F486779
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 957 | 686 | 497 | 225 |
Family's Representative Sequence
| Representative Sequence | 3300046558|Ga0495633_0139263|Ga0495633_0139263_185_922 |
| Length | 245 |
| Sequence | MAAPGTTLIEGAKMSETMHVFDTAAELANALAADVAQRLDAATKEYGTASIAVSGGSTPKLFFQALSRHDLDWSNISVTLVDERFVPPESERSNHRLVGENLLQDKAKAAYFVPLFQPAASPEDAATLATVKTEAICDPFDVVVLGMGTDGHTASFFPGGDNLYEALDLDEPRGVLTMAAETAGEERLTFNFSSLHDAGFLVLHIEGAAKKATLEKAQSGEDEDEMPIRAVLNRAETLVDIYWAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 2 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 3 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 4 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 5 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 6 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 7 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 8 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 9 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 10 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 11 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 12 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 13 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 14 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 15 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 16 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 17 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 18 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 19 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 20 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 21 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 22 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 23 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 24 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 25 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 26 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 27 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 28 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 29 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 30 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 31 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 32 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 33 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 34 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 35 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 36 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 37 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 38 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 39 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 40 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 41 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 42 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 43 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 44 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 45 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 46 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 47 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 48 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 49 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 50 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 51 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 52 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 53 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 54 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 55 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 56 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 57 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 58 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 59 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 60 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 61 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 62 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 63 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 64 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 65 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 66 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 67 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 68 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 69 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 70 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 71 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 72 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 73 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 74 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 75 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 76 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 77 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 78 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 79 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 80 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 81 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 82 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 83 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 84 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 85 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 86 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 87 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 88 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 89 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 90 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 91 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 92 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 93 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 94 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 95 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 96 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 97 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 98 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 99 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 100 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 101 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 102 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 103 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 104 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 105 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 106 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 107 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 108 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 109 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 110 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 111 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 112 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 113 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 114 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 115 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 116 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 117 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 118 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 119 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 120 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 121 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 122 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 123 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 124 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 125 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 126 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 127 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 128 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 129 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 130 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 131 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 132 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 133 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 134 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 135 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 136 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 137 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 138 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 139 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 140 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 141 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 142 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 143 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 144 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 145 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 146 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 147 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 148 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 149 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 150 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 151 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 152 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 153 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 154 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 155 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 156 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 157 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 158 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 159 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 160 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 161 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 162 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 163 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 164 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 165 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 166 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 167 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 168 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 169 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 170 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 171 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 172 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 173 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 174 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 175 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 176 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 177 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 178 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 179 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 180 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 181 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 182 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 183 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 184 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 185 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 186 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 187 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 188 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 189 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 190 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 191 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 192 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 193 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 194 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 195 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 196 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 197 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 198 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 199 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 200 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 201 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 202 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 203 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 204 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 205 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 206 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 207 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 208 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 209 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 210 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 211 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 212 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 213 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 214 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 215 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 216 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 217 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 218 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 219 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 220 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 221 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 222 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 223 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 224 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 225 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 226 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 227 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 228 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 229 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 230 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 231 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 232 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 233 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 234 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 235 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 236 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 237 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 238 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 239 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 240 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 241 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 242 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 243 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 244 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 245 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 246 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 247 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 248 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 249 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 250 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 251 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 252 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 253 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 254 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 255 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 256 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 257 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 258 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 259 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 260 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 261 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 262 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 263 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 264 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 265 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 266 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 267 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 268 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 269 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 270 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 271 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 272 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 273 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 274 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 275 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 276 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 277 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 278 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 279 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 280 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 281 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 282 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 283 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 284 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 285 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 286 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 287 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 288 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 289 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 290 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 291 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 292 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 293 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 294 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 295 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 296 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 297 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 298 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 299 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 300 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 301 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 302 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 303 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 304 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 305 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 306 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 307 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 308 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 309 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 310 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 311 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 312 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 313 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 314 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 315 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 316 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 317 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 318 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 319 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 320 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 321 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 322 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 323 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 324 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 325 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 326 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 327 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 328 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 329 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 330 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 331 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 332 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 333 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 334 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 335 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 336 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 337 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 338 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 339 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 340 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 341 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 342 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 343 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 344 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 345 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 346 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 347 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 348 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 349 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 350 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 351 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 352 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 353 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 354 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 355 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 356 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 357 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 358 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 359 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 360 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 361 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 362 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 363 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 364 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 365 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 366 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 367 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 368 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 369 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 370 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 371 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 372 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 373 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 374 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 375 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 376 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 377 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 378 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 379 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 380 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 381 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 382 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 383 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 384 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 385 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 386 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 387 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 388 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 389 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 390 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 391 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 392 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 393 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 394 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 395 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 396 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 397 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 398 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 399 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 400 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 401 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 402 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 403 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 404 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 405 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 406 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 407 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 408 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 409 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 410 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 411 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 412 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 413 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 414 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 415 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 416 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 417 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 418 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 419 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 420 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 421 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 422 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 423 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 424 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 425 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 426 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 427 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 428 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 429 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 430 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 431 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 432 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 433 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 434 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 435 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 436 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 437 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 438 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 439 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 440 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 441 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 443 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 444 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 445 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 446 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 447 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 448 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 449 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 450 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 451 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 452 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 453 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 454 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 455 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 456 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 457 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 458 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 459 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 460 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 461 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 462 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 463 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 464 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 465 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 466 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 467 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 468 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 469 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 470 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 471 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 472 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 473 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 474 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 475 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 476 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 477 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 478 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 479 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 480 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 481 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 482 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 483 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 484 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 485 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 486 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 487 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 488 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 489 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 490 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 491 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 492 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 493 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 494 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 495 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 496 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 497 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 498 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 499 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 500 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 501 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 502 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 503 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 504 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 505 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 506 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 507 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 508 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 509 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 510 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 511 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 512 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 513 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 514 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 515 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 516 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 517 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 518 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 519 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 520 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 521 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 522 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 523 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 524 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 525 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 526 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 527 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 528 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 529 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 530 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 531 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 532 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 533 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 534 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 535 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 536 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 537 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 538 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 539 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 540 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 541 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 542 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 543 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 544 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 545 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 546 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 547 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 548 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 549 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 550 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 551 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 578 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 579 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 580 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 581 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 582 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 583 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 584 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 585 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 586 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 587 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 588 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 589 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 590 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 591 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 592 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 593 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 595 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 596 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 597 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 598 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 599 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 600 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 601 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 602 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 603 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 604 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 605 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 606 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 607 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 608 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 609 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 610 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 611 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 612 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 613 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 614 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 615 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 616 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 617 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 618 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 619 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 620 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 621 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 622 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 623 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 624 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 625 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 626 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 627 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 628 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 629 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 630 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 631 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 632 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 633 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 634 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 635 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 636 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 637 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 638 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 639 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 640 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 641 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 642 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 643 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 644 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 645 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 646 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 647 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 648 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 649 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 650 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 651 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 652 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 653 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 654 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 655 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 656 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 657 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 658 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 659 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 660 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 661 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 662 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 663 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 664 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 665 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 666 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 667 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 668 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 669 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 670 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 671 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 672 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 673 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 674 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 675 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 676 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 677 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 678 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 679 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 680 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 681 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 682 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 683 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 684 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 685 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 686 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 51.72 |
| Metatranscriptomes | 0.1 |
| Isolates | 48.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.52 |
| Bulb | 0 |
| Endosphere | 16.41 |
| Nodule | 38.04 |
| Rhizoplane | 1.46 |
| Rhizosphere | 26.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000023 | 3300002704 | Bacteria | 136961 |
| 2 | JGI25156J39149_1000029 | 3300002705 | Bacteria | 126505 |
| 3 | JGI25162J39368_1002348 | 3300002737 | Bacteria | 7511 |
| 4 | JGI25154J39366_1000067 | 3300002738 | Bacteria | 100452 |
| 5 | JGI25158J39367_1000254 | 3300002739 | Bacteria | 12201 |
| 6 | JGI25157J39369_1000043 | 3300002741 | Bacteria | 122537 |
| 7 | JGI25152J39213_1006415 | 3300002773 | Bacteria | 3218 |
| 8 | JGI25152J39213_1007261 | 3300002773 | Bacteria | 2894 |
| 9 | JGI25150J39212_1000012 | 3300002774 | Bacteria | 182468 |
| 10 | JGI25159J45721_1000087 | 3300002987 | Bacteria | 43868 |
| 11 | JGI25159J45721_1002669 | 3300002987 | Bacteria | 6642 |
| 12 | JGI25151J46595_10000025 | 3300003187 | Bacteria | 213302 |
| 13 | JGI25151J46595_10000346 | 3300003187 | Bacteria | 49745 |
| 14 | JGI25151J46595_10008951 | 3300003187 | Bacteria | 4775 |
| 15 | JGI25151J46595_10047816 | 3300003187 | Bacteria | 1484 |
| 16 | JGI25165J46597_1000529 | 3300003214 | Bacteria | 35691 |
| 17 | JGI25165J46597_1001287 | 3300003214 | Bacteria | 14566 |
| 18 | JGI25165J46597_1013388 | 3300003214 | Bacteria | 1130 |
| 19 | JGI25153J46596_10002371 | 3300003215 | Bacteria | 10908 |
| 20 | JGI25153J46596_10003997 | 3300003215 | Bacteria | 8052 |
| 21 | rootH1_10041182 | 3300003316 | Bacteria | 1303 |
| 22 | rootH1_10041182 | 3300003323 | Bacteria | 1456 |
| 23 | rootH1_10167985 | 3300003316 | Bacteria | 1273 |
| 24 | rootH2_10017545 | 3300003320 | Bacteria | 1127 |
| 25 | rootH2_10053655 | 3300003320 | Bacteria | 1553 |
| 26 | rootH2_10186027 | 3300003320 | Bacteria | 1218 |
| 27 | rootL2_10099180 | 3300003322 | Bacteria | 2159 |
| 28 | rootH1_10046242 | 3300003323 | Bacteria | 1450 |
| 29 | rootH1_10123595 | 3300003323 | Bacteria | 1117 |
| 30 | JGI25160J50197_1000046 | 3300003354 | Bacteria | 141352 |
| 31 | JGI25160J50197_1000500 | 3300003354 | Bacteria | 23279 |
| 32 | JGI25160J50197_1003907 | 3300003354 | Bacteria | 6525 |
| 33 | JGI25161J50226_1000031 | 3300003374 | Bacteria | 141352 |
| 34 | JGI25161J50226_1000074 | 3300003374 | Bacteria | 85547 |
| 35 | JGI25161J50226_1000382 | 3300003374 | Bacteria | 22288 |
| 36 | Ga0032354_1032914 | 3300003693 | Bacteria | 3030 |
| 37 | Ga0055526_1002431 | 3300003771 | Bacteria | 12618 |
| 38 | Ga0055526_1015836 | 3300003771 | Bacteria | 2998 |
| 39 | Ga0055524_1002633 | 3300003775 | Bacteria | 9137 |
| 40 | Ga0055524_1003868 | 3300003775 | Bacteria | 7101 |
| 41 | Ga0055524_1004431 | 3300003775 | Bacteria | 6477 |
| 42 | Ga0055524_1008508 | 3300003775 | Bacteria | 4258 |
| 43 | Ga0055528_1000303 | 3300003790 | Bacteria | 41794 |
| 44 | Ga0055528_1001497 | 3300003790 | Bacteria | 14166 |
| 45 | Ga0055540_1000471 | 3300003792 | Bacteria | 31092 |
| 46 | Ga0055540_1001471 | 3300003792 | Bacteria | 14037 |
| 47 | Ga0055531_10005094 | 3300003794 | Bacteria | 7768 |
| 48 | Ga0058692_1009082 | 3300003856 | Bacteria | 2528 |
| 49 | Ga0055543_1000008 | 3300004625 | Bacteria | 202062 |
| 50 | Ga0055543_1000141 | 3300004625 | Bacteria | 60055 |
| 51 | Ga0055543_1001182 | 3300004625 | Bacteria | 11019 |
| 52 | Ga0065165_1000031 | 3300005262 | Bacteria | 216330 |
| 53 | Ga0065165_1005966 | 3300005262 | Bacteria | 6585 |
| 54 | Ga0065165_1011908 | 3300005262 | Bacteria | 3580 |
| 55 | Ga0065165_1013652 | 3300005262 | Bacteria | 3213 |
| 56 | Ga0065165_1068442 | 3300005262 | Bacteria | 950 |
| 57 | Ga0065704_10001731 | 3300005289 | Bacteria | 9637 |
| 58 | Ga0070668_100373549 | 3300005347 | Bacteria | 1212 |
| 59 | Ga0070668_100416239 | 3300005347 | Bacteria | 1150 |
| 60 | Ga0070669_100069998 | 3300005353 | Bacteria | 2592 |
| 61 | Ga0070667_100169152 | 3300005367 | Bacteria | 1929 |
| 62 | Ga0070678_100782328 | 3300005456 | Bacteria | 865 |
| 63 | Ga0070665_100014231 | 3300005548 | Bacteria | 7991 |
| 64 | Ga0070665_100220086 | 3300005548 | Bacteria | 1899 |
| 65 | Ga0070665_100536846 | 3300005548 | Bacteria | 1181 |
| 66 | Ga0068855_100254945 | 3300005563 | Bacteria | 1956 |
| 67 | Ga0068854_100198901 | 3300005578 | Bacteria | 1574 |
| 68 | Ga0068854_100284660 | 3300005578 | Bacteria | 1332 |
| 69 | Ga0068856_100301256 | 3300005614 | Bacteria | 1621 |
| 70 | Ga0068851_10051204 | 3300005834 | Bacteria | 2098 |
| 71 | Ga0075365_10011895 | 3300006038 | Bacteria | 5139 |
| 72 | Ga0075365_10106442 | 3300006038 | Bacteria | 1925 |
| 73 | Ga0075368_10000571 | 3300006042 | Bacteria | 11054 |
| 74 | Ga0075368_10019855 | 3300006042 | Bacteria | 2539 |
| 75 | Ga0075363_100085615 | 3300006048 | Bacteria | 1729 |
| 76 | Ga0075364_10151574 | 3300006051 | Bacteria | 1562 |
| 77 | Ga0075364_10214680 | 3300006051 | Bacteria | 1305 |
| 78 | Ga0075367_10085263 | 3300006178 | Bacteria | 1916 |
| 79 | Ga0075367_10088173 | 3300006178 | Bacteria | 1885 |
| 80 | Ga0075369_10027622 | 3300006186 | Bacteria | 2373 |
| 81 | Ga0075369_10028567 | 3300006186 | Bacteria | 2338 |
| 82 | Ga0075369_10074301 | 3300006186 | Bacteria | 1499 |
| 83 | Ga0075366_10014660 | 3300006195 | Bacteria | 4479 |
| 84 | Ga0075370_10086455 | 3300006353 | Bacteria | 1806 |
| 85 | Ga0075370_10139831 | 3300006353 | Bacteria | 1415 |
| 86 | Ga0075370_10214402 | 3300006353 | Bacteria | 1137 |
| 87 | Ga0079104_1000876 | 3300006946 | Bacteria | 24701 |
| 88 | Ga0079104_1004688 | 3300006946 | Bacteria | 5731 |
| 89 | Ga0099826_10000216 | 3300006948 | Bacteria | 24979 |
| 90 | Ga0105244_10081231 | 3300009036 | Bacteria | 1604 |
| 91 | Ga0105240_10000278 | 3300009093 | Bacteria | 101540 |
| 92 | Ga0105237_10003138 | 3300009545 | Bacteria | 19875 |
| 93 | Ga0105238_10300955 | 3300009551 | Bacteria | 1587 |
| 94 | Ga0123341_1000192 | 3300009765 | Bacteria | 31290 |
| 95 | Ga0123342_1013143 | 3300009766 | Bacteria | 8393 |
| 96 | Ga0105239_10001623 | 3300010375 | Bacteria | 29710 |
| 97 | Ga0105246_10156879 | 3300011119 | Bacteria | 1729 |
| 98 | Ga0157373_10049858 | 3300013100 | Bacteria | 2982 |
| 99 | Ga0157371_10000058 | 3300013102 | Bacteria | 171756 |
| 100 | Ga0157371_10015095 | 3300013102 | Bacteria | 5806 |
| 101 | Ga0157370_10002372 | 3300013104 | Bacteria | 22708 |
| 102 | Ga0157369_10866275 | 3300013105 | Bacteria | 927 |
| 103 | Ga0171463_1001 | 3300013249 | Bacteria | 1406070 |
| 104 | Ga0163162_11141173 | 3300013306 | Bacteria | 884 |
| 105 | Ga0182007_10045652 | 3300015262 | Bacteria | 1452 |
| 106 | Ga0182005_1022742 | 3300015265 | Bacteria | 1716 |
| 107 | Ga0183363_1012 | 3300015690 | Bacteria | 90054 |
| 108 | Ga0214544_1000012 | 3300021320 | Bacteria | 229808 |
| 109 | Ga0214542_1000011 | 3300021321 | Bacteria | 238260 |
| 110 | Ga0214542_1009335 | 3300021321 | Bacteria | 15333 |
| 111 | Ga0214543_1000004 | 3300021327 | Bacteria | 527190 |
| 112 | Ga0214543_1000256 | 3300021327 | Bacteria | 82084 |
| 113 | Ga0228711_1000019 | 3300022739 | Bacteria | 111795 |
| 114 | Ga0228710_1000022 | 3300022740 | Bacteria | 111795 |
| 115 | Ga0209435_100011 | 3300025206 | Bacteria | 413027 |
| 116 | Ga0209436_100051 | 3300025208 | Bacteria | 64359 |
| 117 | Ga0209437_100036 | 3300025233 | Bacteria | 469153 |
| 118 | Ga0209437_100086 | 3300025233 | Bacteria | 254578 |
| 119 | Ga0207425_1000012 | 3300025245 | Bacteria | 528324 |
| 120 | Ga0207425_1004154 | 3300025245 | Bacteria | 4415 |
| 121 | Ga0207425_1007794 | 3300025245 | Bacteria | 2792 |
| 122 | Ga0209646_1000024 | 3300025246 | Bacteria | 413027 |
| 123 | Ga0209026_1000030 | 3300025250 | Bacteria | 329811 |
| 124 | Ga0209677_101207 | 3300025253 | Bacteria | 11759 |
| 125 | Ga0209148_1004207 | 3300025254 | Bacteria | 3610 |
| 126 | Ga0209759_1000011 | 3300025256 | Bacteria | 413027 |
| 127 | Ga0209129_1000081 | 3300025258 | Bacteria | 183694 |
| 128 | Ga0209129_1000123 | 3300025258 | Bacteria | 133661 |
| 129 | Ga0209129_1000545 | 3300025258 | Bacteria | 26086 |
| 130 | Ga0209129_1003389 | 3300025258 | Bacteria | 6996 |
| 131 | Ga0209233_1000110 | 3300025261 | Bacteria | 260825 |
| 132 | Ga0209233_1000166 | 3300025261 | Bacteria | 152270 |
| 133 | Ga0209233_1000356 | 3300025261 | Bacteria | 42791 |
| 134 | Ga0209455_1020560 | 3300025272 | Bacteria | 1302 |
| 135 | Ga0209673_1000015 | 3300025273 | Bacteria | 530618 |
| 136 | Ga0209673_1000967 | 3300025273 | Bacteria | 35634 |
| 137 | Ga0209673_1001074 | 3300025273 | Bacteria | 30901 |
| 138 | Ga0209673_1002143 | 3300025273 | Bacteria | 14688 |
| 139 | Ga0209673_1003246 | 3300025273 | Bacteria | 9824 |
| 140 | Ga0209130_1000002 | 3300025284 | Bacteria | 722648 |
| 141 | Ga0209130_1000088 | 3300025284 | Bacteria | 152927 |
| 142 | Ga0209130_1008937 | 3300025284 | Bacteria | 2904 |
| 143 | Ga0209675_1039946 | 3300025291 | Bacteria | 1035 |
| 144 | Ga0209676_1003256 | 3300025292 | Bacteria | 10221 |
| 145 | Ga0209676_1015253 | 3300025292 | Bacteria | 2836 |
| 146 | Ga0209025_1000024 | 3300025294 | Bacteria | 528324 |
| 147 | Ga0209025_1000441 | 3300025294 | Bacteria | 81951 |
| 148 | Ga0209025_1000528 | 3300025294 | Bacteria | 72802 |
| 149 | Ga0209025_1000970 | 3300025294 | Bacteria | 43006 |
| 150 | Ga0209025_1016350 | 3300025294 | Bacteria | 4388 |
| 151 | Ga0209025_1093537 | 3300025294 | Bacteria | 975 |
| 152 | Ga0209564_1000382 | 3300025295 | Bacteria | 81070 |
| 153 | Ga0209564_1001938 | 3300025295 | Bacteria | 18408 |
| 154 | Ga0209564_1006978 | 3300025295 | Bacteria | 5926 |
| 155 | Ga0209758_1000046 | 3300025297 | Bacteria | 364931 |
| 156 | Ga0209758_1000349 | 3300025297 | Bacteria | 84164 |
| 157 | Ga0209758_1001048 | 3300025297 | Bacteria | 36241 |
| 158 | Ga0209050_1002637 | 3300025298 | Bacteria | 14727 |
| 159 | Ga0209050_1005205 | 3300025298 | Bacteria | 8315 |
| 160 | Ga0209256_1000180 | 3300025299 | Bacteria | 123687 |
| 161 | Ga0209256_1000874 | 3300025299 | Bacteria | 37312 |
| 162 | Ga0209256_1000991 | 3300025299 | Bacteria | 33849 |
| 163 | Ga0209256_1003297 | 3300025299 | Bacteria | 11510 |
| 164 | Ga0209256_1052758 | 3300025299 | Bacteria | 976 |
| 165 | Ga0207426_1000012 | 3300025302 | Bacteria | 730942 |
| 166 | Ga0207426_1000013 | 3300025302 | Bacteria | 721897 |
| 167 | Ga0207426_1000063 | 3300025302 | Bacteria | 358920 |
| 168 | Ga0207426_1000172 | 3300025302 | Bacteria | 163690 |
| 169 | Ga0209051_1000084 | 3300025303 | Bacteria | 190324 |
| 170 | Ga0209051_1001361 | 3300025303 | Bacteria | 21200 |
| 171 | Ga0209051_1005782 | 3300025303 | Bacteria | 7121 |
| 172 | Ga0209051_1011680 | 3300025303 | Bacteria | 4313 |
| 173 | Ga0209051_1031902 | 3300025303 | Bacteria | 2019 |
| 174 | Ga0209257_1004216 | 3300025304 | Bacteria | 11393 |
| 175 | Ga0209257_1010896 | 3300025304 | Bacteria | 4495 |
| 176 | Ga0209257_1027231 | 3300025304 | Bacteria | 1906 |
| 177 | Ga0207656_10071163 | 3300025321 | Bacteria | 1546 |
| 178 | Ga0207695_10000376 | 3300025913 | Bacteria | 101548 |
| 179 | Ga0207671_10000275 | 3300025914 | Bacteria | 76888 |
| 180 | Ga0207667_10233512 | 3300025949 | Bacteria | 1883 |
| 181 | Ga0207668_10596720 | 3300025972 | Bacteria | 962 |
| 182 | Ga0207658_10022653 | 3300025986 | Bacteria | 4376 |
| 183 | Ga0207678_10193399 | 3300026067 | Bacteria | 1739 |
| 184 | Ga0207702_10062428 | 3300026078 | Bacteria | 3182 |
| 185 | Ga0209281_1000192 | 3300027111 | Bacteria | 140252 |
| 186 | Ga0209281_1000227 | 3300027111 | Bacteria | 119329 |
| 187 | Ga0209281_1001513 | 3300027111 | Bacteria | 13209 |
| 188 | Ga0209371_1000009 | 3300027312 | Bacteria | 963030 |
| 189 | Ga0209371_1000547 | 3300027312 | Bacteria | 35249 |
| 190 | Ga0209371_1003471 | 3300027312 | Bacteria | 7634 |
| 191 | Ga0209282_1000042 | 3300027666 | Bacteria | 119329 |
| 192 | Ga0209282_1012946 | 3300027666 | Bacteria | 5308 |
| 193 | Ga0209813_10018418 | 3300027866 | Bacteria | 1930 |
| 194 | Ga0268266_10003170 | 3300028379 | Bacteria | 16690 |
| 195 | Ga0268266_10215388 | 3300028379 | Bacteria | 1763 |
| 196 | Ga0268256_1000010 | 3300030500 | Bacteria | 963034 |
| 197 | Ga0268256_1003179 | 3300030500 | Bacteria | 7634 |
| 198 | Ga0268256_1021622 | 3300030500 | Bacteria | 1706 |
| 199 | Ga0316181_1112456 | 3300030744 | Bacteria | 4196 |
| 200 | Ga0307513_10118868 | 3300031456 | Bacteria | 2616 |
| 201 | Ga0316575_10021494 | 3300031665 | Bacteria | 2484 |
| 202 | Ga0307405_10001288 | 3300031731 | Bacteria | 10466 |
| 203 | Ga0307412_10009244 | 3300031911 | Bacteria | 5650 |
| 204 | Ga0315914_1000009 | 3300031967 | Bacteria | 182444 |
| 205 | Ga0307409_100134946 | 3300031995 | Bacteria | 2116 |
| 206 | Ga0307416_100292761 | 3300032002 | Bacteria | 1613 |
| 207 | Ga0307414_10011355 | 3300032004 | Bacteria | 5219 |
| 208 | Ga0315913_1000015 | 3300033430 | Bacteria | 119325 |
| 209 | Ga0315915_1000013 | 3300033464 | Bacteria | 182438 |
| 210 | Ga0373927_0000887 | 3300035695 | Bacteria | 22766 |
| 211 | Ga0373925_0003273 | 3300037068 | Bacteria | 12613 |
| 212 | Ga0439465_0016858 | 3300041413 | Bacteria | 2280 |
| 213 | Ga0439465_0021834 | 3300041413 | Bacteria | 2009 |
| 214 | Ga0439465_0033354 | 3300041413 | Bacteria | 1646 |
| 215 | Ga0451787_595301 | 3300041441 | Bacteria | 1364 |
| 216 | Ga0451791_1542001 | 3300041451 | Bacteria | 1734 |
| 217 | Ga0451798_0298663 | 3300041458 | Bacteria | 1890 |
| 218 | Ga0451841_0033924 | 3300041498 | Bacteria | 1100 |
| 219 | Ga0451851_0667480 | 3300041507 | Bacteria | 3946 |
| 220 | Ga0439459_0031337 | 3300042438 | Bacteria | 1084 |
| 221 | Ga0466960_0014783 | 3300044901 | Bacteria | 3352 |
| 222 | Ga0495590_0084389 | 3300046457 | Bacteria | 1120 |
| 223 | Ga0495638_0192024 | 3300046460 | Bacteria | 1158 |
| 224 | Ga0495662_0018301 | 3300046476 | Bacteria | 3391 |
| 225 | Ga0495585_0053852 | 3300046492 | Bacteria | 2226 |
| 226 | Ga0495606_0001322 | 3300046507 | Bacteria | 33851 |
| 227 | Ga0495606_0053292 | 3300046507 | Bacteria | 2625 |
| 228 | Ga0495606_0106257 | 3300046507 | Bacteria | 1700 |
| 229 | Ga0495610_0123856 | 3300046512 | Bacteria | 1129 |
| 230 | Ga0495616_0163119 | 3300046513 | Bacteria | 1001 |
| 231 | Ga0495620_0101656 | 3300046515 | Bacteria | 1145 |
| 232 | Ga0495643_0036445 | 3300046522 | Bacteria | 2701 |
| 233 | Ga0495643_0117763 | 3300046522 | Bacteria | 1344 |
| 234 | Ga0495648_0095626 | 3300046524 | Bacteria | 1652 |
| 235 | Ga0495654_0001458 | 3300046530 | Bacteria | 16197 |
| 236 | Ga0495597_0100895 | 3300046542 | Bacteria | 1217 |
| 237 | Ga0495633_0139263 | 3300046558 | Bacteria | 1122 |
| 238 | Ga0495668_0044767 | 3300046616 | Bacteria | 2459 |
| 239 | Ga0495611_0190828 | 3300046648 | Bacteria | 956 |
| 240 | Ga0495625_0110963 | 3300046660 | Bacteria | 1874 |
| 241 | Ga0495625_0268577 | 3300046660 | Bacteria | 1101 |
| 242 | Ga0495588_0041275 | 3300046674 | Bacteria | 2355 |
| 243 | Ga0495658_0119475 | 3300046683 | Bacteria | 1593 |
| 244 | Ga0495624_0283059 | 3300046690 | Bacteria | 1001 |
| 245 | Ga0495671_0078267 | 3300046692 | Bacteria | 1621 |
| 246 | Ga0495671_0099083 | 3300046692 | Bacteria | 1425 |
| 247 | Ga0495649_0000165 | 3300046694 | Bacteria | 57643 |
| 248 | Ga0495649_0211207 | 3300046694 | Bacteria | 1005 |
| 249 | Ga0495660_0037091 | 3300046810 | Bacteria | 2716 |
| 250 | Ga0495683_0152950 | 3300047323 | Bacteria | 1072 |
| 251 | Ga0495687_059685 | 3300047443 | Bacteria | 1576 |
| 252 | Ga0495681_0006515 | 3300047470 | Bacteria | 7656 |
| 253 | Ga0495686_0082371 | 3300047472 | Bacteria | 1963 |
| 254 | Ga0495686_0226314 | 3300047472 | Bacteria | 1061 |
| 255 | Ga0495686_0252425 | 3300047472 | Bacteria | 991 |
| 256 | Ga0496101_0530664 | 3300048904 | Bacteria | 930 |
| 257 | Ga0496103_0301184 | 3300048906 | Bacteria | 1031 |
| 258 | Ga0496106_0017594 | 3300048909 | Bacteria | 5287 |
| 259 | Ga0496106_0251774 | 3300048909 | Bacteria | 1412 |
| 260 | Ga0496113_0305184 | 3300048916 | Bacteria | 1275 |
| 261 | Ga0496114_0011920 | 3300048917 | Bacteria | 6956 |
| 262 | Ga0496116_0000080 | 3300048919 | Bacteria | 224530 |
| 263 | Ga0496116_0009980 | 3300048919 | Bacteria | 8021 |
| 264 | Ga0496116_0031077 | 3300048919 | Bacteria | 3829 |
| 265 | Ga0496116_0043024 | 3300048919 | Bacteria | 3080 |
| 266 | Ga0496116_0066648 | 3300048919 | Bacteria | 2303 |
| 267 | Ga0496116_0078950 | 3300048919 | Bacteria | 2050 |
| 268 | Ga0496116_0143485 | 3300048919 | Bacteria | 1339 |
| 269 | Ga0496116_0144264 | 3300048919 | Bacteria | 1333 |
| 270 | Ga0496116_0205731 | 3300048919 | Bacteria | 1025 |
| 271 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 272 | Ga0496117_0002570 | 3300048920 | Bacteria | 22598 |
| 273 | Ga0496117_0003540 | 3300048920 | Bacteria | 18034 |
| 274 | Ga0496117_0016471 | 3300048920 | Bacteria | 6239 |
| 275 | Ga0496117_0031612 | 3300048920 | Bacteria | 4037 |
| 276 | Ga0496117_0116758 | 3300048920 | Bacteria | 1649 |
| 277 | Ga0496117_0117248 | 3300048920 | Bacteria | 1644 |
| 278 | Ga0496117_0149367 | 3300048920 | Bacteria | 1385 |
| 279 | Ga0496117_0161780 | 3300048920 | Bacteria | 1310 |
| 280 | Ga0496117_0179606 | 3300048920 | Bacteria | 1218 |
| 281 | Ga0496117_0187332 | 3300048920 | Bacteria | 1183 |
| 282 | Ga0496118_0000233 | 3300048921 | Bacteria | 97731 |
| 283 | Ga0496118_0004324 | 3300048921 | Bacteria | 16941 |
| 284 | Ga0496118_0056155 | 3300048921 | Bacteria | 2963 |
| 285 | Ga0496118_0060112 | 3300048921 | Bacteria | 2824 |
| 286 | Ga0496118_0114365 | 3300048921 | Bacteria | 1779 |
| 287 | Ga0496118_0138849 | 3300048921 | Bacteria | 1545 |
| 288 | Ga0496118_0147281 | 3300048921 | Bacteria | 1480 |
| 289 | Ga0496118_0189347 | 3300048921 | Bacteria | 1232 |
| 290 | Ga0496119_0025703 | 3300048922 | Bacteria | 4104 |
| 291 | Ga0496119_0147606 | 3300048922 | Bacteria | 1263 |
| 292 | Ga0496119_0168368 | 3300048922 | Bacteria | 1159 |
| 293 | Ga0496120_0000021 | 3300048923 | Bacteria | 250966 |
| 294 | Ga0496120_0006881 | 3300048923 | Bacteria | 8589 |
| 295 | Ga0496120_0038167 | 3300048923 | Bacteria | 2844 |
| 296 | Ga0496121_0000001 | 3300048924 | Bacteria | 1830318 |
| 297 | Ga0496121_0006792 | 3300048924 | Bacteria | 14018 |
| 298 | Ga0496121_0115192 | 3300048924 | Bacteria | 2041 |
| 299 | Ga0496121_0136052 | 3300048924 | Bacteria | 1830 |
| 300 | Ga0496121_0176353 | 3300048924 | Bacteria | 1547 |
| 301 | Ga0496121_0190184 | 3300048924 | Bacteria | 1472 |
| 302 | Ga0496121_0386357 | 3300048924 | Bacteria | 921 |
| 303 | Ga0496122_0000001 | 3300048925 | Bacteria | 1827766 |
| 304 | Ga0496122_0001050 | 3300048925 | Bacteria | 48341 |
| 305 | Ga0496122_0002476 | 3300048925 | Bacteria | 26097 |
| 306 | Ga0496122_0011009 | 3300048925 | Bacteria | 9243 |
| 307 | Ga0496122_0124535 | 3300048925 | Bacteria | 1653 |
| 308 | Ga0496122_0178776 | 3300048925 | Bacteria | 1268 |
| 309 | Ga0496122_0186589 | 3300048925 | Bacteria | 1229 |
| 310 | Ga0496123_0000001 | 3300048926 | Bacteria | 1831497 |
| 311 | Ga0496123_0000020 | 3300048926 | Bacteria | 388748 |
| 312 | Ga0496123_0000158 | 3300048926 | Bacteria | 136078 |
| 313 | Ga0496123_0052473 | 3300048926 | Bacteria | 2705 |
| 314 | Ga0496123_0064102 | 3300048926 | Bacteria | 2343 |
| 315 | Ga0496123_0075335 | 3300048926 | Bacteria | 2083 |
| 316 | Ga0496123_0112189 | 3300048926 | Bacteria | 1555 |
| 317 | Ga0496123_0133630 | 3300048926 | Bacteria | 1369 |
| 318 | Ga0496123_0141095 | 3300048926 | Bacteria | 1317 |
| 319 | Ga0496123_0141915 | 3300048926 | Bacteria | 1311 |
| 320 | Ga0496124_0000063 | 3300048927 | Bacteria | 229705 |
| 321 | Ga0496124_0004315 | 3300048927 | Bacteria | 16678 |
| 322 | Ga0496124_0006030 | 3300048927 | Bacteria | 13355 |
| 323 | Ga0496124_0010037 | 3300048927 | Bacteria | 9661 |
| 324 | Ga0496124_0063645 | 3300048927 | Bacteria | 3080 |
| 325 | Ga0496124_0076573 | 3300048927 | Bacteria | 2761 |
| 326 | Ga0496124_0109017 | 3300048927 | Bacteria | 2232 |
| 327 | Ga0496124_0140029 | 3300048927 | Bacteria | 1910 |
| 328 | Ga0496124_0214194 | 3300048927 | Bacteria | 1455 |
| 329 | Ga0496124_0268676 | 3300048927 | Bacteria | 1250 |
| 330 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 331 | Ga0496125_0000695 | 3300048928 | Bacteria | 55563 |
| 332 | Ga0496125_0056070 | 3300048928 | Bacteria | 3203 |
| 333 | Ga0496125_0056714 | 3300048928 | Bacteria | 3178 |
| 334 | Ga0496125_0117809 | 3300048928 | Bacteria | 1903 |
| 335 | Ga0496125_0130811 | 3300048928 | Bacteria | 1767 |
| 336 | Ga0496125_0199862 | 3300048928 | Bacteria | 1310 |
| 337 | Ga0496125_0204495 | 3300048928 | Bacteria | 1289 |
| 338 | Ga0496126_0000094 | 3300048929 | Bacteria | 208184 |
| 339 | Ga0496126_0000195 | 3300048929 | Bacteria | 135582 |
| 340 | Ga0496126_0190342 | 3300048929 | Bacteria | 1738 |
| 341 | Ga0496126_0193203 | 3300048929 | Bacteria | 1723 |
| 342 | Ga0496126_0645744 | 3300048929 | Bacteria | 828 |
| 343 | Ga0496126_0645784 | 3300048929 | Bacteria | 828 |
| 344 | Ga0495678_043266 | 3300049459 | Bacteria | 1790 |
| 345 | Ga0501031_0000003 | 3300049568 | Bacteria | 206821 |
| 346 | Ga0501031_0010940 | 3300049568 | Bacteria | 5910 |
| 347 | Ga0501031_0012255 | 3300049568 | Bacteria | 5588 |
| 348 | Ga0501031_0283955 | 3300049568 | Bacteria | 1073 |
| 349 | Ga0501032_0000010 | 3300049569 | Bacteria | 206795 |
| 350 | Ga0501032_0000234 | 3300049569 | Bacteria | 46284 |
| 351 | Ga0501032_0021226 | 3300049569 | Bacteria | 4516 |
| 352 | Ga0501032_0137564 | 3300049569 | Bacteria | 1609 |
| 353 | Ga0501032_0172395 | 3300049569 | Bacteria | 1418 |
| 354 | Ga0501032_0296874 | 3300049569 | Bacteria | 1045 |
| 355 | Ga0501033_0000017 | 3300049570 | Bacteria | 206819 |
| 356 | Ga0501033_0000076 | 3300049570 | Bacteria | 93921 |
| 357 | Ga0501033_0000495 | 3300049570 | Bacteria | 37085 |
| 358 | Ga0501033_0001157 | 3300049570 | Bacteria | 23861 |
| 359 | Ga0501033_0012742 | 3300049570 | Bacteria | 6412 |
| 360 | Ga0501033_0178235 | 3300049570 | Bacteria | 1524 |
| 361 | Ga0501033_0328447 | 3300049570 | Bacteria | 1073 |
| 362 | Ga0501034_0000053 | 3300049571 | Bacteria | 206821 |
| 363 | Ga0501034_0000408 | 3300049571 | Bacteria | 72244 |
| 364 | Ga0501034_0043595 | 3300049571 | Bacteria | 4539 |
| 365 | Ga0501034_0164311 | 3300049571 | Bacteria | 2189 |
| 366 | Ga0501034_0465523 | 3300049571 | Bacteria | 1180 |
| 367 | Ga0501036_0000009 | 3300049572 | Bacteria | 206821 |
| 368 | Ga0501036_0001942 | 3300049572 | Bacteria | 16039 |
| 369 | Ga0501036_0073396 | 3300049572 | Bacteria | 2893 |
| 370 | Ga0501036_0369304 | 3300049572 | Bacteria | 1197 |
| 371 | Ga0501036_0449501 | 3300049572 | Bacteria | 1073 |
| 372 | Ga0501037_0000008 | 3300049573 | Bacteria | 206812 |
| 373 | Ga0501037_0000308 | 3300049573 | Bacteria | 41514 |
| 374 | Ga0501037_0000533 | 3300049573 | Bacteria | 30360 |
| 375 | Ga0501037_0047422 | 3300049573 | Bacteria | 3148 |
| 376 | Ga0501037_0156831 | 3300049573 | Bacteria | 1624 |
| 377 | Ga0501037_0252976 | 3300049573 | Bacteria | 1232 |
| 378 | Ga0501037_0263556 | 3300049573 | Bacteria | 1204 |
| 379 | Ga0501038_0000008 | 3300049574 | Bacteria | 206821 |
| 380 | Ga0501038_0000241 | 3300049574 | Bacteria | 46177 |
| 381 | Ga0501038_0110679 | 3300049574 | Bacteria | 2275 |
| 382 | Ga0501038_0327317 | 3300049574 | Bacteria | 1197 |
| 383 | Ga0501038_0465463 | 3300049574 | Bacteria | 971 |
| 384 | Ga0501039_0000021 | 3300049575 | Bacteria | 162552 |
| 385 | Ga0501039_0000196 | 3300049575 | Bacteria | 43498 |
| 386 | Ga0501039_0010706 | 3300049575 | Bacteria | 6986 |
| 387 | Ga0501039_0435611 | 3300049575 | Bacteria | 1029 |
| 388 | Ga0501040_0001596 | 3300049576 | Bacteria | 14448 |
| 389 | Ga0501040_0096527 | 3300049576 | Bacteria | 2058 |
| 390 | Ga0501042_0106048 | 3300049578 | Bacteria | 2022 |
| 391 | Ga0501043_0000005 | 3300049579 | Bacteria | 254466 |
| 392 | Ga0501043_0000043 | 3300049579 | Bacteria | 115410 |
| 393 | Ga0501043_0001135 | 3300049579 | Bacteria | 23377 |
| 394 | Ga0501043_0039716 | 3300049579 | Bacteria | 3699 |
| 395 | Ga0501043_0088873 | 3300049579 | Bacteria | 2428 |
| 396 | Ga0501043_0266271 | 3300049579 | Bacteria | 1316 |
| 397 | Ga0501046_0053761 | 3300049580 | Bacteria | 3170 |
| 398 | Ga0501046_0119833 | 3300049580 | Bacteria | 2003 |
| 399 | Ga0501046_0308926 | 3300049580 | Bacteria | 1153 |
| 400 | Ga0501047_0000126 | 3300049581 | Bacteria | 93841 |
| 401 | Ga0501047_0094812 | 3300049581 | Bacteria | 2863 |
| 402 | Ga0501047_0169348 | 3300049581 | Bacteria | 2053 |
| 403 | Ga0501047_0397490 | 3300049581 | Bacteria | 1211 |
| 404 | Ga0501047_0419612 | 3300049581 | Bacteria | 1169 |
| 405 | Ga0501047_0466447 | 3300049581 | Bacteria | 1091 |
| 406 | Ga0501048_0004705 | 3300049582 | Bacteria | 10392 |
| 407 | Ga0501067_0142045 | 3300049583 | Bacteria | 1337 |
| 408 | Ga0501068_0122751 | 3300049584 | Bacteria | 1621 |
| 409 | Ga0501068_0179028 | 3300049584 | Bacteria | 1340 |
| 410 | Ga0501069_0000011 | 3300049585 | Bacteria | 153214 |
| 411 | Ga0501069_0203562 | 3300049585 | Bacteria | 1147 |
| 412 | Ga0501069_0280354 | 3300049585 | Bacteria | 975 |
| 413 | Ga0501070_0000117 | 3300049586 | Bacteria | 70793 |
| 414 | Ga0501070_0000257 | 3300049586 | Bacteria | 50142 |
| 415 | Ga0501070_0010854 | 3300049586 | Bacteria | 7694 |
| 416 | Ga0501070_0021633 | 3300049586 | Bacteria | 5394 |
| 417 | Ga0501070_0024616 | 3300049586 | Bacteria | 5047 |
| 418 | Ga0501070_0043444 | 3300049586 | Bacteria | 3739 |
| 419 | Ga0501071_0072949 | 3300049587 | Bacteria | 2503 |
| 420 | Ga0501073_0052547 | 3300049589 | Bacteria | 2853 |
| 421 | Ga0501073_0084610 | 3300049589 | Bacteria | 2207 |
| 422 | Ga0501073_0277058 | 3300049589 | Bacteria | 1157 |
| 423 | Ga0501074_0038414 | 3300049590 | Bacteria | 3469 |
| 424 | Ga0501074_0050119 | 3300049590 | Bacteria | 3014 |
| 425 | Ga0501074_0188929 | 3300049590 | Bacteria | 1469 |
| 426 | Ga0501080_0016949 | 3300049742 | Bacteria | 6727 |
| 427 | Ga0501080_0039435 | 3300049742 | Bacteria | 4408 |
| 428 | Ga0501080_0150872 | 3300049742 | Bacteria | 2148 |
| 429 | Ga0501083_0000831 | 3300049744 | Bacteria | 20279 |
| 430 | Ga0501083_0040937 | 3300049744 | Bacteria | 3144 |
| 431 | Ga0501083_0283738 | 3300049744 | Bacteria | 1077 |
| 432 | Ga0501035_0000023 | 3300049822 | Bacteria | 206821 |
| 433 | Ga0501035_0000107 | 3300049822 | Bacteria | 103130 |
| 434 | Ga0501035_0000449 | 3300049822 | Bacteria | 46083 |
| 435 | Ga0501035_0001314 | 3300049822 | Bacteria | 25674 |
| 436 | Ga0501035_0002296 | 3300049822 | Bacteria | 18885 |
| 437 | Ga0501035_0022408 | 3300049822 | Bacteria | 5800 |
| 438 | Ga0501035_0044299 | 3300049822 | Bacteria | 4007 |
| 439 | Ga0501035_0051590 | 3300049822 | Bacteria | 3682 |
| 440 | Ga0501035_0074842 | 3300049822 | Bacteria | 2995 |
| 441 | Ga0501035_0120322 | 3300049822 | Bacteria | 2296 |
| 442 | Ga0501035_0283448 | 3300049822 | Bacteria | 1400 |
| 443 | Ga0501035_0369481 | 3300049822 | Bacteria | 1197 |
| 444 | Ga0501035_0444308 | 3300049822 | Bacteria | 1073 |
| 445 | Ga0501035_0714358 | 3300049822 | Bacteria | 807 |
| 446 | Ga0501044_0000021 | 3300049823 | Bacteria | 206821 |
| 447 | Ga0501044_0000154 | 3300049823 | Bacteria | 85407 |
| 448 | Ga0501044_0003690 | 3300049823 | Bacteria | 17210 |
| 449 | Ga0501044_0082812 | 3300049823 | Bacteria | 3245 |
| 450 | Ga0501044_0098865 | 3300049823 | Bacteria | 2937 |
| 451 | Ga0501044_0192944 | 3300049823 | Bacteria | 1998 |
| 452 | Ga0501044_0227015 | 3300049823 | Bacteria | 1816 |
| 453 | Ga0501044_0448222 | 3300049823 | Bacteria | 1197 |
| 454 | Ga0501044_0532370 | 3300049823 | Bacteria | 1073 |
| 455 | Ga0501045_0027060 | 3300049824 | Bacteria | 4129 |
| 456 | nmdc:mga00v17_4902_c1 | 3300050491 | Bacteria | 7015 |
| 457 | nmdc:mga00v17_72_c1 | 3300050491 | Bacteria | 60922 |
| 458 | nmdc:mga0yw44_109848_c1 | 3300050492 | Bacteria | 1766 |
| 459 | nmdc:mga0yw44_35604_c1 | 3300050492 | Bacteria | 2926 |
| 460 | nmdc:mga0yw44_41265_c1 | 3300050492 | Bacteria | 2747 |
| 461 | nmdc:mga0k408_150279_c1 | 3300050493 | Bacteria | 1387 |
| 462 | nmdc:mga06z11_104763_c1 | 3300050494 | Bacteria | 1558 |
| 463 | nmdc:mga06z11_166055_c1 | 3300050494 | Bacteria | 1264 |
| 464 | nmdc:mga04h51_1892_c1 | 3300050495 | Bacteria | 4885 |
| 465 | nmdc:mga07m45_113552_c1 | 3300050496 | Bacteria | 1561 |
| 466 | nmdc:mga07m45_162572_c1 | 3300050496 | Bacteria | 1296 |
| 467 | nmdc:mga0sz30_168461_c1 | 3300050516 | Bacteria | 971 |
| 468 | nmdc:mga0sz30_82783_c1 | 3300050516 | Bacteria | 1390 |
| 469 | Ga0500644_0045322 | 3300053088 | Bacteria | 1481 |
| 470 | Ga0500644_0084213 | 3300053088 | Bacteria | 1176 |
| 471 | Ga0500651_0015578 | 3300053093 | Bacteria | 4667 |
| 472 | Ga0500560_026381 | 3300053107 | Bacteria | 1715 |
| 473 | Ga0500560_103419 | 3300053107 | Bacteria | 954 |
| 474 | Ga0500562_073957 | 3300053108 | Bacteria | 920 |
| 475 | Ga0500572_002397 | 3300053111 | Bacteria | 4521 |
| 476 | Ga0500594_0113537 | 3300053118 | Bacteria | 845 |
| 477 | Ga0500618_024101 | 3300053125 | Bacteria | 1467 |
| 478 | Ga0500642_0252219 | 3300053130 | Bacteria | 810 |
| 479 | Ga0500658_0005820 | 3300053134 | Bacteria | 4591 |
| 480 | Ga0500658_0097498 | 3300053134 | Bacteria | 1279 |
| 481 | Ga0500659_0159517 | 3300053135 | Bacteria | 1117 |
| 482 | Ga0500568_0027275 | 3300053139 | Bacteria | 2390 |
| 483 | Ga0500568_0090338 | 3300053139 | Bacteria | 1155 |
| 484 | Ga0500573_0002214 | 3300053140 | Bacteria | 9624 |
| 485 | Ga0500573_0112053 | 3300053140 | Bacteria | 1525 |
| 486 | Ga0500604_0059210 | 3300053151 | Bacteria | 1199 |
| 487 | Ga0500616_0000817 | 3300053153 | Bacteria | 35314 |
| 488 | Ga0500616_0091130 | 3300053153 | Bacteria | 1509 |
| 489 | Ga0500622_0000391 | 3300053156 | Bacteria | 42302 |
| 490 | Ga0500622_0086810 | 3300053156 | Bacteria | 1558 |
| 491 | Ga0500624_001342 | 3300053157 | Bacteria | 4168 |
| 492 | Ga0500627_0189577 | 3300053158 | Bacteria | 924 |
| 493 | Ga0500633_0076466 | 3300053160 | Bacteria | 1204 |
| 494 | Ga0500634_0074801 | 3300053161 | Bacteria | 1763 |
| 495 | Ga0500636_0000010 | 3300053177 | Bacteria | 145932 |
| 496 | Ga0500636_0006722 | 3300053177 | Bacteria | 6617 |
| 497 | Ga0501082_0093908 | 3300060353 | Bacteria | 2592 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2924776078 | 2924781660 | 186 |
| 2 | 3300049568 | Ga0501031_0010940 | Ga0501031_0010940_5310_5885 | 189 |
| 3 | 3300049575 | Ga0501039_0435611 | Ga0501039_0435611_26_601 | 189 |
| 4 | 3300048920 | Ga0496117_0117248 | Ga0496117_0117248_143_790 | 192 |
| 5 | 3300032004 | Ga0307414_10011355 | Ga0307414_100113552 | 193 |
| 6 | 3300048917 | Ga0496114_0011920 | Ga0496114_0011920_3046_3759 | 193 |
| 7 | 3300049822 | Ga0501035_0714358 | Ga0501035_0714358_61_696 | 193 |
| 8 | 3300031665 | Ga0316575_10021494 | Ga0316575_100214942 | 198 |
| 9 | 3300002773 | JGI25152J39213_1007261 | JGI25152J39213_10072612 | 199 |
| 10 | 3300003187 | JGI25151J46595_10047816 | JGI25151J46595_100478162 | 199 |
| 11 | 3300003316 | rootH1_10167985 | rootH1_101679852 | 199 |
| 12 | 3300005262 | Ga0065165_1068442 | Ga0065165_10684422 | 199 |
| 13 | 3300025245 | Ga0207425_1007794 | Ga0207425_10077942 | 199 |
| 14 | 3300025258 | Ga0209129_1000123 | Ga0209129_100012335 | 199 |
| 15 | 3300025303 | Ga0209051_1031902 | Ga0209051_10319022 | 199 |
| 16 | 3300041413 | Ga0439465_0021834 | Ga0439465_0021834_648_1361 | 200 |
| 17 | iso_pu_bacteria | 2547132103 | 2547372860 | 201 |
| 18 | iso_pu_bacteria | 2843690924 | 2843695746 | 201 |
| 19 | 3300005548 | Ga0070665_100536846 | Ga0070665_1005368461 | 202 |
| 20 | 3300009036 | Ga0105244_10081231 | Ga0105244_100812312 | 202 |
| 21 | 3300025284 | Ga0209130_1008937 | Ga0209130_10089372 | 202 |
| 22 | 3300046507 | Ga0495606_0001322 | Ga0495606_0001322_27419_28156 | 202 |
| 23 | 3300048909 | Ga0496106_0251774 | Ga0496106_0251774_384_1082 | 202 |
| 24 | 3300048920 | Ga0496117_0116758 | Ga0496117_0116758_673_1371 | 202 |
| 25 | 3300048924 | Ga0496121_0136052 | Ga0496121_0136052_832_1530 | 202 |
| 26 | 3300048924 | Ga0496121_0176353 | Ga0496121_0176353_353_1090 | 202 |
| 27 | 3300049568 | Ga0501031_0012255 | Ga0501031_0012255_1908_2597 | 202 |
| 28 | 3300049569 | Ga0501032_0000234 | Ga0501032_0000234_11101_11790 | 202 |
| 29 | 3300049570 | Ga0501033_0000076 | Ga0501033_0000076_45970_46659 | 202 |
| 30 | 3300049571 | Ga0501034_0000408 | Ga0501034_0000408_63758_64447 | 202 |
| 31 | 3300049572 | Ga0501036_0001942 | Ga0501036_0001942_3700_4389 | 202 |
| 32 | 3300049573 | Ga0501037_0000533 | Ga0501037_0000533_3614_4303 | 202 |
| 33 | 3300049574 | Ga0501038_0000241 | Ga0501038_0000241_34381_35070 | 202 |
| 34 | 3300049575 | Ga0501039_0000196 | Ga0501039_0000196_34529_35218 | 202 |
| 35 | 3300049579 | Ga0501043_0000043 | Ga0501043_0000043_50693_51382 | 202 |
| 36 | 3300049580 | Ga0501046_0053761 | Ga0501046_0053761_2120_2809 | 202 |
| 37 | 3300049822 | Ga0501035_0000449 | Ga0501035_0000449_34414_35103 | 202 |
| 38 | 3300049823 | Ga0501044_0003690 | Ga0501044_0003690_12975_13664 | 202 |
| 39 | 3300003771 | Ga0055526_1015836 | Ga0055526_10158362 | 203 |
| 40 | 3300003775 | Ga0055524_1008508 | Ga0055524_10085082 | 203 |
| 41 | 3300003790 | Ga0055528_1000303 | Ga0055528_10003037 | 203 |
| 42 | 3300025273 | Ga0209673_1000015 | Ga0209673_1000015379 | 203 |
| 43 | 3300025292 | Ga0209676_1015253 | Ga0209676_10152532 | 203 |
| 44 | 3300025294 | Ga0209025_1016350 | Ga0209025_10163503 | 203 |
| 45 | 3300025295 | Ga0209564_1006978 | Ga0209564_10069783 | 203 |
| 46 | 3300025299 | Ga0209256_1000991 | Ga0209256_10009913 | 203 |
| 47 | 3300010375 | Ga0105239_10001623 | Ga0105239_100016239 | 204 |
| 48 | 3300015265 | Ga0182005_1022742 | Ga0182005_10227422 | 204 |
| 49 | 3300048922 | Ga0496119_0147606 | Ga0496119_0147606_285_971 | 204 |
| 50 | 3300048924 | Ga0496121_0006792 | Ga0496121_0006792_350_1036 | 204 |
| 51 | 3300048927 | Ga0496124_0004315 | Ga0496124_0004315_15632_16318 | 204 |
| 52 | 3300049568 | Ga0501031_0283955 | Ga0501031_0283955_319_1017 | 204 |
| 53 | 3300049569 | Ga0501032_0137564 | Ga0501032_0137564_855_1553 | 204 |
| 54 | 3300049570 | Ga0501033_0328447 | Ga0501033_0328447_57_755 | 204 |
| 55 | 3300049571 | Ga0501034_0043595 | Ga0501034_0043595_2174_2872 | 204 |
| 56 | 3300049571 | Ga0501034_0465523 | Ga0501034_0465523_40_738 | 204 |
| 57 | 3300049572 | Ga0501036_0369304 | Ga0501036_0369304_443_1141 | 204 |
| 58 | 3300049572 | Ga0501036_0449501 | Ga0501036_0449501_319_1017 | 204 |
| 59 | 3300049573 | Ga0501037_0047422 | Ga0501037_0047422_1016_1714 | 204 |
| 60 | 3300049573 | Ga0501037_0252976 | Ga0501037_0252976_419_1117 | 204 |
| 61 | 3300049574 | Ga0501038_0110679 | Ga0501038_0110679_57_755 | 204 |
| 62 | 3300049574 | Ga0501038_0327317 | Ga0501038_0327317_443_1141 | 204 |
| 63 | 3300049574 | Ga0501038_0465463 | Ga0501038_0465463_108_821 | 204 |
| 64 | 3300049575 | Ga0501039_0010706 | Ga0501039_0010706_2020_2718 | 204 |
| 65 | 3300049576 | Ga0501040_0096527 | Ga0501040_0096527_1257_1955 | 204 |
| 66 | 3300049578 | Ga0501042_0106048 | Ga0501042_0106048_914_1612 | 204 |
| 67 | 3300049579 | Ga0501043_0266271 | Ga0501043_0266271_562_1260 | 204 |
| 68 | 3300049580 | Ga0501046_0308926 | Ga0501046_0308926_408_1106 | 204 |
| 69 | 3300049581 | Ga0501047_0397490 | Ga0501047_0397490_373_1086 | 204 |
| 70 | 3300049581 | Ga0501047_0419612 | Ga0501047_0419612_57_755 | 204 |
| 71 | 3300049582 | Ga0501048_0004705 | Ga0501048_0004705_5152_5850 | 204 |
| 72 | 3300049583 | Ga0501067_0142045 | Ga0501067_0142045_390_1088 | 204 |
| 73 | 3300049586 | Ga0501070_0010854 | Ga0501070_0010854_4823_5521 | 204 |
| 74 | 3300049590 | Ga0501074_0050119 | Ga0501074_0050119_1386_2084 | 204 |
| 75 | 3300049744 | Ga0501083_0040937 | Ga0501083_0040937_108_806 | 204 |
| 76 | 3300049822 | Ga0501035_0044299 | Ga0501035_0044299_137_850 | 204 |
| 77 | 3300049822 | Ga0501035_0369481 | Ga0501035_0369481_57_755 | 204 |
| 78 | 3300049822 | Ga0501035_0444308 | Ga0501035_0444308_319_1017 | 204 |
| 79 | 3300049823 | Ga0501044_0448222 | Ga0501044_0448222_57_755 | 204 |
| 80 | 3300049823 | Ga0501044_0532370 | Ga0501044_0532370_319_1017 | 204 |
| 81 | 3300049824 | Ga0501045_0027060 | Ga0501045_0027060_2863_3561 | 204 |
| 82 | iso_pu_bacteria | 2915980308 | 2915980769 | 204 |
| 83 | iso_pu_bacteria | 2916061851 | 2916063664 | 204 |
| 84 | iso_pu_bacteria | 2921250672 | 2921257173 | 204 |
| 85 | 3300002739 | JGI25158J39367_1000254 | JGI25158J39367_10002548 | 205 |
| 86 | 3300002773 | JGI25152J39213_1006415 | JGI25152J39213_10064152 | 205 |
| 87 | 3300002987 | JGI25159J45721_1002669 | JGI25159J45721_10026692 | 205 |
| 88 | 3300003215 | JGI25153J46596_10003997 | JGI25153J46596_100039972 | 205 |
| 89 | 3300003323 | rootH1_10046242 | rootH1_100462422 | 205 |
| 90 | 3300003354 | JGI25160J50197_1003907 | JGI25160J50197_10039073 | 205 |
| 91 | 3300003374 | JGI25161J50226_1000074 | JGI25161J50226_10000748 | 205 |
| 92 | 3300003374 | JGI25161J50226_1000382 | JGI25161J50226_10003822 | 205 |
| 93 | 3300003771 | Ga0055526_1002431 | Ga0055526_10024317 | 205 |
| 94 | 3300003775 | Ga0055524_1002633 | Ga0055524_10026336 | 205 |
| 95 | 3300003790 | Ga0055528_1001497 | Ga0055528_10014974 | 205 |
| 96 | 3300003792 | Ga0055540_1001471 | Ga0055540_100147110 | 205 |
| 97 | 3300004625 | Ga0055543_1000141 | Ga0055543_100014121 | 205 |
| 98 | 3300005262 | Ga0065165_1011908 | Ga0065165_10119083 | 205 |
| 99 | 3300005347 | Ga0070668_100373549 | Ga0070668_1003735491 | 205 |
| 100 | 3300006353 | Ga0075370_10086455 | Ga0075370_100864552 | 205 |
| 101 | 3300009551 | Ga0105238_10300955 | Ga0105238_103009552 | 205 |
| 102 | 3300025208 | Ga0209436_100051 | Ga0209436_1000514 | 205 |
| 103 | 3300025258 | Ga0209129_1000545 | Ga0209129_10005455 | 205 |
| 104 | 3300025273 | Ga0209673_1003246 | Ga0209673_10032462 | 205 |
| 105 | 3300025284 | Ga0209130_1000002 | Ga0209130_100000274 | 205 |
| 106 | 3300025295 | Ga0209564_1001938 | Ga0209564_10019384 | 205 |
| 107 | 3300025297 | Ga0209758_1001048 | Ga0209758_10010483 | 205 |
| 108 | 3300025299 | Ga0209256_1003297 | Ga0209256_10032973 | 205 |
| 109 | 3300025302 | Ga0207426_1000013 | Ga0207426_100001374 | 205 |
| 110 | 3300025302 | Ga0207426_1000172 | Ga0207426_100017294 | 205 |
| 111 | 3300025303 | Ga0209051_1005782 | Ga0209051_10057824 | 205 |
| 112 | 3300025304 | Ga0209257_1027231 | Ga0209257_10272312 | 205 |
| 113 | 3300031456 | Ga0307513_10118868 | Ga0307513_101188682 | 205 |
| 114 | 3300041413 | Ga0439465_0016858 | Ga0439465_0016858_1368_2066 | 205 |
| 115 | 3300041413 | Ga0439465_0033354 | Ga0439465_0033354_610_1314 | 205 |
| 116 | 3300042438 | Ga0439459_0031337 | Ga0439459_0031337_311_1009 | 205 |
| 117 | 3300046694 | Ga0495649_0000165 | Ga0495649_0000165_30596_31300 | 205 |
| 118 | 3300048909 | Ga0496106_0017594 | Ga0496106_0017594_4155_4853 | 205 |
| 119 | 3300049570 | Ga0501033_0012742 | Ga0501033_0012742_4919_5638 | 205 |
| 120 | 3300049580 | Ga0501046_0119833 | Ga0501046_0119833_593_1312 | 205 |
| 121 | 3300050496 | nmdc:mga07m45_162572_c1 | nmdc:mga07m45_162572_c1_289_987 | 205 |
| 122 | 3300053088 | Ga0500644_0084213 | Ga0500644_0084213_304_1002 | 205 |
| 123 | 3300053139 | Ga0500568_0027275 | Ga0500568_0027275_686_1384 | 205 |
| 124 | 3300053151 | Ga0500604_0059210 | Ga0500604_0059210_78_776 | 205 |
| 125 | 3300053160 | Ga0500633_0076466 | Ga0500633_0076466_126_824 | 205 |
| 126 | iso_pu_bacteria | 2765235802 | 2765464303 | 205 |
| 127 | iso_pu_bacteria | 2850079185 | 2850079962 | 205 |
| 128 | iso_pu_bacteria | 2855825444 | 2855831760 | 205 |
| 129 | iso_pu_bacteria | 2855839649 | 2855839981 | 205 |
| 130 | iso_pu_bacteria | 2858800743 | 2858803955 | 205 |
| 131 | iso_pu_bacteria | 2915986958 | 2915992642 | 205 |
| 132 | iso_pu_bacteria | 2915993759 | 2915999702 | 205 |
| 133 | iso_pu_bacteria | 2916000859 | 2916002014 | 205 |
| 134 | iso_pu_bacteria | 2916014648 | 2916015417 | 205 |
| 135 | iso_pu_bacteria | 2916021584 | 2916022522 | 205 |
| 136 | iso_pu_bacteria | 2916028427 | 2916033338 | 205 |
| 137 | iso_pu_bacteria | 2916035215 | 2916038826 | 205 |
| 138 | iso_pu_bacteria | 2916041962 | 2916042768 | 205 |
| 139 | iso_pu_bacteria | 2916048683 | 2916050226 | 205 |
| 140 | iso_pu_bacteria | 2916055098 | 2916057693 | 205 |
| 141 | iso_pu_bacteria | 2916068649 | 2916071928 | 205 |
| 142 | iso_pu_bacteria | 2916076590 | 2916081867 | 205 |
| 143 | iso_pu_bacteria | 2921201388 | 2921207924 | 205 |
| 144 | iso_pu_bacteria | 2921208531 | 2921209377 | 205 |
| 145 | iso_pu_bacteria | 2921237296 | 2921238992 | 205 |
| 146 | iso_pu_bacteria | 2921244191 | 2921245216 | 205 |
| 147 | iso_pu_bacteria | 2921257292 | 2921260362 | 205 |
| 148 | iso_pu_bacteria | 2921263974 | 2921266463 | 205 |
| 149 | iso_pu_bacteria | 2921282425 | 2921287577 | 205 |
| 150 | iso_pu_bacteria | 2921289301 | 2921291966 | 205 |
| 151 | iso_pu_bacteria | 2921296804 | 2921301756 | 205 |
| 152 | iso_pu_bacteria | 2924144063 | 2924146036 | 205 |
| 153 | iso_pu_bacteria | 2924150972 | 2924154419 | 205 |
| 154 | iso_pu_bacteria | 2924158325 | 2924163479 | 205 |
| 155 | iso_pu_bacteria | 2924165586 | 2924167067 | 205 |
| 156 | iso_pu_bacteria | 2924172951 | 2924174639 | 205 |
| 157 | iso_pu_bacteria | 2924179722 | 2924180878 | 205 |
| 158 | iso_pu_bacteria | 2924186466 | 2924191792 | 205 |
| 159 | iso_pu_bacteria | 2924193448 | 2924194307 | 205 |
| 160 | iso_pu_bacteria | 2924200457 | 2924202422 | 205 |
| 161 | iso_pu_bacteria | 2924207177 | 2924209654 | 205 |
| 162 | iso_pu_bacteria | 2924214083 | 2924214550 | 205 |
| 163 | iso_pu_bacteria | 2924221636 | 2924224297 | 205 |
| 164 | iso_pu_bacteria | 2924228884 | 2924232979 | 205 |
| 165 | 3300005262 | Ga0065165_1013652 | Ga0065165_10136523 | 206 |
| 166 | 3300021321 | Ga0214542_1000011 | Ga0214542_1000011125 | 206 |
| 167 | 3300021327 | Ga0214543_1000004 | Ga0214543_1000004375 | 206 |
| 168 | 3300025972 | Ga0207668_10596720 | Ga0207668_105967202 | 206 |
| 169 | 3300048927 | Ga0496124_0214194 | Ga0496124_0214194_381_1094 | 206 |
| 170 | 3300049822 | Ga0501035_0283448 | Ga0501035_0283448_199_897 | 206 |
| 171 | 3300002737 | JGI25162J39368_1002348 | JGI25162J39368_10023482 | 207 |
| 172 | 3300003214 | JGI25165J46597_1000529 | JGI25165J46597_10005292 | 207 |
| 173 | 3300003316 | rootH1_10041182 | rootH1_100411822 | 207 |
| 174 | 3300003320 | rootH2_10053655 | rootH2_100536552 | 207 |
| 175 | 3300003322 | rootL2_10099180 | rootL2_100991802 | 207 |
| 176 | 3300005456 | Ga0070678_100782328 | Ga0070678_1007823281 | 207 |
| 177 | 3300013306 | Ga0163162_11141173 | Ga0163162_111411731 | 207 |
| 178 | 3300025273 | Ga0209673_1000967 | Ga0209673_100096726 | 207 |
| 179 | 3300025295 | Ga0209564_1000382 | Ga0209564_100038253 | 207 |
| 180 | 3300025299 | Ga0209256_1000874 | Ga0209256_10008747 | 207 |
| 181 | 3300046492 | Ga0495585_0053852 | Ga0495585_0053852_206_904 | 207 |
| 182 | 3300046507 | Ga0495606_0053292 | Ga0495606_0053292_1306_2004 | 207 |
| 183 | 3300046512 | Ga0495610_0123856 | Ga0495610_0123856_67_765 | 207 |
| 184 | 3300046515 | Ga0495620_0101656 | Ga0495620_0101656_81_779 | 207 |
| 185 | 3300046522 | Ga0495643_0036445 | Ga0495643_0036445_1230_1928 | 207 |
| 186 | 3300046616 | Ga0495668_0044767 | Ga0495668_0044767_56_754 | 207 |
| 187 | 3300046648 | Ga0495611_0190828 | Ga0495611_0190828_205_903 | 207 |
| 188 | 3300046660 | Ga0495625_0110963 | Ga0495625_0110963_290_988 | 207 |
| 189 | 3300046660 | Ga0495625_0268577 | Ga0495625_0268577_325_1023 | 207 |
| 190 | 3300046692 | Ga0495671_0078267 | Ga0495671_0078267_562_1260 | 207 |
| 191 | 3300046810 | Ga0495660_0037091 | Ga0495660_0037091_1673_2371 | 207 |
| 192 | 3300047323 | Ga0495683_0152950 | Ga0495683_0152950_275_973 | 207 |
| 193 | 3300047443 | Ga0495687_059685 | Ga0495687_059685_223_921 | 207 |
| 194 | 3300047472 | Ga0495686_0082371 | Ga0495686_0082371_509_1207 | 207 |
| 195 | 3300049459 | Ga0495678_043266 | Ga0495678_043266_847_1545 | 207 |
| 196 | 3300053118 | Ga0500594_0113537 | Ga0500594_0113537_80_778 | 207 |
| 197 | 3300053134 | Ga0500658_0005820 | Ga0500658_0005820_3596_4294 | 207 |
| 198 | 3300053135 | Ga0500659_0159517 | Ga0500659_0159517_324_1022 | 207 |
| 199 | 3300053153 | Ga0500616_0091130 | Ga0500616_0091130_197_895 | 207 |
| 200 | 3300005367 | Ga0070667_100169152 | Ga0070667_1001691522 | 208 |
| 201 | 3300006048 | Ga0075363_100085615 | Ga0075363_1000856152 | 208 |
| 202 | 3300009765 | Ga0123341_1000192 | Ga0123341_100019226 | 208 |
| 203 | 3300009766 | Ga0123342_1013143 | Ga0123342_10131438 | 208 |
| 204 | 3300021320 | Ga0214544_1000012 | Ga0214544_1000012131 | 208 |
| 205 | 3300025254 | Ga0209148_1004207 | Ga0209148_10042072 | 208 |
| 206 | 3300025914 | Ga0207671_10000275 | Ga0207671_1000027530 | 208 |
| 207 | 3300025986 | Ga0207658_10022653 | Ga0207658_100226532 | 208 |
| 208 | 3300041441 | Ga0451787_595301 | Ga0451787_595301_335_1033 | 208 |
| 209 | 3300041451 | Ga0451791_1542001 | Ga0451791_1542001_323_1021 | 208 |
| 210 | 3300041458 | Ga0451798_0298663 | Ga0451798_0298663_912_1610 | 208 |
| 211 | 3300041498 | Ga0451841_0033924 | Ga0451841_0033924_284_982 | 208 |
| 212 | 3300041507 | Ga0451851_0667480 | Ga0451851_0667480_2136_2834 | 208 |
| 213 | 3300046460 | Ga0495638_0192024 | Ga0495638_0192024_432_1145 | 208 |
| 214 | 3300046513 | Ga0495616_0163119 | Ga0495616_0163119_70_768 | 208 |
| 215 | 3300046524 | Ga0495648_0095626 | Ga0495648_0095626_876_1574 | 208 |
| 216 | 3300046542 | Ga0495597_0100895 | Ga0495597_0100895_245_943 | 208 |
| 217 | 3300053093 | Ga0500651_0015578 | Ga0500651_0015578_2645_3358 | 208 |
| 218 | 3300053111 | Ga0500572_002397 | Ga0500572_002397_3027_3731 | 208 |
| 219 | 3300053134 | Ga0500658_0097498 | Ga0500658_0097498_235_933 | 208 |
| 220 | 3300053140 | Ga0500573_0002214 | Ga0500573_0002214_6168_6881 | 208 |
| 221 | 3300053177 | Ga0500636_0006722 | Ga0500636_0006722_5885_6589 | 208 |
| 222 | iso_pu_bacteria | 2513237089 | 2513602909 | 208 |
| 223 | iso_pu_bacteria | 2517487022 | 2517568639 | 208 |
| 224 | iso_pu_bacteria | 2802428859 | 2802726148 | 208 |
| 225 | iso_pu_bacteria | 2802428860 | 2802731688 | 208 |
| 226 | iso_pu_bacteria | 2802428861 | 2802739439 | 208 |
| 227 | iso_pu_bacteria | 2913295892 | 2913298006 | 208 |
| 228 | iso_pu_bacteria | 2937029754 | 2937034543 | 208 |
| 229 | iso_pu_bacteria | 2937078374 | 2937078755 | 208 |
| 230 | iso_pu_bacteria | 2957375807 | 2957382071 | 208 |
| 231 | iso_pu_bacteria | 2960631154 | 2960637471 | 208 |
| 232 | iso_pu_bacteria | 2960680706 | 2960686597 | 208 |
| 233 | iso_pu_bacteria | 2960693952 | 2960698838 | 208 |
| 234 | iso_pu_bacteria | 2967686174 | 2967691511 | 208 |
| 235 | iso_pu_bacteria | 2977544691 | 2977549479 | 208 |
| 236 | 3300002987 | JGI25159J45721_1000087 | JGI25159J45721_10000876 | 209 |
| 237 | 3300003354 | JGI25160J50197_1000046 | JGI25160J50197_1000046124 | 209 |
| 238 | 3300003374 | JGI25161J50226_1000031 | JGI25161J50226_1000031124 | 209 |
| 239 | 3300003792 | Ga0055540_1000471 | Ga0055540_10004716 | 209 |
| 240 | 3300004625 | Ga0055543_1000008 | Ga0055543_1000008124 | 209 |
| 241 | 3300005262 | Ga0065165_1000031 | Ga0065165_10000315 | 209 |
| 242 | 3300006186 | Ga0075369_10074301 | Ga0075369_100743012 | 209 |
| 243 | 3300009093 | Ga0105240_10000278 | Ga0105240_1000027812 | 209 |
| 244 | 3300009545 | Ga0105237_10003138 | Ga0105237_100031382 | 209 |
| 245 | 3300013104 | Ga0157370_10002372 | Ga0157370_100023723 | 209 |
| 246 | 3300015262 | Ga0182007_10045652 | Ga0182007_100456522 | 209 |
| 247 | 3300025273 | Ga0209673_1001074 | Ga0209673_10010742 | 209 |
| 248 | 3300025284 | Ga0209130_1000088 | Ga0209130_100008870 | 209 |
| 249 | 3300025298 | Ga0209050_1005205 | Ga0209050_10052054 | 209 |
| 250 | 3300025302 | Ga0207426_1000012 | Ga0207426_1000012125 | 209 |
| 251 | 3300025303 | Ga0209051_1000084 | Ga0209051_1000084153 | 209 |
| 252 | 3300025304 | Ga0209257_1010896 | Ga0209257_10108962 | 209 |
| 253 | 3300044901 | Ga0466960_0014783 | Ga0466960_0014783_1260_1958 | 209 |
| 254 | 3300046476 | Ga0495662_0018301 | Ga0495662_0018301_1378_2064 | 209 |
| 255 | 3300046683 | Ga0495658_0119475 | Ga0495658_0119475_702_1388 | 209 |
| 256 | 3300046690 | Ga0495624_0283059 | Ga0495624_0283059_276_962 | 209 |
| 257 | 3300048919 | Ga0496116_0031077 | Ga0496116_0031077_554_1240 | 209 |
| 258 | 3300048919 | Ga0496116_0143485 | Ga0496116_0143485_25_723 | 209 |
| 259 | 3300048919 | Ga0496116_0205731 | Ga0496116_0205731_107_805 | 209 |
| 260 | 3300048920 | Ga0496117_0002570 | Ga0496117_0002570_21568_22254 | 209 |
| 261 | 3300048921 | Ga0496118_0004324 | Ga0496118_0004324_475_1161 | 209 |
| 262 | 3300048921 | Ga0496118_0189347 | Ga0496118_0189347_80_778 | 209 |
| 263 | 3300048923 | Ga0496120_0006881 | Ga0496120_0006881_7556_8242 | 209 |
| 264 | 3300048923 | Ga0496120_0038167 | Ga0496120_0038167_1777_2475 | 209 |
| 265 | 3300048925 | Ga0496122_0001050 | Ga0496122_0001050_1613_2311 | 209 |
| 266 | 3300048926 | Ga0496123_0000158 | Ga0496123_0000158_46031_46729 | 209 |
| 267 | 3300048926 | Ga0496123_0133630 | Ga0496123_0133630_198_884 | 209 |
| 268 | 3300048928 | Ga0496125_0204495 | Ga0496125_0204495_462_1148 | 209 |
| 269 | 3300049568 | Ga0501031_0000003 | Ga0501031_0000003_93121_93819 | 209 |
| 270 | 3300049569 | Ga0501032_0000010 | Ga0501032_0000010_93121_93819 | 209 |
| 271 | 3300049570 | Ga0501033_0000017 | Ga0501033_0000017_93121_93819 | 209 |
| 272 | 3300049571 | Ga0501034_0000053 | Ga0501034_0000053_113003_113701 | 209 |
| 273 | 3300049572 | Ga0501036_0000009 | Ga0501036_0000009_93121_93819 | 209 |
| 274 | 3300049573 | Ga0501037_0000008 | Ga0501037_0000008_112994_113692 | 209 |
| 275 | 3300049574 | Ga0501038_0000008 | Ga0501038_0000008_113003_113701 | 209 |
| 276 | 3300049575 | Ga0501039_0000021 | Ga0501039_0000021_48852_49550 | 209 |
| 277 | 3300049576 | Ga0501040_0001596 | Ga0501040_0001596_8792_9490 | 209 |
| 278 | 3300049579 | Ga0501043_0001135 | Ga0501043_0001135_1682_2380 | 209 |
| 279 | 3300049581 | Ga0501047_0000126 | Ga0501047_0000126_23_721 | 209 |
| 280 | 3300049586 | Ga0501070_0021633 | Ga0501070_0021633_875_1573 | 209 |
| 281 | 3300049822 | Ga0501035_0000023 | Ga0501035_0000023_93121_93819 | 209 |
| 282 | 3300049823 | Ga0501044_0000021 | Ga0501044_0000021_113003_113701 | 209 |
| 283 | 3300050516 | nmdc:mga0sz30_168461_c1 | nmdc:mga0sz30_168461_c1_183_881 | 209 |
| 284 | 3300053107 | Ga0500560_026381 | Ga0500560_026381_527_1213 | 209 |
| 285 | iso_pu_bacteria | 2509276019 | 2509375018 | 209 |
| 286 | iso_pu_bacteria | 2509276021 | 2509388455 | 209 |
| 287 | iso_pu_bacteria | 2510065019 | 2510131398 | 209 |
| 288 | iso_pu_bacteria | 2510461076 | 2510897752 | 209 |
| 289 | iso_pu_bacteria | 2510917022 | 2511136292 | 209 |
| 290 | iso_pu_bacteria | 2510917026 | 2511170127 | 209 |
| 291 | iso_pu_bacteria | 2510917030 | 2511196833 | 209 |
| 292 | iso_pu_bacteria | 2511231052 | 2511500511 | 209 |
| 293 | iso_pu_bacteria | 2512047086 | 2512531972 | 209 |
| 294 | iso_pu_bacteria | 2512875026 | 2512972702 | 209 |
| 295 | iso_pu_bacteria | 2513237084 | 2513570617 | 209 |
| 296 | iso_pu_bacteria | 2513237085 | 2513580230 | 209 |
| 297 | iso_pu_bacteria | 2513237086 | 2513584139 | 209 |
| 298 | iso_pu_bacteria | 2513237091 | 2513620456 | 209 |
| 299 | iso_pu_bacteria | 2513237093 | 2513634235 | 209 |
| 300 | iso_pu_bacteria | 2513237103 | 2513713206 | 209 |
| 301 | iso_pu_bacteria | 2513237140 | 2513880583 | 209 |
| 302 | iso_pu_bacteria | 2513237143 | 2513903313 | 209 |
| 303 | iso_pu_bacteria | 2513237156 | 2513987675 | 209 |
| 304 | iso_pu_bacteria | 2513237160 | 2514005161 | 209 |
| 305 | iso_pu_bacteria | 2513237162 | 2514020262 | 209 |
| 306 | iso_pu_bacteria | 2515075009 | 2515110359 | 209 |
| 307 | iso_pu_bacteria | 2515154107 | 2515607709 | 209 |
| 308 | iso_pu_bacteria | 2515154113 | 2515634559 | 209 |
| 309 | iso_pu_bacteria | 2515154114 | 2515643784 | 209 |
| 310 | iso_pu_bacteria | 2515154116 | 2515657182 | 209 |
| 311 | iso_pu_bacteria | 2515154134 | 2515743317 | 209 |
| 312 | iso_pu_bacteria | 2516143018 | 2516204352 | 209 |
| 313 | iso_pu_bacteria | 2516653046 | 2516891843 | 209 |
| 314 | iso_pu_bacteria | 2516653077 | 2517039036 | 209 |
| 315 | iso_pu_bacteria | 2516653085 | 2517079302 | 209 |
| 316 | iso_pu_bacteria | 2517093000 | 2517093231 | 209 |
| 317 | iso_pu_bacteria | 2517287029 | 2517409500 | 209 |
| 318 | iso_pu_bacteria | 2519899620 | 2520377850 | 209 |
| 319 | iso_pu_bacteria | 2524023207 | 2524449879 | 209 |
| 320 | iso_pu_bacteria | 2524023209 | 2524457500 | 209 |
| 321 | iso_pu_bacteria | 2529292951 | 2530647837 | 209 |
| 322 | iso_pu_bacteria | 2537561587 | 2537872792 | 209 |
| 323 | iso_pu_bacteria | 2551306084 | 2551679314 | 209 |
| 324 | iso_pu_bacteria | 2551306085 | 2551686181 | 209 |
| 325 | iso_pu_bacteria | 2551306086 | 2551691040 | 209 |
| 326 | iso_pu_bacteria | 2551306087 | 2551698520 | 209 |
| 327 | iso_pu_bacteria | 2551306089 | 2551712305 | 209 |
| 328 | iso_pu_bacteria | 2551306090 | 2551722049 | 209 |
| 329 | iso_pu_bacteria | 2551306091 | 2551729915 | 209 |
| 330 | iso_pu_bacteria | 2551306093 | 2551745697 | 209 |
| 331 | iso_pu_bacteria | 2554235003 | 2554246629 | 209 |
| 332 | iso_pu_bacteria | 2558860100 | 2558866019 | 209 |
| 333 | iso_pu_bacteria | 2558860242 | 2559293857 | 209 |
| 334 | iso_pu_bacteria | 2582581298 | 2585227060 | 209 |
| 335 | iso_pu_bacteria | 2582581307 | 2585275455 | 209 |
| 336 | iso_pu_bacteria | 2582581308 | 2585282314 | 209 |
| 337 | iso_pu_bacteria | 2582581315 | 2585325991 | 209 |
| 338 | iso_pu_bacteria | 2582581316 | 2585330161 | 209 |
| 339 | iso_pu_bacteria | 2585427526 | 2585529281 | 209 |
| 340 | iso_pu_bacteria | 2585427527 | 2585536489 | 209 |
| 341 | iso_pu_bacteria | 2585427528 | 2585539667 | 209 |
| 342 | iso_pu_bacteria | 2585427529 | 2585550515 | 209 |
| 343 | iso_pu_bacteria | 2585427530 | 2585556966 | 209 |
| 344 | iso_pu_bacteria | 2585427531 | 2585560102 | 209 |
| 345 | iso_pu_bacteria | 2585427593 | 2585837624 | 209 |
| 346 | iso_pu_bacteria | 2585427594 | 2585844669 | 209 |
| 347 | iso_pu_bacteria | 2585427609 | 2585905717 | 209 |
| 348 | iso_pu_bacteria | 2585427633 | 2585994385 | 209 |
| 349 | iso_pu_bacteria | 2585427634 | 2585998843 | 209 |
| 350 | iso_pu_bacteria | 2585428125 | 2587979167 | 209 |
| 351 | iso_pu_bacteria | 2599185210 | 2599605406 | 209 |
| 352 | iso_pu_bacteria | 2600255279 | 2601609169 | 209 |
| 353 | iso_pu_bacteria | 2600255308 | 2601745944 | 209 |
| 354 | iso_pu_bacteria | 2615840626 | 2616306337 | 209 |
| 355 | iso_pu_bacteria | 2615840698 | 2616553393 | 209 |
| 356 | iso_pu_bacteria | 2643221557 | 2643806279 | 209 |
| 357 | iso_pu_bacteria | 2643221568 | 2643856349 | 209 |
| 358 | iso_pu_bacteria | 2643221599 | 2644007303 | 209 |
| 359 | iso_pu_bacteria | 2643221610 | 2644070119 | 209 |
| 360 | iso_pu_bacteria | 2643221668 | 2644381090 | 209 |
| 361 | iso_pu_bacteria | 2643221675 | 2644414996 | 209 |
| 362 | iso_pu_bacteria | 2643221680 | 2644448653 | 209 |
| 363 | iso_pu_bacteria | 2643221693 | 2644519229 | 209 |
| 364 | iso_pu_bacteria | 2643221726 | 2644689039 | 209 |
| 365 | iso_pu_bacteria | 2657244999 | 2657681882 | 209 |
| 366 | iso_pu_bacteria | 2667528174 | 2671112354 | 209 |
| 367 | iso_pu_bacteria | 2690316117 | 2692317270 | 209 |
| 368 | iso_pu_bacteria | 2718217882 | 2719179553 | 209 |
| 369 | iso_pu_bacteria | 2718217997 | 2719663900 | 209 |
| 370 | iso_pu_bacteria | 2718218009 | 2719730223 | 209 |
| 371 | iso_pu_bacteria | 2718218199 | 2720490319 | 209 |
| 372 | iso_pu_bacteria | 2718218233 | 2720618543 | 209 |
| 373 | iso_pu_bacteria | 2718218235 | 2720629951 | 209 |
| 374 | iso_pu_bacteria | 2718218269 | 2720773646 | 209 |
| 375 | iso_pu_bacteria | 2718218363 | 2721145646 | 209 |
| 376 | iso_pu_bacteria | 2718218365 | 2721157163 | 209 |
| 377 | iso_pu_bacteria | 2718218366 | 2721162525 | 209 |
| 378 | iso_pu_bacteria | 2721755514 | 2722838695 | 209 |
| 379 | iso_pu_bacteria | 2721755684 | 2723558902 | 209 |
| 380 | iso_pu_bacteria | 2721755685 | 2723565472 | 209 |
| 381 | iso_pu_bacteria | 2721755810 | 2724042979 | 209 |
| 382 | iso_pu_bacteria | 2721755819 | 2724088253 | 209 |
| 383 | iso_pu_bacteria | 2721755822 | 2724102737 | 209 |
| 384 | iso_pu_bacteria | 2721755823 | 2724108635 | 209 |
| 385 | iso_pu_bacteria | 2724679232 | 2725948977 | 209 |
| 386 | iso_pu_bacteria | 2728369365 | 2730162790 | 209 |
| 387 | iso_pu_bacteria | 2728369397 | 2730296795 | 209 |
| 388 | iso_pu_bacteria | 2738541293 | 2738801257 | 209 |
| 389 | iso_pu_bacteria | 2738541317 | 2738948248 | 209 |
| 390 | iso_pu_bacteria | 2738541333 | 2739037057 | 209 |
| 391 | iso_pu_bacteria | 2751185821 | 2753461332 | 209 |
| 392 | iso_pu_bacteria | 2765235942 | 2766066583 | 209 |
| 393 | iso_pu_bacteria | 2775507049 | 2776912074 | 209 |
| 394 | iso_pu_bacteria | 2775507266 | 2778174155 | 209 |
| 395 | iso_pu_bacteria | 2791355082 | 2792582936 | 209 |
| 396 | iso_pu_bacteria | 2791355091 | 2792623823 | 209 |
| 397 | iso_pu_bacteria | 2791355092 | 2792629797 | 209 |
| 398 | iso_pu_bacteria | 2791355094 | 2792638132 | 209 |
| 399 | iso_pu_bacteria | 2791355259 | 2793316346 | 209 |
| 400 | iso_pu_bacteria | 2791355260 | 2793323422 | 209 |
| 401 | iso_pu_bacteria | 2791355261 | 2793326184 | 209 |
| 402 | iso_pu_bacteria | 2791355264 | 2793348159 | 209 |
| 403 | iso_pu_bacteria | 2791355267 | 2793364658 | 209 |
| 404 | iso_pu_bacteria | 2802428858 | 2802720328 | 209 |
| 405 | iso_pu_bacteria | 2802428862 | 2802742581 | 209 |
| 406 | iso_pu_bacteria | 2802428863 | 2802749286 | 209 |
| 407 | iso_pu_bacteria | 2802429268 | 2804750902 | 209 |
| 408 | iso_pu_bacteria | 2802429633 | 2806047561 | 209 |
| 409 | iso_pu_bacteria | 2802429634 | 2806054980 | 209 |
| 410 | iso_pu_bacteria | 2802429635 | 2806062118 | 209 |
| 411 | iso_pu_bacteria | 2802429636 | 2806067156 | 209 |
| 412 | iso_pu_bacteria | 2802429637 | 2806076477 | 209 |
| 413 | iso_pu_bacteria | 2808606387 | 2808986368 | 209 |
| 414 | iso_pu_bacteria | 2818991439 | 2819556498 | 209 |
| 415 | iso_pu_bacteria | 2818991448 | 2819608423 | 209 |
| 416 | iso_pu_bacteria | 2818991453 | 2819643500 | 209 |
| 417 | iso_pu_bacteria | 2818991461 | 2819686308 | 209 |
| 418 | iso_pu_bacteria | 2821123053 | 2821123625 | 209 |
| 419 | iso_pu_bacteria | 2838016132 | 2838020268 | 209 |
| 420 | iso_pu_bacteria | 2838022645 | 2838025785 | 209 |
| 421 | iso_pu_bacteria | 2838029111 | 2838029306 | 209 |
| 422 | iso_pu_bacteria | 2838042994 | 2838044441 | 209 |
| 423 | iso_pu_bacteria | 2838048938 | 2838051516 | 209 |
| 424 | iso_pu_bacteria | 2838068647 | 2838071092 | 209 |
| 425 | iso_pu_bacteria | 2838675328 | 2838677226 | 209 |
| 426 | iso_pu_bacteria | 2838686498 | 2838691601 | 209 |
| 427 | iso_pu_bacteria | 2838714209 | 2838716114 | 209 |
| 428 | iso_pu_bacteria | 2838719591 | 2838720086 | 209 |
| 429 | iso_pu_bacteria | 2838724970 | 2838726866 | 209 |
| 430 | iso_pu_bacteria | 2838729681 | 2838733915 | 209 |
| 431 | iso_pu_bacteria | 2838742623 | 2838747021 | 209 |
| 432 | iso_pu_bacteria | 2839993093 | 2839994225 | 209 |
| 433 | iso_pu_bacteria | 2840764183 | 2840769383 | 209 |
| 434 | iso_pu_bacteria | 2841846520 | 2841847018 | 209 |
| 435 | iso_pu_bacteria | 2841851746 | 2841856162 | 209 |
| 436 | iso_pu_bacteria | 2841859092 | 2841860452 | 209 |
| 437 | iso_pu_bacteria | 2842110456 | 2842112191 | 209 |
| 438 | iso_pu_bacteria | 2842124991 | 2842126953 | 209 |
| 439 | iso_pu_bacteria | 2842130223 | 2842132119 | 209 |
| 440 | iso_pu_bacteria | 2842152218 | 2842152712 | 209 |
| 441 | iso_pu_bacteria | 2842156927 | 2842161950 | 209 |
| 442 | iso_pu_bacteria | 2842163707 | 2842169674 | 209 |
| 443 | iso_pu_bacteria | 2842170452 | 2842172359 | 209 |
| 444 | iso_pu_bacteria | 2842175837 | 2842176331 | 209 |
| 445 | iso_pu_bacteria | 2842180545 | 2842185792 | 209 |
| 446 | iso_pu_bacteria | 2842187318 | 2842189221 | 209 |
| 447 | iso_pu_bacteria | 2842198810 | 2842202936 | 209 |
| 448 | iso_pu_bacteria | 2842211629 | 2842213535 | 209 |
| 449 | iso_pu_bacteria | 2842217011 | 2842218813 | 209 |
| 450 | iso_pu_bacteria | 2842224351 | 2842224847 | 209 |
| 451 | iso_pu_bacteria | 2842229732 | 2842235320 | 209 |
| 452 | iso_pu_bacteria | 2842243621 | 2842248225 | 209 |
| 453 | iso_pu_bacteria | 2842257432 | 2842262181 | 209 |
| 454 | iso_pu_bacteria | 2842264693 | 2842268778 | 209 |
| 455 | iso_pu_bacteria | 2842271015 | 2842276574 | 209 |
| 456 | iso_pu_bacteria | 2842298080 | 2842300885 | 209 |
| 457 | iso_pu_bacteria | 2842304105 | 2842306520 | 209 |
| 458 | iso_pu_bacteria | 2842357229 | 2842357993 | 209 |
| 459 | iso_pu_bacteria | 2842422224 | 2842424708 | 209 |
| 460 | iso_pu_bacteria | 2842428310 | 2842433022 | 209 |
| 461 | iso_pu_bacteria | 2842434925 | 2842439327 | 209 |
| 462 | iso_pu_bacteria | 2842441272 | 2842445956 | 209 |
| 463 | iso_pu_bacteria | 2842462802 | 2842467142 | 209 |
| 464 | iso_pu_bacteria | 2842469257 | 2842473830 | 209 |
| 465 | iso_pu_bacteria | 2842475841 | 2842476264 | 209 |
| 466 | iso_pu_bacteria | 2842482326 | 2842482336 | 209 |
| 467 | iso_pu_bacteria | 2842502639 | 2842502834 | 209 |
| 468 | iso_pu_bacteria | 2842509118 | 2842509188 | 209 |
| 469 | iso_pu_bacteria | 2842515876 | 2842517237 | 209 |
| 470 | iso_pu_bacteria | 2844454524 | 2844456010 | 209 |
| 471 | iso_pu_bacteria | 2847417321 | 2847417663 | 209 |
| 472 | iso_pu_bacteria | 2848992105 | 2848992468 | 209 |
| 473 | iso_pu_bacteria | 2852387548 | 2852388463 | 209 |
| 474 | iso_pu_bacteria | 2854916844 | 2854919933 | 209 |
| 475 | iso_pu_bacteria | 2855872281 | 2855874550 | 209 |
| 476 | iso_pu_bacteria | 2857516855 | 2857523458 | 209 |
| 477 | iso_pu_bacteria | 2857531043 | 2857531189 | 209 |
| 478 | iso_pu_bacteria | 2891048133 | 2891049562 | 209 |
| 479 | iso_pu_bacteria | 2891373044 | 2891374950 | 209 |
| 480 | iso_pu_bacteria | 2896384573 | 2896391568 | 209 |
| 481 | iso_pu_bacteria | 2899792073 | 2899792517 | 209 |
| 482 | iso_pu_bacteria | 2899803654 | 2899805280 | 209 |
| 483 | iso_pu_bacteria | 2899845264 | 2899847892 | 209 |
| 484 | iso_pu_bacteria | 2913308742 | 2913313410 | 209 |
| 485 | iso_pu_bacteria | 2919100787 | 2919101367 | 209 |
| 486 | iso_pu_bacteria | 2919114240 | 2919116317 | 209 |
| 487 | iso_pu_bacteria | 2919166419 | 2919166884 | 209 |
| 488 | iso_pu_bacteria | 2919171160 | 2919172104 | 209 |
| 489 | iso_pu_bacteria | 2919408235 | 2919408785 | 209 |
| 490 | iso_pu_bacteria | 2920822456 | 2920823360 | 209 |
| 491 | iso_pu_bacteria | 2926754445 | 2926757271 | 209 |
| 492 | iso_pu_bacteria | 2926760298 | 2926761487 | 209 |
| 493 | iso_pu_bacteria | 2933006813 | 2933007357 | 209 |
| 494 | iso_pu_bacteria | 2933011516 | 2933015051 | 209 |
| 495 | iso_pu_bacteria | 2933570622 | 2933573589 | 209 |
| 496 | iso_pu_bacteria | 2933586486 | 2933587520 | 209 |
| 497 | iso_pu_bacteria | 2933594066 | 2933594565 | 209 |
| 498 | iso_pu_bacteria | 2933599457 | 2933601891 | 209 |
| 499 | iso_pu_bacteria | 2935901341 | 2935907183 | 209 |
| 500 | iso_pu_bacteria | 2936367885 | 2936368947 | 209 |
| 501 | iso_pu_bacteria | 2936375103 | 2936378437 | 209 |
| 502 | iso_pu_bacteria | 2936381700 | 2936383725 | 209 |
| 503 | iso_pu_bacteria | 2936996657 | 2936999104 | 209 |
| 504 | iso_pu_bacteria | 2937002841 | 2937005061 | 209 |
| 505 | iso_pu_bacteria | 2937009748 | 2937011342 | 209 |
| 506 | iso_pu_bacteria | 2937016420 | 2937018751 | 209 |
| 507 | iso_pu_bacteria | 2937023124 | 2937023805 | 209 |
| 508 | iso_pu_bacteria | 2937036028 | 2937041296 | 209 |
| 509 | iso_pu_bacteria | 2937042894 | 2937049457 | 209 |
| 510 | iso_pu_bacteria | 2937049772 | 2937054012 | 209 |
| 511 | iso_pu_bacteria | 2937056579 | 2937060641 | 209 |
| 512 | iso_pu_bacteria | 2937063883 | 2937070015 | 209 |
| 513 | iso_pu_bacteria | 2937071275 | 2937071534 | 209 |
| 514 | iso_pu_bacteria | 2937084907 | 2937086085 | 209 |
| 515 | iso_pu_bacteria | 2937091812 | 2937093276 | 209 |
| 516 | iso_pu_bacteria | 2937098957 | 2937103464 | 209 |
| 517 | iso_pu_bacteria | 2937106411 | 2937110393 | 209 |
| 518 | iso_pu_bacteria | 2937113482 | 2937114691 | 209 |
| 519 | iso_pu_bacteria | 2937119839 | 2937122601 | 209 |
| 520 | iso_pu_bacteria | 2937126314 | 2937128479 | 209 |
| 521 | iso_pu_bacteria | 2957382221 | 2957383649 | 209 |
| 522 | iso_pu_bacteria | 2957388812 | 2957394052 | 209 |
| 523 | iso_pu_bacteria | 2957395598 | 2957399573 | 209 |
| 524 | iso_pu_bacteria | 2957402308 | 2957403697 | 209 |
| 525 | iso_pu_bacteria | 2957408893 | 2957411052 | 209 |
| 526 | iso_pu_bacteria | 2957415311 | 2957421549 | 209 |
| 527 | iso_pu_bacteria | 2957422303 | 2957429480 | 209 |
| 528 | iso_pu_bacteria | 2957430029 | 2957435389 | 209 |
| 529 | iso_pu_bacteria | 2957437181 | 2957442624 | 209 |
| 530 | iso_pu_bacteria | 2957443900 | 2957447142 | 209 |
| 531 | iso_pu_bacteria | 2957450854 | 2957457314 | 209 |
| 532 | iso_pu_bacteria | 2957457609 | 2957464425 | 209 |
| 533 | iso_pu_bacteria | 2957464669 | 2957466198 | 209 |
| 534 | iso_pu_bacteria | 2957471148 | 2957477049 | 209 |
| 535 | iso_pu_bacteria | 2957478035 | 2957480301 | 209 |
| 536 | iso_pu_bacteria | 2957484790 | 2957489045 | 209 |
| 537 | iso_pu_bacteria | 2957491536 | 2957494585 | 209 |
| 538 | iso_pu_bacteria | 2957498199 | 2957503796 | 209 |
| 539 | iso_pu_bacteria | 2957505466 | 2957508594 | 209 |
| 540 | iso_pu_bacteria | 2960584000 | 2960585693 | 209 |
| 541 | iso_pu_bacteria | 2960591022 | 2960594752 | 209 |
| 542 | iso_pu_bacteria | 2960597568 | 2960599754 | 209 |
| 543 | iso_pu_bacteria | 2960603979 | 2960605395 | 209 |
| 544 | iso_pu_bacteria | 2960610863 | 2960616914 | 209 |
| 545 | iso_pu_bacteria | 2960617483 | 2960621682 | 209 |
| 546 | iso_pu_bacteria | 2960624210 | 2960629218 | 209 |
| 547 | iso_pu_bacteria | 2960637947 | 2960638834 | 209 |
| 548 | iso_pu_bacteria | 2960645483 | 2960647669 | 209 |
| 549 | iso_pu_bacteria | 2960652885 | 2960658871 | 209 |
| 550 | iso_pu_bacteria | 2960660292 | 2960660426 | 209 |
| 551 | iso_pu_bacteria | 2960667422 | 2960668440 | 209 |
| 552 | iso_pu_bacteria | 2960674078 | 2960676388 | 209 |
| 553 | iso_pu_bacteria | 2960687367 | 2960690308 | 209 |
| 554 | iso_pu_bacteria | 2964607997 | 2964608419 | 209 |
| 555 | iso_pu_bacteria | 2964615318 | 2964619794 | 209 |
| 556 | iso_pu_bacteria | 2964621998 | 2964622449 | 209 |
| 557 | iso_pu_bacteria | 2964628898 | 2964634293 | 209 |
| 558 | iso_pu_bacteria | 2964636051 | 2964636423 | 209 |
| 559 | iso_pu_bacteria | 2964643177 | 2964646952 | 209 |
| 560 | iso_pu_bacteria | 2964649959 | 2964650317 | 209 |
| 561 | iso_pu_bacteria | 2964656573 | 2964659450 | 209 |
| 562 | iso_pu_bacteria | 2964663802 | 2964664933 | 209 |
| 563 | iso_pu_bacteria | 2964670856 | 2964675417 | 209 |
| 564 | iso_pu_bacteria | 2964678106 | 2964680595 | 209 |
| 565 | iso_pu_bacteria | 2964685014 | 2964691086 | 209 |
| 566 | iso_pu_bacteria | 2964691889 | 2964693055 | 209 |
| 567 | iso_pu_bacteria | 2964698721 | 2964704148 | 209 |
| 568 | iso_pu_bacteria | 2964705432 | 2964707170 | 209 |
| 569 | iso_pu_bacteria | 2964712639 | 2964718589 | 209 |
| 570 | iso_pu_bacteria | 2964719344 | 2964724992 | 209 |
| 571 | iso_pu_bacteria | 2967664464 | 2967667659 | 209 |
| 572 | iso_pu_bacteria | 2967671571 | 2967678163 | 209 |
| 573 | iso_pu_bacteria | 2967678726 | 2967684943 | 209 |
| 574 | iso_pu_bacteria | 2967693043 | 2967695055 | 209 |
| 575 | iso_pu_bacteria | 2967699805 | 2967701967 | 209 |
| 576 | iso_pu_bacteria | 2967706974 | 2967712751 | 209 |
| 577 | iso_pu_bacteria | 2967714385 | 2967714649 | 209 |
| 578 | iso_pu_bacteria | 2967721400 | 2967722476 | 209 |
| 579 | iso_pu_bacteria | 2967728569 | 2967730544 | 209 |
| 580 | iso_pu_bacteria | 2967735183 | 2967736346 | 209 |
| 581 | iso_pu_bacteria | 2967742019 | 2967747798 | 209 |
| 582 | iso_pu_bacteria | 2967748971 | 2967751861 | 209 |
| 583 | iso_pu_bacteria | 2967755722 | 2967761283 | 209 |
| 584 | iso_pu_bacteria | 2967762386 | 2967762703 | 209 |
| 585 | iso_pu_bacteria | 2967769361 | 2967771318 | 209 |
| 586 | iso_pu_bacteria | 2967775926 | 2967777019 | 209 |
| 587 | iso_pu_bacteria | 2970019648 | 2970023336 | 209 |
| 588 | iso_pu_bacteria | 2970026789 | 2970030565 | 209 |
| 589 | iso_pu_bacteria | 2970033650 | 2970034048 | 209 |
| 590 | iso_pu_bacteria | 2970040964 | 2970045475 | 209 |
| 591 | iso_pu_bacteria | 2970047711 | 2970052644 | 209 |
| 592 | iso_pu_bacteria | 2970054988 | 2970061189 | 209 |
| 593 | iso_pu_bacteria | 2970061556 | 2970063978 | 209 |
| 594 | iso_pu_bacteria | 2970068827 | 2970073357 | 209 |
| 595 | iso_pu_bacteria | 2970076120 | 2970080385 | 209 |
| 596 | iso_pu_bacteria | 2970082768 | 2970087323 | 209 |
| 597 | iso_pu_bacteria | 2970088815 | 2970095391 | 209 |
| 598 | iso_pu_bacteria | 2970095765 | 2970101499 | 209 |
| 599 | iso_pu_bacteria | 2970102677 | 2970103351 | 209 |
| 600 | iso_pu_bacteria | 2970109326 | 2970116073 | 209 |
| 601 | iso_pu_bacteria | 2970116247 | 2970118579 | 209 |
| 602 | iso_pu_bacteria | 2970122695 | 2970126283 | 209 |
| 603 | iso_pu_bacteria | 2970129317 | 2970131553 | 209 |
| 604 | iso_pu_bacteria | 2970136068 | 2970143356 | 209 |
| 605 | iso_pu_bacteria | 2970143518 | 2970148526 | 209 |
| 606 | iso_pu_bacteria | 2970149975 | 2970153239 | 209 |
| 607 | iso_pu_bacteria | 2970156795 | 2970159547 | 209 |
| 608 | iso_pu_bacteria | 2970164137 | 2970167723 | 209 |
| 609 | iso_pu_bacteria | 2970170962 | 2970177003 | 209 |
| 610 | iso_pu_bacteria | 2970177841 | 2970181914 | 209 |
| 611 | iso_pu_bacteria | 2970184632 | 2970188471 | 209 |
| 612 | iso_pu_bacteria | 2970191845 | 2970196410 | 209 |
| 613 | iso_pu_bacteria | 2977516862 | 2977518036 | 209 |
| 614 | iso_pu_bacteria | 2977523885 | 2977529148 | 209 |
| 615 | iso_pu_bacteria | 2977530762 | 2977535847 | 209 |
| 616 | iso_pu_bacteria | 2977537788 | 2977539973 | 209 |
| 617 | iso_pu_bacteria | 2977551784 | 2977552945 | 209 |
| 618 | iso_pu_bacteria | 2977558990 | 2977559294 | 209 |
| 619 | iso_pu_bacteria | 2977565890 | 2977567496 | 209 |
| 620 | iso_pu_bacteria | 2977572785 | 2977579590 | 209 |
| 621 | iso_pu_bacteria | 2977579622 | 2977580423 | 209 |
| 622 | iso_pu_bacteria | 2978969890 | 2978973301 | 209 |
| 623 | iso_pu_bacteria | 2979089926 | 2979093225 | 209 |
| 624 | iso_pu_bacteria | 2979095461 | 2979099390 | 209 |
| 625 | iso_pu_bacteria | 2979100975 | 2979105195 | 209 |
| 626 | iso_pu_bacteria | 2984509177 | 2984512948 | 209 |
| 627 | iso_pu_bacteria | 2984518228 | 2984520688 | 209 |
| 628 | iso_pu_bacteria | 2984537506 | 2984539980 | 209 |
| 629 | iso_pu_bacteria | 2984587000 | 2984591582 | 209 |
| 630 | iso_pu_bacteria | 2984601300 | 2984602171 | 209 |
| 631 | iso_pu_bacteria | 2989349275 | 2989351425 | 209 |
| 632 | iso_pu_bacteria | 2989771324 | 2989772774 | 209 |
| 633 | iso_pu_bacteria | 2996893221 | 2996893415 | 209 |
| 634 | iso_pu_bacteria | 3005409236 | 3005411214 | 209 |
| 635 | iso_pu_bacteria | 3005416602 | 3005422823 | 209 |
| 636 | iso_pu_bacteria | 3005445848 | 3005446165 | 209 |
| 637 | iso_pu_bacteria | 3005452660 | 3005452824 | 209 |
| 638 | iso_pu_bacteria | 639633055 | 639646630 | 209 |
| 639 | iso_pu_bacteria | 643692032 | 643824526 | 209 |
| 640 | iso_pu_bacteria | 648276728 | 648739357 | 209 |
| 641 | iso_pu_bacteria | 650716007 | 650739048 | 209 |
| 642 | iso_pu_bacteria | 8003992118 | 8003992434 | 209 |
| 643 | iso_pu_bacteria | 8003999396 | 8003999762 | 209 |
| 644 | iso_pu_bacteria | 8005282627 | 8005289028 | 209 |
| 645 | iso_pu_bacteria | 8005301065 | 8005301534 | 209 |
| 646 | iso_pu_bacteria | 8005307578 | 8005309213 | 209 |
| 647 | iso_pu_bacteria | 8005314921 | 8005321641 | 209 |
| 648 | iso_pu_bacteria | 8005376324 | 8005377453 | 209 |
| 649 | iso_pu_bacteria | 8005382845 | 8005387316 | 209 |
| 650 | iso_pu_bacteria | 8005395548 | 8005400107 | 209 |
| 651 | iso_pu_bacteria | 8005430974 | 8005432914 | 209 |
| 652 | iso_pu_bacteria | 8005460587 | 8005460998 | 209 |
| 653 | iso_pu_bacteria | 8005484373 | 8005484934 | 209 |
| 654 | iso_pu_bacteria | 8005497431 | 8005498642 | 209 |
| 655 | iso_pu_bacteria | 8005556819 | 8005560603 | 209 |
| 656 | iso_pu_bacteria | 8005563573 | 8005563938 | 209 |
| 657 | iso_pu_bacteria | 8005570704 | 8005576902 | 209 |
| 658 | iso_pu_bacteria | 8005619151 | 8005619836 | 209 |
| 659 | iso_pu_bacteria | 8005645114 | 8005650130 | 209 |
| 660 | iso_pu_bacteria | 8005658619 | 8005660374 | 209 |
| 661 | iso_pu_bacteria | 8005668836 | 8005670053 | 209 |
| 662 | iso_pu_bacteria | 8005688590 | 8005690250 | 209 |
| 663 | iso_pu_bacteria | 8005695170 | 8005699273 | 209 |
| 664 | iso_pu_bacteria | 8018150411 | 8018153081 | 209 |
| 665 | iso_pu_bacteria | 8018163183 | 8018169006 | 209 |
| 666 | iso_pu_bacteria | 8023680758 | 8023684260 | 209 |
| 667 | iso_pu_bacteria | 8024479707 | 8024480257 | 209 |
| 668 | iso_pu_bacteria | 8046767195 | 8046769860 | 209 |
| 669 | iso_pu_bacteria | 8049293176 | 8049293458 | 209 |
| 670 | iso_pu_bacteria | 8056375014 | 8056375615 | 209 |
| 671 | iso_pu_bacteria | 8057575449 | 8057577821 | 209 |
| 672 | iso_pu_bacteria | 8057874678 | 8057876029 | 209 |
| 673 | 3300003187 | JGI25151J46595_10008951 | JGI25151J46595_100089512 | 210 |
| 674 | 3300003320 | rootH2_10017545 | rootH2_100175452 | 210 |
| 675 | 3300003323 | rootH1_10123595 | rootH1_101235952 | 210 |
| 676 | 3300005289 | Ga0065704_10001731 | Ga0065704_100017314 | 210 |
| 677 | 3300021321 | Ga0214542_1009335 | Ga0214542_10093354 | 210 |
| 678 | 3300021327 | Ga0214543_1000256 | Ga0214543_100025657 | 210 |
| 679 | 3300025233 | Ga0209437_100086 | Ga0209437_100086236 | 210 |
| 680 | 3300025261 | Ga0209233_1000356 | Ga0209233_100035625 | 210 |
| 681 | 3300025294 | Ga0209025_1000528 | Ga0209025_100052842 | 210 |
| 682 | 3300027312 | Ga0209371_1003471 | Ga0209371_10034714 | 210 |
| 683 | 3300030500 | Ga0268256_1003179 | Ga0268256_10031794 | 210 |
| 684 | 3300048920 | Ga0496117_0016471 | Ga0496117_0016471_505_1203 | 210 |
| 685 | 3300048927 | Ga0496124_0006030 | Ga0496124_0006030_688_1386 | 210 |
| 686 | 3300048928 | Ga0496125_0000695 | Ga0496125_0000695_24081_24779 | 210 |
| 687 | 3300048928 | Ga0496125_0199862 | Ga0496125_0199862_428_1126 | 210 |
| 688 | 3300049569 | Ga0501032_0021226 | Ga0501032_0021226_904_1620 | 210 |
| 689 | 3300049569 | Ga0501032_0172395 | Ga0501032_0172395_14_730 | 210 |
| 690 | 3300049569 | Ga0501032_0296874 | Ga0501032_0296874_279_995 | 210 |
| 691 | 3300049570 | Ga0501033_0000495 | Ga0501033_0000495_33297_34013 | 210 |
| 692 | 3300049570 | Ga0501033_0001157 | Ga0501033_0001157_16155_16853 | 210 |
| 693 | 3300049570 | Ga0501033_0178235 | Ga0501033_0178235_558_1274 | 210 |
| 694 | 3300049572 | Ga0501036_0073396 | Ga0501036_0073396_842_1558 | 210 |
| 695 | 3300049573 | Ga0501037_0000308 | Ga0501037_0000308_36060_36776 | 210 |
| 696 | 3300049573 | Ga0501037_0156831 | Ga0501037_0156831_182_898 | 210 |
| 697 | 3300049579 | Ga0501043_0000005 | Ga0501043_0000005_69140_69856 | 210 |
| 698 | 3300049579 | Ga0501043_0088873 | Ga0501043_0088873_1612_2328 | 210 |
| 699 | 3300049581 | Ga0501047_0094812 | Ga0501047_0094812_186_902 | 210 |
| 700 | 3300049581 | Ga0501047_0169348 | Ga0501047_0169348_1060_1776 | 210 |
| 701 | 3300049584 | Ga0501068_0122751 | Ga0501068_0122751_873_1589 | 210 |
| 702 | 3300049584 | Ga0501068_0179028 | Ga0501068_0179028_302_1018 | 210 |
| 703 | 3300049585 | Ga0501069_0000011 | Ga0501069_0000011_64451_65167 | 210 |
| 704 | 3300049585 | Ga0501069_0203562 | Ga0501069_0203562_336_1052 | 210 |
| 705 | 3300049585 | Ga0501069_0280354 | Ga0501069_0280354_96_812 | 210 |
| 706 | 3300049586 | Ga0501070_0000117 | Ga0501070_0000117_54102_54818 | 210 |
| 707 | 3300049586 | Ga0501070_0000257 | Ga0501070_0000257_40184_40900 | 210 |
| 708 | 3300049586 | Ga0501070_0043444 | Ga0501070_0043444_327_1043 | 210 |
| 709 | 3300049587 | Ga0501071_0072949 | Ga0501071_0072949_908_1624 | 210 |
| 710 | 3300049589 | Ga0501073_0052547 | Ga0501073_0052547_466_1182 | 210 |
| 711 | 3300049589 | Ga0501073_0084610 | Ga0501073_0084610_297_1013 | 210 |
| 712 | 3300049589 | Ga0501073_0277058 | Ga0501073_0277058_70_786 | 210 |
| 713 | 3300049590 | Ga0501074_0038414 | Ga0501074_0038414_1241_1957 | 210 |
| 714 | 3300049590 | Ga0501074_0188929 | Ga0501074_0188929_538_1254 | 210 |
| 715 | 3300049742 | Ga0501080_0016949 | Ga0501080_0016949_5631_6347 | 210 |
| 716 | 3300049742 | Ga0501080_0039435 | Ga0501080_0039435_886_1602 | 210 |
| 717 | 3300049742 | Ga0501080_0150872 | Ga0501080_0150872_160_876 | 210 |
| 718 | 3300049744 | Ga0501083_0000831 | Ga0501083_0000831_3362_4078 | 210 |
| 719 | 3300049744 | Ga0501083_0283738 | Ga0501083_0283738_162_881 | 210 |
| 720 | 3300049822 | Ga0501035_0000107 | Ga0501035_0000107_65348_66064 | 210 |
| 721 | 3300049822 | Ga0501035_0001314 | Ga0501035_0001314_18446_19162 | 210 |
| 722 | 3300049822 | Ga0501035_0002296 | Ga0501035_0002296_10181_10879 | 210 |
| 723 | 3300049822 | Ga0501035_0051590 | Ga0501035_0051590_1614_2330 | 210 |
| 724 | 3300049822 | Ga0501035_0120322 | Ga0501035_0120322_711_1427 | 210 |
| 725 | 3300049823 | Ga0501044_0000154 | Ga0501044_0000154_39892_40608 | 210 |
| 726 | 3300049823 | Ga0501044_0082812 | Ga0501044_0082812_539_1255 | 210 |
| 727 | 3300049823 | Ga0501044_0098865 | Ga0501044_0098865_1053_1769 | 210 |
| 728 | 3300050492 | nmdc:mga0yw44_109848_c1 | nmdc:mga0yw44_109848_c1_882_1595 | 210 |
| 729 | 3300060353 | Ga0501082_0093908 | Ga0501082_0093908_862_1578 | 210 |
| 730 | iso_pu_bacteria | 2961170736 | 2961177043 | 210 |
| 731 | iso_pu_bacteria | 2967996073 | 2968002831 | 210 |
| 732 | iso_pu_bacteria | 2977821940 | 2977822151 | 210 |
| 733 | 3300003187 | JGI25151J46595_10000346 | JGI25151J46595_1000034621 | 211 |
| 734 | 3300003354 | JGI25160J50197_1000500 | JGI25160J50197_10005008 | 211 |
| 735 | 3300003775 | Ga0055524_1003868 | Ga0055524_10038686 | 211 |
| 736 | 3300003775 | Ga0055524_1004431 | Ga0055524_10044315 | 211 |
| 737 | 3300004625 | Ga0055543_1001182 | Ga0055543_10011823 | 211 |
| 738 | 3300005262 | Ga0065165_1005966 | Ga0065165_10059665 | 211 |
| 739 | 3300006038 | Ga0075365_10011895 | Ga0075365_100118953 | 211 |
| 740 | 3300006042 | Ga0075368_10019855 | Ga0075368_100198552 | 211 |
| 741 | 3300006051 | Ga0075364_10214680 | Ga0075364_102146802 | 211 |
| 742 | 3300006178 | Ga0075367_10085263 | Ga0075367_100852632 | 211 |
| 743 | 3300006195 | Ga0075366_10014660 | Ga0075366_100146602 | 211 |
| 744 | 3300013249 | Ga0171463_1001 | Ga0171463_1001705 | 211 |
| 745 | 3300015690 | Ga0183363_1012 | Ga0183363_101248 | 211 |
| 746 | 3300025245 | Ga0207425_1004154 | Ga0207425_10041542 | 211 |
| 747 | 3300025258 | Ga0209129_1003389 | Ga0209129_10033895 | 211 |
| 748 | 3300025273 | Ga0209673_1002143 | Ga0209673_10021435 | 211 |
| 749 | 3300025291 | Ga0209675_1039946 | Ga0209675_10399461 | 211 |
| 750 | 3300025294 | Ga0209025_1000970 | Ga0209025_100097020 | 211 |
| 751 | 3300025299 | Ga0209256_1000180 | Ga0209256_100018080 | 211 |
| 752 | 3300025302 | Ga0207426_1000063 | Ga0207426_1000063241 | 211 |
| 753 | 3300025303 | Ga0209051_1011680 | Ga0209051_10116802 | 211 |
| 754 | 3300026067 | Ga0207678_10193399 | Ga0207678_101933992 | 211 |
| 755 | 3300048927 | Ga0496124_0000063 | Ga0496124_0000063_108561_109298 | 211 |
| 756 | 3300049573 | Ga0501037_0263556 | Ga0501037_0263556_171_890 | 211 |
| 757 | 3300049579 | Ga0501043_0039716 | Ga0501043_0039716_1015_1734 | 211 |
| 758 | 3300049581 | Ga0501047_0466447 | Ga0501047_0466447_113_832 | 211 |
| 759 | 3300049586 | Ga0501070_0024616 | Ga0501070_0024616_934_1653 | 211 |
| 760 | 3300049822 | Ga0501035_0022408 | Ga0501035_0022408_4845_5564 | 211 |
| 761 | 3300049822 | Ga0501035_0074842 | Ga0501035_0074842_1031_1750 | 211 |
| 762 | 3300049823 | Ga0501044_0192944 | Ga0501044_0192944_906_1625 | 211 |
| 763 | 3300049823 | Ga0501044_0227015 | Ga0501044_0227015_677_1396 | 211 |
| 764 | 3300050492 | nmdc:mga0yw44_35604_c1 | nmdc:mga0yw44_35604_c1_1520_2236 | 211 |
| 765 | 3300050493 | nmdc:mga0k408_150279_c1 | nmdc:mga0k408_150279_c1_581_1279 | 211 |
| 766 | iso_pu_bacteria | 2511231027 | 2511389332 | 211 |
| 767 | iso_pu_bacteria | 2721755686 | 2723578262 | 211 |
| 768 | iso_pu_bacteria | 2842871566 | 2842873063 | 211 |
| 769 | iso_pu_bacteria | 2894652903 | 2894655410 | 211 |
| 770 | iso_pu_bacteria | 2919119836 | 2919122068 | 211 |
| 771 | iso_pu_bacteria | 8004640170 | 8004644546 | 211 |
| 772 | iso_pu_bacteria | 8054460903 | 8054461310 | 211 |
| 773 | 3300006051 | Ga0075364_10151574 | Ga0075364_101515742 | 212 |
| 774 | 3300006946 | Ga0079104_1000876 | Ga0079104_10008765 | 212 |
| 775 | 3300022739 | Ga0228711_1000019 | Ga0228711_100001920 | 212 |
| 776 | 3300022740 | Ga0228710_1000022 | Ga0228710_100002220 | 212 |
| 777 | 3300025294 | Ga0209025_1093537 | Ga0209025_10935372 | 212 |
| 778 | 3300027111 | Ga0209281_1000227 | Ga0209281_100022726 | 212 |
| 779 | 3300027666 | Ga0209282_1000042 | Ga0209282_100004226 | 212 |
| 780 | 3300031967 | Ga0315914_1000009 | Ga0315914_1000009101 | 212 |
| 781 | 3300033430 | Ga0315913_1000015 | Ga0315913_100001526 | 212 |
| 782 | 3300033464 | Ga0315915_1000013 | Ga0315915_100001387 | 212 |
| 783 | 3300048919 | Ga0496116_0043024 | Ga0496116_0043024_1773_2471 | 212 |
| 784 | 3300048920 | Ga0496117_0003540 | Ga0496117_0003540_4326_5024 | 212 |
| 785 | 3300048921 | Ga0496118_0060112 | Ga0496118_0060112_1612_2310 | 212 |
| 786 | 3300048924 | Ga0496121_0000001 | Ga0496121_0000001_428319_429017 | 212 |
| 787 | 3300048926 | Ga0496123_0112189 | Ga0496123_0112189_463_1161 | 212 |
| 788 | 3300048927 | Ga0496124_0063645 | Ga0496124_0063645_610_1308 | 212 |
| 789 | 3300048928 | Ga0496125_0000001 | Ga0496125_0000001_540342_541040 | 212 |
| 790 | 3300048929 | Ga0496126_0645744 | Ga0496126_0645744_51_749 | 212 |
| 791 | 3300048929 | Ga0496126_0645784 | Ga0496126_0645784_51_749 | 212 |
| 792 | 3300050491 | nmdc:mga00v17_4902_c1 | nmdc:mga00v17_4902_c1_79_777 | 212 |
| 793 | 3300050494 | nmdc:mga06z11_166055_c1 | nmdc:mga06z11_166055_c1_278_976 | 212 |
| 794 | iso_pu_bacteria | 2643221582 | 2643921154 | 212 |
| 795 | iso_pu_bacteria | 8003570095 | 8003572681 | 212 |
| 796 | 3300002704 | JGI25155J39150_1000023 | JGI25155J39150_100002335 | 213 |
| 797 | 3300002705 | JGI25156J39149_1000029 | JGI25156J39149_100002971 | 213 |
| 798 | 3300002738 | JGI25154J39366_1000067 | JGI25154J39366_100006735 | 213 |
| 799 | 3300002741 | JGI25157J39369_1000043 | JGI25157J39369_100004392 | 213 |
| 800 | 3300002774 | JGI25150J39212_1000012 | JGI25150J39212_100001272 | 213 |
| 801 | 3300003187 | JGI25151J46595_10000025 | JGI25151J46595_10000025112 | 213 |
| 802 | 3300003214 | JGI25165J46597_1001287 | JGI25165J46597_100128712 | 213 |
| 803 | 3300003214 | JGI25165J46597_1013388 | JGI25165J46597_10133882 | 213 |
| 804 | 3300003215 | JGI25153J46596_10002371 | JGI25153J46596_100023713 | 213 |
| 805 | 3300003320 | rootH2_10186027 | rootH2_101860272 | 213 |
| 806 | 3300003693 | Ga0032354_1032914 | Ga0032354_10329142 | 213 |
| 807 | 3300003794 | Ga0055531_10005094 | Ga0055531_100050945 | 213 |
| 808 | 3300003856 | Ga0058692_1009082 | Ga0058692_10090822 | 213 |
| 809 | 3300005347 | Ga0070668_100416239 | Ga0070668_1004162392 | 213 |
| 810 | 3300005353 | Ga0070669_100069998 | Ga0070669_1000699982 | 213 |
| 811 | 3300005548 | Ga0070665_100014231 | Ga0070665_1000142315 | 213 |
| 812 | 3300005548 | Ga0070665_100220086 | Ga0070665_1002200862 | 213 |
| 813 | 3300005563 | Ga0068855_100254945 | Ga0068855_1002549452 | 213 |
| 814 | 3300005578 | Ga0068854_100198901 | Ga0068854_1001989012 | 213 |
| 815 | 3300005578 | Ga0068854_100284660 | Ga0068854_1002846602 | 213 |
| 816 | 3300005614 | Ga0068856_100301256 | Ga0068856_1003012562 | 213 |
| 817 | 3300005834 | Ga0068851_10051204 | Ga0068851_100512042 | 213 |
| 818 | 3300006038 | Ga0075365_10106442 | Ga0075365_101064422 | 213 |
| 819 | 3300006042 | Ga0075368_10000571 | Ga0075368_100005717 | 213 |
| 820 | 3300006178 | Ga0075367_10088173 | Ga0075367_100881732 | 213 |
| 821 | 3300006186 | Ga0075369_10027622 | Ga0075369_100276222 | 213 |
| 822 | 3300006186 | Ga0075369_10028567 | Ga0075369_100285672 | 213 |
| 823 | 3300006353 | Ga0075370_10139831 | Ga0075370_101398311 | 213 |
| 824 | 3300006353 | Ga0075370_10214402 | Ga0075370_102144022 | 213 |
| 825 | 3300006946 | Ga0079104_1004688 | Ga0079104_10046882 | 213 |
| 826 | 3300006948 | Ga0099826_10000216 | Ga0099826_100002162 | 213 |
| 827 | 3300011119 | Ga0105246_10156879 | Ga0105246_101568792 | 213 |
| 828 | 3300013100 | Ga0157373_10049858 | Ga0157373_100498582 | 213 |
| 829 | 3300013102 | Ga0157371_10000058 | Ga0157371_100000582 | 213 |
| 830 | 3300013102 | Ga0157371_10015095 | Ga0157371_100150954 | 213 |
| 831 | 3300013105 | Ga0157369_10866275 | Ga0157369_108662751 | 213 |
| 832 | 3300025206 | Ga0209435_100011 | Ga0209435_100011339 | 213 |
| 833 | 3300025233 | Ga0209437_100036 | Ga0209437_10003612 | 213 |
| 834 | 3300025245 | Ga0207425_1000012 | Ga0207425_1000012275 | 213 |
| 835 | 3300025246 | Ga0209646_1000024 | Ga0209646_100002471 | 213 |
| 836 | 3300025250 | Ga0209026_1000030 | Ga0209026_100003071 | 213 |
| 837 | 3300025253 | Ga0209677_101207 | Ga0209677_1012073 | 213 |
| 838 | 3300025256 | Ga0209759_1000011 | Ga0209759_1000011339 | 213 |
| 839 | 3300025258 | Ga0209129_1000081 | Ga0209129_100008186 | 213 |
| 840 | 3300025261 | Ga0209233_1000110 | Ga0209233_100011012 | 213 |
| 841 | 3300025261 | Ga0209233_1000166 | Ga0209233_100016612 | 213 |
| 842 | 3300025272 | Ga0209455_1020560 | Ga0209455_10205602 | 213 |
| 843 | 3300025292 | Ga0209676_1003256 | Ga0209676_10032567 | 213 |
| 844 | 3300025294 | Ga0209025_1000024 | Ga0209025_1000024275 | 213 |
| 845 | 3300025294 | Ga0209025_1000441 | Ga0209025_100044140 | 213 |
| 846 | 3300025297 | Ga0209758_1000046 | Ga0209758_1000046267 | 213 |
| 847 | 3300025297 | Ga0209758_1000349 | Ga0209758_100034950 | 213 |
| 848 | 3300025298 | Ga0209050_1002637 | Ga0209050_10026373 | 213 |
| 849 | 3300025299 | Ga0209256_1052758 | Ga0209256_10527581 | 213 |
| 850 | 3300025303 | Ga0209051_1001361 | Ga0209051_100136111 | 213 |
| 851 | 3300025304 | Ga0209257_1004216 | Ga0209257_10042168 | 213 |
| 852 | 3300025321 | Ga0207656_10071163 | Ga0207656_100711632 | 213 |
| 853 | 3300025913 | Ga0207695_10000376 | Ga0207695_1000037612 | 213 |
| 854 | 3300025949 | Ga0207667_10233512 | Ga0207667_102335122 | 213 |
| 855 | 3300026078 | Ga0207702_10062428 | Ga0207702_100624283 | 213 |
| 856 | 3300027111 | Ga0209281_1000192 | Ga0209281_100019292 | 213 |
| 857 | 3300027111 | Ga0209281_1001513 | Ga0209281_10015132 | 213 |
| 858 | 3300027312 | Ga0209371_1000009 | Ga0209371_1000009440 | 213 |
| 859 | 3300027312 | Ga0209371_1000547 | Ga0209371_10005478 | 213 |
| 860 | 3300027666 | Ga0209282_1012946 | Ga0209282_10129462 | 213 |
| 861 | 3300027866 | Ga0209813_10018418 | Ga0209813_100184182 | 213 |
| 862 | 3300028379 | Ga0268266_10003170 | Ga0268266_1000317011 | 213 |
| 863 | 3300028379 | Ga0268266_10215388 | Ga0268266_102153882 | 213 |
| 864 | 3300030500 | Ga0268256_1000010 | Ga0268256_1000010439 | 213 |
| 865 | 3300030500 | Ga0268256_1021622 | Ga0268256_10216222 | 213 |
| 866 | 3300030744 | Ga0316181_1112456 | Ga0316181_11124562 | 213 |
| 867 | 3300031731 | Ga0307405_10001288 | Ga0307405_100012884 | 213 |
| 868 | 3300031911 | Ga0307412_10009244 | Ga0307412_100092445 | 213 |
| 869 | 3300031995 | Ga0307409_100134946 | Ga0307409_1001349462 | 213 |
| 870 | 3300032002 | Ga0307416_100292761 | Ga0307416_1002927612 | 213 |
| 871 | 3300035695 | Ga0373927_0000887 | Ga0373927_0000887_16401_17099 | 213 |
| 872 | 3300037068 | Ga0373925_0003273 | Ga0373925_0003273_3874_4572 | 213 |
| 873 | 3300046457 | Ga0495590_0084389 | Ga0495590_0084389_350_1048 | 213 |
| 874 | 3300046507 | Ga0495606_0106257 | Ga0495606_0106257_554_1252 | 213 |
| 875 | 3300046522 | Ga0495643_0117763 | Ga0495643_0117763_522_1220 | 213 |
| 876 | 3300046530 | Ga0495654_0001458 | Ga0495654_0001458_3081_3779 | 213 |
| 877 | 3300046558 | Ga0495633_0139263 | Ga0495633_0139263_185_922 | 213 |
| 878 | 3300046674 | Ga0495588_0041275 | Ga0495588_0041275_138_875 | 213 |
| 879 | 3300046692 | Ga0495671_0099083 | Ga0495671_0099083_612_1349 | 213 |
| 880 | 3300046694 | Ga0495649_0211207 | Ga0495649_0211207_229_927 | 213 |
| 881 | 3300047470 | Ga0495681_0006515 | Ga0495681_0006515_173_910 | 213 |
| 882 | 3300047472 | Ga0495686_0226314 | Ga0495686_0226314_255_953 | 213 |
| 883 | 3300047472 | Ga0495686_0252425 | Ga0495686_0252425_207_905 | 213 |
| 884 | 3300048904 | Ga0496101_0530664 | Ga0496101_0530664_98_796 | 213 |
| 885 | 3300048906 | Ga0496103_0301184 | Ga0496103_0301184_58_756 | 213 |
| 886 | 3300048916 | Ga0496113_0305184 | Ga0496113_0305184_393_1091 | 213 |
| 887 | 3300048919 | Ga0496116_0000080 | Ga0496116_0000080_6378_7076 | 213 |
| 888 | 3300048919 | Ga0496116_0009980 | Ga0496116_0009980_5498_6196 | 213 |
| 889 | 3300048919 | Ga0496116_0066648 | Ga0496116_0066648_1479_2177 | 213 |
| 890 | 3300048919 | Ga0496116_0078950 | Ga0496116_0078950_578_1276 | 213 |
| 891 | 3300048919 | Ga0496116_0144264 | Ga0496116_0144264_613_1311 | 213 |
| 892 | 3300048920 | Ga0496117_0000002 | Ga0496117_0000002_1970789_1971487 | 213 |
| 893 | 3300048920 | Ga0496117_0031612 | Ga0496117_0031612_2822_3520 | 213 |
| 894 | 3300048920 | Ga0496117_0149367 | Ga0496117_0149367_135_833 | 213 |
| 895 | 3300048920 | Ga0496117_0161780 | Ga0496117_0161780_280_978 | 213 |
| 896 | 3300048920 | Ga0496117_0179606 | Ga0496117_0179606_180_878 | 213 |
| 897 | 3300048920 | Ga0496117_0187332 | Ga0496117_0187332_222_920 | 213 |
| 898 | 3300048921 | Ga0496118_0000233 | Ga0496118_0000233_38617_39315 | 213 |
| 899 | 3300048921 | Ga0496118_0056155 | Ga0496118_0056155_1973_2677 | 213 |
| 900 | 3300048921 | Ga0496118_0114365 | Ga0496118_0114365_646_1344 | 213 |
| 901 | 3300048921 | Ga0496118_0138849 | Ga0496118_0138849_803_1501 | 213 |
| 902 | 3300048921 | Ga0496118_0147281 | Ga0496118_0147281_350_1048 | 213 |
| 903 | 3300048922 | Ga0496119_0025703 | Ga0496119_0025703_2407_3105 | 213 |
| 904 | 3300048922 | Ga0496119_0168368 | Ga0496119_0168368_317_1015 | 213 |
| 905 | 3300048923 | Ga0496120_0000021 | Ga0496120_0000021_95088_95786 | 213 |
| 906 | 3300048924 | Ga0496121_0115192 | Ga0496121_0115192_134_832 | 213 |
| 907 | 3300048924 | Ga0496121_0190184 | Ga0496121_0190184_548_1246 | 213 |
| 908 | 3300048924 | Ga0496121_0386357 | Ga0496121_0386357_19_717 | 213 |
| 909 | 3300048925 | Ga0496122_0000001 | Ga0496122_0000001_1341579_1342277 | 213 |
| 910 | 3300048925 | Ga0496122_0002476 | Ga0496122_0002476_21851_22549 | 213 |
| 911 | 3300048925 | Ga0496122_0011009 | Ga0496122_0011009_5899_6597 | 213 |
| 912 | 3300048925 | Ga0496122_0124535 | Ga0496122_0124535_517_1215 | 213 |
| 913 | 3300048925 | Ga0496122_0178776 | Ga0496122_0178776_66_764 | 213 |
| 914 | 3300048925 | Ga0496122_0186589 | Ga0496122_0186589_135_833 | 213 |
| 915 | 3300048926 | Ga0496123_0000001 | Ga0496123_0000001_1345310_1346008 | 213 |
| 916 | 3300048926 | Ga0496123_0000020 | Ga0496123_0000020_335435_336148 | 213 |
| 917 | 3300048926 | Ga0496123_0052473 | Ga0496123_0052473_1586_2284 | 213 |
| 918 | 3300048926 | Ga0496123_0064102 | Ga0496123_0064102_838_1536 | 213 |
| 919 | 3300048926 | Ga0496123_0075335 | Ga0496123_0075335_271_969 | 213 |
| 920 | 3300048926 | Ga0496123_0141095 | Ga0496123_0141095_86_784 | 213 |
| 921 | 3300048926 | Ga0496123_0141915 | Ga0496123_0141915_504_1202 | 213 |
| 922 | 3300048927 | Ga0496124_0010037 | Ga0496124_0010037_5773_6471 | 213 |
| 923 | 3300048927 | Ga0496124_0076573 | Ga0496124_0076573_532_1230 | 213 |
| 924 | 3300048927 | Ga0496124_0109017 | Ga0496124_0109017_1137_1835 | 213 |
| 925 | 3300048927 | Ga0496124_0140029 | Ga0496124_0140029_688_1386 | 213 |
| 926 | 3300048927 | Ga0496124_0268676 | Ga0496124_0268676_169_867 | 213 |
| 927 | 3300048928 | Ga0496125_0056070 | Ga0496125_0056070_760_1458 | 213 |
| 928 | 3300048928 | Ga0496125_0056714 | Ga0496125_0056714_1216_1914 | 213 |
| 929 | 3300048928 | Ga0496125_0117809 | Ga0496125_0117809_1114_1833 | 213 |
| 930 | 3300048928 | Ga0496125_0130811 | Ga0496125_0130811_246_944 | 213 |
| 931 | 3300048929 | Ga0496126_0000094 | Ga0496126_0000094_46097_46795 | 213 |
| 932 | 3300048929 | Ga0496126_0000195 | Ga0496126_0000195_88777_89475 | 213 |
| 933 | 3300048929 | Ga0496126_0190342 | Ga0496126_0190342_489_1187 | 213 |
| 934 | 3300048929 | Ga0496126_0193203 | Ga0496126_0193203_601_1299 | 213 |
| 935 | 3300049571 | Ga0501034_0164311 | Ga0501034_0164311_965_1663 | 213 |
| 936 | 3300050491 | nmdc:mga00v17_72_c1 | nmdc:mga00v17_72_c1_37232_37930 | 213 |
| 937 | 3300050492 | nmdc:mga0yw44_41265_c1 | nmdc:mga0yw44_41265_c1_1569_2267 | 213 |
| 938 | 3300050494 | nmdc:mga06z11_104763_c1 | nmdc:mga06z11_104763_c1_540_1238 | 213 |
| 939 | 3300050495 | nmdc:mga04h51_1892_c1 | nmdc:mga04h51_1892_c1_1249_1947 | 213 |
| 940 | 3300050496 | nmdc:mga07m45_113552_c1 | nmdc:mga07m45_113552_c1_507_1205 | 213 |
| 941 | 3300050516 | nmdc:mga0sz30_82783_c1 | nmdc:mga0sz30_82783_c1_303_1022 | 213 |
| 942 | 3300053088 | Ga0500644_0045322 | Ga0500644_0045322_35_733 | 213 |
| 943 | 3300053107 | Ga0500560_103419 | Ga0500560_103419_183_920 | 213 |
| 944 | 3300053108 | Ga0500562_073957 | Ga0500562_073957_132_830 | 213 |
| 945 | 3300053125 | Ga0500618_024101 | Ga0500618_024101_206_904 | 213 |
| 946 | 3300053130 | Ga0500642_0252219 | Ga0500642_0252219_93_791 | 213 |
| 947 | 3300053139 | Ga0500568_0090338 | Ga0500568_0090338_126_824 | 213 |
| 948 | 3300053140 | Ga0500573_0112053 | Ga0500573_0112053_305_1003 | 213 |
| 949 | 3300053153 | Ga0500616_0000817 | Ga0500616_0000817_376_1074 | 213 |
| 950 | 3300053156 | Ga0500622_0000391 | Ga0500622_0000391_28737_29435 | 213 |
| 951 | 3300053156 | Ga0500622_0086810 | Ga0500622_0086810_376_1074 | 213 |
| 952 | 3300053157 | Ga0500624_001342 | Ga0500624_001342_1085_1783 | 213 |
| 953 | 3300053158 | Ga0500627_0189577 | Ga0500627_0189577_103_801 | 213 |
| 954 | 3300053161 | Ga0500634_0074801 | Ga0500634_0074801_955_1653 | 213 |
| 955 | 3300053177 | Ga0500636_0000010 | Ga0500636_0000010_102793_103497 | 213 |
| 956 | iso_pu_bacteria | 2954011201 | 2954014653 | 213 |
| 957 | iso_pu_bacteria | 8055431914 | 8055433426 | 213 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3nwp-assembly2.cif.gz_B | crystal structure of a 6-phosphogluconolactonase (sbal_2240) from shewanella baltica os155 at 1.40 a resolution | 0.944 | 2 | 213 |
| 3nwp-assembly2.cif.gz_B | crystal structure of a 6-phosphogluconolactonase (sbal_2240) from shewanella baltica os155 at 1.40 a resolution | 0.9354 | 2 | 213 |
| 3lwd-assembly1.cif.gz_A-2 | crystal structure of putative 6-phosphogluconolactonase (yp_574786.1) from chromohalobacter salexigens dsm 3043 at 1.88 a resolution | 0.9251 | 12 | 213 |
| 3lhi-assembly1.cif.gz_A | crystal structure of putative 6-phosphogluconolactonase(yp_207848.1) from neisseria gonorrhoeae fa 1090 at 1.33 a resolution | 0.9075 | 2 | 213 |
| 3lhi-assembly1.cif.gz_A | crystal structure of putative 6-phosphogluconolactonase(yp_207848.1) from neisseria gonorrhoeae fa 1090 at 1.33 a resolution | 0.8992 | 2 | 213 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3lwdA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9202 | 12 | 213 | 3.40.50.1360 |
| 3nwpB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9154 | 2 | 213 | 3.40.50.1360 |
| 3nwpB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9071 | 2 | 213 | 3.40.50.1360 |
| 3lhiA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.892 | 5 | 213 | 3.40.50.1360 |
| 3lhiA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8718 | 5 | 213 | 3.40.50.1360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-M5JS82-F1-model_v4 | 6-phosphogluconolactonase (EC 3.1.1.31) | 0.9865 | 45 | 213 |
GO:0005975
GO:0006098 GO:0017057 |
| AF-A0A7W7YWS2-F1-model_v4 | 6-phosphogluconolactonase (6PGL) (EC 3.1.1.31) | 0.9844 | 1 | 213 |
GO:0005975
GO:0006098 GO:0017057 |
| AF-A0A7K3UD13-F1-model_v4 | 6-phosphogluconolactonase (6PGL) (EC 3.1.1.31) | 0.9829 | 1 | 213 |
GO:0005975
GO:0006098 GO:0017057 |
| AF-A0A4Q3I3H1-F1-model_v4 | 6-phosphogluconolactonase (6PGL) (EC 3.1.1.31) | 0.9802 | 1 | 167 |
GO:0005975
GO:0006098 GO:0017057 |
| AF-A0A7W7YWS2-F1-model_v4 | 6-phosphogluconolactonase (6PGL) (EC 3.1.1.31) | 0.9798 | 1 | 213 |
GO:0005975
GO:0006098 GO:0017057 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar