F486779

General Info

Members Datasets Scaffolds Average Seq Length
957 686 497 225

Family's Representative Sequence

Representative Sequence 3300046558|Ga0495633_0139263|Ga0495633_0139263_185_922
Length 245
Sequence MAAPGTTLIEGAKMSETMHVFDTAAELANALAADVAQRLDAATKEYGTASIAVSGGSTPKLFFQALSRHDLDWSNISVTLVDERFVPPESERSNHRLVGENLLQDKAKAAYFVPLFQPAASPEDAATLATVKTEAICDPFDVVVLGMGTDGHTASFFPGGDNLYEALDLDEPRGVLTMAAETAGEERLTFNFSSLHDAGFLVLHIEGAAKKATLEKAQSGEDEDEMPIRAVLNRAETLVDIYWAP

Samples

Sample ID Description Type Environment
1 2509276019 Ensifer aridi TW10 Isolate Nodule
2 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
6 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
7 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
8 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
9 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
10 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
11 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
12 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
13 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
14 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
15 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
16 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
17 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
18 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
19 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
20 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
21 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
22 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
23 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
24 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
25 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
26 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
27 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
28 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
29 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
30 2516143018 Ensifer sp. BR816 Isolate Nodule
31 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
32 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
33 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
34 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
35 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
36 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
37 2519899620 Rhizobium sp. Pop5 Isolate Nodule
38 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
39 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
40 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
41 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
42 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
43 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
44 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
45 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
46 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
47 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
48 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
49 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
50 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
51 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
52 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
53 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
54 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
55 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
56 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
57 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
58 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
59 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
60 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
61 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
62 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
63 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
64 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
65 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
66 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
67 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
68 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
69 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
70 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
71 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
72 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
73 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
74 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
75 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
76 2643221557 Ensifer sp. Root558 Isolate Unclassified
77 2643221568 Rhizobium sp. Root564 Isolate Unclassified
78 2643221582 Rhizobium sp. Root651 Isolate Unclassified
79 2643221599 Rhizobium sp. Root708 Isolate Unclassified
80 2643221610 Ensifer sp. Root74 Isolate Unclassified
81 2643221668 Ensifer sp. Root423 Isolate Unclassified
82 2643221675 Ensifer sp. Root1298 Isolate Unclassified
83 2643221680 Ensifer sp. Root1312 Isolate Unclassified
84 2643221693 Rhizobium sp. Root491 Isolate Unclassified
85 2643221726 Ensifer sp. Root954 Isolate Unclassified
86 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
87 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
88 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
89 2718217882 Rhizobium sp. N741 Isolate Nodule
90 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
91 2718218009 Rhizobium sp. N561 Isolate Nodule
92 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
93 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
94 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
95 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
96 2718218363 Rhizobium sp. N113 Isolate Nodule
97 2718218365 Rhizobium sp. N731 Isolate Nodule
98 2718218366 Rhizobium sp. N621 Isolate Nodule
99 2721755514 Rhizobium sp. N6212 Isolate Nodule
100 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
101 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
102 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
103 2721755810 Rhizobium sp. N871 Isolate Nodule
104 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
105 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
106 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
107 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
108 2728369365 Rhizobium sp. N1341 Isolate Nodule
109 2728369397 Rhizobium sp. N1314 Isolate Nodule
110 2738541293 Rhizobium sp. GV031 Isolate Unclassified
111 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
112 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
113 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
114 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
115 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
116 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
117 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
118 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
119 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
120 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
121 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
122 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
123 2791355260 Rhizobium sp. L9 Isolate Nodule
124 2791355261 Rhizobium sp. J15 Isolate Nodule
125 2791355264 Rhizobium sp. S9 Isolate Nodule
126 2791355267 Rhizobium sp. L18 Isolate Nodule
127 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
128 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
129 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
130 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
131 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
132 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
133 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
134 2802429633 Rhizobium anhuiense J3 Isolate Nodule
135 2802429634 Rhizobium anhuiense S10 Isolate Nodule
136 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
137 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
138 2802429637 Rhizobium anhuiense C15 Isolate Nodule
139 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
140 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
141 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
142 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
143 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
144 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
145 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
146 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
147 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
148 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
149 2838048938 Rhizobium pisi 27/80 Isolate Nodule
150 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
151 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
152 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
153 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
154 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
155 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
156 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
157 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
158 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
159 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
160 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
161 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
162 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
163 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
164 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
165 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
166 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
167 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
168 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
169 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
170 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
171 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
172 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
173 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
174 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
175 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
176 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
177 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
178 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
179 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
180 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
181 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
182 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
183 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
184 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
185 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
186 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
187 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
188 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
189 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
190 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
191 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
192 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
193 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
194 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
195 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
196 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
197 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
198 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
199 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
200 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
201 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
202 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
203 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
204 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
205 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
206 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
207 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
208 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
209 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
210 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
211 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
212 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
213 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
214 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
215 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
216 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
217 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
218 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
219 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
220 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
221 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
222 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
223 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
224 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
225 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
226 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
227 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
228 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
229 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
230 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
231 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
232 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
233 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
234 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
235 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
236 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
237 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
238 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
239 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
240 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
241 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
242 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
243 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
244 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
245 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
246 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
247 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
248 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
249 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
250 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
251 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
252 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
253 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
254 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
255 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
256 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
257 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
258 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
259 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
260 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
261 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
262 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
263 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
264 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
265 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
266 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
267 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
268 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
269 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
270 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
271 2933599457 Rhizobium phaseoli M3 Isolate Nodule
272 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
273 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
274 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
275 2936381700 Rhizobium chutanense C16 Isolate Unclassified
276 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
277 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
278 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
279 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
280 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
281 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
282 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
283 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
284 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
285 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
286 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
287 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
288 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
289 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
290 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
291 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
292 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
293 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
294 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
295 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
296 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
297 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
298 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
299 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
300 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
301 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
302 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
303 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
304 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
305 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
306 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
307 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
308 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
309 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
310 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
311 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
312 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
313 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
314 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
315 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
316 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
317 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
318 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
319 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
320 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
321 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
322 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
323 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
324 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
325 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
326 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
327 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
328 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
329 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
330 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
331 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
332 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
333 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
334 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
335 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
336 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
337 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
338 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
339 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
340 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
341 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
342 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
343 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
344 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
345 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
346 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
347 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
348 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
349 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
350 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
351 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
352 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
353 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
354 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
355 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
356 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
357 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
358 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
359 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
360 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
361 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
362 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
363 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
364 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
365 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
366 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
367 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
368 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
369 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
370 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
371 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
372 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
373 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
374 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
375 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
376 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
377 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
378 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
379 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
380 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
381 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
382 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
383 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
384 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
385 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
386 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
387 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
388 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
389 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
390 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
391 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
392 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
393 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
394 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
395 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
396 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
397 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
398 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
399 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
400 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
401 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
402 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
403 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
404 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
405 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
406 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
407 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
408 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
409 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
410 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
411 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
412 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
413 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
414 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
415 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
416 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
417 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
418 2996893221 Rhizobium sp. R635 Isolate Nodule
419 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
420 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
421 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
422 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
423 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
424 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
425 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
426 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
427 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
428 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
429 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
430 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
431 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
432 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
433 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
434 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
435 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
436 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
437 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
438 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
439 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
440 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
441 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
443 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
444 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
445 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
446 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
447 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
448 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
449 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
450 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
451 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
452 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
453 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
454 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
455 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
456 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
457 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
458 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
459 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
460 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
461 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
462 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
463 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
464 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
465 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
466 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
467 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
468 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
469 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
470 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
471 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
472 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
473 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
474 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
475 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
476 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
477 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
478 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
479 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
480 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
481 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
482 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
483 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
484 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
485 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
486 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
487 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
488 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
489 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
490 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
491 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
492 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
493 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
494 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
495 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
496 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
497 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
498 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
499 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
500 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
501 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
502 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
503 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
504 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
505 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
506 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
507 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
508 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
509 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
510 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
511 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
512 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
513 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
514 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
515 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
516 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
517 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
518 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
519 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
520 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
521 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
522 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
523 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
524 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
525 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
526 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
527 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
528 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
529 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
530 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
531 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
532 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
533 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
534 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
535 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
536 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
537 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
538 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
539 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
540 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
541 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
542 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
543 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
544 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
545 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
546 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
547 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
548 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
549 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
550 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
551 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
552 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
553 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
554 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
555 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
556 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
557 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
558 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
559 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
560 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
561 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
562 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
563 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
564 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
565 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
566 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
567 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
568 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
569 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
570 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
571 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
572 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
573 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
574 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
575 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
576 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
577 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
578 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
579 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
580 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
581 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
582 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
583 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
584 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
585 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
586 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
587 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
588 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
589 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
590 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
591 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
592 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
593 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
594 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
595 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
596 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
597 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
598 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
599 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
600 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
601 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
602 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
603 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
604 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
605 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
606 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
607 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
608 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
609 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
610 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
611 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
612 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
613 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
614 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
615 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
616 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
617 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
618 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
619 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
620 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
621 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
622 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
623 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
624 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
625 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
626 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
627 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
628 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
629 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
630 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
631 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
632 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
633 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
634 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
635 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
636 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
637 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
638 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
639 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
640 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
641 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
642 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
643 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
644 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
645 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
646 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
647 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
648 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
649 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
650 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
651 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
652 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
653 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
654 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
655 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
656 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
657 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
658 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
659 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
660 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
661 8005382845 Rhizobium sp. R634 Isolate Nodule
662 8005395548 Rhizobium sp. R339 Isolate Nodule
663 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
664 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
665 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
666 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
667 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
668 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
669 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
670 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
671 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
672 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
673 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
674 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
675 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
676 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
677 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
678 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
679 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
680 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
681 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
682 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
683 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
684 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
685 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
686 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 51.72
Metatranscriptomes 0.1
Isolates 48.17

Biome Distribution

Category Percentage (%)
Aerial Root 0.52
Bulb 0
Endosphere 16.41
Nodule 38.04
Rhizoplane 1.46
Rhizosphere 26.12
Stem 0
Stem Tuber 0
Unclassified 17.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000023 3300002704 Bacteria 136961
2 JGI25156J39149_1000029 3300002705 Bacteria 126505
3 JGI25162J39368_1002348 3300002737 Bacteria 7511
4 JGI25154J39366_1000067 3300002738 Bacteria 100452
5 JGI25158J39367_1000254 3300002739 Bacteria 12201
6 JGI25157J39369_1000043 3300002741 Bacteria 122537
7 JGI25152J39213_1006415 3300002773 Bacteria 3218
8 JGI25152J39213_1007261 3300002773 Bacteria 2894
9 JGI25150J39212_1000012 3300002774 Bacteria 182468
10 JGI25159J45721_1000087 3300002987 Bacteria 43868
11 JGI25159J45721_1002669 3300002987 Bacteria 6642
12 JGI25151J46595_10000025 3300003187 Bacteria 213302
13 JGI25151J46595_10000346 3300003187 Bacteria 49745
14 JGI25151J46595_10008951 3300003187 Bacteria 4775
15 JGI25151J46595_10047816 3300003187 Bacteria 1484
16 JGI25165J46597_1000529 3300003214 Bacteria 35691
17 JGI25165J46597_1001287 3300003214 Bacteria 14566
18 JGI25165J46597_1013388 3300003214 Bacteria 1130
19 JGI25153J46596_10002371 3300003215 Bacteria 10908
20 JGI25153J46596_10003997 3300003215 Bacteria 8052
21 rootH1_10041182 3300003316 Bacteria 1303
22 rootH1_10041182 3300003323 Bacteria 1456
23 rootH1_10167985 3300003316 Bacteria 1273
24 rootH2_10017545 3300003320 Bacteria 1127
25 rootH2_10053655 3300003320 Bacteria 1553
26 rootH2_10186027 3300003320 Bacteria 1218
27 rootL2_10099180 3300003322 Bacteria 2159
28 rootH1_10046242 3300003323 Bacteria 1450
29 rootH1_10123595 3300003323 Bacteria 1117
30 JGI25160J50197_1000046 3300003354 Bacteria 141352
31 JGI25160J50197_1000500 3300003354 Bacteria 23279
32 JGI25160J50197_1003907 3300003354 Bacteria 6525
33 JGI25161J50226_1000031 3300003374 Bacteria 141352
34 JGI25161J50226_1000074 3300003374 Bacteria 85547
35 JGI25161J50226_1000382 3300003374 Bacteria 22288
36 Ga0032354_1032914 3300003693 Bacteria 3030
37 Ga0055526_1002431 3300003771 Bacteria 12618
38 Ga0055526_1015836 3300003771 Bacteria 2998
39 Ga0055524_1002633 3300003775 Bacteria 9137
40 Ga0055524_1003868 3300003775 Bacteria 7101
41 Ga0055524_1004431 3300003775 Bacteria 6477
42 Ga0055524_1008508 3300003775 Bacteria 4258
43 Ga0055528_1000303 3300003790 Bacteria 41794
44 Ga0055528_1001497 3300003790 Bacteria 14166
45 Ga0055540_1000471 3300003792 Bacteria 31092
46 Ga0055540_1001471 3300003792 Bacteria 14037
47 Ga0055531_10005094 3300003794 Bacteria 7768
48 Ga0058692_1009082 3300003856 Bacteria 2528
49 Ga0055543_1000008 3300004625 Bacteria 202062
50 Ga0055543_1000141 3300004625 Bacteria 60055
51 Ga0055543_1001182 3300004625 Bacteria 11019
52 Ga0065165_1000031 3300005262 Bacteria 216330
53 Ga0065165_1005966 3300005262 Bacteria 6585
54 Ga0065165_1011908 3300005262 Bacteria 3580
55 Ga0065165_1013652 3300005262 Bacteria 3213
56 Ga0065165_1068442 3300005262 Bacteria 950
57 Ga0065704_10001731 3300005289 Bacteria 9637
58 Ga0070668_100373549 3300005347 Bacteria 1212
59 Ga0070668_100416239 3300005347 Bacteria 1150
60 Ga0070669_100069998 3300005353 Bacteria 2592
61 Ga0070667_100169152 3300005367 Bacteria 1929
62 Ga0070678_100782328 3300005456 Bacteria 865
63 Ga0070665_100014231 3300005548 Bacteria 7991
64 Ga0070665_100220086 3300005548 Bacteria 1899
65 Ga0070665_100536846 3300005548 Bacteria 1181
66 Ga0068855_100254945 3300005563 Bacteria 1956
67 Ga0068854_100198901 3300005578 Bacteria 1574
68 Ga0068854_100284660 3300005578 Bacteria 1332
69 Ga0068856_100301256 3300005614 Bacteria 1621
70 Ga0068851_10051204 3300005834 Bacteria 2098
71 Ga0075365_10011895 3300006038 Bacteria 5139
72 Ga0075365_10106442 3300006038 Bacteria 1925
73 Ga0075368_10000571 3300006042 Bacteria 11054
74 Ga0075368_10019855 3300006042 Bacteria 2539
75 Ga0075363_100085615 3300006048 Bacteria 1729
76 Ga0075364_10151574 3300006051 Bacteria 1562
77 Ga0075364_10214680 3300006051 Bacteria 1305
78 Ga0075367_10085263 3300006178 Bacteria 1916
79 Ga0075367_10088173 3300006178 Bacteria 1885
80 Ga0075369_10027622 3300006186 Bacteria 2373
81 Ga0075369_10028567 3300006186 Bacteria 2338
82 Ga0075369_10074301 3300006186 Bacteria 1499
83 Ga0075366_10014660 3300006195 Bacteria 4479
84 Ga0075370_10086455 3300006353 Bacteria 1806
85 Ga0075370_10139831 3300006353 Bacteria 1415
86 Ga0075370_10214402 3300006353 Bacteria 1137
87 Ga0079104_1000876 3300006946 Bacteria 24701
88 Ga0079104_1004688 3300006946 Bacteria 5731
89 Ga0099826_10000216 3300006948 Bacteria 24979
90 Ga0105244_10081231 3300009036 Bacteria 1604
91 Ga0105240_10000278 3300009093 Bacteria 101540
92 Ga0105237_10003138 3300009545 Bacteria 19875
93 Ga0105238_10300955 3300009551 Bacteria 1587
94 Ga0123341_1000192 3300009765 Bacteria 31290
95 Ga0123342_1013143 3300009766 Bacteria 8393
96 Ga0105239_10001623 3300010375 Bacteria 29710
97 Ga0105246_10156879 3300011119 Bacteria 1729
98 Ga0157373_10049858 3300013100 Bacteria 2982
99 Ga0157371_10000058 3300013102 Bacteria 171756
100 Ga0157371_10015095 3300013102 Bacteria 5806
101 Ga0157370_10002372 3300013104 Bacteria 22708
102 Ga0157369_10866275 3300013105 Bacteria 927
103 Ga0171463_1001 3300013249 Bacteria 1406070
104 Ga0163162_11141173 3300013306 Bacteria 884
105 Ga0182007_10045652 3300015262 Bacteria 1452
106 Ga0182005_1022742 3300015265 Bacteria 1716
107 Ga0183363_1012 3300015690 Bacteria 90054
108 Ga0214544_1000012 3300021320 Bacteria 229808
109 Ga0214542_1000011 3300021321 Bacteria 238260
110 Ga0214542_1009335 3300021321 Bacteria 15333
111 Ga0214543_1000004 3300021327 Bacteria 527190
112 Ga0214543_1000256 3300021327 Bacteria 82084
113 Ga0228711_1000019 3300022739 Bacteria 111795
114 Ga0228710_1000022 3300022740 Bacteria 111795
115 Ga0209435_100011 3300025206 Bacteria 413027
116 Ga0209436_100051 3300025208 Bacteria 64359
117 Ga0209437_100036 3300025233 Bacteria 469153
118 Ga0209437_100086 3300025233 Bacteria 254578
119 Ga0207425_1000012 3300025245 Bacteria 528324
120 Ga0207425_1004154 3300025245 Bacteria 4415
121 Ga0207425_1007794 3300025245 Bacteria 2792
122 Ga0209646_1000024 3300025246 Bacteria 413027
123 Ga0209026_1000030 3300025250 Bacteria 329811
124 Ga0209677_101207 3300025253 Bacteria 11759
125 Ga0209148_1004207 3300025254 Bacteria 3610
126 Ga0209759_1000011 3300025256 Bacteria 413027
127 Ga0209129_1000081 3300025258 Bacteria 183694
128 Ga0209129_1000123 3300025258 Bacteria 133661
129 Ga0209129_1000545 3300025258 Bacteria 26086
130 Ga0209129_1003389 3300025258 Bacteria 6996
131 Ga0209233_1000110 3300025261 Bacteria 260825
132 Ga0209233_1000166 3300025261 Bacteria 152270
133 Ga0209233_1000356 3300025261 Bacteria 42791
134 Ga0209455_1020560 3300025272 Bacteria 1302
135 Ga0209673_1000015 3300025273 Bacteria 530618
136 Ga0209673_1000967 3300025273 Bacteria 35634
137 Ga0209673_1001074 3300025273 Bacteria 30901
138 Ga0209673_1002143 3300025273 Bacteria 14688
139 Ga0209673_1003246 3300025273 Bacteria 9824
140 Ga0209130_1000002 3300025284 Bacteria 722648
141 Ga0209130_1000088 3300025284 Bacteria 152927
142 Ga0209130_1008937 3300025284 Bacteria 2904
143 Ga0209675_1039946 3300025291 Bacteria 1035
144 Ga0209676_1003256 3300025292 Bacteria 10221
145 Ga0209676_1015253 3300025292 Bacteria 2836
146 Ga0209025_1000024 3300025294 Bacteria 528324
147 Ga0209025_1000441 3300025294 Bacteria 81951
148 Ga0209025_1000528 3300025294 Bacteria 72802
149 Ga0209025_1000970 3300025294 Bacteria 43006
150 Ga0209025_1016350 3300025294 Bacteria 4388
151 Ga0209025_1093537 3300025294 Bacteria 975
152 Ga0209564_1000382 3300025295 Bacteria 81070
153 Ga0209564_1001938 3300025295 Bacteria 18408
154 Ga0209564_1006978 3300025295 Bacteria 5926
155 Ga0209758_1000046 3300025297 Bacteria 364931
156 Ga0209758_1000349 3300025297 Bacteria 84164
157 Ga0209758_1001048 3300025297 Bacteria 36241
158 Ga0209050_1002637 3300025298 Bacteria 14727
159 Ga0209050_1005205 3300025298 Bacteria 8315
160 Ga0209256_1000180 3300025299 Bacteria 123687
161 Ga0209256_1000874 3300025299 Bacteria 37312
162 Ga0209256_1000991 3300025299 Bacteria 33849
163 Ga0209256_1003297 3300025299 Bacteria 11510
164 Ga0209256_1052758 3300025299 Bacteria 976
165 Ga0207426_1000012 3300025302 Bacteria 730942
166 Ga0207426_1000013 3300025302 Bacteria 721897
167 Ga0207426_1000063 3300025302 Bacteria 358920
168 Ga0207426_1000172 3300025302 Bacteria 163690
169 Ga0209051_1000084 3300025303 Bacteria 190324
170 Ga0209051_1001361 3300025303 Bacteria 21200
171 Ga0209051_1005782 3300025303 Bacteria 7121
172 Ga0209051_1011680 3300025303 Bacteria 4313
173 Ga0209051_1031902 3300025303 Bacteria 2019
174 Ga0209257_1004216 3300025304 Bacteria 11393
175 Ga0209257_1010896 3300025304 Bacteria 4495
176 Ga0209257_1027231 3300025304 Bacteria 1906
177 Ga0207656_10071163 3300025321 Bacteria 1546
178 Ga0207695_10000376 3300025913 Bacteria 101548
179 Ga0207671_10000275 3300025914 Bacteria 76888
180 Ga0207667_10233512 3300025949 Bacteria 1883
181 Ga0207668_10596720 3300025972 Bacteria 962
182 Ga0207658_10022653 3300025986 Bacteria 4376
183 Ga0207678_10193399 3300026067 Bacteria 1739
184 Ga0207702_10062428 3300026078 Bacteria 3182
185 Ga0209281_1000192 3300027111 Bacteria 140252
186 Ga0209281_1000227 3300027111 Bacteria 119329
187 Ga0209281_1001513 3300027111 Bacteria 13209
188 Ga0209371_1000009 3300027312 Bacteria 963030
189 Ga0209371_1000547 3300027312 Bacteria 35249
190 Ga0209371_1003471 3300027312 Bacteria 7634
191 Ga0209282_1000042 3300027666 Bacteria 119329
192 Ga0209282_1012946 3300027666 Bacteria 5308
193 Ga0209813_10018418 3300027866 Bacteria 1930
194 Ga0268266_10003170 3300028379 Bacteria 16690
195 Ga0268266_10215388 3300028379 Bacteria 1763
196 Ga0268256_1000010 3300030500 Bacteria 963034
197 Ga0268256_1003179 3300030500 Bacteria 7634
198 Ga0268256_1021622 3300030500 Bacteria 1706
199 Ga0316181_1112456 3300030744 Bacteria 4196
200 Ga0307513_10118868 3300031456 Bacteria 2616
201 Ga0316575_10021494 3300031665 Bacteria 2484
202 Ga0307405_10001288 3300031731 Bacteria 10466
203 Ga0307412_10009244 3300031911 Bacteria 5650
204 Ga0315914_1000009 3300031967 Bacteria 182444
205 Ga0307409_100134946 3300031995 Bacteria 2116
206 Ga0307416_100292761 3300032002 Bacteria 1613
207 Ga0307414_10011355 3300032004 Bacteria 5219
208 Ga0315913_1000015 3300033430 Bacteria 119325
209 Ga0315915_1000013 3300033464 Bacteria 182438
210 Ga0373927_0000887 3300035695 Bacteria 22766
211 Ga0373925_0003273 3300037068 Bacteria 12613
212 Ga0439465_0016858 3300041413 Bacteria 2280
213 Ga0439465_0021834 3300041413 Bacteria 2009
214 Ga0439465_0033354 3300041413 Bacteria 1646
215 Ga0451787_595301 3300041441 Bacteria 1364
216 Ga0451791_1542001 3300041451 Bacteria 1734
217 Ga0451798_0298663 3300041458 Bacteria 1890
218 Ga0451841_0033924 3300041498 Bacteria 1100
219 Ga0451851_0667480 3300041507 Bacteria 3946
220 Ga0439459_0031337 3300042438 Bacteria 1084
221 Ga0466960_0014783 3300044901 Bacteria 3352
222 Ga0495590_0084389 3300046457 Bacteria 1120
223 Ga0495638_0192024 3300046460 Bacteria 1158
224 Ga0495662_0018301 3300046476 Bacteria 3391
225 Ga0495585_0053852 3300046492 Bacteria 2226
226 Ga0495606_0001322 3300046507 Bacteria 33851
227 Ga0495606_0053292 3300046507 Bacteria 2625
228 Ga0495606_0106257 3300046507 Bacteria 1700
229 Ga0495610_0123856 3300046512 Bacteria 1129
230 Ga0495616_0163119 3300046513 Bacteria 1001
231 Ga0495620_0101656 3300046515 Bacteria 1145
232 Ga0495643_0036445 3300046522 Bacteria 2701
233 Ga0495643_0117763 3300046522 Bacteria 1344
234 Ga0495648_0095626 3300046524 Bacteria 1652
235 Ga0495654_0001458 3300046530 Bacteria 16197
236 Ga0495597_0100895 3300046542 Bacteria 1217
237 Ga0495633_0139263 3300046558 Bacteria 1122
238 Ga0495668_0044767 3300046616 Bacteria 2459
239 Ga0495611_0190828 3300046648 Bacteria 956
240 Ga0495625_0110963 3300046660 Bacteria 1874
241 Ga0495625_0268577 3300046660 Bacteria 1101
242 Ga0495588_0041275 3300046674 Bacteria 2355
243 Ga0495658_0119475 3300046683 Bacteria 1593
244 Ga0495624_0283059 3300046690 Bacteria 1001
245 Ga0495671_0078267 3300046692 Bacteria 1621
246 Ga0495671_0099083 3300046692 Bacteria 1425
247 Ga0495649_0000165 3300046694 Bacteria 57643
248 Ga0495649_0211207 3300046694 Bacteria 1005
249 Ga0495660_0037091 3300046810 Bacteria 2716
250 Ga0495683_0152950 3300047323 Bacteria 1072
251 Ga0495687_059685 3300047443 Bacteria 1576
252 Ga0495681_0006515 3300047470 Bacteria 7656
253 Ga0495686_0082371 3300047472 Bacteria 1963
254 Ga0495686_0226314 3300047472 Bacteria 1061
255 Ga0495686_0252425 3300047472 Bacteria 991
256 Ga0496101_0530664 3300048904 Bacteria 930
257 Ga0496103_0301184 3300048906 Bacteria 1031
258 Ga0496106_0017594 3300048909 Bacteria 5287
259 Ga0496106_0251774 3300048909 Bacteria 1412
260 Ga0496113_0305184 3300048916 Bacteria 1275
261 Ga0496114_0011920 3300048917 Bacteria 6956
262 Ga0496116_0000080 3300048919 Bacteria 224530
263 Ga0496116_0009980 3300048919 Bacteria 8021
264 Ga0496116_0031077 3300048919 Bacteria 3829
265 Ga0496116_0043024 3300048919 Bacteria 3080
266 Ga0496116_0066648 3300048919 Bacteria 2303
267 Ga0496116_0078950 3300048919 Bacteria 2050
268 Ga0496116_0143485 3300048919 Bacteria 1339
269 Ga0496116_0144264 3300048919 Bacteria 1333
270 Ga0496116_0205731 3300048919 Bacteria 1025
271 Ga0496117_0000002 3300048920 Bacteria 2483758
272 Ga0496117_0002570 3300048920 Bacteria 22598
273 Ga0496117_0003540 3300048920 Bacteria 18034
274 Ga0496117_0016471 3300048920 Bacteria 6239
275 Ga0496117_0031612 3300048920 Bacteria 4037
276 Ga0496117_0116758 3300048920 Bacteria 1649
277 Ga0496117_0117248 3300048920 Bacteria 1644
278 Ga0496117_0149367 3300048920 Bacteria 1385
279 Ga0496117_0161780 3300048920 Bacteria 1310
280 Ga0496117_0179606 3300048920 Bacteria 1218
281 Ga0496117_0187332 3300048920 Bacteria 1183
282 Ga0496118_0000233 3300048921 Bacteria 97731
283 Ga0496118_0004324 3300048921 Bacteria 16941
284 Ga0496118_0056155 3300048921 Bacteria 2963
285 Ga0496118_0060112 3300048921 Bacteria 2824
286 Ga0496118_0114365 3300048921 Bacteria 1779
287 Ga0496118_0138849 3300048921 Bacteria 1545
288 Ga0496118_0147281 3300048921 Bacteria 1480
289 Ga0496118_0189347 3300048921 Bacteria 1232
290 Ga0496119_0025703 3300048922 Bacteria 4104
291 Ga0496119_0147606 3300048922 Bacteria 1263
292 Ga0496119_0168368 3300048922 Bacteria 1159
293 Ga0496120_0000021 3300048923 Bacteria 250966
294 Ga0496120_0006881 3300048923 Bacteria 8589
295 Ga0496120_0038167 3300048923 Bacteria 2844
296 Ga0496121_0000001 3300048924 Bacteria 1830318
297 Ga0496121_0006792 3300048924 Bacteria 14018
298 Ga0496121_0115192 3300048924 Bacteria 2041
299 Ga0496121_0136052 3300048924 Bacteria 1830
300 Ga0496121_0176353 3300048924 Bacteria 1547
301 Ga0496121_0190184 3300048924 Bacteria 1472
302 Ga0496121_0386357 3300048924 Bacteria 921
303 Ga0496122_0000001 3300048925 Bacteria 1827766
304 Ga0496122_0001050 3300048925 Bacteria 48341
305 Ga0496122_0002476 3300048925 Bacteria 26097
306 Ga0496122_0011009 3300048925 Bacteria 9243
307 Ga0496122_0124535 3300048925 Bacteria 1653
308 Ga0496122_0178776 3300048925 Bacteria 1268
309 Ga0496122_0186589 3300048925 Bacteria 1229
310 Ga0496123_0000001 3300048926 Bacteria 1831497
311 Ga0496123_0000020 3300048926 Bacteria 388748
312 Ga0496123_0000158 3300048926 Bacteria 136078
313 Ga0496123_0052473 3300048926 Bacteria 2705
314 Ga0496123_0064102 3300048926 Bacteria 2343
315 Ga0496123_0075335 3300048926 Bacteria 2083
316 Ga0496123_0112189 3300048926 Bacteria 1555
317 Ga0496123_0133630 3300048926 Bacteria 1369
318 Ga0496123_0141095 3300048926 Bacteria 1317
319 Ga0496123_0141915 3300048926 Bacteria 1311
320 Ga0496124_0000063 3300048927 Bacteria 229705
321 Ga0496124_0004315 3300048927 Bacteria 16678
322 Ga0496124_0006030 3300048927 Bacteria 13355
323 Ga0496124_0010037 3300048927 Bacteria 9661
324 Ga0496124_0063645 3300048927 Bacteria 3080
325 Ga0496124_0076573 3300048927 Bacteria 2761
326 Ga0496124_0109017 3300048927 Bacteria 2232
327 Ga0496124_0140029 3300048927 Bacteria 1910
328 Ga0496124_0214194 3300048927 Bacteria 1455
329 Ga0496124_0268676 3300048927 Bacteria 1250
330 Ga0496125_0000001 3300048928 Bacteria 1766138
331 Ga0496125_0000695 3300048928 Bacteria 55563
332 Ga0496125_0056070 3300048928 Bacteria 3203
333 Ga0496125_0056714 3300048928 Bacteria 3178
334 Ga0496125_0117809 3300048928 Bacteria 1903
335 Ga0496125_0130811 3300048928 Bacteria 1767
336 Ga0496125_0199862 3300048928 Bacteria 1310
337 Ga0496125_0204495 3300048928 Bacteria 1289
338 Ga0496126_0000094 3300048929 Bacteria 208184
339 Ga0496126_0000195 3300048929 Bacteria 135582
340 Ga0496126_0190342 3300048929 Bacteria 1738
341 Ga0496126_0193203 3300048929 Bacteria 1723
342 Ga0496126_0645744 3300048929 Bacteria 828
343 Ga0496126_0645784 3300048929 Bacteria 828
344 Ga0495678_043266 3300049459 Bacteria 1790
345 Ga0501031_0000003 3300049568 Bacteria 206821
346 Ga0501031_0010940 3300049568 Bacteria 5910
347 Ga0501031_0012255 3300049568 Bacteria 5588
348 Ga0501031_0283955 3300049568 Bacteria 1073
349 Ga0501032_0000010 3300049569 Bacteria 206795
350 Ga0501032_0000234 3300049569 Bacteria 46284
351 Ga0501032_0021226 3300049569 Bacteria 4516
352 Ga0501032_0137564 3300049569 Bacteria 1609
353 Ga0501032_0172395 3300049569 Bacteria 1418
354 Ga0501032_0296874 3300049569 Bacteria 1045
355 Ga0501033_0000017 3300049570 Bacteria 206819
356 Ga0501033_0000076 3300049570 Bacteria 93921
357 Ga0501033_0000495 3300049570 Bacteria 37085
358 Ga0501033_0001157 3300049570 Bacteria 23861
359 Ga0501033_0012742 3300049570 Bacteria 6412
360 Ga0501033_0178235 3300049570 Bacteria 1524
361 Ga0501033_0328447 3300049570 Bacteria 1073
362 Ga0501034_0000053 3300049571 Bacteria 206821
363 Ga0501034_0000408 3300049571 Bacteria 72244
364 Ga0501034_0043595 3300049571 Bacteria 4539
365 Ga0501034_0164311 3300049571 Bacteria 2189
366 Ga0501034_0465523 3300049571 Bacteria 1180
367 Ga0501036_0000009 3300049572 Bacteria 206821
368 Ga0501036_0001942 3300049572 Bacteria 16039
369 Ga0501036_0073396 3300049572 Bacteria 2893
370 Ga0501036_0369304 3300049572 Bacteria 1197
371 Ga0501036_0449501 3300049572 Bacteria 1073
372 Ga0501037_0000008 3300049573 Bacteria 206812
373 Ga0501037_0000308 3300049573 Bacteria 41514
374 Ga0501037_0000533 3300049573 Bacteria 30360
375 Ga0501037_0047422 3300049573 Bacteria 3148
376 Ga0501037_0156831 3300049573 Bacteria 1624
377 Ga0501037_0252976 3300049573 Bacteria 1232
378 Ga0501037_0263556 3300049573 Bacteria 1204
379 Ga0501038_0000008 3300049574 Bacteria 206821
380 Ga0501038_0000241 3300049574 Bacteria 46177
381 Ga0501038_0110679 3300049574 Bacteria 2275
382 Ga0501038_0327317 3300049574 Bacteria 1197
383 Ga0501038_0465463 3300049574 Bacteria 971
384 Ga0501039_0000021 3300049575 Bacteria 162552
385 Ga0501039_0000196 3300049575 Bacteria 43498
386 Ga0501039_0010706 3300049575 Bacteria 6986
387 Ga0501039_0435611 3300049575 Bacteria 1029
388 Ga0501040_0001596 3300049576 Bacteria 14448
389 Ga0501040_0096527 3300049576 Bacteria 2058
390 Ga0501042_0106048 3300049578 Bacteria 2022
391 Ga0501043_0000005 3300049579 Bacteria 254466
392 Ga0501043_0000043 3300049579 Bacteria 115410
393 Ga0501043_0001135 3300049579 Bacteria 23377
394 Ga0501043_0039716 3300049579 Bacteria 3699
395 Ga0501043_0088873 3300049579 Bacteria 2428
396 Ga0501043_0266271 3300049579 Bacteria 1316
397 Ga0501046_0053761 3300049580 Bacteria 3170
398 Ga0501046_0119833 3300049580 Bacteria 2003
399 Ga0501046_0308926 3300049580 Bacteria 1153
400 Ga0501047_0000126 3300049581 Bacteria 93841
401 Ga0501047_0094812 3300049581 Bacteria 2863
402 Ga0501047_0169348 3300049581 Bacteria 2053
403 Ga0501047_0397490 3300049581 Bacteria 1211
404 Ga0501047_0419612 3300049581 Bacteria 1169
405 Ga0501047_0466447 3300049581 Bacteria 1091
406 Ga0501048_0004705 3300049582 Bacteria 10392
407 Ga0501067_0142045 3300049583 Bacteria 1337
408 Ga0501068_0122751 3300049584 Bacteria 1621
409 Ga0501068_0179028 3300049584 Bacteria 1340
410 Ga0501069_0000011 3300049585 Bacteria 153214
411 Ga0501069_0203562 3300049585 Bacteria 1147
412 Ga0501069_0280354 3300049585 Bacteria 975
413 Ga0501070_0000117 3300049586 Bacteria 70793
414 Ga0501070_0000257 3300049586 Bacteria 50142
415 Ga0501070_0010854 3300049586 Bacteria 7694
416 Ga0501070_0021633 3300049586 Bacteria 5394
417 Ga0501070_0024616 3300049586 Bacteria 5047
418 Ga0501070_0043444 3300049586 Bacteria 3739
419 Ga0501071_0072949 3300049587 Bacteria 2503
420 Ga0501073_0052547 3300049589 Bacteria 2853
421 Ga0501073_0084610 3300049589 Bacteria 2207
422 Ga0501073_0277058 3300049589 Bacteria 1157
423 Ga0501074_0038414 3300049590 Bacteria 3469
424 Ga0501074_0050119 3300049590 Bacteria 3014
425 Ga0501074_0188929 3300049590 Bacteria 1469
426 Ga0501080_0016949 3300049742 Bacteria 6727
427 Ga0501080_0039435 3300049742 Bacteria 4408
428 Ga0501080_0150872 3300049742 Bacteria 2148
429 Ga0501083_0000831 3300049744 Bacteria 20279
430 Ga0501083_0040937 3300049744 Bacteria 3144
431 Ga0501083_0283738 3300049744 Bacteria 1077
432 Ga0501035_0000023 3300049822 Bacteria 206821
433 Ga0501035_0000107 3300049822 Bacteria 103130
434 Ga0501035_0000449 3300049822 Bacteria 46083
435 Ga0501035_0001314 3300049822 Bacteria 25674
436 Ga0501035_0002296 3300049822 Bacteria 18885
437 Ga0501035_0022408 3300049822 Bacteria 5800
438 Ga0501035_0044299 3300049822 Bacteria 4007
439 Ga0501035_0051590 3300049822 Bacteria 3682
440 Ga0501035_0074842 3300049822 Bacteria 2995
441 Ga0501035_0120322 3300049822 Bacteria 2296
442 Ga0501035_0283448 3300049822 Bacteria 1400
443 Ga0501035_0369481 3300049822 Bacteria 1197
444 Ga0501035_0444308 3300049822 Bacteria 1073
445 Ga0501035_0714358 3300049822 Bacteria 807
446 Ga0501044_0000021 3300049823 Bacteria 206821
447 Ga0501044_0000154 3300049823 Bacteria 85407
448 Ga0501044_0003690 3300049823 Bacteria 17210
449 Ga0501044_0082812 3300049823 Bacteria 3245
450 Ga0501044_0098865 3300049823 Bacteria 2937
451 Ga0501044_0192944 3300049823 Bacteria 1998
452 Ga0501044_0227015 3300049823 Bacteria 1816
453 Ga0501044_0448222 3300049823 Bacteria 1197
454 Ga0501044_0532370 3300049823 Bacteria 1073
455 Ga0501045_0027060 3300049824 Bacteria 4129
456 nmdc:mga00v17_4902_c1 3300050491 Bacteria 7015
457 nmdc:mga00v17_72_c1 3300050491 Bacteria 60922
458 nmdc:mga0yw44_109848_c1 3300050492 Bacteria 1766
459 nmdc:mga0yw44_35604_c1 3300050492 Bacteria 2926
460 nmdc:mga0yw44_41265_c1 3300050492 Bacteria 2747
461 nmdc:mga0k408_150279_c1 3300050493 Bacteria 1387
462 nmdc:mga06z11_104763_c1 3300050494 Bacteria 1558
463 nmdc:mga06z11_166055_c1 3300050494 Bacteria 1264
464 nmdc:mga04h51_1892_c1 3300050495 Bacteria 4885
465 nmdc:mga07m45_113552_c1 3300050496 Bacteria 1561
466 nmdc:mga07m45_162572_c1 3300050496 Bacteria 1296
467 nmdc:mga0sz30_168461_c1 3300050516 Bacteria 971
468 nmdc:mga0sz30_82783_c1 3300050516 Bacteria 1390
469 Ga0500644_0045322 3300053088 Bacteria 1481
470 Ga0500644_0084213 3300053088 Bacteria 1176
471 Ga0500651_0015578 3300053093 Bacteria 4667
472 Ga0500560_026381 3300053107 Bacteria 1715
473 Ga0500560_103419 3300053107 Bacteria 954
474 Ga0500562_073957 3300053108 Bacteria 920
475 Ga0500572_002397 3300053111 Bacteria 4521
476 Ga0500594_0113537 3300053118 Bacteria 845
477 Ga0500618_024101 3300053125 Bacteria 1467
478 Ga0500642_0252219 3300053130 Bacteria 810
479 Ga0500658_0005820 3300053134 Bacteria 4591
480 Ga0500658_0097498 3300053134 Bacteria 1279
481 Ga0500659_0159517 3300053135 Bacteria 1117
482 Ga0500568_0027275 3300053139 Bacteria 2390
483 Ga0500568_0090338 3300053139 Bacteria 1155
484 Ga0500573_0002214 3300053140 Bacteria 9624
485 Ga0500573_0112053 3300053140 Bacteria 1525
486 Ga0500604_0059210 3300053151 Bacteria 1199
487 Ga0500616_0000817 3300053153 Bacteria 35314
488 Ga0500616_0091130 3300053153 Bacteria 1509
489 Ga0500622_0000391 3300053156 Bacteria 42302
490 Ga0500622_0086810 3300053156 Bacteria 1558
491 Ga0500624_001342 3300053157 Bacteria 4168
492 Ga0500627_0189577 3300053158 Bacteria 924
493 Ga0500633_0076466 3300053160 Bacteria 1204
494 Ga0500634_0074801 3300053161 Bacteria 1763
495 Ga0500636_0000010 3300053177 Bacteria 145932
496 Ga0500636_0006722 3300053177 Bacteria 6617
497 Ga0501082_0093908 3300060353 Bacteria 2592

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2924776078 2924781660 186
2 3300049568 Ga0501031_0010940 Ga0501031_0010940_5310_5885 189
3 3300049575 Ga0501039_0435611 Ga0501039_0435611_26_601 189
4 3300048920 Ga0496117_0117248 Ga0496117_0117248_143_790 192
5 3300032004 Ga0307414_10011355 Ga0307414_100113552 193
6 3300048917 Ga0496114_0011920 Ga0496114_0011920_3046_3759 193
7 3300049822 Ga0501035_0714358 Ga0501035_0714358_61_696 193
8 3300031665 Ga0316575_10021494 Ga0316575_100214942 198
9 3300002773 JGI25152J39213_1007261 JGI25152J39213_10072612 199
10 3300003187 JGI25151J46595_10047816 JGI25151J46595_100478162 199
11 3300003316 rootH1_10167985 rootH1_101679852 199
12 3300005262 Ga0065165_1068442 Ga0065165_10684422 199
13 3300025245 Ga0207425_1007794 Ga0207425_10077942 199
14 3300025258 Ga0209129_1000123 Ga0209129_100012335 199
15 3300025303 Ga0209051_1031902 Ga0209051_10319022 199
16 3300041413 Ga0439465_0021834 Ga0439465_0021834_648_1361 200
17 iso_pu_bacteria 2547132103 2547372860 201
18 iso_pu_bacteria 2843690924 2843695746 201
19 3300005548 Ga0070665_100536846 Ga0070665_1005368461 202
20 3300009036 Ga0105244_10081231 Ga0105244_100812312 202
21 3300025284 Ga0209130_1008937 Ga0209130_10089372 202
22 3300046507 Ga0495606_0001322 Ga0495606_0001322_27419_28156 202
23 3300048909 Ga0496106_0251774 Ga0496106_0251774_384_1082 202
24 3300048920 Ga0496117_0116758 Ga0496117_0116758_673_1371 202
25 3300048924 Ga0496121_0136052 Ga0496121_0136052_832_1530 202
26 3300048924 Ga0496121_0176353 Ga0496121_0176353_353_1090 202
27 3300049568 Ga0501031_0012255 Ga0501031_0012255_1908_2597 202
28 3300049569 Ga0501032_0000234 Ga0501032_0000234_11101_11790 202
29 3300049570 Ga0501033_0000076 Ga0501033_0000076_45970_46659 202
30 3300049571 Ga0501034_0000408 Ga0501034_0000408_63758_64447 202
31 3300049572 Ga0501036_0001942 Ga0501036_0001942_3700_4389 202
32 3300049573 Ga0501037_0000533 Ga0501037_0000533_3614_4303 202
33 3300049574 Ga0501038_0000241 Ga0501038_0000241_34381_35070 202
34 3300049575 Ga0501039_0000196 Ga0501039_0000196_34529_35218 202
35 3300049579 Ga0501043_0000043 Ga0501043_0000043_50693_51382 202
36 3300049580 Ga0501046_0053761 Ga0501046_0053761_2120_2809 202
37 3300049822 Ga0501035_0000449 Ga0501035_0000449_34414_35103 202
38 3300049823 Ga0501044_0003690 Ga0501044_0003690_12975_13664 202
39 3300003771 Ga0055526_1015836 Ga0055526_10158362 203
40 3300003775 Ga0055524_1008508 Ga0055524_10085082 203
41 3300003790 Ga0055528_1000303 Ga0055528_10003037 203
42 3300025273 Ga0209673_1000015 Ga0209673_1000015379 203
43 3300025292 Ga0209676_1015253 Ga0209676_10152532 203
44 3300025294 Ga0209025_1016350 Ga0209025_10163503 203
45 3300025295 Ga0209564_1006978 Ga0209564_10069783 203
46 3300025299 Ga0209256_1000991 Ga0209256_10009913 203
47 3300010375 Ga0105239_10001623 Ga0105239_100016239 204
48 3300015265 Ga0182005_1022742 Ga0182005_10227422 204
49 3300048922 Ga0496119_0147606 Ga0496119_0147606_285_971 204
50 3300048924 Ga0496121_0006792 Ga0496121_0006792_350_1036 204
51 3300048927 Ga0496124_0004315 Ga0496124_0004315_15632_16318 204
52 3300049568 Ga0501031_0283955 Ga0501031_0283955_319_1017 204
53 3300049569 Ga0501032_0137564 Ga0501032_0137564_855_1553 204
54 3300049570 Ga0501033_0328447 Ga0501033_0328447_57_755 204
55 3300049571 Ga0501034_0043595 Ga0501034_0043595_2174_2872 204
56 3300049571 Ga0501034_0465523 Ga0501034_0465523_40_738 204
57 3300049572 Ga0501036_0369304 Ga0501036_0369304_443_1141 204
58 3300049572 Ga0501036_0449501 Ga0501036_0449501_319_1017 204
59 3300049573 Ga0501037_0047422 Ga0501037_0047422_1016_1714 204
60 3300049573 Ga0501037_0252976 Ga0501037_0252976_419_1117 204
61 3300049574 Ga0501038_0110679 Ga0501038_0110679_57_755 204
62 3300049574 Ga0501038_0327317 Ga0501038_0327317_443_1141 204
63 3300049574 Ga0501038_0465463 Ga0501038_0465463_108_821 204
64 3300049575 Ga0501039_0010706 Ga0501039_0010706_2020_2718 204
65 3300049576 Ga0501040_0096527 Ga0501040_0096527_1257_1955 204
66 3300049578 Ga0501042_0106048 Ga0501042_0106048_914_1612 204
67 3300049579 Ga0501043_0266271 Ga0501043_0266271_562_1260 204
68 3300049580 Ga0501046_0308926 Ga0501046_0308926_408_1106 204
69 3300049581 Ga0501047_0397490 Ga0501047_0397490_373_1086 204
70 3300049581 Ga0501047_0419612 Ga0501047_0419612_57_755 204
71 3300049582 Ga0501048_0004705 Ga0501048_0004705_5152_5850 204
72 3300049583 Ga0501067_0142045 Ga0501067_0142045_390_1088 204
73 3300049586 Ga0501070_0010854 Ga0501070_0010854_4823_5521 204
74 3300049590 Ga0501074_0050119 Ga0501074_0050119_1386_2084 204
75 3300049744 Ga0501083_0040937 Ga0501083_0040937_108_806 204
76 3300049822 Ga0501035_0044299 Ga0501035_0044299_137_850 204
77 3300049822 Ga0501035_0369481 Ga0501035_0369481_57_755 204
78 3300049822 Ga0501035_0444308 Ga0501035_0444308_319_1017 204
79 3300049823 Ga0501044_0448222 Ga0501044_0448222_57_755 204
80 3300049823 Ga0501044_0532370 Ga0501044_0532370_319_1017 204
81 3300049824 Ga0501045_0027060 Ga0501045_0027060_2863_3561 204
82 iso_pu_bacteria 2915980308 2915980769 204
83 iso_pu_bacteria 2916061851 2916063664 204
84 iso_pu_bacteria 2921250672 2921257173 204
85 3300002739 JGI25158J39367_1000254 JGI25158J39367_10002548 205
86 3300002773 JGI25152J39213_1006415 JGI25152J39213_10064152 205
87 3300002987 JGI25159J45721_1002669 JGI25159J45721_10026692 205
88 3300003215 JGI25153J46596_10003997 JGI25153J46596_100039972 205
89 3300003323 rootH1_10046242 rootH1_100462422 205
90 3300003354 JGI25160J50197_1003907 JGI25160J50197_10039073 205
91 3300003374 JGI25161J50226_1000074 JGI25161J50226_10000748 205
92 3300003374 JGI25161J50226_1000382 JGI25161J50226_10003822 205
93 3300003771 Ga0055526_1002431 Ga0055526_10024317 205
94 3300003775 Ga0055524_1002633 Ga0055524_10026336 205
95 3300003790 Ga0055528_1001497 Ga0055528_10014974 205
96 3300003792 Ga0055540_1001471 Ga0055540_100147110 205
97 3300004625 Ga0055543_1000141 Ga0055543_100014121 205
98 3300005262 Ga0065165_1011908 Ga0065165_10119083 205
99 3300005347 Ga0070668_100373549 Ga0070668_1003735491 205
100 3300006353 Ga0075370_10086455 Ga0075370_100864552 205
101 3300009551 Ga0105238_10300955 Ga0105238_103009552 205
102 3300025208 Ga0209436_100051 Ga0209436_1000514 205
103 3300025258 Ga0209129_1000545 Ga0209129_10005455 205
104 3300025273 Ga0209673_1003246 Ga0209673_10032462 205
105 3300025284 Ga0209130_1000002 Ga0209130_100000274 205
106 3300025295 Ga0209564_1001938 Ga0209564_10019384 205
107 3300025297 Ga0209758_1001048 Ga0209758_10010483 205
108 3300025299 Ga0209256_1003297 Ga0209256_10032973 205
109 3300025302 Ga0207426_1000013 Ga0207426_100001374 205
110 3300025302 Ga0207426_1000172 Ga0207426_100017294 205
111 3300025303 Ga0209051_1005782 Ga0209051_10057824 205
112 3300025304 Ga0209257_1027231 Ga0209257_10272312 205
113 3300031456 Ga0307513_10118868 Ga0307513_101188682 205
114 3300041413 Ga0439465_0016858 Ga0439465_0016858_1368_2066 205
115 3300041413 Ga0439465_0033354 Ga0439465_0033354_610_1314 205
116 3300042438 Ga0439459_0031337 Ga0439459_0031337_311_1009 205
117 3300046694 Ga0495649_0000165 Ga0495649_0000165_30596_31300 205
118 3300048909 Ga0496106_0017594 Ga0496106_0017594_4155_4853 205
119 3300049570 Ga0501033_0012742 Ga0501033_0012742_4919_5638 205
120 3300049580 Ga0501046_0119833 Ga0501046_0119833_593_1312 205
121 3300050496 nmdc:mga07m45_162572_c1 nmdc:mga07m45_162572_c1_289_987 205
122 3300053088 Ga0500644_0084213 Ga0500644_0084213_304_1002 205
123 3300053139 Ga0500568_0027275 Ga0500568_0027275_686_1384 205
124 3300053151 Ga0500604_0059210 Ga0500604_0059210_78_776 205
125 3300053160 Ga0500633_0076466 Ga0500633_0076466_126_824 205
126 iso_pu_bacteria 2765235802 2765464303 205
127 iso_pu_bacteria 2850079185 2850079962 205
128 iso_pu_bacteria 2855825444 2855831760 205
129 iso_pu_bacteria 2855839649 2855839981 205
130 iso_pu_bacteria 2858800743 2858803955 205
131 iso_pu_bacteria 2915986958 2915992642 205
132 iso_pu_bacteria 2915993759 2915999702 205
133 iso_pu_bacteria 2916000859 2916002014 205
134 iso_pu_bacteria 2916014648 2916015417 205
135 iso_pu_bacteria 2916021584 2916022522 205
136 iso_pu_bacteria 2916028427 2916033338 205
137 iso_pu_bacteria 2916035215 2916038826 205
138 iso_pu_bacteria 2916041962 2916042768 205
139 iso_pu_bacteria 2916048683 2916050226 205
140 iso_pu_bacteria 2916055098 2916057693 205
141 iso_pu_bacteria 2916068649 2916071928 205
142 iso_pu_bacteria 2916076590 2916081867 205
143 iso_pu_bacteria 2921201388 2921207924 205
144 iso_pu_bacteria 2921208531 2921209377 205
145 iso_pu_bacteria 2921237296 2921238992 205
146 iso_pu_bacteria 2921244191 2921245216 205
147 iso_pu_bacteria 2921257292 2921260362 205
148 iso_pu_bacteria 2921263974 2921266463 205
149 iso_pu_bacteria 2921282425 2921287577 205
150 iso_pu_bacteria 2921289301 2921291966 205
151 iso_pu_bacteria 2921296804 2921301756 205
152 iso_pu_bacteria 2924144063 2924146036 205
153 iso_pu_bacteria 2924150972 2924154419 205
154 iso_pu_bacteria 2924158325 2924163479 205
155 iso_pu_bacteria 2924165586 2924167067 205
156 iso_pu_bacteria 2924172951 2924174639 205
157 iso_pu_bacteria 2924179722 2924180878 205
158 iso_pu_bacteria 2924186466 2924191792 205
159 iso_pu_bacteria 2924193448 2924194307 205
160 iso_pu_bacteria 2924200457 2924202422 205
161 iso_pu_bacteria 2924207177 2924209654 205
162 iso_pu_bacteria 2924214083 2924214550 205
163 iso_pu_bacteria 2924221636 2924224297 205
164 iso_pu_bacteria 2924228884 2924232979 205
165 3300005262 Ga0065165_1013652 Ga0065165_10136523 206
166 3300021321 Ga0214542_1000011 Ga0214542_1000011125 206
167 3300021327 Ga0214543_1000004 Ga0214543_1000004375 206
168 3300025972 Ga0207668_10596720 Ga0207668_105967202 206
169 3300048927 Ga0496124_0214194 Ga0496124_0214194_381_1094 206
170 3300049822 Ga0501035_0283448 Ga0501035_0283448_199_897 206
171 3300002737 JGI25162J39368_1002348 JGI25162J39368_10023482 207
172 3300003214 JGI25165J46597_1000529 JGI25165J46597_10005292 207
173 3300003316 rootH1_10041182 rootH1_100411822 207
174 3300003320 rootH2_10053655 rootH2_100536552 207
175 3300003322 rootL2_10099180 rootL2_100991802 207
176 3300005456 Ga0070678_100782328 Ga0070678_1007823281 207
177 3300013306 Ga0163162_11141173 Ga0163162_111411731 207
178 3300025273 Ga0209673_1000967 Ga0209673_100096726 207
179 3300025295 Ga0209564_1000382 Ga0209564_100038253 207
180 3300025299 Ga0209256_1000874 Ga0209256_10008747 207
181 3300046492 Ga0495585_0053852 Ga0495585_0053852_206_904 207
182 3300046507 Ga0495606_0053292 Ga0495606_0053292_1306_2004 207
183 3300046512 Ga0495610_0123856 Ga0495610_0123856_67_765 207
184 3300046515 Ga0495620_0101656 Ga0495620_0101656_81_779 207
185 3300046522 Ga0495643_0036445 Ga0495643_0036445_1230_1928 207
186 3300046616 Ga0495668_0044767 Ga0495668_0044767_56_754 207
187 3300046648 Ga0495611_0190828 Ga0495611_0190828_205_903 207
188 3300046660 Ga0495625_0110963 Ga0495625_0110963_290_988 207
189 3300046660 Ga0495625_0268577 Ga0495625_0268577_325_1023 207
190 3300046692 Ga0495671_0078267 Ga0495671_0078267_562_1260 207
191 3300046810 Ga0495660_0037091 Ga0495660_0037091_1673_2371 207
192 3300047323 Ga0495683_0152950 Ga0495683_0152950_275_973 207
193 3300047443 Ga0495687_059685 Ga0495687_059685_223_921 207
194 3300047472 Ga0495686_0082371 Ga0495686_0082371_509_1207 207
195 3300049459 Ga0495678_043266 Ga0495678_043266_847_1545 207
196 3300053118 Ga0500594_0113537 Ga0500594_0113537_80_778 207
197 3300053134 Ga0500658_0005820 Ga0500658_0005820_3596_4294 207
198 3300053135 Ga0500659_0159517 Ga0500659_0159517_324_1022 207
199 3300053153 Ga0500616_0091130 Ga0500616_0091130_197_895 207
200 3300005367 Ga0070667_100169152 Ga0070667_1001691522 208
201 3300006048 Ga0075363_100085615 Ga0075363_1000856152 208
202 3300009765 Ga0123341_1000192 Ga0123341_100019226 208
203 3300009766 Ga0123342_1013143 Ga0123342_10131438 208
204 3300021320 Ga0214544_1000012 Ga0214544_1000012131 208
205 3300025254 Ga0209148_1004207 Ga0209148_10042072 208
206 3300025914 Ga0207671_10000275 Ga0207671_1000027530 208
207 3300025986 Ga0207658_10022653 Ga0207658_100226532 208
208 3300041441 Ga0451787_595301 Ga0451787_595301_335_1033 208
209 3300041451 Ga0451791_1542001 Ga0451791_1542001_323_1021 208
210 3300041458 Ga0451798_0298663 Ga0451798_0298663_912_1610 208
211 3300041498 Ga0451841_0033924 Ga0451841_0033924_284_982 208
212 3300041507 Ga0451851_0667480 Ga0451851_0667480_2136_2834 208
213 3300046460 Ga0495638_0192024 Ga0495638_0192024_432_1145 208
214 3300046513 Ga0495616_0163119 Ga0495616_0163119_70_768 208
215 3300046524 Ga0495648_0095626 Ga0495648_0095626_876_1574 208
216 3300046542 Ga0495597_0100895 Ga0495597_0100895_245_943 208
217 3300053093 Ga0500651_0015578 Ga0500651_0015578_2645_3358 208
218 3300053111 Ga0500572_002397 Ga0500572_002397_3027_3731 208
219 3300053134 Ga0500658_0097498 Ga0500658_0097498_235_933 208
220 3300053140 Ga0500573_0002214 Ga0500573_0002214_6168_6881 208
221 3300053177 Ga0500636_0006722 Ga0500636_0006722_5885_6589 208
222 iso_pu_bacteria 2513237089 2513602909 208
223 iso_pu_bacteria 2517487022 2517568639 208
224 iso_pu_bacteria 2802428859 2802726148 208
225 iso_pu_bacteria 2802428860 2802731688 208
226 iso_pu_bacteria 2802428861 2802739439 208
227 iso_pu_bacteria 2913295892 2913298006 208
228 iso_pu_bacteria 2937029754 2937034543 208
229 iso_pu_bacteria 2937078374 2937078755 208
230 iso_pu_bacteria 2957375807 2957382071 208
231 iso_pu_bacteria 2960631154 2960637471 208
232 iso_pu_bacteria 2960680706 2960686597 208
233 iso_pu_bacteria 2960693952 2960698838 208
234 iso_pu_bacteria 2967686174 2967691511 208
235 iso_pu_bacteria 2977544691 2977549479 208
236 3300002987 JGI25159J45721_1000087 JGI25159J45721_10000876 209
237 3300003354 JGI25160J50197_1000046 JGI25160J50197_1000046124 209
238 3300003374 JGI25161J50226_1000031 JGI25161J50226_1000031124 209
239 3300003792 Ga0055540_1000471 Ga0055540_10004716 209
240 3300004625 Ga0055543_1000008 Ga0055543_1000008124 209
241 3300005262 Ga0065165_1000031 Ga0065165_10000315 209
242 3300006186 Ga0075369_10074301 Ga0075369_100743012 209
243 3300009093 Ga0105240_10000278 Ga0105240_1000027812 209
244 3300009545 Ga0105237_10003138 Ga0105237_100031382 209
245 3300013104 Ga0157370_10002372 Ga0157370_100023723 209
246 3300015262 Ga0182007_10045652 Ga0182007_100456522 209
247 3300025273 Ga0209673_1001074 Ga0209673_10010742 209
248 3300025284 Ga0209130_1000088 Ga0209130_100008870 209
249 3300025298 Ga0209050_1005205 Ga0209050_10052054 209
250 3300025302 Ga0207426_1000012 Ga0207426_1000012125 209
251 3300025303 Ga0209051_1000084 Ga0209051_1000084153 209
252 3300025304 Ga0209257_1010896 Ga0209257_10108962 209
253 3300044901 Ga0466960_0014783 Ga0466960_0014783_1260_1958 209
254 3300046476 Ga0495662_0018301 Ga0495662_0018301_1378_2064 209
255 3300046683 Ga0495658_0119475 Ga0495658_0119475_702_1388 209
256 3300046690 Ga0495624_0283059 Ga0495624_0283059_276_962 209
257 3300048919 Ga0496116_0031077 Ga0496116_0031077_554_1240 209
258 3300048919 Ga0496116_0143485 Ga0496116_0143485_25_723 209
259 3300048919 Ga0496116_0205731 Ga0496116_0205731_107_805 209
260 3300048920 Ga0496117_0002570 Ga0496117_0002570_21568_22254 209
261 3300048921 Ga0496118_0004324 Ga0496118_0004324_475_1161 209
262 3300048921 Ga0496118_0189347 Ga0496118_0189347_80_778 209
263 3300048923 Ga0496120_0006881 Ga0496120_0006881_7556_8242 209
264 3300048923 Ga0496120_0038167 Ga0496120_0038167_1777_2475 209
265 3300048925 Ga0496122_0001050 Ga0496122_0001050_1613_2311 209
266 3300048926 Ga0496123_0000158 Ga0496123_0000158_46031_46729 209
267 3300048926 Ga0496123_0133630 Ga0496123_0133630_198_884 209
268 3300048928 Ga0496125_0204495 Ga0496125_0204495_462_1148 209
269 3300049568 Ga0501031_0000003 Ga0501031_0000003_93121_93819 209
270 3300049569 Ga0501032_0000010 Ga0501032_0000010_93121_93819 209
271 3300049570 Ga0501033_0000017 Ga0501033_0000017_93121_93819 209
272 3300049571 Ga0501034_0000053 Ga0501034_0000053_113003_113701 209
273 3300049572 Ga0501036_0000009 Ga0501036_0000009_93121_93819 209
274 3300049573 Ga0501037_0000008 Ga0501037_0000008_112994_113692 209
275 3300049574 Ga0501038_0000008 Ga0501038_0000008_113003_113701 209
276 3300049575 Ga0501039_0000021 Ga0501039_0000021_48852_49550 209
277 3300049576 Ga0501040_0001596 Ga0501040_0001596_8792_9490 209
278 3300049579 Ga0501043_0001135 Ga0501043_0001135_1682_2380 209
279 3300049581 Ga0501047_0000126 Ga0501047_0000126_23_721 209
280 3300049586 Ga0501070_0021633 Ga0501070_0021633_875_1573 209
281 3300049822 Ga0501035_0000023 Ga0501035_0000023_93121_93819 209
282 3300049823 Ga0501044_0000021 Ga0501044_0000021_113003_113701 209
283 3300050516 nmdc:mga0sz30_168461_c1 nmdc:mga0sz30_168461_c1_183_881 209
284 3300053107 Ga0500560_026381 Ga0500560_026381_527_1213 209
285 iso_pu_bacteria 2509276019 2509375018 209
286 iso_pu_bacteria 2509276021 2509388455 209
287 iso_pu_bacteria 2510065019 2510131398 209
288 iso_pu_bacteria 2510461076 2510897752 209
289 iso_pu_bacteria 2510917022 2511136292 209
290 iso_pu_bacteria 2510917026 2511170127 209
291 iso_pu_bacteria 2510917030 2511196833 209
292 iso_pu_bacteria 2511231052 2511500511 209
293 iso_pu_bacteria 2512047086 2512531972 209
294 iso_pu_bacteria 2512875026 2512972702 209
295 iso_pu_bacteria 2513237084 2513570617 209
296 iso_pu_bacteria 2513237085 2513580230 209
297 iso_pu_bacteria 2513237086 2513584139 209
298 iso_pu_bacteria 2513237091 2513620456 209
299 iso_pu_bacteria 2513237093 2513634235 209
300 iso_pu_bacteria 2513237103 2513713206 209
301 iso_pu_bacteria 2513237140 2513880583 209
302 iso_pu_bacteria 2513237143 2513903313 209
303 iso_pu_bacteria 2513237156 2513987675 209
304 iso_pu_bacteria 2513237160 2514005161 209
305 iso_pu_bacteria 2513237162 2514020262 209
306 iso_pu_bacteria 2515075009 2515110359 209
307 iso_pu_bacteria 2515154107 2515607709 209
308 iso_pu_bacteria 2515154113 2515634559 209
309 iso_pu_bacteria 2515154114 2515643784 209
310 iso_pu_bacteria 2515154116 2515657182 209
311 iso_pu_bacteria 2515154134 2515743317 209
312 iso_pu_bacteria 2516143018 2516204352 209
313 iso_pu_bacteria 2516653046 2516891843 209
314 iso_pu_bacteria 2516653077 2517039036 209
315 iso_pu_bacteria 2516653085 2517079302 209
316 iso_pu_bacteria 2517093000 2517093231 209
317 iso_pu_bacteria 2517287029 2517409500 209
318 iso_pu_bacteria 2519899620 2520377850 209
319 iso_pu_bacteria 2524023207 2524449879 209
320 iso_pu_bacteria 2524023209 2524457500 209
321 iso_pu_bacteria 2529292951 2530647837 209
322 iso_pu_bacteria 2537561587 2537872792 209
323 iso_pu_bacteria 2551306084 2551679314 209
324 iso_pu_bacteria 2551306085 2551686181 209
325 iso_pu_bacteria 2551306086 2551691040 209
326 iso_pu_bacteria 2551306087 2551698520 209
327 iso_pu_bacteria 2551306089 2551712305 209
328 iso_pu_bacteria 2551306090 2551722049 209
329 iso_pu_bacteria 2551306091 2551729915 209
330 iso_pu_bacteria 2551306093 2551745697 209
331 iso_pu_bacteria 2554235003 2554246629 209
332 iso_pu_bacteria 2558860100 2558866019 209
333 iso_pu_bacteria 2558860242 2559293857 209
334 iso_pu_bacteria 2582581298 2585227060 209
335 iso_pu_bacteria 2582581307 2585275455 209
336 iso_pu_bacteria 2582581308 2585282314 209
337 iso_pu_bacteria 2582581315 2585325991 209
338 iso_pu_bacteria 2582581316 2585330161 209
339 iso_pu_bacteria 2585427526 2585529281 209
340 iso_pu_bacteria 2585427527 2585536489 209
341 iso_pu_bacteria 2585427528 2585539667 209
342 iso_pu_bacteria 2585427529 2585550515 209
343 iso_pu_bacteria 2585427530 2585556966 209
344 iso_pu_bacteria 2585427531 2585560102 209
345 iso_pu_bacteria 2585427593 2585837624 209
346 iso_pu_bacteria 2585427594 2585844669 209
347 iso_pu_bacteria 2585427609 2585905717 209
348 iso_pu_bacteria 2585427633 2585994385 209
349 iso_pu_bacteria 2585427634 2585998843 209
350 iso_pu_bacteria 2585428125 2587979167 209
351 iso_pu_bacteria 2599185210 2599605406 209
352 iso_pu_bacteria 2600255279 2601609169 209
353 iso_pu_bacteria 2600255308 2601745944 209
354 iso_pu_bacteria 2615840626 2616306337 209
355 iso_pu_bacteria 2615840698 2616553393 209
356 iso_pu_bacteria 2643221557 2643806279 209
357 iso_pu_bacteria 2643221568 2643856349 209
358 iso_pu_bacteria 2643221599 2644007303 209
359 iso_pu_bacteria 2643221610 2644070119 209
360 iso_pu_bacteria 2643221668 2644381090 209
361 iso_pu_bacteria 2643221675 2644414996 209
362 iso_pu_bacteria 2643221680 2644448653 209
363 iso_pu_bacteria 2643221693 2644519229 209
364 iso_pu_bacteria 2643221726 2644689039 209
365 iso_pu_bacteria 2657244999 2657681882 209
366 iso_pu_bacteria 2667528174 2671112354 209
367 iso_pu_bacteria 2690316117 2692317270 209
368 iso_pu_bacteria 2718217882 2719179553 209
369 iso_pu_bacteria 2718217997 2719663900 209
370 iso_pu_bacteria 2718218009 2719730223 209
371 iso_pu_bacteria 2718218199 2720490319 209
372 iso_pu_bacteria 2718218233 2720618543 209
373 iso_pu_bacteria 2718218235 2720629951 209
374 iso_pu_bacteria 2718218269 2720773646 209
375 iso_pu_bacteria 2718218363 2721145646 209
376 iso_pu_bacteria 2718218365 2721157163 209
377 iso_pu_bacteria 2718218366 2721162525 209
378 iso_pu_bacteria 2721755514 2722838695 209
379 iso_pu_bacteria 2721755684 2723558902 209
380 iso_pu_bacteria 2721755685 2723565472 209
381 iso_pu_bacteria 2721755810 2724042979 209
382 iso_pu_bacteria 2721755819 2724088253 209
383 iso_pu_bacteria 2721755822 2724102737 209
384 iso_pu_bacteria 2721755823 2724108635 209
385 iso_pu_bacteria 2724679232 2725948977 209
386 iso_pu_bacteria 2728369365 2730162790 209
387 iso_pu_bacteria 2728369397 2730296795 209
388 iso_pu_bacteria 2738541293 2738801257 209
389 iso_pu_bacteria 2738541317 2738948248 209
390 iso_pu_bacteria 2738541333 2739037057 209
391 iso_pu_bacteria 2751185821 2753461332 209
392 iso_pu_bacteria 2765235942 2766066583 209
393 iso_pu_bacteria 2775507049 2776912074 209
394 iso_pu_bacteria 2775507266 2778174155 209
395 iso_pu_bacteria 2791355082 2792582936 209
396 iso_pu_bacteria 2791355091 2792623823 209
397 iso_pu_bacteria 2791355092 2792629797 209
398 iso_pu_bacteria 2791355094 2792638132 209
399 iso_pu_bacteria 2791355259 2793316346 209
400 iso_pu_bacteria 2791355260 2793323422 209
401 iso_pu_bacteria 2791355261 2793326184 209
402 iso_pu_bacteria 2791355264 2793348159 209
403 iso_pu_bacteria 2791355267 2793364658 209
404 iso_pu_bacteria 2802428858 2802720328 209
405 iso_pu_bacteria 2802428862 2802742581 209
406 iso_pu_bacteria 2802428863 2802749286 209
407 iso_pu_bacteria 2802429268 2804750902 209
408 iso_pu_bacteria 2802429633 2806047561 209
409 iso_pu_bacteria 2802429634 2806054980 209
410 iso_pu_bacteria 2802429635 2806062118 209
411 iso_pu_bacteria 2802429636 2806067156 209
412 iso_pu_bacteria 2802429637 2806076477 209
413 iso_pu_bacteria 2808606387 2808986368 209
414 iso_pu_bacteria 2818991439 2819556498 209
415 iso_pu_bacteria 2818991448 2819608423 209
416 iso_pu_bacteria 2818991453 2819643500 209
417 iso_pu_bacteria 2818991461 2819686308 209
418 iso_pu_bacteria 2821123053 2821123625 209
419 iso_pu_bacteria 2838016132 2838020268 209
420 iso_pu_bacteria 2838022645 2838025785 209
421 iso_pu_bacteria 2838029111 2838029306 209
422 iso_pu_bacteria 2838042994 2838044441 209
423 iso_pu_bacteria 2838048938 2838051516 209
424 iso_pu_bacteria 2838068647 2838071092 209
425 iso_pu_bacteria 2838675328 2838677226 209
426 iso_pu_bacteria 2838686498 2838691601 209
427 iso_pu_bacteria 2838714209 2838716114 209
428 iso_pu_bacteria 2838719591 2838720086 209
429 iso_pu_bacteria 2838724970 2838726866 209
430 iso_pu_bacteria 2838729681 2838733915 209
431 iso_pu_bacteria 2838742623 2838747021 209
432 iso_pu_bacteria 2839993093 2839994225 209
433 iso_pu_bacteria 2840764183 2840769383 209
434 iso_pu_bacteria 2841846520 2841847018 209
435 iso_pu_bacteria 2841851746 2841856162 209
436 iso_pu_bacteria 2841859092 2841860452 209
437 iso_pu_bacteria 2842110456 2842112191 209
438 iso_pu_bacteria 2842124991 2842126953 209
439 iso_pu_bacteria 2842130223 2842132119 209
440 iso_pu_bacteria 2842152218 2842152712 209
441 iso_pu_bacteria 2842156927 2842161950 209
442 iso_pu_bacteria 2842163707 2842169674 209
443 iso_pu_bacteria 2842170452 2842172359 209
444 iso_pu_bacteria 2842175837 2842176331 209
445 iso_pu_bacteria 2842180545 2842185792 209
446 iso_pu_bacteria 2842187318 2842189221 209
447 iso_pu_bacteria 2842198810 2842202936 209
448 iso_pu_bacteria 2842211629 2842213535 209
449 iso_pu_bacteria 2842217011 2842218813 209
450 iso_pu_bacteria 2842224351 2842224847 209
451 iso_pu_bacteria 2842229732 2842235320 209
452 iso_pu_bacteria 2842243621 2842248225 209
453 iso_pu_bacteria 2842257432 2842262181 209
454 iso_pu_bacteria 2842264693 2842268778 209
455 iso_pu_bacteria 2842271015 2842276574 209
456 iso_pu_bacteria 2842298080 2842300885 209
457 iso_pu_bacteria 2842304105 2842306520 209
458 iso_pu_bacteria 2842357229 2842357993 209
459 iso_pu_bacteria 2842422224 2842424708 209
460 iso_pu_bacteria 2842428310 2842433022 209
461 iso_pu_bacteria 2842434925 2842439327 209
462 iso_pu_bacteria 2842441272 2842445956 209
463 iso_pu_bacteria 2842462802 2842467142 209
464 iso_pu_bacteria 2842469257 2842473830 209
465 iso_pu_bacteria 2842475841 2842476264 209
466 iso_pu_bacteria 2842482326 2842482336 209
467 iso_pu_bacteria 2842502639 2842502834 209
468 iso_pu_bacteria 2842509118 2842509188 209
469 iso_pu_bacteria 2842515876 2842517237 209
470 iso_pu_bacteria 2844454524 2844456010 209
471 iso_pu_bacteria 2847417321 2847417663 209
472 iso_pu_bacteria 2848992105 2848992468 209
473 iso_pu_bacteria 2852387548 2852388463 209
474 iso_pu_bacteria 2854916844 2854919933 209
475 iso_pu_bacteria 2855872281 2855874550 209
476 iso_pu_bacteria 2857516855 2857523458 209
477 iso_pu_bacteria 2857531043 2857531189 209
478 iso_pu_bacteria 2891048133 2891049562 209
479 iso_pu_bacteria 2891373044 2891374950 209
480 iso_pu_bacteria 2896384573 2896391568 209
481 iso_pu_bacteria 2899792073 2899792517 209
482 iso_pu_bacteria 2899803654 2899805280 209
483 iso_pu_bacteria 2899845264 2899847892 209
484 iso_pu_bacteria 2913308742 2913313410 209
485 iso_pu_bacteria 2919100787 2919101367 209
486 iso_pu_bacteria 2919114240 2919116317 209
487 iso_pu_bacteria 2919166419 2919166884 209
488 iso_pu_bacteria 2919171160 2919172104 209
489 iso_pu_bacteria 2919408235 2919408785 209
490 iso_pu_bacteria 2920822456 2920823360 209
491 iso_pu_bacteria 2926754445 2926757271 209
492 iso_pu_bacteria 2926760298 2926761487 209
493 iso_pu_bacteria 2933006813 2933007357 209
494 iso_pu_bacteria 2933011516 2933015051 209
495 iso_pu_bacteria 2933570622 2933573589 209
496 iso_pu_bacteria 2933586486 2933587520 209
497 iso_pu_bacteria 2933594066 2933594565 209
498 iso_pu_bacteria 2933599457 2933601891 209
499 iso_pu_bacteria 2935901341 2935907183 209
500 iso_pu_bacteria 2936367885 2936368947 209
501 iso_pu_bacteria 2936375103 2936378437 209
502 iso_pu_bacteria 2936381700 2936383725 209
503 iso_pu_bacteria 2936996657 2936999104 209
504 iso_pu_bacteria 2937002841 2937005061 209
505 iso_pu_bacteria 2937009748 2937011342 209
506 iso_pu_bacteria 2937016420 2937018751 209
507 iso_pu_bacteria 2937023124 2937023805 209
508 iso_pu_bacteria 2937036028 2937041296 209
509 iso_pu_bacteria 2937042894 2937049457 209
510 iso_pu_bacteria 2937049772 2937054012 209
511 iso_pu_bacteria 2937056579 2937060641 209
512 iso_pu_bacteria 2937063883 2937070015 209
513 iso_pu_bacteria 2937071275 2937071534 209
514 iso_pu_bacteria 2937084907 2937086085 209
515 iso_pu_bacteria 2937091812 2937093276 209
516 iso_pu_bacteria 2937098957 2937103464 209
517 iso_pu_bacteria 2937106411 2937110393 209
518 iso_pu_bacteria 2937113482 2937114691 209
519 iso_pu_bacteria 2937119839 2937122601 209
520 iso_pu_bacteria 2937126314 2937128479 209
521 iso_pu_bacteria 2957382221 2957383649 209
522 iso_pu_bacteria 2957388812 2957394052 209
523 iso_pu_bacteria 2957395598 2957399573 209
524 iso_pu_bacteria 2957402308 2957403697 209
525 iso_pu_bacteria 2957408893 2957411052 209
526 iso_pu_bacteria 2957415311 2957421549 209
527 iso_pu_bacteria 2957422303 2957429480 209
528 iso_pu_bacteria 2957430029 2957435389 209
529 iso_pu_bacteria 2957437181 2957442624 209
530 iso_pu_bacteria 2957443900 2957447142 209
531 iso_pu_bacteria 2957450854 2957457314 209
532 iso_pu_bacteria 2957457609 2957464425 209
533 iso_pu_bacteria 2957464669 2957466198 209
534 iso_pu_bacteria 2957471148 2957477049 209
535 iso_pu_bacteria 2957478035 2957480301 209
536 iso_pu_bacteria 2957484790 2957489045 209
537 iso_pu_bacteria 2957491536 2957494585 209
538 iso_pu_bacteria 2957498199 2957503796 209
539 iso_pu_bacteria 2957505466 2957508594 209
540 iso_pu_bacteria 2960584000 2960585693 209
541 iso_pu_bacteria 2960591022 2960594752 209
542 iso_pu_bacteria 2960597568 2960599754 209
543 iso_pu_bacteria 2960603979 2960605395 209
544 iso_pu_bacteria 2960610863 2960616914 209
545 iso_pu_bacteria 2960617483 2960621682 209
546 iso_pu_bacteria 2960624210 2960629218 209
547 iso_pu_bacteria 2960637947 2960638834 209
548 iso_pu_bacteria 2960645483 2960647669 209
549 iso_pu_bacteria 2960652885 2960658871 209
550 iso_pu_bacteria 2960660292 2960660426 209
551 iso_pu_bacteria 2960667422 2960668440 209
552 iso_pu_bacteria 2960674078 2960676388 209
553 iso_pu_bacteria 2960687367 2960690308 209
554 iso_pu_bacteria 2964607997 2964608419 209
555 iso_pu_bacteria 2964615318 2964619794 209
556 iso_pu_bacteria 2964621998 2964622449 209
557 iso_pu_bacteria 2964628898 2964634293 209
558 iso_pu_bacteria 2964636051 2964636423 209
559 iso_pu_bacteria 2964643177 2964646952 209
560 iso_pu_bacteria 2964649959 2964650317 209
561 iso_pu_bacteria 2964656573 2964659450 209
562 iso_pu_bacteria 2964663802 2964664933 209
563 iso_pu_bacteria 2964670856 2964675417 209
564 iso_pu_bacteria 2964678106 2964680595 209
565 iso_pu_bacteria 2964685014 2964691086 209
566 iso_pu_bacteria 2964691889 2964693055 209
567 iso_pu_bacteria 2964698721 2964704148 209
568 iso_pu_bacteria 2964705432 2964707170 209
569 iso_pu_bacteria 2964712639 2964718589 209
570 iso_pu_bacteria 2964719344 2964724992 209
571 iso_pu_bacteria 2967664464 2967667659 209
572 iso_pu_bacteria 2967671571 2967678163 209
573 iso_pu_bacteria 2967678726 2967684943 209
574 iso_pu_bacteria 2967693043 2967695055 209
575 iso_pu_bacteria 2967699805 2967701967 209
576 iso_pu_bacteria 2967706974 2967712751 209
577 iso_pu_bacteria 2967714385 2967714649 209
578 iso_pu_bacteria 2967721400 2967722476 209
579 iso_pu_bacteria 2967728569 2967730544 209
580 iso_pu_bacteria 2967735183 2967736346 209
581 iso_pu_bacteria 2967742019 2967747798 209
582 iso_pu_bacteria 2967748971 2967751861 209
583 iso_pu_bacteria 2967755722 2967761283 209
584 iso_pu_bacteria 2967762386 2967762703 209
585 iso_pu_bacteria 2967769361 2967771318 209
586 iso_pu_bacteria 2967775926 2967777019 209
587 iso_pu_bacteria 2970019648 2970023336 209
588 iso_pu_bacteria 2970026789 2970030565 209
589 iso_pu_bacteria 2970033650 2970034048 209
590 iso_pu_bacteria 2970040964 2970045475 209
591 iso_pu_bacteria 2970047711 2970052644 209
592 iso_pu_bacteria 2970054988 2970061189 209
593 iso_pu_bacteria 2970061556 2970063978 209
594 iso_pu_bacteria 2970068827 2970073357 209
595 iso_pu_bacteria 2970076120 2970080385 209
596 iso_pu_bacteria 2970082768 2970087323 209
597 iso_pu_bacteria 2970088815 2970095391 209
598 iso_pu_bacteria 2970095765 2970101499 209
599 iso_pu_bacteria 2970102677 2970103351 209
600 iso_pu_bacteria 2970109326 2970116073 209
601 iso_pu_bacteria 2970116247 2970118579 209
602 iso_pu_bacteria 2970122695 2970126283 209
603 iso_pu_bacteria 2970129317 2970131553 209
604 iso_pu_bacteria 2970136068 2970143356 209
605 iso_pu_bacteria 2970143518 2970148526 209
606 iso_pu_bacteria 2970149975 2970153239 209
607 iso_pu_bacteria 2970156795 2970159547 209
608 iso_pu_bacteria 2970164137 2970167723 209
609 iso_pu_bacteria 2970170962 2970177003 209
610 iso_pu_bacteria 2970177841 2970181914 209
611 iso_pu_bacteria 2970184632 2970188471 209
612 iso_pu_bacteria 2970191845 2970196410 209
613 iso_pu_bacteria 2977516862 2977518036 209
614 iso_pu_bacteria 2977523885 2977529148 209
615 iso_pu_bacteria 2977530762 2977535847 209
616 iso_pu_bacteria 2977537788 2977539973 209
617 iso_pu_bacteria 2977551784 2977552945 209
618 iso_pu_bacteria 2977558990 2977559294 209
619 iso_pu_bacteria 2977565890 2977567496 209
620 iso_pu_bacteria 2977572785 2977579590 209
621 iso_pu_bacteria 2977579622 2977580423 209
622 iso_pu_bacteria 2978969890 2978973301 209
623 iso_pu_bacteria 2979089926 2979093225 209
624 iso_pu_bacteria 2979095461 2979099390 209
625 iso_pu_bacteria 2979100975 2979105195 209
626 iso_pu_bacteria 2984509177 2984512948 209
627 iso_pu_bacteria 2984518228 2984520688 209
628 iso_pu_bacteria 2984537506 2984539980 209
629 iso_pu_bacteria 2984587000 2984591582 209
630 iso_pu_bacteria 2984601300 2984602171 209
631 iso_pu_bacteria 2989349275 2989351425 209
632 iso_pu_bacteria 2989771324 2989772774 209
633 iso_pu_bacteria 2996893221 2996893415 209
634 iso_pu_bacteria 3005409236 3005411214 209
635 iso_pu_bacteria 3005416602 3005422823 209
636 iso_pu_bacteria 3005445848 3005446165 209
637 iso_pu_bacteria 3005452660 3005452824 209
638 iso_pu_bacteria 639633055 639646630 209
639 iso_pu_bacteria 643692032 643824526 209
640 iso_pu_bacteria 648276728 648739357 209
641 iso_pu_bacteria 650716007 650739048 209
642 iso_pu_bacteria 8003992118 8003992434 209
643 iso_pu_bacteria 8003999396 8003999762 209
644 iso_pu_bacteria 8005282627 8005289028 209
645 iso_pu_bacteria 8005301065 8005301534 209
646 iso_pu_bacteria 8005307578 8005309213 209
647 iso_pu_bacteria 8005314921 8005321641 209
648 iso_pu_bacteria 8005376324 8005377453 209
649 iso_pu_bacteria 8005382845 8005387316 209
650 iso_pu_bacteria 8005395548 8005400107 209
651 iso_pu_bacteria 8005430974 8005432914 209
652 iso_pu_bacteria 8005460587 8005460998 209
653 iso_pu_bacteria 8005484373 8005484934 209
654 iso_pu_bacteria 8005497431 8005498642 209
655 iso_pu_bacteria 8005556819 8005560603 209
656 iso_pu_bacteria 8005563573 8005563938 209
657 iso_pu_bacteria 8005570704 8005576902 209
658 iso_pu_bacteria 8005619151 8005619836 209
659 iso_pu_bacteria 8005645114 8005650130 209
660 iso_pu_bacteria 8005658619 8005660374 209
661 iso_pu_bacteria 8005668836 8005670053 209
662 iso_pu_bacteria 8005688590 8005690250 209
663 iso_pu_bacteria 8005695170 8005699273 209
664 iso_pu_bacteria 8018150411 8018153081 209
665 iso_pu_bacteria 8018163183 8018169006 209
666 iso_pu_bacteria 8023680758 8023684260 209
667 iso_pu_bacteria 8024479707 8024480257 209
668 iso_pu_bacteria 8046767195 8046769860 209
669 iso_pu_bacteria 8049293176 8049293458 209
670 iso_pu_bacteria 8056375014 8056375615 209
671 iso_pu_bacteria 8057575449 8057577821 209
672 iso_pu_bacteria 8057874678 8057876029 209
673 3300003187 JGI25151J46595_10008951 JGI25151J46595_100089512 210
674 3300003320 rootH2_10017545 rootH2_100175452 210
675 3300003323 rootH1_10123595 rootH1_101235952 210
676 3300005289 Ga0065704_10001731 Ga0065704_100017314 210
677 3300021321 Ga0214542_1009335 Ga0214542_10093354 210
678 3300021327 Ga0214543_1000256 Ga0214543_100025657 210
679 3300025233 Ga0209437_100086 Ga0209437_100086236 210
680 3300025261 Ga0209233_1000356 Ga0209233_100035625 210
681 3300025294 Ga0209025_1000528 Ga0209025_100052842 210
682 3300027312 Ga0209371_1003471 Ga0209371_10034714 210
683 3300030500 Ga0268256_1003179 Ga0268256_10031794 210
684 3300048920 Ga0496117_0016471 Ga0496117_0016471_505_1203 210
685 3300048927 Ga0496124_0006030 Ga0496124_0006030_688_1386 210
686 3300048928 Ga0496125_0000695 Ga0496125_0000695_24081_24779 210
687 3300048928 Ga0496125_0199862 Ga0496125_0199862_428_1126 210
688 3300049569 Ga0501032_0021226 Ga0501032_0021226_904_1620 210
689 3300049569 Ga0501032_0172395 Ga0501032_0172395_14_730 210
690 3300049569 Ga0501032_0296874 Ga0501032_0296874_279_995 210
691 3300049570 Ga0501033_0000495 Ga0501033_0000495_33297_34013 210
692 3300049570 Ga0501033_0001157 Ga0501033_0001157_16155_16853 210
693 3300049570 Ga0501033_0178235 Ga0501033_0178235_558_1274 210
694 3300049572 Ga0501036_0073396 Ga0501036_0073396_842_1558 210
695 3300049573 Ga0501037_0000308 Ga0501037_0000308_36060_36776 210
696 3300049573 Ga0501037_0156831 Ga0501037_0156831_182_898 210
697 3300049579 Ga0501043_0000005 Ga0501043_0000005_69140_69856 210
698 3300049579 Ga0501043_0088873 Ga0501043_0088873_1612_2328 210
699 3300049581 Ga0501047_0094812 Ga0501047_0094812_186_902 210
700 3300049581 Ga0501047_0169348 Ga0501047_0169348_1060_1776 210
701 3300049584 Ga0501068_0122751 Ga0501068_0122751_873_1589 210
702 3300049584 Ga0501068_0179028 Ga0501068_0179028_302_1018 210
703 3300049585 Ga0501069_0000011 Ga0501069_0000011_64451_65167 210
704 3300049585 Ga0501069_0203562 Ga0501069_0203562_336_1052 210
705 3300049585 Ga0501069_0280354 Ga0501069_0280354_96_812 210
706 3300049586 Ga0501070_0000117 Ga0501070_0000117_54102_54818 210
707 3300049586 Ga0501070_0000257 Ga0501070_0000257_40184_40900 210
708 3300049586 Ga0501070_0043444 Ga0501070_0043444_327_1043 210
709 3300049587 Ga0501071_0072949 Ga0501071_0072949_908_1624 210
710 3300049589 Ga0501073_0052547 Ga0501073_0052547_466_1182 210
711 3300049589 Ga0501073_0084610 Ga0501073_0084610_297_1013 210
712 3300049589 Ga0501073_0277058 Ga0501073_0277058_70_786 210
713 3300049590 Ga0501074_0038414 Ga0501074_0038414_1241_1957 210
714 3300049590 Ga0501074_0188929 Ga0501074_0188929_538_1254 210
715 3300049742 Ga0501080_0016949 Ga0501080_0016949_5631_6347 210
716 3300049742 Ga0501080_0039435 Ga0501080_0039435_886_1602 210
717 3300049742 Ga0501080_0150872 Ga0501080_0150872_160_876 210
718 3300049744 Ga0501083_0000831 Ga0501083_0000831_3362_4078 210
719 3300049744 Ga0501083_0283738 Ga0501083_0283738_162_881 210
720 3300049822 Ga0501035_0000107 Ga0501035_0000107_65348_66064 210
721 3300049822 Ga0501035_0001314 Ga0501035_0001314_18446_19162 210
722 3300049822 Ga0501035_0002296 Ga0501035_0002296_10181_10879 210
723 3300049822 Ga0501035_0051590 Ga0501035_0051590_1614_2330 210
724 3300049822 Ga0501035_0120322 Ga0501035_0120322_711_1427 210
725 3300049823 Ga0501044_0000154 Ga0501044_0000154_39892_40608 210
726 3300049823 Ga0501044_0082812 Ga0501044_0082812_539_1255 210
727 3300049823 Ga0501044_0098865 Ga0501044_0098865_1053_1769 210
728 3300050492 nmdc:mga0yw44_109848_c1 nmdc:mga0yw44_109848_c1_882_1595 210
729 3300060353 Ga0501082_0093908 Ga0501082_0093908_862_1578 210
730 iso_pu_bacteria 2961170736 2961177043 210
731 iso_pu_bacteria 2967996073 2968002831 210
732 iso_pu_bacteria 2977821940 2977822151 210
733 3300003187 JGI25151J46595_10000346 JGI25151J46595_1000034621 211
734 3300003354 JGI25160J50197_1000500 JGI25160J50197_10005008 211
735 3300003775 Ga0055524_1003868 Ga0055524_10038686 211
736 3300003775 Ga0055524_1004431 Ga0055524_10044315 211
737 3300004625 Ga0055543_1001182 Ga0055543_10011823 211
738 3300005262 Ga0065165_1005966 Ga0065165_10059665 211
739 3300006038 Ga0075365_10011895 Ga0075365_100118953 211
740 3300006042 Ga0075368_10019855 Ga0075368_100198552 211
741 3300006051 Ga0075364_10214680 Ga0075364_102146802 211
742 3300006178 Ga0075367_10085263 Ga0075367_100852632 211
743 3300006195 Ga0075366_10014660 Ga0075366_100146602 211
744 3300013249 Ga0171463_1001 Ga0171463_1001705 211
745 3300015690 Ga0183363_1012 Ga0183363_101248 211
746 3300025245 Ga0207425_1004154 Ga0207425_10041542 211
747 3300025258 Ga0209129_1003389 Ga0209129_10033895 211
748 3300025273 Ga0209673_1002143 Ga0209673_10021435 211
749 3300025291 Ga0209675_1039946 Ga0209675_10399461 211
750 3300025294 Ga0209025_1000970 Ga0209025_100097020 211
751 3300025299 Ga0209256_1000180 Ga0209256_100018080 211
752 3300025302 Ga0207426_1000063 Ga0207426_1000063241 211
753 3300025303 Ga0209051_1011680 Ga0209051_10116802 211
754 3300026067 Ga0207678_10193399 Ga0207678_101933992 211
755 3300048927 Ga0496124_0000063 Ga0496124_0000063_108561_109298 211
756 3300049573 Ga0501037_0263556 Ga0501037_0263556_171_890 211
757 3300049579 Ga0501043_0039716 Ga0501043_0039716_1015_1734 211
758 3300049581 Ga0501047_0466447 Ga0501047_0466447_113_832 211
759 3300049586 Ga0501070_0024616 Ga0501070_0024616_934_1653 211
760 3300049822 Ga0501035_0022408 Ga0501035_0022408_4845_5564 211
761 3300049822 Ga0501035_0074842 Ga0501035_0074842_1031_1750 211
762 3300049823 Ga0501044_0192944 Ga0501044_0192944_906_1625 211
763 3300049823 Ga0501044_0227015 Ga0501044_0227015_677_1396 211
764 3300050492 nmdc:mga0yw44_35604_c1 nmdc:mga0yw44_35604_c1_1520_2236 211
765 3300050493 nmdc:mga0k408_150279_c1 nmdc:mga0k408_150279_c1_581_1279 211
766 iso_pu_bacteria 2511231027 2511389332 211
767 iso_pu_bacteria 2721755686 2723578262 211
768 iso_pu_bacteria 2842871566 2842873063 211
769 iso_pu_bacteria 2894652903 2894655410 211
770 iso_pu_bacteria 2919119836 2919122068 211
771 iso_pu_bacteria 8004640170 8004644546 211
772 iso_pu_bacteria 8054460903 8054461310 211
773 3300006051 Ga0075364_10151574 Ga0075364_101515742 212
774 3300006946 Ga0079104_1000876 Ga0079104_10008765 212
775 3300022739 Ga0228711_1000019 Ga0228711_100001920 212
776 3300022740 Ga0228710_1000022 Ga0228710_100002220 212
777 3300025294 Ga0209025_1093537 Ga0209025_10935372 212
778 3300027111 Ga0209281_1000227 Ga0209281_100022726 212
779 3300027666 Ga0209282_1000042 Ga0209282_100004226 212
780 3300031967 Ga0315914_1000009 Ga0315914_1000009101 212
781 3300033430 Ga0315913_1000015 Ga0315913_100001526 212
782 3300033464 Ga0315915_1000013 Ga0315915_100001387 212
783 3300048919 Ga0496116_0043024 Ga0496116_0043024_1773_2471 212
784 3300048920 Ga0496117_0003540 Ga0496117_0003540_4326_5024 212
785 3300048921 Ga0496118_0060112 Ga0496118_0060112_1612_2310 212
786 3300048924 Ga0496121_0000001 Ga0496121_0000001_428319_429017 212
787 3300048926 Ga0496123_0112189 Ga0496123_0112189_463_1161 212
788 3300048927 Ga0496124_0063645 Ga0496124_0063645_610_1308 212
789 3300048928 Ga0496125_0000001 Ga0496125_0000001_540342_541040 212
790 3300048929 Ga0496126_0645744 Ga0496126_0645744_51_749 212
791 3300048929 Ga0496126_0645784 Ga0496126_0645784_51_749 212
792 3300050491 nmdc:mga00v17_4902_c1 nmdc:mga00v17_4902_c1_79_777 212
793 3300050494 nmdc:mga06z11_166055_c1 nmdc:mga06z11_166055_c1_278_976 212
794 iso_pu_bacteria 2643221582 2643921154 212
795 iso_pu_bacteria 8003570095 8003572681 212
796 3300002704 JGI25155J39150_1000023 JGI25155J39150_100002335 213
797 3300002705 JGI25156J39149_1000029 JGI25156J39149_100002971 213
798 3300002738 JGI25154J39366_1000067 JGI25154J39366_100006735 213
799 3300002741 JGI25157J39369_1000043 JGI25157J39369_100004392 213
800 3300002774 JGI25150J39212_1000012 JGI25150J39212_100001272 213
801 3300003187 JGI25151J46595_10000025 JGI25151J46595_10000025112 213
802 3300003214 JGI25165J46597_1001287 JGI25165J46597_100128712 213
803 3300003214 JGI25165J46597_1013388 JGI25165J46597_10133882 213
804 3300003215 JGI25153J46596_10002371 JGI25153J46596_100023713 213
805 3300003320 rootH2_10186027 rootH2_101860272 213
806 3300003693 Ga0032354_1032914 Ga0032354_10329142 213
807 3300003794 Ga0055531_10005094 Ga0055531_100050945 213
808 3300003856 Ga0058692_1009082 Ga0058692_10090822 213
809 3300005347 Ga0070668_100416239 Ga0070668_1004162392 213
810 3300005353 Ga0070669_100069998 Ga0070669_1000699982 213
811 3300005548 Ga0070665_100014231 Ga0070665_1000142315 213
812 3300005548 Ga0070665_100220086 Ga0070665_1002200862 213
813 3300005563 Ga0068855_100254945 Ga0068855_1002549452 213
814 3300005578 Ga0068854_100198901 Ga0068854_1001989012 213
815 3300005578 Ga0068854_100284660 Ga0068854_1002846602 213
816 3300005614 Ga0068856_100301256 Ga0068856_1003012562 213
817 3300005834 Ga0068851_10051204 Ga0068851_100512042 213
818 3300006038 Ga0075365_10106442 Ga0075365_101064422 213
819 3300006042 Ga0075368_10000571 Ga0075368_100005717 213
820 3300006178 Ga0075367_10088173 Ga0075367_100881732 213
821 3300006186 Ga0075369_10027622 Ga0075369_100276222 213
822 3300006186 Ga0075369_10028567 Ga0075369_100285672 213
823 3300006353 Ga0075370_10139831 Ga0075370_101398311 213
824 3300006353 Ga0075370_10214402 Ga0075370_102144022 213
825 3300006946 Ga0079104_1004688 Ga0079104_10046882 213
826 3300006948 Ga0099826_10000216 Ga0099826_100002162 213
827 3300011119 Ga0105246_10156879 Ga0105246_101568792 213
828 3300013100 Ga0157373_10049858 Ga0157373_100498582 213
829 3300013102 Ga0157371_10000058 Ga0157371_100000582 213
830 3300013102 Ga0157371_10015095 Ga0157371_100150954 213
831 3300013105 Ga0157369_10866275 Ga0157369_108662751 213
832 3300025206 Ga0209435_100011 Ga0209435_100011339 213
833 3300025233 Ga0209437_100036 Ga0209437_10003612 213
834 3300025245 Ga0207425_1000012 Ga0207425_1000012275 213
835 3300025246 Ga0209646_1000024 Ga0209646_100002471 213
836 3300025250 Ga0209026_1000030 Ga0209026_100003071 213
837 3300025253 Ga0209677_101207 Ga0209677_1012073 213
838 3300025256 Ga0209759_1000011 Ga0209759_1000011339 213
839 3300025258 Ga0209129_1000081 Ga0209129_100008186 213
840 3300025261 Ga0209233_1000110 Ga0209233_100011012 213
841 3300025261 Ga0209233_1000166 Ga0209233_100016612 213
842 3300025272 Ga0209455_1020560 Ga0209455_10205602 213
843 3300025292 Ga0209676_1003256 Ga0209676_10032567 213
844 3300025294 Ga0209025_1000024 Ga0209025_1000024275 213
845 3300025294 Ga0209025_1000441 Ga0209025_100044140 213
846 3300025297 Ga0209758_1000046 Ga0209758_1000046267 213
847 3300025297 Ga0209758_1000349 Ga0209758_100034950 213
848 3300025298 Ga0209050_1002637 Ga0209050_10026373 213
849 3300025299 Ga0209256_1052758 Ga0209256_10527581 213
850 3300025303 Ga0209051_1001361 Ga0209051_100136111 213
851 3300025304 Ga0209257_1004216 Ga0209257_10042168 213
852 3300025321 Ga0207656_10071163 Ga0207656_100711632 213
853 3300025913 Ga0207695_10000376 Ga0207695_1000037612 213
854 3300025949 Ga0207667_10233512 Ga0207667_102335122 213
855 3300026078 Ga0207702_10062428 Ga0207702_100624283 213
856 3300027111 Ga0209281_1000192 Ga0209281_100019292 213
857 3300027111 Ga0209281_1001513 Ga0209281_10015132 213
858 3300027312 Ga0209371_1000009 Ga0209371_1000009440 213
859 3300027312 Ga0209371_1000547 Ga0209371_10005478 213
860 3300027666 Ga0209282_1012946 Ga0209282_10129462 213
861 3300027866 Ga0209813_10018418 Ga0209813_100184182 213
862 3300028379 Ga0268266_10003170 Ga0268266_1000317011 213
863 3300028379 Ga0268266_10215388 Ga0268266_102153882 213
864 3300030500 Ga0268256_1000010 Ga0268256_1000010439 213
865 3300030500 Ga0268256_1021622 Ga0268256_10216222 213
866 3300030744 Ga0316181_1112456 Ga0316181_11124562 213
867 3300031731 Ga0307405_10001288 Ga0307405_100012884 213
868 3300031911 Ga0307412_10009244 Ga0307412_100092445 213
869 3300031995 Ga0307409_100134946 Ga0307409_1001349462 213
870 3300032002 Ga0307416_100292761 Ga0307416_1002927612 213
871 3300035695 Ga0373927_0000887 Ga0373927_0000887_16401_17099 213
872 3300037068 Ga0373925_0003273 Ga0373925_0003273_3874_4572 213
873 3300046457 Ga0495590_0084389 Ga0495590_0084389_350_1048 213
874 3300046507 Ga0495606_0106257 Ga0495606_0106257_554_1252 213
875 3300046522 Ga0495643_0117763 Ga0495643_0117763_522_1220 213
876 3300046530 Ga0495654_0001458 Ga0495654_0001458_3081_3779 213
877 3300046558 Ga0495633_0139263 Ga0495633_0139263_185_922 213
878 3300046674 Ga0495588_0041275 Ga0495588_0041275_138_875 213
879 3300046692 Ga0495671_0099083 Ga0495671_0099083_612_1349 213
880 3300046694 Ga0495649_0211207 Ga0495649_0211207_229_927 213
881 3300047470 Ga0495681_0006515 Ga0495681_0006515_173_910 213
882 3300047472 Ga0495686_0226314 Ga0495686_0226314_255_953 213
883 3300047472 Ga0495686_0252425 Ga0495686_0252425_207_905 213
884 3300048904 Ga0496101_0530664 Ga0496101_0530664_98_796 213
885 3300048906 Ga0496103_0301184 Ga0496103_0301184_58_756 213
886 3300048916 Ga0496113_0305184 Ga0496113_0305184_393_1091 213
887 3300048919 Ga0496116_0000080 Ga0496116_0000080_6378_7076 213
888 3300048919 Ga0496116_0009980 Ga0496116_0009980_5498_6196 213
889 3300048919 Ga0496116_0066648 Ga0496116_0066648_1479_2177 213
890 3300048919 Ga0496116_0078950 Ga0496116_0078950_578_1276 213
891 3300048919 Ga0496116_0144264 Ga0496116_0144264_613_1311 213
892 3300048920 Ga0496117_0000002 Ga0496117_0000002_1970789_1971487 213
893 3300048920 Ga0496117_0031612 Ga0496117_0031612_2822_3520 213
894 3300048920 Ga0496117_0149367 Ga0496117_0149367_135_833 213
895 3300048920 Ga0496117_0161780 Ga0496117_0161780_280_978 213
896 3300048920 Ga0496117_0179606 Ga0496117_0179606_180_878 213
897 3300048920 Ga0496117_0187332 Ga0496117_0187332_222_920 213
898 3300048921 Ga0496118_0000233 Ga0496118_0000233_38617_39315 213
899 3300048921 Ga0496118_0056155 Ga0496118_0056155_1973_2677 213
900 3300048921 Ga0496118_0114365 Ga0496118_0114365_646_1344 213
901 3300048921 Ga0496118_0138849 Ga0496118_0138849_803_1501 213
902 3300048921 Ga0496118_0147281 Ga0496118_0147281_350_1048 213
903 3300048922 Ga0496119_0025703 Ga0496119_0025703_2407_3105 213
904 3300048922 Ga0496119_0168368 Ga0496119_0168368_317_1015 213
905 3300048923 Ga0496120_0000021 Ga0496120_0000021_95088_95786 213
906 3300048924 Ga0496121_0115192 Ga0496121_0115192_134_832 213
907 3300048924 Ga0496121_0190184 Ga0496121_0190184_548_1246 213
908 3300048924 Ga0496121_0386357 Ga0496121_0386357_19_717 213
909 3300048925 Ga0496122_0000001 Ga0496122_0000001_1341579_1342277 213
910 3300048925 Ga0496122_0002476 Ga0496122_0002476_21851_22549 213
911 3300048925 Ga0496122_0011009 Ga0496122_0011009_5899_6597 213
912 3300048925 Ga0496122_0124535 Ga0496122_0124535_517_1215 213
913 3300048925 Ga0496122_0178776 Ga0496122_0178776_66_764 213
914 3300048925 Ga0496122_0186589 Ga0496122_0186589_135_833 213
915 3300048926 Ga0496123_0000001 Ga0496123_0000001_1345310_1346008 213
916 3300048926 Ga0496123_0000020 Ga0496123_0000020_335435_336148 213
917 3300048926 Ga0496123_0052473 Ga0496123_0052473_1586_2284 213
918 3300048926 Ga0496123_0064102 Ga0496123_0064102_838_1536 213
919 3300048926 Ga0496123_0075335 Ga0496123_0075335_271_969 213
920 3300048926 Ga0496123_0141095 Ga0496123_0141095_86_784 213
921 3300048926 Ga0496123_0141915 Ga0496123_0141915_504_1202 213
922 3300048927 Ga0496124_0010037 Ga0496124_0010037_5773_6471 213
923 3300048927 Ga0496124_0076573 Ga0496124_0076573_532_1230 213
924 3300048927 Ga0496124_0109017 Ga0496124_0109017_1137_1835 213
925 3300048927 Ga0496124_0140029 Ga0496124_0140029_688_1386 213
926 3300048927 Ga0496124_0268676 Ga0496124_0268676_169_867 213
927 3300048928 Ga0496125_0056070 Ga0496125_0056070_760_1458 213
928 3300048928 Ga0496125_0056714 Ga0496125_0056714_1216_1914 213
929 3300048928 Ga0496125_0117809 Ga0496125_0117809_1114_1833 213
930 3300048928 Ga0496125_0130811 Ga0496125_0130811_246_944 213
931 3300048929 Ga0496126_0000094 Ga0496126_0000094_46097_46795 213
932 3300048929 Ga0496126_0000195 Ga0496126_0000195_88777_89475 213
933 3300048929 Ga0496126_0190342 Ga0496126_0190342_489_1187 213
934 3300048929 Ga0496126_0193203 Ga0496126_0193203_601_1299 213
935 3300049571 Ga0501034_0164311 Ga0501034_0164311_965_1663 213
936 3300050491 nmdc:mga00v17_72_c1 nmdc:mga00v17_72_c1_37232_37930 213
937 3300050492 nmdc:mga0yw44_41265_c1 nmdc:mga0yw44_41265_c1_1569_2267 213
938 3300050494 nmdc:mga06z11_104763_c1 nmdc:mga06z11_104763_c1_540_1238 213
939 3300050495 nmdc:mga04h51_1892_c1 nmdc:mga04h51_1892_c1_1249_1947 213
940 3300050496 nmdc:mga07m45_113552_c1 nmdc:mga07m45_113552_c1_507_1205 213
941 3300050516 nmdc:mga0sz30_82783_c1 nmdc:mga0sz30_82783_c1_303_1022 213
942 3300053088 Ga0500644_0045322 Ga0500644_0045322_35_733 213
943 3300053107 Ga0500560_103419 Ga0500560_103419_183_920 213
944 3300053108 Ga0500562_073957 Ga0500562_073957_132_830 213
945 3300053125 Ga0500618_024101 Ga0500618_024101_206_904 213
946 3300053130 Ga0500642_0252219 Ga0500642_0252219_93_791 213
947 3300053139 Ga0500568_0090338 Ga0500568_0090338_126_824 213
948 3300053140 Ga0500573_0112053 Ga0500573_0112053_305_1003 213
949 3300053153 Ga0500616_0000817 Ga0500616_0000817_376_1074 213
950 3300053156 Ga0500622_0000391 Ga0500622_0000391_28737_29435 213
951 3300053156 Ga0500622_0086810 Ga0500622_0086810_376_1074 213
952 3300053157 Ga0500624_001342 Ga0500624_001342_1085_1783 213
953 3300053158 Ga0500627_0189577 Ga0500627_0189577_103_801 213
954 3300053161 Ga0500634_0074801 Ga0500634_0074801_955_1653 213
955 3300053177 Ga0500636_0000010 Ga0500636_0000010_102793_103497 213
956 iso_pu_bacteria 2954011201 2954014653 213
957 iso_pu_bacteria 8055431914 8055433426 213

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01182

Glucosamine_iso

Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase

22

243

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nwp-assembly2.cif.gz_B crystal structure of a 6-phosphogluconolactonase (sbal_2240) from shewanella baltica os155 at 1.40 a resolution 0.944 2 213
3nwp-assembly2.cif.gz_B crystal structure of a 6-phosphogluconolactonase (sbal_2240) from shewanella baltica os155 at 1.40 a resolution 0.9354 2 213
3lwd-assembly1.cif.gz_A-2 crystal structure of putative 6-phosphogluconolactonase (yp_574786.1) from chromohalobacter salexigens dsm 3043 at 1.88 a resolution 0.9251 12 213
3lhi-assembly1.cif.gz_A crystal structure of putative 6-phosphogluconolactonase(yp_207848.1) from neisseria gonorrhoeae fa 1090 at 1.33 a resolution 0.9075 2 213
3lhi-assembly1.cif.gz_A crystal structure of putative 6-phosphogluconolactonase(yp_207848.1) from neisseria gonorrhoeae fa 1090 at 1.33 a resolution 0.8992 2 213
ID Description Score Start End Superfamily
3lwdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9202 12 213 3.40.50.1360
3nwpB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9154 2 213 3.40.50.1360
3nwpB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9071 2 213 3.40.50.1360
3lhiA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.892 5 213 3.40.50.1360
3lhiA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8718 5 213 3.40.50.1360
ID Description Score Start End GO Terms
AF-M5JS82-F1-model_v4 6-phosphogluconolactonase (EC 3.1.1.31) 0.9865 45 213 GO:0005975
GO:0006098
GO:0017057
AF-A0A7W7YWS2-F1-model_v4 6-phosphogluconolactonase (6PGL) (EC 3.1.1.31) 0.9844 1 213 GO:0005975
GO:0006098
GO:0017057
AF-A0A7K3UD13-F1-model_v4 6-phosphogluconolactonase (6PGL) (EC 3.1.1.31) 0.9829 1 213 GO:0005975
GO:0006098
GO:0017057
AF-A0A4Q3I3H1-F1-model_v4 6-phosphogluconolactonase (6PGL) (EC 3.1.1.31) 0.9802 1 167 GO:0005975
GO:0006098
GO:0017057
AF-A0A7W7YWS2-F1-model_v4 6-phosphogluconolactonase (6PGL) (EC 3.1.1.31) 0.9798 1 213 GO:0005975
GO:0006098
GO:0017057

Feature Viewer

pLDDT pTM Quality
91.63 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map