | 3300046524 | Ga0495648_0034402 | Ga0495648_0034402_345_1268 | 303 |
| 892 | 3300046525 | Ga0495663_0038003 | Ga0495663_0038003_60_971 | 303 |
| 893 | 3300046530 | Ga0495654_0044161 | Ga0495654_0044161_691_1614 | 303 |
| 894 | 3300046538 | Ga0495609_0001564 | Ga0495609_0001564_7107_8024 | 303 |
| 895 | 3300046538 | Ga0495609_0003140 | Ga0495609_0003140_3856_4770 | 303 |
| 896 | 3300046538 | Ga0495609_0006038 | Ga0495609_0006038_4047_4973 | 303 |
| 897 | 3300046542 | Ga0495597_0000022 | Ga0495597_0000022_12764_13678 | 303 |
| 898 | 3300046542 | Ga0495597_0002183 | Ga0495597_0002183_2996_3910 | 303 |
| 899 | 3300046557 | Ga0495622_0000003 | Ga0495622_0000003_186517_187431 | 303 |
| 900 | 3300046557 | Ga0495622_0000432 | Ga0495622_0000432_7829_8743 | 303 |
| 901 | 3300046558 | Ga0495633_0000045 | Ga0495633_0000045_96877_97791 | 303 |
| 902 | 3300046558 | Ga0495633_0000449 | Ga0495633_0000449_13330_14244 | 303 |
| 903 | 3300046616 | Ga0495668_0000051 | Ga0495668_0000051_128696_129622 | 303 |
| 904 | 3300046616 | Ga0495668_0000158 | Ga0495668_0000158_32105_33019 | 303 |
| 905 | 3300046616 | Ga0495668_0000205 | Ga0495668_0000205_37447_38361 | 303 |
| 906 | 3300046616 | Ga0495668_0002645 | Ga0495668_0002645_3609_4532 | 303 |
| 907 | 3300046616 | Ga0495668_0029158 | Ga0495668_0029158_88_1014 | 303 |
| 908 | 3300046660 | Ga0495625_0000073 | Ga0495625_0000073_148120_149034 | 303 |
| 909 | 3300046660 | Ga0495625_0006264 | Ga0495625_0006264_9043_9957 | 303 |
| 910 | 3300046660 | Ga0495625_0011301 | Ga0495625_0011301_192_1118 | 303 |
| 911 | 3300046660 | Ga0495625_0097982 | Ga0495625_0097982_380_1294 | 303 |
| 912 | 3300046664 | Ga0495659_0007009 | Ga0495659_0007009_700_1626 | 303 |
| 913 | 3300046691 | Ga0495670_0010375 | Ga0495670_0010375_3504_4421 | 303 |
| 914 | 3300046692 | Ga0495671_0002900 | Ga0495671_0002900_723_1646 | 303 |
| 915 | 3300046692 | Ga0495671_0173180 | Ga0495671_0173180_91_1017 | 303 |
| 916 | 3300046694 | Ga0495649_0013231 | Ga0495649_0013231_1732_2658 | 303 |
| 917 | 3300046694 | Ga0495649_0024659 | Ga0495649_0024659_1727_2641 | 303 |
| 918 | 3300046810 | Ga0495660_0012028 | Ga0495660_0012028_1162_2085 | 303 |
| 919 | 3300046810 | Ga0495660_0023202 | Ga0495660_0023202_877_1791 | 303 |
| 920 | 3300046810 | Ga0495660_0035893 | Ga0495660_0035893_782_1696 | 303 |
| 921 | 3300047318 | Ga0495636_0010303 | Ga0495636_0010303_1031_1957 | 303 |
| 922 | 3300047320 | Ga0495672_0000588 | Ga0495672_0000588_28872_29786 | 303 |
| 923 | 3300047320 | Ga0495672_0095019 | Ga0495672_0095019_259_1176 | 303 |
| 924 | 3300047323 | Ga0495683_0027845 | Ga0495683_0027845_1652_2569 | 303 |
| 925 | 3300047443 | Ga0495687_000703 | Ga0495687_000703_27502_28416 | 303 |
| 926 | 3300047443 | Ga0495687_001553 | Ga0495687_001553_2005_2919 | 303 |
| 927 | 3300047447 | Ga0495685_000314 | Ga0495685_000314_1239_2156 | 303 |
| 928 | 3300047447 | Ga0495685_036536 | Ga0495685_036536_200_1126 | 303 |
| 929 | 3300047469 | Ga0495673_0000017 | Ga0495673_0000017_259502_260425 | 303 |
| 930 | 3300047469 | Ga0495673_0000027 | Ga0495673_0000027_78566_79492 | 303 |
| 931 | 3300047469 | Ga0495673_0040655 | Ga0495673_0040655_292_1209 | 303 |
| 932 | 3300047470 | Ga0495681_0067172 | Ga0495681_0067172_316_1230 | 303 |
| 933 | 3300047472 | Ga0495686_0002027 | Ga0495686_0002027_17010_17921 | 303 |
| 934 | 3300047472 | Ga0495686_0002626 | Ga0495686_0002626_12193_13107 | 303 |
| 935 | 3300047472 | Ga0495686_0061230 | Ga0495686_0061230_409_1323 | 303 |
| 936 | 3300047472 | Ga0495686_0108909 | Ga0495686_0108909_656_1579 | 303 |
| 937 | 3300048903 | Ga0496100_0066685 | Ga0496100_0066685_1410_2321 | 303 |
| 938 | 3300048924 | Ga0496121_0088460 | Ga0496121_0088460_697_1611 | 303 |
| 939 | 3300048925 | Ga0496122_0043701 | Ga0496122_0043701_620_1543 | 303 |
| 940 | 3300048927 | Ga0496124_0120874 | Ga0496124_0120874_794_1708 | 303 |
| 941 | 3300048929 | Ga0496126_0011339 | Ga0496126_0011339_7631_8557 | 303 |
| 942 | 3300049459 | Ga0495678_000445 | Ga0495678_000445_11383_12297 | 303 |
| 943 | 3300049459 | Ga0495678_001532 | Ga0495678_001532_14427_15341 | 303 |
| 944 | 3300049459 | Ga0495678_009979 | Ga0495678_009979_3648_4565 | 303 |
| 945 | 3300049569 | Ga0501032_0042640 | Ga0501032_0042640_624_1568 | 303 |
| 946 | 3300049570 | Ga0501033_0000310 | Ga0501033_0000310_7415_8359 | 303 |
| 947 | 3300049580 | Ga0501046_0001350 | Ga0501046_0001350_22363_23307 | 303 |
| 948 | 3300049581 | Ga0501047_0060157 | Ga0501047_0060157_1523_2467 | 303 |
| 949 | 3300049581 | Ga0501047_0168356 | Ga0501047_0168356_952_1869 | 303 |
| 950 | 3300049582 | Ga0501048_0087851 | Ga0501048_0087851_57_1001 | 303 |
| 951 | 3300049586 | Ga0501070_0152393 | Ga0501070_0152393_581_1525 | 303 |
| 952 | 3300049671 | Ga0501238_009067 | Ga0501238_009067_151_1065 | 303 |
| 953 | 3300049679 | Ga0501249_005296 | Ga0501249_005296_687_1601 | 303 |
| 954 | 3300049742 | Ga0501080_0247908 | Ga0501080_0247908_76_1020 | 303 |
| 955 | 3300049766 | Ga0501269_001829 | Ga0501269_001829_1077_1991 | 303 |
| 956 | 3300049823 | Ga0501044_0018545 | Ga0501044_0018545_3010_3954 | 303 |
| 957 | 3300050489 | nmdc:mga03683_5929_c2 | nmdc:mga03683_5929_c2_408_1322 | 303 |
| 958 | iso_pu_bacteria | 2919476304 | 2919481036 | 303 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8t7w-assembly1.cif.gz_A | crystal structure of oxygen-dependent coproporphyrinogen-iii oxidase (hemf) from klebsiella aerogenes | 0.9809 | 4 | 300 |
| 2qt8-assembly1.cif.gz_A | coproporphyrinogen iii oxidase from leishmania major | 0.9803 | 7 | 300 |
| 1vju-assembly1.cif.gz_A | coproporphyrinogen iii oxidase from leishmania major | 0.9778 | 7 | 300 |
| 3ejo-assembly1.cif.gz_A | coproporphyrinogen iii oxidase from leishmania donovani | 0.9777 | 7 | 300 |
| 3dwr-assembly1.cif.gz_B | leishmania major coproporphyrinogen iii oxidase with bound ligand | 0.977 | 7 | 300 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3dwsA00 | Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic | 0.9768 | 7 | 300 | 3.40.1500.10 |
| 3dwsA00 | Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic | 0.9541 | 7 | 300 | 3.40.1500.10 |
| af_Q7XPL2_53_398_3.40.1500.10 | Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic | 0.9446 | 1 | 301 | 3.40.1500.10 |
| af_Q7XPL2_53_398_3.40.1500.10 | Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic | 0.9355 | 1 | 301 | 3.40.1500.10 |
| af_Q9UTE2_2_312_3.40.1500.10 | Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic | 0.9328 | 1 | 300 | 3.40.1500.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B9PMB0-F1-model_v4 | coproporphyrinogen oxidase (EC 1.3.3.3) | 0.9925 | 4 | 107 |
GO:0004109
GO:0005737 GO:0006782 |
| AF-A0A4V5RJJ9-F1-model_v4 | coproporphyrinogen oxidase (EC 1.3.3.3) | 0.9898 | 131 | 251 |
GO:0004109
GO:0005737 GO:0006782 |
| AF-A0A523GL91-F1-model_v4 | Oxygen-dependent coproporphyrinogen-III oxidase (CPO) (Coprogen oxidase) (Coproporphyrinogenase) (EC 1.3.3.3) | 0.9873 | 4 | 300 |
GO:0004109
GO:0005737 GO:0006782 GO:0042803 GO:0046872 |
| AF-A0A837WWI8-F1-model_v4 | deleted | 0.9862 | 4 | 116 |
|
| AF-A0A2S5NPS2-F1-model_v4 | coproporphyrinogen oxidase (EC 1.3.3.3) | 0.9852 | 3 | 263 |
GO:0004109
GO:0005737 GO:0006782 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar