F486709

General Info

Members Datasets Scaffolds Average Seq Length
955 257 955 165

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10454878|Ga0111539_104548782
Length 173
Sequence MMTRRKTMTDKLDLVLERTIDAPLNLVWAAYTNPEHLKQWFAPRPYEITECELDLQPGGIFRIRMQGPDGFDTGHGNAGCVLEVIEGKKLAWTSALGPEYRPAEMAATGCESFPMTAIVTFADAGNGKTAYKAVALHANEADREKHEQMGFHDGWGTVAGQLEEFAQSLRANA

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
161 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
162 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
163 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
177 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
178 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
179 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
187 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
188 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
189 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
190 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
191 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
192 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
193 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
194 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
195 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
196 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
197 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
198 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
199 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
200 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
201 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
202 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
203 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
204 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
205 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
206 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
207 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
208 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
209 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
210 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
220 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
221 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
222 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
223 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
224 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
225 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
226 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
227 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
228 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
229 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
230 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
231 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
232 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
233 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
234 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
235 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
236 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
237 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
238 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
239 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
240 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
241 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
242 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
243 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
244 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
245 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
246 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
247 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
248 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
249 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
257 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.84
Nodule 0
Rhizoplane 1.57
Rhizosphere 97.49
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1005733 3300001904 Bacteria 2098
2 JGI24741J21665_1034242 3300001915 Bacteria 755
3 JGI24740J21852_10007768 3300001979 Bacteria 4333
4 JGI24739J22299_10084522 3300001989 Bacteria 971
5 JGI24737J22298_10002218 3300001990 Bacteria 6926
6 JGI24737J22298_10005083 3300001990 Bacteria 4557
7 JGI24737J22298_10099222 3300001990 Bacteria 863
8 JGI24735J21928_10063644 3300002067 Bacteria 1059
9 JGI24735J21928_10149241 3300002067 Unclassified 675
10 JGI24738J21930_10042690 3300002075 Bacteria 921
11 JGI24738J21930_10055873 3300002075 Bacteria 807
12 JGI24742J22300_10018404 3300002244 Bacteria 1184
13 JGI24742J22300_10056069 3300002244 Bacteria 719
14 JGI24751J29686_10021313 3300002459 Bacteria 1343
15 JGI24751J29686_10071553 3300002459 Bacteria 716
16 Ga0065714_10246408 3300005288 Bacteria 784
17 Ga0065712_10071048 3300005290 Bacteria 5492
18 Ga0065712_10109914 3300005290 Bacteria 1847
19 Ga0065712_10166660 3300005290 Bacteria 1254
20 Ga0065712_10459928 3300005290 Bacteria 679
21 Ga0065715_10089390 3300005293 Bacteria 10619
22 Ga0065715_10121419 3300005293 Bacteria 2230
23 Ga0065715_10306988 3300005293 Unclassified 1028
24 Ga0065715_10439293 3300005293 Bacteria 838
25 Ga0065715_10497343 3300005293 Unclassified 783
26 Ga0070658_10019314 3300005327 Bacteria 5458
27 Ga0070658_10038048 3300005327 Bacteria 3880
28 Ga0070658_10046294 3300005327 Bacteria 3520
29 Ga0070658_10719721 3300005327 Bacteria 867
30 Ga0070676_10004434 3300005328 Bacteria 7385
31 Ga0070676_10031323 3300005328 Bacteria 3039
32 Ga0070676_10144249 3300005328 Bacteria 1518
33 Ga0070676_10617475 3300005328 Bacteria 783
34 Ga0070690_100810994 3300005330 Unclassified 726
35 Ga0070690_101016570 3300005330 Bacteria 654
36 Ga0070670_100000558 3300005331 Bacteria 29547
37 Ga0070670_100002114 3300005331 Bacteria 16307
38 Ga0070670_100006350 3300005331 Bacteria 10005
39 Ga0070670_100059973 3300005331 Bacteria 3266
40 Ga0070670_100070610 3300005331 Bacteria 2998
41 Ga0070670_100113020 3300005331 Bacteria 2341
42 Ga0070670_100167181 3300005331 Bacteria 1907
43 Ga0070670_100299065 3300005331 Bacteria 1407
44 Ga0070670_100374464 3300005331 Bacteria 1254
45 Ga0070670_100397915 3300005331 Bacteria 1216
46 Ga0070670_101317509 3300005331 Unclassified 661
47 Ga0070677_10000148 3300005333 Bacteria 23747
48 Ga0070677_10000835 3300005333 Bacteria 10120
49 Ga0070677_10001376 3300005333 Bacteria 7762
50 Ga0070677_10099350 3300005333 Bacteria 1280
51 Ga0070677_10106845 3300005333 Bacteria 1243
52 Ga0070677_10172584 3300005333 Bacteria 1023
53 Ga0068869_100132628 3300005334 Bacteria 1916
54 Ga0068869_100699821 3300005334 Bacteria 864
55 Ga0068869_101050005 3300005334 Unclassified 711
56 Ga0070666_10060359 3300005335 Bacteria 2566
57 Ga0070666_10070929 3300005335 Bacteria 2371
58 Ga0070666_10547777 3300005335 Bacteria 841
59 Ga0070680_100311648 3300005336 Unclassified 1335
60 Ga0070682_100199551 3300005337 Unclassified 1410
61 Ga0068868_100000036 3300005338 Bacteria 74490
62 Ga0068868_100024267 3300005338 Unclassified 4599
63 Ga0068868_100031015 3300005338 Bacteria 4103
64 Ga0068868_100341007 3300005338 Bacteria 1281
65 Ga0070660_100011134 3300005339 Bacteria 6379
66 Ga0070660_100021649 3300005339 Bacteria 4745
67 Ga0070660_100067902 3300005339 Bacteria 2778
68 Ga0070660_100111560 3300005339 Bacteria 2176
69 Ga0070660_100420183 3300005339 Bacteria 1107
70 Ga0070660_100423193 3300005339 Unclassified 1103
71 Ga0070660_100602960 3300005339 Unclassified 918
72 Ga0070689_100384305 3300005340 Bacteria 1184
73 Ga0070689_100410488 3300005340 Bacteria 1146
74 Ga0070687_100038295 3300005343 Bacteria 2403
75 Ga0070687_100066580 3300005343 Bacteria 1920
76 Ga0070687_100631402 3300005343 Bacteria 740
77 Ga0070661_100213785 3300005344 Bacteria 1477
78 Ga0070661_100319545 3300005344 Bacteria 1212
79 Ga0070661_100354424 3300005344 Bacteria 1152
80 Ga0070661_100356800 3300005344 Unclassified 1148
81 Ga0070661_100362409 3300005344 Bacteria 1139
82 Ga0070692_10024695 3300005345 Bacteria 2956
83 Ga0070668_100013438 3300005347 Bacteria 6111
84 Ga0070668_100027703 3300005347 Bacteria 4302
85 Ga0070668_100050650 3300005347 Bacteria 3198
86 Ga0070668_100153584 3300005347 Bacteria 1864
87 Ga0070668_100423070 3300005347 Bacteria 1141
88 Ga0070668_100458571 3300005347 Bacteria 1097
89 Ga0070669_100016815 3300005353 Bacteria 5221
90 Ga0070669_100059200 3300005353 Bacteria 2813
91 Ga0070669_100100659 3300005353 Bacteria 2179
92 Ga0070669_100138667 3300005353 Bacteria 1873
93 Ga0070669_100194474 3300005353 Bacteria 1593
94 Ga0070669_100490718 3300005353 Bacteria 1018
95 Ga0070669_100600728 3300005353 Unclassified 922
96 Ga0070669_100833264 3300005353 Bacteria 785
97 Ga0070669_101212429 3300005353 Bacteria 652
98 Ga0070675_100000985 3300005354 Bacteria 20370
99 Ga0070675_100002386 3300005354 Bacteria 13991
100 Ga0070675_100008116 3300005354 Bacteria 8140
101 Ga0070675_100017593 3300005354 Bacteria 5682
102 Ga0070675_100118180 3300005354 Bacteria 2251
103 Ga0070675_100158842 3300005354 Bacteria 1943
104 Ga0070675_100203758 3300005354 Bacteria 1717
105 Ga0070675_100292374 3300005354 Bacteria 1434
106 Ga0070675_100653017 3300005354 Unclassified 956
107 Ga0070675_101398628 3300005354 Bacteria 645
108 Ga0070671_100003600 3300005355 Bacteria 12118
109 Ga0070671_100032842 3300005355 Bacteria 4290
110 Ga0070671_100036831 3300005355 Bacteria 4056
111 Ga0070671_100148174 3300005355 Bacteria 1981
112 Ga0070671_100240461 3300005355 Bacteria 1537
113 Ga0070671_100394291 3300005355 Bacteria 1184
114 Ga0070671_100524620 3300005355 Bacteria 1020
115 Ga0070671_100745956 3300005355 Unclassified 851
116 Ga0070671_100937303 3300005355 Bacteria 757
117 Ga0070674_100001003 3300005356 Bacteria 14723
118 Ga0070674_100041908 3300005356 Bacteria 3106
119 Ga0070674_100065921 3300005356 Bacteria 2543
120 Ga0070674_100892188 3300005356 Bacteria 774
121 Ga0070673_100026106 3300005364 Bacteria 4309
122 Ga0070673_100070084 3300005364 Bacteria 2812
123 Ga0070673_100249507 3300005364 Bacteria 1546
124 Ga0070673_100263707 3300005364 Bacteria 1506
125 Ga0070673_100267167 3300005364 Bacteria 1496
126 Ga0070673_100393189 3300005364 Bacteria 1238
127 Ga0070673_100394184 3300005364 Bacteria 1237
128 Ga0070673_101666848 3300005364 Bacteria 603
129 Ga0070673_101730854 3300005364 Bacteria 592
130 Ga0070659_100000025 3300005366 Bacteria 144955
131 Ga0070659_100003057 3300005366 Bacteria 11885
132 Ga0070659_100007001 3300005366 Bacteria 8165
133 Ga0070659_100026834 3300005366 Bacteria 4433
134 Ga0070659_100038767 3300005366 Bacteria 3717
135 Ga0070659_100065177 3300005366 Bacteria 2885
136 Ga0070659_100113232 3300005366 Bacteria 2191
137 Ga0070659_100126562 3300005366 Bacteria 2073
138 Ga0070659_100742530 3300005366 Unclassified 851
139 Ga0070667_100021253 3300005367 Bacteria 5391
140 Ga0070667_100414949 3300005367 Bacteria 1227
141 Ga0070713_101237747 3300005436 Bacteria 723
142 Ga0070701_10056401 3300005438 Bacteria 2055
143 Ga0070700_100444011 3300005441 Bacteria 986
144 Ga0070694_100002873 3300005444 Bacteria 10234
145 Ga0070663_100005892 3300005455 Bacteria 7330
146 Ga0070663_100246149 3300005455 Unclassified 1413
147 Ga0070663_100439949 3300005455 Bacteria 1073
148 Ga0070663_100652356 3300005455 Bacteria 890
149 Ga0070663_101073266 3300005455 Bacteria 703
150 Ga0070678_100048694 3300005456 Bacteria 3054
151 Ga0070678_100224449 3300005456 Bacteria 1563
152 Ga0070678_100983773 3300005456 Bacteria 775
153 Ga0070662_100000146 3300005457 Bacteria 40344
154 Ga0070662_100000435 3300005457 Bacteria 24674
155 Ga0070662_100002110 3300005457 Bacteria 12199
156 Ga0070662_100007360 3300005457 Bacteria 7132
157 Ga0070662_100017721 3300005457 Bacteria 4805
158 Ga0070662_100026264 3300005457 Bacteria 4032
159 Ga0070662_100036581 3300005457 Bacteria 3474
160 Ga0070662_100043184 3300005457 Bacteria 3224
161 Ga0070662_100156809 3300005457 Bacteria 1778
162 Ga0070662_100199658 3300005457 Bacteria 1586
163 Ga0070662_100366958 3300005457 Bacteria 1182
164 Ga0070662_100770476 3300005457 Bacteria 817
165 Ga0070681_10032642 3300005458 Bacteria 5226
166 Ga0070681_10471092 3300005458 Bacteria 1168
167 Ga0070681_10803936 3300005458 Bacteria 857
168 Ga0068867_100070470 3300005459 Bacteria 2613
169 Ga0068867_100322817 3300005459 Bacteria 1280
170 Ga0070679_100028060 3300005530 Bacteria 5546
171 Ga0070679_101040210 3300005530 Bacteria 763
172 Ga0068853_100118998 3300005539 Bacteria 2354
173 Ga0068853_100185596 3300005539 Bacteria 1888
174 Ga0068853_100759812 3300005539 Bacteria 927
175 Ga0070672_100001035 3300005543 Bacteria 16924
176 Ga0070672_100001785 3300005543 Bacteria 13457
177 Ga0070672_100032749 3300005543 Bacteria 3927
178 Ga0070672_100046058 3300005543 Bacteria 3377
179 Ga0070672_100139081 3300005543 Bacteria 2001
180 Ga0070695_100127581 3300005545 Bacteria 1749
181 Ga0070695_100238832 3300005545 Bacteria 1317
182 Ga0070696_100006917 3300005546 Bacteria 7570
183 Ga0070693_100017274 3300005547 Bacteria 3748
184 Ga0070693_100182468 3300005547 Unclassified 1352
185 Ga0070665_100001627 3300005548 Bacteria 25878
186 Ga0070665_100015670 3300005548 Bacteria 7613
187 Ga0070665_100089762 3300005548 Bacteria 3079
188 Ga0070665_100153761 3300005548 Bacteria 2303
189 Ga0070665_101187166 3300005548 Bacteria 774
190 Ga0068855_100025567 3300005563 Bacteria 7061
191 Ga0068855_100530726 3300005563 Unclassified 1276
192 Ga0070664_100003664 3300005564 Bacteria 12374
193 Ga0070664_100039409 3300005564 Bacteria 3981
194 Ga0070664_100107432 3300005564 Bacteria 2433
195 Ga0070664_100121811 3300005564 Bacteria 2284
196 Ga0070664_100223963 3300005564 Unclassified 1683
197 Ga0070664_100386122 3300005564 Bacteria 1279
198 Ga0070664_100425219 3300005564 Bacteria 1217
199 Ga0070664_100520448 3300005564 Bacteria 1098
200 Ga0070664_100932134 3300005564 Bacteria 815
201 Ga0070664_101142350 3300005564 Bacteria 734
202 Ga0068857_100005983 3300005577 Bacteria 10388
203 Ga0068857_100030988 3300005577 Bacteria 4726
204 Ga0068857_100031238 3300005577 Bacteria 4706
205 Ga0068857_100049836 3300005577 Bacteria 3715
206 Ga0068857_100140154 3300005577 Unclassified 2185
207 Ga0068857_101012195 3300005577 Bacteria 800
208 Ga0068854_100105709 3300005578 Bacteria 2116
209 Ga0068854_100133384 3300005578 Bacteria 1899
210 Ga0068854_100227832 3300005578 Bacteria 1478
211 Ga0068854_100332766 3300005578 Bacteria 1238
212 Ga0068854_100688918 3300005578 Bacteria 881
213 Ga0068856_100757732 3300005614 Unclassified 991
214 Ga0068852_100010799 3300005616 Bacteria 6842
215 Ga0068852_100091774 3300005616 Plasmid 2718
216 Ga0068852_100183880 3300005616 Bacteria 1967
217 Ga0068852_100264370 3300005616 Bacteria 1653
218 Ga0068859_100033191 3300005617 Bacteria 5184
219 Ga0068859_100052189 3300005617 Bacteria 4110
220 Ga0068859_100058069 3300005617 Bacteria 3897
221 Ga0068859_100580103 3300005617 Bacteria 1215
222 Ga0068864_100055650 3300005618 Bacteria 3416
223 Ga0068864_100099352 3300005618 Bacteria 2578
224 Ga0068864_100117137 3300005618 Bacteria 2378
225 Ga0068864_100251155 3300005618 Bacteria 1642
226 Ga0068864_100891951 3300005618 Bacteria 878
227 Ga0068864_101570504 3300005618 Unclassified 662
228 Ga0068866_10730583 3300005718 Bacteria 682
229 Ga0068861_100049373 3300005719 Bacteria 3185
230 Ga0068861_100096713 3300005719 Bacteria 2341
231 Ga0068861_100616168 3300005719 Bacteria 998
232 Ga0068861_101410382 3300005719 Bacteria 681
233 Ga0068863_100006559 3300005841 Bacteria 11425
234 Ga0068863_100014719 3300005841 Bacteria 7528
235 Ga0068863_100564022 3300005841 Bacteria 1125
236 Ga0068858_100007474 3300005842 Bacteria 10564
237 Ga0068858_100018374 3300005842 Bacteria 6547
238 Ga0068858_100113023 3300005842 Bacteria 2536
239 Ga0068858_100837044 3300005842 Bacteria 898
240 Ga0068860_100020068 3300005843 Bacteria 6474
241 Ga0068860_100023289 3300005843 Bacteria 5985
242 Ga0068860_100034183 3300005843 Bacteria 4875
243 Ga0068860_100185203 3300005843 Bacteria 2013
244 Ga0068862_100001114 3300005844 Bacteria 25468
245 Ga0068862_100001902 3300005844 Bacteria 18953
246 Ga0068862_100009745 3300005844 Bacteria 7942
247 Ga0068862_100052987 3300005844 Bacteria 3473
248 Ga0068862_100063881 3300005844 Bacteria 3168
249 Ga0068862_100357455 3300005844 Bacteria 1356
250 Ga0081539_10056861 3300005985 Bacteria 2168
251 Ga0075364_10381666 3300006051 Unclassified 961
252 Ga0075364_10385664 3300006051 Unclassified 956
253 Ga0075364_10508364 3300006051 Bacteria 824
254 Ga0075362_10250993 3300006177 Unclassified 870
255 Ga0075366_10100257 3300006195 Unclassified 1738
256 Ga0097621_100069022 3300006237 Bacteria 2917
257 Ga0097621_100083883 3300006237 Bacteria 2656
258 Ga0068871_100053949 3300006358 Bacteria 3260
259 Ga0068871_100340918 3300006358 Bacteria 1323
260 Ga0075428_100135257 3300006844 Bacteria 2681
261 Ga0075430_100752235 3300006846 Bacteria 803
262 Ga0075431_100077167 3300006847 Bacteria 3438
263 Ga0075433_10003509 3300006852 Bacteria 12116
264 Ga0075434_101206200 3300006871 Bacteria 769
265 Ga0075429_101327121 3300006880 Bacteria 627
266 Ga0068865_100096387 3300006881 Bacteria 2157
267 Ga0097620_100033192 3300006931 Bacteria 5184
268 Ga0097620_100052188 3300006931 Bacteria 4110
269 Ga0097620_100058069 3300006931 Bacteria 3897
270 Ga0097620_100580055 3300006931 Bacteria 1215
271 Ga0105240_10764768 3300009093 Bacteria 1049
272 Ga0111539_10288288 3300009094 Bacteria 1910
273 Ga0111539_10454878 3300009094 Bacteria 1491
274 Ga0105245_10053211 3300009098 Bacteria 3633
275 Ga0105245_10208509 3300009098 Bacteria 1880
276 Ga0105245_10382139 3300009098 Bacteria 1402
277 Ga0105245_10912541 3300009098 Bacteria 920
278 Ga0114129_11209654 3300009147 Bacteria 941
279 Ga0105243_10153806 3300009148 Bacteria 1976
280 Ga0105241_10196008 3300009174 Bacteria 1684
281 Ga0105248_10014420 3300009177 Bacteria 8699
282 Ga0105248_10060129 3300009177 Bacteria 4265
283 Ga0105248_10073709 3300009177 Bacteria 3836
284 Ga0105248_10237202 3300009177 Bacteria 2053
285 Ga0105248_11091511 3300009177 Bacteria 902
286 Ga0105238_10084942 3300009551 Bacteria 3154
287 Ga0105249_10022558 3300009553 Bacteria 5639
288 Ga0105249_10091809 3300009553 Bacteria 2842
289 Ga0105249_10150285 3300009553 Bacteria 2242
290 Ga0105249_10588969 3300009553 Bacteria 1166
291 Ga0105249_10695981 3300009553 Bacteria 1076
292 Ga0105239_10164811 3300010375 Bacteria 2478
293 Ga0105246_10072138 3300011119 Bacteria 2433
294 Ga0105246_10386074 3300011119 Bacteria 1159
295 Ga0105246_10451415 3300011119 Bacteria 1080
296 Ga0157316_1005979 3300012510 Bacteria 982
297 Ga0157373_10024258 3300013100 Bacteria 4395
298 Ga0157373_10080028 3300013100 Bacteria 2304
299 Ga0157373_10086890 3300013100 Bacteria 2203
300 Ga0157373_10149182 3300013100 Bacteria 1645
301 Ga0157373_10528102 3300013100 Bacteria 854
302 Ga0157371_10069194 3300013102 Bacteria 2499
303 Ga0157371_10077393 3300013102 Bacteria 2355
304 Ga0157371_10435119 3300013102 Bacteria 963
305 Ga0157370_10014333 3300013104 Bacteria 8111
306 Ga0157370_10224176 3300013104 Bacteria 1741
307 Ga0157369_10005512 3300013105 Bacteria 14699
308 Ga0157374_10384378 3300013296 Bacteria 1398
309 Ga0157378_10216506 3300013297 Bacteria 1819
310 Ga0157378_10335579 3300013297 Bacteria 1473
311 Ga0163162_10023647 3300013306 Bacteria 6067
312 Ga0163162_10191961 3300013306 Bacteria 2170
313 Ga0163162_10604914 3300013306 Bacteria 1222
314 Ga0157372_10073164 3300013307 Bacteria 3862
315 Ga0157372_10437423 3300013307 Unclassified 1525
316 Ga0157372_10647552 3300013307 Bacteria 1231
317 Ga0157372_10951032 3300013307 Bacteria 996
318 Ga0157372_12332655 3300013307 Unclassified 615
319 Ga0157375_10020096 3300013308 Bacteria 6095
320 Ga0157375_10036902 3300013308 Bacteria 4678
321 Ga0157375_10095432 3300013308 Bacteria 3045
322 Ga0157375_10605058 3300013308 Bacteria 1255
323 Ga0157375_10867233 3300013308 Bacteria 1048
324 Ga0163163_10011391 3300014325 Bacteria 8062
325 Ga0163163_10157261 3300014325 Bacteria 2317
326 Ga0163163_10911318 3300014325 Bacteria 942
327 Ga0157380_10005666 3300014326 Bacteria 8733
328 Ga0157380_10007456 3300014326 Bacteria 7767
329 Ga0157380_10076484 3300014326 Bacteria 2724
330 Ga0157380_10187015 3300014326 Unclassified 1825
331 Ga0157377_10025692 3300014745 Bacteria 3143
332 Ga0157377_10119155 3300014745 Bacteria 1597
333 Ga0157377_10171351 3300014745 Bacteria 1358
334 Ga0157379_10265558 3300014968 Bacteria 1560
335 Ga0157379_10537509 3300014968 Bacteria 1086
336 Ga0163161_10036821 3300017792 Bacteria 3505
337 Ga0163161_10039145 3300017792 Bacteria 3402
338 Ga0163161_10614693 3300017792 Bacteria 897
339 Ga0207697_10000872 3300025315 Bacteria 17097
340 Ga0207697_10045407 3300025315 Bacteria 1808
341 Ga0207682_10002944 3300025893 Bacteria 7496
342 Ga0207682_10005062 3300025893 Bacteria 5401
343 Ga0207682_10023187 3300025893 Bacteria 2450
344 Ga0207682_10092089 3300025893 Bacteria 1316
345 Ga0207688_10011568 3300025901 Bacteria 4802
346 Ga0207688_10020097 3300025901 Bacteria 3644
347 Ga0207688_10096098 3300025901 Bacteria 1706
348 Ga0207688_10146006 3300025901 Bacteria 1395
349 Ga0207688_10241600 3300025901 Unclassified 1092
350 Ga0207688_10282353 3300025901 Bacteria 1012
351 Ga0207688_10493723 3300025901 Bacteria 766
352 Ga0207680_10027901 3300025903 Bacteria 3152
353 Ga0207647_10000304 3300025904 Bacteria 40516
354 Ga0207647_10023827 3300025904 Bacteria 4043
355 Ga0207647_10051566 3300025904 Bacteria 2542
356 Ga0207647_10160373 3300025904 Bacteria 1312
357 Ga0207647_10271031 3300025904 Bacteria 970
358 Ga0207647_10460059 3300025904 Bacteria 712
359 Ga0207647_10754153 3300025904 Bacteria 527
360 Ga0207645_10013271 3300025907 Bacteria 5558
361 Ga0207645_10100959 3300025907 Bacteria 1861
362 Ga0207645_10118246 3300025907 Bacteria 1719
363 Ga0207645_10430187 3300025907 Bacteria 890
364 Ga0207643_10187008 3300025908 Bacteria 1256
365 Ga0207705_10025958 3300025909 Bacteria 4180
366 Ga0207705_10042065 3300025909 Bacteria 3280
367 Ga0207705_10083736 3300025909 Bacteria 2327
368 Ga0207705_11156475 3300025909 Unclassified 595
369 Ga0207707_10052736 3300025912 Bacteria 3540
370 Ga0207707_10207882 3300025912 Bacteria 1706
371 Ga0207707_10750399 3300025912 Bacteria 816
372 Ga0207695_10559536 3300025913 Bacteria 1025
373 Ga0207660_11239313 3300025917 Bacteria 607
374 Ga0207662_10048828 3300025918 Bacteria 2509
375 Ga0207662_10058199 3300025918 Bacteria 2313
376 Ga0207657_10004622 3300025919 Bacteria 14538
377 Ga0207657_10007288 3300025919 Bacteria 11347
378 Ga0207657_10019578 3300025919 Bacteria 6421
379 Ga0207657_10130296 3300025919 Bacteria 2062
380 Ga0207657_10196355 3300025919 Bacteria 1625
381 Ga0207657_10465522 3300025919 Unclassified 991
382 Ga0207657_10860596 3300025919 Unclassified 699
383 Ga0207649_10125358 3300025920 Bacteria 1737
384 Ga0207649_10202769 3300025920 Bacteria 1402
385 Ga0207649_10367375 3300025920 Unclassified 1069
386 Ga0207681_10001202 3300025923 Bacteria 16646
387 Ga0207681_10037400 3300025923 Bacteria 3208
388 Ga0207681_10047827 3300025923 Bacteria 2884
389 Ga0207681_10570718 3300025923 Bacteria 933
390 Ga0207681_11145713 3300025923 Bacteria 653
391 Ga0207694_10130208 3300025924 Bacteria 2016
392 Ga0207650_10002617 3300025925 Bacteria 12461
393 Ga0207650_10075119 3300025925 Bacteria 2549
394 Ga0207650_10079010 3300025925 Bacteria 2491
395 Ga0207650_10097894 3300025925 Bacteria 2253
396 Ga0207650_10107144 3300025925 Bacteria 2159
397 Ga0207650_10107395 3300025925 Bacteria 2156
398 Ga0207650_10392147 3300025925 Bacteria 1148
399 Ga0207659_10000979 3300025926 Bacteria 17034
400 Ga0207659_10004864 3300025926 Bacteria 8142
401 Ga0207659_10209799 3300025926 Bacteria 1560
402 Ga0207659_10251249 3300025926 Bacteria 1435
403 Ga0207659_10297523 3300025926 Bacteria 1324
404 Ga0207659_10340039 3300025926 Bacteria 1243
405 Ga0207659_10350787 3300025926 Bacteria 1224
406 Ga0207659_11131015 3300025926 Bacteria 674
407 Ga0207687_10119334 3300025927 Bacteria 1970
408 Ga0207687_10224756 3300025927 Bacteria 1480
409 Ga0207687_10248340 3300025927 Bacteria 1413
410 Ga0207644_10006138 3300025931 Bacteria 7836
411 Ga0207644_10363017 3300025931 Bacteria 1178
412 Ga0207644_10527648 3300025931 Bacteria 976
413 Ga0207644_10653945 3300025931 Unclassified 875
414 Ga0207644_10796512 3300025931 Bacteria 790
415 Ga0207690_10000005 3300025932 Bacteria 581199
416 Ga0207690_10002267 3300025932 Bacteria 11728
417 Ga0207690_10006400 3300025932 Bacteria 6980
418 Ga0207690_10041857 3300025932 Bacteria 3005
419 Ga0207690_10047947 3300025932 Bacteria 2837
420 Ga0207690_10049712 3300025932 Bacteria 2796
421 Ga0207690_10501579 3300025932 Bacteria 982
422 Ga0207706_10000461 3300025933 Bacteria 43387
423 Ga0207706_10001629 3300025933 Bacteria 22265
424 Ga0207706_10003866 3300025933 Bacteria 14256
425 Ga0207706_10009055 3300025933 Bacteria 9158
426 Ga0207706_10009959 3300025933 Bacteria 8711
427 Ga0207706_10015193 3300025933 Bacteria 6967
428 Ga0207706_10069320 3300025933 Bacteria 3102
429 Ga0207706_10222033 3300025933 Bacteria 1654
430 Ga0207706_10237704 3300025933 Bacteria 1593
431 Ga0207706_10280476 3300025933 Bacteria 1453
432 Ga0207706_10416309 3300025933 Bacteria 1164
433 Ga0207709_10312934 3300025935 Bacteria 1172
434 Ga0207670_10300293 3300025936 Bacteria 1257
435 Ga0207670_10383520 3300025936 Bacteria 1120
436 Ga0207669_10041884 3300025937 Bacteria 2669
437 Ga0207669_10045242 3300025937 Bacteria 2592
438 Ga0207669_10255919 3300025937 Bacteria 1306
439 Ga0207669_10897128 3300025937 Bacteria 740
440 Ga0207704_10445806 3300025938 Bacteria 1032
441 Ga0207691_10003132 3300025940 Bacteria 16163
442 Ga0207691_10008707 3300025940 Bacteria 9736
443 Ga0207691_10039371 3300025940 Bacteria 4374
444 Ga0207691_10183083 3300025940 Bacteria 1830
445 Ga0207691_10542081 3300025940 Bacteria 987
446 Ga0207711_10024292 3300025941 Bacteria 5075
447 Ga0207711_10050585 3300025941 Bacteria 3557
448 Ga0207711_10056329 3300025941 Bacteria 3378
449 Ga0207689_10086861 3300025942 Bacteria 2570
450 Ga0207689_10678058 3300025942 Bacteria 869
451 Ga0207679_10024562 3300025945 Bacteria 4133
452 Ga0207679_10024758 3300025945 Bacteria 4118
453 Ga0207679_10028133 3300025945 Bacteria 3897
454 Ga0207679_10032629 3300025945 Bacteria 3658
455 Ga0207679_10227758 3300025945 Bacteria 1572
456 Ga0207679_10333048 3300025945 Unclassified 1318
457 Ga0207679_10467572 3300025945 Bacteria 1121
458 Ga0207679_10606482 3300025945 Bacteria 987
459 Ga0207667_10025784 3300025949 Bacteria 6431
460 Ga0207651_10031994 3300025960 Bacteria 3372
461 Ga0207651_10425389 3300025960 Bacteria 1135
462 Ga0207712_10000195 3300025961 Bacteria 62560
463 Ga0207712_10126102 3300025961 Bacteria 1944
464 Ga0207712_10624699 3300025961 Bacteria 934
465 Ga0207668_10002536 3300025972 Bacteria 10669
466 Ga0207668_10081270 3300025972 Bacteria 2350
467 Ga0207668_10099173 3300025972 Bacteria 2160
468 Ga0207668_10381084 3300025972 Bacteria 1187
469 Ga0207668_11144692 3300025972 Bacteria 698
470 Ga0207640_10022993 3300025981 Bacteria 3741
471 Ga0207640_10162695 3300025981 Bacteria 1653
472 Ga0207640_10374474 3300025981 Bacteria 1152
473 Ga0207640_10682599 3300025981 Bacteria 878
474 Ga0207640_11163231 3300025981 Bacteria 685
475 Ga0207640_11185408 3300025981 Bacteria 678
476 Ga0207658_10007131 3300025986 Bacteria 7614
477 Ga0207658_10019289 3300025986 Bacteria 4715
478 Ga0207677_10000044 3300026023 Bacteria 107614
479 Ga0207677_10027383 3300026023 Bacteria 3589
480 Ga0207677_10166374 3300026023 Unclassified 1719
481 Ga0207677_10293227 3300026023 Bacteria 1341
482 Ga0207677_10349564 3300026023 Bacteria 1238
483 Ga0207703_10012934 3300026035 Bacteria 6504
484 Ga0207703_10032033 3300026035 Bacteria 4159
485 Ga0207703_10858571 3300026035 Bacteria 868
486 Ga0207639_10110017 3300026041 Bacteria 2244
487 Ga0207639_10781960 3300026041 Unclassified 889
488 Ga0207639_11168276 3300026041 Unclassified 722
489 Ga0207678_10001437 3300026067 Bacteria 21856
490 Ga0207678_10022031 3300026067 Bacteria 5583
491 Ga0207678_10026141 3300026067 Bacteria 5093
492 Ga0207678_10065278 3300026067 Bacteria 3126
493 Ga0207678_10456101 3300026067 Bacteria 1112
494 Ga0207678_10605920 3300026067 Bacteria 960
495 Ga0207708_10209607 3300026075 Bacteria 1557
496 Ga0207708_10566266 3300026075 Bacteria 959
497 Ga0207702_10194615 3300026078 Bacteria 1876
498 Ga0207641_10076459 3300026088 Bacteria 2894
499 Ga0207641_10418790 3300026088 Bacteria 1289
500 Ga0207648_10132865 3300026089 Bacteria 2191
501 Ga0207648_10193697 3300026089 Bacteria 1802
502 Ga0207676_10221250 3300026095 Unclassified 1686
503 Ga0207676_10266542 3300026095 Bacteria 1549
504 Ga0207676_10610516 3300026095 Bacteria 1049
505 Ga0207676_11040605 3300026095 Bacteria 808
506 Ga0207674_10000082 3300026116 Bacteria 101650
507 Ga0207674_10000742 3300026116 Bacteria 42731
508 Ga0207674_10021934 3300026116 Bacteria 6868
509 Ga0207674_10024895 3300026116 Bacteria 6388
510 Ga0207674_10039213 3300026116 Bacteria 4912
511 Ga0207674_11405553 3300026116 Bacteria 667
512 Ga0207675_100118250 3300026118 Bacteria 2506
513 Ga0207675_100254848 3300026118 Bacteria 1699
514 Ga0207675_100374588 3300026118 Bacteria 1399
515 Ga0207675_100533263 3300026118 Bacteria 1171
516 Ga0207675_100572267 3300026118 Bacteria 1130
517 Ga0207683_10039447 3300026121 Bacteria 4120
518 Ga0207683_10124907 3300026121 Bacteria 2312
519 Ga0207683_10593936 3300026121 Bacteria 1025
520 Ga0207698_10016251 3300026142 Bacteria 5011
521 Ga0207698_10755462 3300026142 Bacteria 972
522 Ga0209983_1049604 3300027665 Bacteria 917
523 Ga0209974_10021493 3300027876 Bacteria 2137
524 Ga0209974_10060753 3300027876 Bacteria 1279
525 Ga0209974_10145744 3300027876 Bacteria 852
526 Ga0209974_10202678 3300027876 Bacteria 733
527 Ga0268266_10000998 3300028379 Bacteria 35702
528 Ga0268266_10014168 3300028379 Bacteria 6860
529 Ga0268266_10076810 3300028379 Bacteria 2903
530 Ga0268266_10165258 3300028379 Bacteria 2004
531 Ga0268265_10000904 3300028380 Bacteria 27551
532 Ga0268265_10001512 3300028380 Bacteria 19417
533 Ga0268265_10031556 3300028380 Bacteria 3827
534 Ga0268265_10068935 3300028380 Bacteria 2745
535 Ga0268265_10071917 3300028380 Bacteria 2696
536 Ga0268265_10137565 3300028380 Bacteria 2040
537 Ga0268265_10414514 3300028380 Bacteria 1249
538 Ga0268265_10435077 3300028380 Bacteria 1221
539 Ga0268265_11177260 3300028380 Bacteria 763
540 Ga0268265_11310675 3300028380 Bacteria 724
541 Ga0268265_11517088 3300028380 Unclassified 674
542 Ga0268264_10001156 3300028381 Bacteria 25715
543 Ga0268264_10016372 3300028381 Bacteria 6070
544 Ga0268264_10082038 3300028381 Bacteria 2758
545 Ga0268264_10424242 3300028381 Bacteria 1283
546 Ga0268264_11757047 3300028381 Bacteria 630
547 Ga0268264_12586980 3300028381 Unclassified 512
548 Ga0316179_1056112 3300030734 Bacteria 672
549 Ga0316178_1062952 3300030735 Bacteria 712
550 Ga0316183_1160958 3300030742 Unclassified 1469
551 Ga0316182_1344640 3300030745 Bacteria 1047
552 Ga0307408_100019904 3300031548 Bacteria 4522
553 Ga0307408_100035684 3300031548 Bacteria 3491
554 Ga0307408_100043480 3300031548 Bacteria 3196
555 Ga0307408_100061767 3300031548 Bacteria 2735
556 Ga0307408_100072183 3300031548 Bacteria 2555
557 Ga0307408_100311447 3300031548 Bacteria 1323
558 Ga0307408_100330488 3300031548 Bacteria 1287
559 Ga0307408_100389029 3300031548 Bacteria 1194
560 Ga0307408_100432551 3300031548 Bacteria 1137
561 Ga0307408_100574806 3300031548 Bacteria 998
562 Ga0307408_100623078 3300031548 Bacteria 961
563 Ga0307408_100639890 3300031548 Unclassified 949
564 Ga0307408_100932417 3300031548 Unclassified 796
565 Ga0307408_100976075 3300031548 Bacteria 779
566 Ga0307408_101098701 3300031548 Bacteria 737
567 Ga0307405_10008446 3300031731 Bacteria 5221
568 Ga0307405_10013596 3300031731 Bacteria 4346
569 Ga0307405_10022923 3300031731 Bacteria 3538
570 Ga0307405_10023179 3300031731 Bacteria 3524
571 Ga0307405_10034602 3300031731 Bacteria 3008
572 Ga0307405_10057311 3300031731 Unclassified 2447
573 Ga0307405_10078740 3300031731 Bacteria 2146
574 Ga0307405_10093998 3300031731 Bacteria 1993
575 Ga0307405_10132311 3300031731 Bacteria 1725
576 Ga0307405_10360603 3300031731 Bacteria 1124
577 Ga0307405_10377992 3300031731 Unclassified 1102
578 Ga0307405_10430862 3300031731 Bacteria 1040
579 Ga0307405_10515705 3300031731 Bacteria 961
580 Ga0307405_10903722 3300031731 Bacteria 747
581 Ga0307413_10000319 3300031824 Bacteria 14991
582 Ga0307413_10008490 3300031824 Bacteria 4854
583 Ga0307413_10009685 3300031824 Bacteria 4624
584 Ga0307413_10023295 3300031824 Bacteria 3354
585 Ga0307413_10066071 3300031824 Bacteria 2255
586 Ga0307413_10071081 3300031824 Bacteria 2191
587 Ga0307413_10082162 3300031824 Bacteria 2069
588 Ga0307413_10108962 3300031824 Bacteria 1849
589 Ga0307413_10147705 3300031824 Bacteria 1634
590 Ga0307413_10151384 3300031824 Bacteria 1617
591 Ga0307413_10306658 3300031824 Bacteria 1206
592 Ga0307413_10435205 3300031824 Bacteria 1037
593 Ga0307413_10485821 3300031824 Bacteria 988
594 Ga0307413_10627171 3300031824 Bacteria 883
595 Ga0307413_10663729 3300031824 Bacteria 862
596 Ga0307413_11237145 3300031824 Bacteria 651
597 Ga0307410_10002711 3300031852 Bacteria 8644
598 Ga0307410_10004584 3300031852 Bacteria 7168
599 Ga0307410_10005320 3300031852 Bacteria 6797
600 Ga0307410_10016702 3300031852 Bacteria 4387
601 Ga0307410_10025787 3300031852 Bacteria 3692
602 Ga0307410_10040427 3300031852 Bacteria 3068
603 Ga0307410_10054710 3300031852 Bacteria 2706
604 Ga0307410_10070650 3300031852 Bacteria 2419
605 Ga0307410_10081451 3300031852 Bacteria 2274
606 Ga0307410_10122112 3300031852 Bacteria 1901
607 Ga0307410_10130862 3300031852 Bacteria 1843
608 Ga0307410_10144070 3300031852 Unclassified 1766
609 Ga0307410_10161100 3300031852 Bacteria 1681
610 Ga0307410_10297937 3300031852 Bacteria 1271
611 Ga0307410_10308761 3300031852 Bacteria 1251
612 Ga0307410_10356986 3300031852 Bacteria 1169
613 Ga0307410_10375629 3300031852 Bacteria 1142
614 Ga0307410_10514884 3300031852 Bacteria 986
615 Ga0307410_10983949 3300031852 Bacteria 727
616 Ga0307410_11327565 3300031852 Bacteria 630
617 Ga0307406_10020360 3300031901 Bacteria 3906
618 Ga0307406_10026376 3300031901 Bacteria 3488
619 Ga0307406_10310496 3300031901 Bacteria 1215
620 Ga0307406_10351337 3300031901 Bacteria 1152
621 Ga0307406_10382494 3300031901 Bacteria 1110
622 Ga0307406_10530577 3300031901 Bacteria 959
623 Ga0307406_10639311 3300031901 Bacteria 882
624 Ga0307406_10674852 3300031901 Unclassified 860
625 Ga0307406_10749816 3300031901 Bacteria 819
626 Ga0307406_11233935 3300031901 Bacteria 650
627 Ga0307407_10001271 3300031903 Bacteria 8988
628 Ga0307407_10007630 3300031903 Bacteria 4910
629 Ga0307407_10015882 3300031903 Bacteria 3735
630 Ga0307407_10057832 3300031903 Bacteria 2251
631 Ga0307407_10063805 3300031903 Bacteria 2163
632 Ga0307407_10300651 3300031903 Bacteria 1119
633 Ga0307407_10325458 3300031903 Bacteria 1080
634 Ga0307407_10384735 3300031903 Unclassified 1003
635 Ga0307407_10522056 3300031903 Bacteria 873
636 Ga0307407_11025696 3300031903 Bacteria 638
637 Ga0307407_11041620 3300031903 Bacteria 634
638 Ga0307407_11227274 3300031903 Bacteria 586
639 Ga0307412_10012093 3300031911 Bacteria 5018
640 Ga0307412_10022909 3300031911 Bacteria 3835
641 Ga0307412_10025242 3300031911 Bacteria 3678
642 Ga0307412_10027237 3300031911 Bacteria 3561
643 Ga0307412_10028208 3300031911 Bacteria 3509
644 Ga0307412_10182292 3300031911 Bacteria 1580
645 Ga0307412_10207483 3300031911 Unclassified 1492
646 Ga0307412_10261446 3300031911 Bacteria 1349
647 Ga0307412_10360935 3300031911 Bacteria 1170
648 Ga0307412_10373222 3300031911 Bacteria 1152
649 Ga0307412_10473286 3300031911 Bacteria 1037
650 Ga0307412_10797968 3300031911 Unclassified 819
651 Ga0307412_10865982 3300031911 Bacteria 789
652 Ga0307409_100001246 3300031995 Bacteria 12261
653 Ga0307409_100005066 3300031995 Bacteria 7512
654 Ga0307409_100008713 3300031995 Bacteria 6180
655 Ga0307409_100009020 3300031995 Bacteria 6101
656 Ga0307409_100010184 3300031995 Bacteria 5827
657 Ga0307409_100023711 3300031995 Bacteria 4260
658 Ga0307409_100026480 3300031995 Bacteria 4090
659 Ga0307409_100027250 3300031995 Bacteria 4047
660 Ga0307409_100028293 3300031995 Bacteria 3990
661 Ga0307409_100032981 3300031995 Bacteria 3762
662 Ga0307409_100046073 3300031995 Bacteria 3298
663 Ga0307409_100124659 3300031995 Bacteria 2189
664 Ga0307409_100179781 3300031995 Bacteria 1871
665 Ga0307409_100200258 3300031995 Bacteria 1786
666 Ga0307409_100515620 3300031995 Bacteria 1167
667 Ga0307409_100608442 3300031995 Bacteria 1081
668 Ga0307409_100616188 3300031995 Bacteria 1075
669 Ga0307409_100672312 3300031995 Bacteria 1032
670 Ga0307409_100843267 3300031995 Bacteria 927
671 Ga0307409_102368127 3300031995 Bacteria 560
672 Ga0307416_100023149 3300032002 Bacteria 4502
673 Ga0307416_100025962 3300032002 Bacteria 4308
674 Ga0307416_100031424 3300032002 Bacteria 3997
675 Ga0307416_100041998 3300032002 Bacteria 3566
676 Ga0307416_100068215 3300032002 Bacteria 2937
677 Ga0307416_100134485 3300032002 Bacteria 2233
678 Ga0307416_100165618 3300032002 Bacteria 2050
679 Ga0307416_100228851 3300032002 Bacteria 1790
680 Ga0307416_100263505 3300032002 Bacteria 1686
681 Ga0307416_100271308 3300032002 Bacteria 1666
682 Ga0307416_100315136 3300032002 Bacteria 1563
683 Ga0307416_100368095 3300032002 Bacteria 1462
684 Ga0307416_100615778 3300032002 Bacteria 1167
685 Ga0307416_101000005 3300032002 Bacteria 939
686 Ga0307416_101075690 3300032002 Bacteria 908
687 Ga0307416_101191247 3300032002 Bacteria 867
688 Ga0307416_101199617 3300032002 Bacteria 864
689 Ga0307416_101430796 3300032002 Bacteria 797
690 Ga0307416_101702028 3300032002 Bacteria 735
691 Ga0307414_10003327 3300032004 Bacteria 8580
692 Ga0307414_10006791 3300032004 Bacteria 6402
693 Ga0307414_10006964 3300032004 Bacteria 6336
694 Ga0307414_10016846 3300032004 Bacteria 4456
695 Ga0307414_10025948 3300032004 Bacteria 3763
696 Ga0307414_10026489 3300032004 Bacteria 3732
697 Ga0307414_10037607 3300032004 Bacteria 3243
698 Ga0307414_10037860 3300032004 Bacteria 3233
699 Ga0307414_10051077 3300032004 Bacteria 2868
700 Ga0307414_10131034 3300032004 Bacteria 1946
701 Ga0307414_10167642 3300032004 Bacteria 1752
702 Ga0307414_10172571 3300032004 Bacteria 1730
703 Ga0307414_10199146 3300032004 Bacteria 1627
704 Ga0307414_10239853 3300032004 Bacteria 1500
705 Ga0307414_10288225 3300032004 Bacteria 1383
706 Ga0307414_10326095 3300032004 Bacteria 1309
707 Ga0307414_10330477 3300032004 Bacteria 1301
708 Ga0307414_10453262 3300032004 Bacteria 1125
709 Ga0307414_10661206 3300032004 Bacteria 943
710 Ga0307414_10828917 3300032004 Bacteria 845
711 Ga0307414_10917547 3300032004 Bacteria 803
712 Ga0307414_10943336 3300032004 Bacteria 793
713 Ga0307414_11306250 3300032004 Bacteria 673
714 Ga0307411_10001005 3300032005 Bacteria 10875
715 Ga0307411_10001575 3300032005 Bacteria 9463
716 Ga0307411_10001921 3300032005 Bacteria 8881
717 Ga0307411_10008808 3300032005 Bacteria 5253
718 Ga0307411_10009521 3300032005 Bacteria 5114
719 Ga0307411_10011850 3300032005 Bacteria 4728
720 Ga0307411_10014233 3300032005 Bacteria 4419
721 Ga0307411_10017316 3300032005 Bacteria 4102
722 Ga0307411_10022483 3300032005 Bacteria 3713
723 Ga0307411_10025884 3300032005 Bacteria 3522
724 Ga0307411_10026777 3300032005 Bacteria 3476
725 Ga0307411_10041864 3300032005 Bacteria 2918
726 Ga0307411_10059709 3300032005 Bacteria 2529
727 Ga0307411_10083042 3300032005 Bacteria 2211
728 Ga0307411_10116120 3300032005 Bacteria 1926
729 Ga0307411_10145995 3300032005 Bacteria 1751
730 Ga0307411_10194872 3300032005 Bacteria 1550
731 Ga0307411_10214329 3300032005 Bacteria 1489
732 Ga0307411_10289936 3300032005 Bacteria 1307
733 Ga0307411_11089570 3300032005 Bacteria 719
734 Ga0307411_11103354 3300032005 Bacteria 715
735 Ga0307411_11660088 3300032005 Bacteria 591
736 Ga0307415_100001667 3300032126 Bacteria 10778
737 Ga0307415_100005954 3300032126 Bacteria 6532
738 Ga0307415_100027881 3300032126 Bacteria 3584
739 Ga0307415_100056224 3300032126 Bacteria 2696
740 Ga0307415_100081327 3300032126 Bacteria 2314
741 Ga0307415_100118017 3300032126 Bacteria 1983
742 Ga0307415_100139339 3300032126 Bacteria 1850
743 Ga0307415_100354775 3300032126 Bacteria 1236
744 Ga0307415_100455107 3300032126 Bacteria 1107
745 Ga0307415_100558678 3300032126 Bacteria 1011
746 Ga0307415_100632863 3300032126 Bacteria 957
747 Ga0307415_100666268 3300032126 Bacteria 935
748 Ga0307415_100696523 3300032126 Bacteria 916
749 Ga0307415_100802005 3300032126 Bacteria 859
750 Ga0307415_100902747 3300032126 Bacteria 814
751 Ga0307415_100986397 3300032126 Bacteria 782
752 Ga0307415_100997809 3300032126 Bacteria 778
753 Ga0307415_101443971 3300032126 Bacteria 656
754 Ga0307415_101444874 3300032126 Bacteria 656
755 Ga0307415_101811480 3300032126 Bacteria 591
756 Ga0373929_0040180 3300035085 Bacteria 1036
757 Ga0373940_0081264 3300035088 Bacteria 958
758 Ga0373943_0633214 3300035170 Unclassified 631
759 Ga0373961_0043720 3300035241 Unclassified 1304
760 Ga0373925_1325710 3300037068 Unclassified 590
761 Ga0395899_0001981 3300037312 Bacteria 16845
762 Ga0395899_0034165 3300037312 Bacteria 3817
763 Ga0395899_0113561 3300037312 Bacteria 1945
764 Ga0395899_0230862 3300037312 Bacteria 1278
765 Ga0395899_0237272 3300037312 Bacteria 1256
766 Ga0395899_0384441 3300037312 Unclassified 932
767 Ga0395899_0385080 3300037312 Bacteria 931
768 Ga0395900_0004556 3300037418 Bacteria 14642
769 Ga0395900_0011699 3300037418 Bacteria 8977
770 Ga0395900_0025568 3300037418 Bacteria 6044
771 Ga0395900_0046262 3300037418 Bacteria 4481
772 Ga0395900_0053286 3300037418 Bacteria 4163
773 Ga0395900_0069803 3300037418 Bacteria 3612
774 Ga0395900_0073606 3300037418 Bacteria 3513
775 Ga0395900_0080624 3300037418 Bacteria 3344
776 Ga0395900_0086841 3300037418 Bacteria 3215
777 Ga0395900_0092984 3300037418 Bacteria 3098
778 Ga0395900_0107834 3300037418 Bacteria 2861
779 Ga0395900_0130171 3300037418 Bacteria 2579
780 Ga0395900_0139530 3300037418 Bacteria 2483
781 Ga0395900_0155170 3300037418 Bacteria 2338
782 Ga0395900_0497812 3300037418 Bacteria 1169
783 Ga0395900_0559124 3300037418 Bacteria 1088
784 Ga0395900_0578347 3300037418 Bacteria 1065
785 Ga0395900_0668368 3300037418 Unclassified 974
786 Ga0395900_0849700 3300037418 Unclassified 838
787 Ga0395898_0014031 3300037466 Bacteria 8234
788 Ga0395898_0133510 3300037466 Bacteria 2377
789 Ga0395898_0168167 3300037466 Bacteria 2096
790 Ga0395898_0186335 3300037466 Bacteria 1983
791 Ga0395898_0349295 3300037466 Bacteria 1410
792 Ga0395898_0410494 3300037466 Unclassified 1291
793 Ga0395898_0760318 3300037466 Bacteria 910
794 Ga0395898_0851867 3300037466 Bacteria 851
795 Ga0395905_0001242 3300037471 Bacteria 31620
796 Ga0395905_0001527 3300037471 Bacteria 27687
797 Ga0395905_0002470 3300037471 Bacteria 20479
798 Ga0395905_0003328 3300037471 Bacteria 17250
799 Ga0395905_0004038 3300037471 Bacteria 15406
800 Ga0395905_0019750 3300037471 Bacteria 6387
801 Ga0395905_0030825 3300037471 Bacteria 5050
802 Ga0395905_0050418 3300037471 Bacteria 3899
803 Ga0395905_0059625 3300037471 Bacteria 3567
804 Ga0395905_0065629 3300037471 Bacteria 3398
805 Ga0395905_0084043 3300037471 Bacteria 2982
806 Ga0395905_0122767 3300037471 Bacteria 2442
807 Ga0395905_0127992 3300037471 Bacteria 2388
808 Ga0395905_0187306 3300037471 Bacteria 1942
809 Ga0395905_0193016 3300037471 Bacteria 1910
810 Ga0395905_0203400 3300037471 Bacteria 1856
811 Ga0395905_0236789 3300037471 Bacteria 1706
812 Ga0395905_0338046 3300037471 Bacteria 1396
813 Ga0395905_0536177 3300037471 Bacteria 1071
814 Ga0395905_0695347 3300037471 Unclassified 919
815 Ga0395905_1473018 3300037471 Bacteria 585
816 Ga0395901_0001188 3300038443 Bacteria 27720
817 Ga0395901_0014280 3300038443 Bacteria 8085
818 Ga0395901_0015098 3300038443 Bacteria 7855
819 Ga0395901_0024056 3300038443 Bacteria 6248
820 Ga0395901_0030229 3300038443 Bacteria 5581
821 Ga0395901_0033440 3300038443 Bacteria 5309
822 Ga0395901_0078177 3300038443 Bacteria 3454
823 Ga0395901_0105987 3300038443 Bacteria 2950
824 Ga0395901_0109977 3300038443 Bacteria 2893
825 Ga0395901_0133446 3300038443 Unclassified 2609
826 Ga0395901_0143071 3300038443 Bacteria 2514
827 Ga0395901_0149387 3300038443 Bacteria 2455
828 Ga0395901_0173846 3300038443 Bacteria 2259
829 Ga0395901_0177652 3300038443 Bacteria 2233
830 Ga0395901_0210855 3300038443 Bacteria 2033
831 Ga0395901_0467794 3300038443 Bacteria 1287
832 Ga0395901_0675132 3300038443 Bacteria 1033
833 Ga0395901_0997261 3300038443 Bacteria 814
834 Ga0395901_1081543 3300038443 Bacteria 773
835 Ga0439453_0070174 3300041408 Bacteria 740
836 Ga0439465_0258952 3300041413 Unclassified 645
837 Ga0451797_0630063 3300041453 Bacteria 788
838 Ga0451853_3080815 3300041512 Bacteria 767
839 Ga0439445_0000012 3300042004 Bacteria 24357
840 Ga0439432_009664 3300042006 Bacteria 3357
841 Ga0439432_044080 3300042006 Bacteria 1406
842 Ga0439452_127219 3300042010 Bacteria 541
843 Ga0439462_0160594 3300042015 Bacteria 634
844 Ga0450920_041391 3300042122 Bacteria 919
845 Ga0450889_043135 3300042144 Bacteria 547
846 Ga0439458_0004512 3300042157 Bacteria 3190
847 Ga0439458_0008197 3300042157 Unclassified 2323
848 Ga0439464_0001790 3300042439 Bacteria 5181
849 Ga0495585_0040405 3300046492 Bacteria 2619
850 Ga0495585_0502373 3300046492 Bacteria 576
851 Ga0495643_0084158 3300046522 Bacteria 1651
852 Ga0495663_0001128 3300046525 Bacteria 8621
853 Ga0495663_0053707 3300046525 Bacteria 1253
854 Ga0495598_0053327 3300046537 Bacteria 1225
855 Ga0495621_0000662 3300046539 Bacteria 8715
856 Ga0495621_0001074 3300046539 Bacteria 7008
857 Ga0495621_0395426 3300046539 Unclassified 585
858 Ga0495633_0018106 3300046558 Bacteria 3582
859 Ga0495633_0204119 3300046558 Unclassified 907
860 Ga0495656_0210682 3300046615 Bacteria 968
861 Ga0495668_0035874 3300046616 Bacteria 2779
862 Ga0495659_0081053 3300046664 Unclassified 1232
863 Ga0495669_0018705 3300046684 Bacteria 2981
864 Ga0495669_0022815 3300046684 Bacteria 2720
865 Ga0495669_0029756 3300046684 Bacteria 2396
866 Ga0495669_0033465 3300046684 Bacteria 2262
867 Ga0495669_0060000 3300046684 Bacteria 1719
868 Ga0495669_0103219 3300046684 Bacteria 1326
869 Ga0495669_0122661 3300046684 Bacteria 1219
870 Ga0495669_0130680 3300046684 Unclassified 1182
871 Ga0495669_0355305 3300046684 Bacteria 708
872 Ga0495670_0017115 3300046691 Bacteria 3565
873 Ga0495670_0035432 3300046691 Bacteria 2487
874 Ga0495670_0062461 3300046691 Bacteria 1874
875 Ga0495670_0066826 3300046691 Bacteria 1814
876 Ga0495670_0132639 3300046691 Bacteria 1299
877 Ga0495670_0133657 3300046691 Bacteria 1294
878 Ga0495670_0214395 3300046691 Bacteria 1022
879 Ga0495670_0218956 3300046691 Bacteria 1011
880 Ga0495670_0272484 3300046691 Bacteria 904
881 Ga0495670_0459956 3300046691 Unclassified 690
882 Ga0495670_0650425 3300046691 Bacteria 574
883 Ga0495649_0497035 3300046694 Bacteria 607
884 Ga0495677_0035788 3300047445 Bacteria 1812
885 Ga0495677_0149316 3300047445 Bacteria 900
886 Ga0495677_0177323 3300047445 Unclassified 825
887 Ga0496101_0313061 3300048904 Bacteria 1231
888 Ga0496103_0075721 3300048906 Bacteria 2111
889 Ga0496107_0057217 3300048910 Bacteria 2819
890 Ga0496108_0080208 3300048911 Bacteria 2764
891 Ga0496108_0503963 3300048911 Bacteria 1057
892 Ga0496109_0280417 3300048912 Bacteria 1570
893 Ga0496109_1149241 3300048912 Bacteria 713
894 Ga0496110_0020696 3300048913 Bacteria 5556
895 Ga0496110_0026486 3300048913 Bacteria 4962
896 Ga0496110_0070286 3300048913 Bacteria 3102
897 Ga0496111_0005000 3300048914 Bacteria 8435
898 Ga0496111_0121349 3300048914 Bacteria 1930
899 Ga0496111_0446879 3300048914 Bacteria 954
900 Ga0496114_0494829 3300048917 Bacteria 1082
901 Ga0501292_006633 3300049515 Bacteria 1651
902 Ga0501298_076989 3300049521 Bacteria 728
903 Ga0501201_001558 3300049651 Bacteria 2134
904 Ga0501216_003241 3300049660 Bacteria 2366
905 Ga0501217_002297 3300049661 Bacteria 3739
906 Ga0501217_005889 3300049661 Bacteria 2580
907 Ga0501223_002150 3300049663 Bacteria 4419
908 Ga0501223_044313 3300049663 Bacteria 863
909 Ga0501224_003228 3300049664 Bacteria 2268
910 Ga0501233_009012 3300049668 Bacteria 1939
911 Ga0501233_043148 3300049668 Bacteria 1067
912 Ga0501235_002957 3300049669 Bacteria 3661
913 Ga0501235_002977 3300049669 Bacteria 3653
914 Ga0501239_014929 3300049672 Bacteria 903
915 Ga0501242_002043 3300049674 Bacteria 2101
916 Ga0501242_002375 3300049674 Bacteria 1974
917 Ga0501243_007634 3300049675 Bacteria 1656
918 Ga0501247_001257 3300049677 Bacteria 2384
919 Ga0501249_001192 3300049679 Bacteria 5457
920 Ga0501249_003332 3300049679 Bacteria 3224
921 Ga0501257_006689 3300049686 Bacteria 2562
922 Ga0501257_012293 3300049686 Bacteria 1958
923 Ga0501258_003203 3300049687 Bacteria 1487
924 Ga0501258_019933 3300049687 Bacteria 782
925 Ga0501259_017571 3300049688 Unclassified 1241
926 Ga0501259_084693 3300049688 Unclassified 703
927 Ga0501260_012994 3300049689 Bacteria 856
928 Ga0501225_0005177 3300049705 Bacteria 3840
929 Ga0501225_0005402 3300049705 Bacteria 3754
930 Ga0501229_007951 3300049706 Bacteria 1321
931 Ga0501245_035791 3300049708 Bacteria 837
932 Ga0501267_001906 3300049764 Bacteria 1838
933 Ga0501268_000191 3300049765 Bacteria 5791
934 Ga0501268_001804 3300049765 Bacteria 2733
935 Ga0501268_022476 3300049765 Bacteria 1089
936 Ga0501270_093263 3300049767 Bacteria 618
937 Ga0501272_004623 3300049769 Bacteria 1434
938 Ga0501273_000219 3300049770 Bacteria 4205
939 Ga0501279_049857 3300049775 Bacteria 662
940 Ga0501283_011441 3300049779 Bacteria 1320
941 Ga0501204_002087 3300049850 Bacteria 2013
942 Ga0501204_003941 3300049850 Bacteria 1581
943 Ga0501212_010090 3300049851 Bacteria 1340
944 nmdc:mga00v17_299183_c1 3300050491 Unclassified 1045
945 nmdc:mga00v17_390237_c1 3300050491 Unclassified 905
946 nmdc:mga0qj67_800384_c1 3300050509 Bacteria 746
947 nmdc:mga06r32_5441_c1 3300050510 Bacteria 11463
948 nmdc:mga08y16_140640_c1 3300050511 Bacteria 2509
949 nmdc:mga08y16_368194_c1 3300050511 Bacteria 1474
950 nmdc:mga0n895_1568891_c1 3300050512 Bacteria 623
951 nmdc:mga0n895_171861_c1 3300050512 Bacteria 2199
952 nmdc:mga0rr50_362822_c1 3300050513 Unclassified 1219
953 nmdc:mga0a205_696_c1 3300050515 Bacteria 26947
954 Ga0500658_0000022 3300053134 Bacteria 129341
955 Ga0501084_1472116 3300054114 Bacteria 570

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0050418 Ga0395905_0050418_3477_3887 136
2 3300038443 Ga0395901_1081543 Ga0395901_1081543_14_424 136
3 3300028381 Ga0268264_12586980 Ga0268264_125869801 141
4 3300005353 Ga0070669_100059200 Ga0070669_1000592003 145
5 3300005456 Ga0070678_100048694 Ga0070678_1000486943 145
6 3300009553 Ga0105249_10695981 Ga0105249_106959812 145
7 3300025961 Ga0207712_10624699 Ga0207712_106246992 145
8 3300028381 Ga0268264_11757047 Ga0268264_117570472 145
9 3300037471 Ga0395905_1473018 Ga0395905_1473018_32_475 146
10 3300005347 Ga0070668_100153584 Ga0070668_1001535842 147
11 3300025972 Ga0207668_11144692 Ga0207668_111446921 147
12 3300048911 Ga0496108_0080208 Ga0496108_0080208_2306_2749 147
13 3300046684 Ga0495669_0018705 Ga0495669_0018705_2137_2634 148
14 3300046537 Ga0495598_0053327 Ga0495598_0053327_650_1102 150
15 3300005356 Ga0070674_100892188 Ga0070674_1008921881 151
16 3300025937 Ga0207669_10897128 Ga0207669_108971281 151
17 3300028380 Ga0268265_11310675 Ga0268265_113106752 151
18 3300005564 Ga0070664_100223963 Ga0070664_1002239632 154
19 3300005577 Ga0068857_100140154 Ga0068857_1001401543 154
20 3300014745 Ga0157377_10171351 Ga0157377_101713512 154
21 3300026116 Ga0207674_10024895 Ga0207674_100248955 154
22 3300005331 Ga0070670_100006350 Ga0070670_10000635011 156
23 3300005543 Ga0070672_100139081 Ga0070672_1001390812 156
24 3300005564 Ga0070664_100039409 Ga0070664_1000394095 156
25 3300025925 Ga0207650_10075119 Ga0207650_100751193 156
26 3300025942 Ga0207689_10086861 Ga0207689_100868612 156
27 3300025945 Ga0207679_10024562 Ga0207679_100245624 156
28 3300031852 Ga0307410_11327565 Ga0307410_113275651 157
29 3300005366 Ga0070659_100126562 Ga0070659_1001265622 158
30 3300013307 Ga0157372_12332655 Ga0157372_123326551 159
31 3300025981 Ga0207640_10682599 Ga0207640_106825992 159
32 3300005327 Ga0070658_10046294 Ga0070658_100462943 160
33 3300005333 Ga0070677_10099350 Ga0070677_100993502 160
34 3300005339 Ga0070660_100111560 Ga0070660_1001115603 160
35 3300005366 Ga0070659_100038767 Ga0070659_1000387672 160
36 3300005457 Ga0070662_100000146 Ga0070662_10000014633 160
37 3300005458 Ga0070681_10803936 Ga0070681_108039362 160
38 3300005530 Ga0070679_100028060 Ga0070679_1000280606 160
39 3300013100 Ga0157373_10149182 Ga0157373_101491823 160
40 3300025893 Ga0207682_10092089 Ga0207682_100920892 160
41 3300025909 Ga0207705_10083736 Ga0207705_100837363 160
42 3300025912 Ga0207707_10207882 Ga0207707_102078821 160
43 3300025919 Ga0207657_10007288 Ga0207657_100072884 160
44 3300025919 Ga0207657_10130296 Ga0207657_101302962 160
45 3300025933 Ga0207706_10000461 Ga0207706_1000046110 160
46 3300027876 Ga0209974_10021493 Ga0209974_100214932 160
47 3300031548 Ga0307408_100932417 Ga0307408_1009324171 160
48 3300031731 Ga0307405_10377992 Ga0307405_103779921 160
49 3300031824 Ga0307413_10485821 Ga0307413_104858212 160
50 3300031901 Ga0307406_10674852 Ga0307406_106748522 160
51 3300032004 Ga0307414_10037607 Ga0307414_100376075 160
52 3300037418 Ga0395900_0080624 Ga0395900_0080624_1527_2018 160
53 3300037466 Ga0395898_0410494 Ga0395898_0410494_417_908 160
54 3300037471 Ga0395905_0236789 Ga0395905_0236789_486_977 160
55 3300038443 Ga0395901_0133446 Ga0395901_0133446_282_773 160
56 3300005333 Ga0070677_10000148 Ga0070677_100001483 161
57 3300005353 Ga0070669_100833264 Ga0070669_1008332642 161
58 3300025893 Ga0207682_10005062 Ga0207682_100050625 161
59 3300031731 Ga0307405_10093998 Ga0307405_100939981 161
60 3300031852 Ga0307410_10081451 Ga0307410_100814512 161
61 3300046694 Ga0495649_0497035 Ga0495649_0497035_25_513 161
62 3300049674 Ga0501242_002375 Ga0501242_002375_26_520 161
63 3300049764 Ga0501267_001906 Ga0501267_001906_1259_1753 161
64 3300049765 Ga0501268_000191 Ga0501268_000191_1568_2062 161
65 3300001979 JGI24740J21852_10007768 JGI24740J21852_100077684 162
66 3300002075 JGI24738J21930_10055873 JGI24738J21930_100558731 162
67 3300005327 Ga0070658_10719721 Ga0070658_107197212 162
68 3300005337 Ga0070682_100199551 Ga0070682_1001995512 162
69 3300005344 Ga0070661_100362409 Ga0070661_1003624092 162
70 3300005355 Ga0070671_100937303 Ga0070671_1009373031 162
71 3300005455 Ga0070663_100246149 Ga0070663_1002461492 162
72 3300005564 Ga0070664_101142350 Ga0070664_1011423501 162
73 3300005578 Ga0068854_100105709 Ga0068854_1001057093 162
74 3300005616 Ga0068852_100091774 Ga0068852_1000917741 162
75 3300013102 Ga0157371_10435119 Ga0157371_104351192 162
76 3300013307 Ga0157372_10647552 Ga0157372_106475522 162
77 3300013307 Ga0157372_10951032 Ga0157372_109510322 162
78 3300025909 Ga0207705_11156475 Ga0207705_111564751 162
79 3300025920 Ga0207649_10125358 Ga0207649_101253581 162
80 3300025945 Ga0207679_10606482 Ga0207679_106064822 162
81 3300025981 Ga0207640_10162695 Ga0207640_101626953 162
82 3300026067 Ga0207678_10022031 Ga0207678_100220314 162
83 3300037312 Ga0395899_0230862 Ga0395899_0230862_97_594 162
84 3300037418 Ga0395900_0025568 Ga0395900_0025568_4612_5109 162
85 3300037418 Ga0395900_0086841 Ga0395900_0086841_2193_2690 162
86 3300037418 Ga0395900_0578347 Ga0395900_0578347_122_619 162
87 3300037418 Ga0395900_0668368 Ga0395900_0668368_284_781 162
88 3300037466 Ga0395898_0186335 Ga0395898_0186335_965_1462 162
89 3300037471 Ga0395905_0003328 Ga0395905_0003328_1202_1699 162
90 3300037471 Ga0395905_0030825 Ga0395905_0030825_3001_3498 162
91 3300037471 Ga0395905_0187306 Ga0395905_0187306_430_927 162
92 3300037471 Ga0395905_0203400 Ga0395905_0203400_1256_1753 162
93 3300038443 Ga0395901_0015098 Ga0395901_0015098_3421_3918 162
94 3300038443 Ga0395901_0105987 Ga0395901_0105987_105_602 162
95 3300038443 Ga0395901_0109977 Ga0395901_0109977_1529_2026 162
96 3300038443 Ga0395901_0467794 Ga0395901_0467794_76_573 162
97 3300042157 Ga0439458_0004512 Ga0439458_0004512_1912_2409 162
98 3300042157 Ga0439458_0008197 Ga0439458_0008197_166_663 162
99 3300001904 JGI24736J21556_1005733 JGI24736J21556_10057334 163
100 3300001915 JGI24741J21665_1034242 JGI24741J21665_10342421 163
101 3300001989 JGI24739J22299_10084522 JGI24739J22299_100845222 163
102 3300001990 JGI24737J22298_10002218 JGI24737J22298_100022183 163
103 3300001990 JGI24737J22298_10005083 JGI24737J22298_100050833 163
104 3300001990 JGI24737J22298_10099222 JGI24737J22298_100992221 163
105 3300002067 JGI24735J21928_10063644 JGI24735J21928_100636443 163
106 3300002067 JGI24735J21928_10149241 JGI24735J21928_101492412 163
107 3300002075 JGI24738J21930_10042690 JGI24738J21930_100426902 163
108 3300002244 JGI24742J22300_10018404 JGI24742J22300_100184041 163
109 3300002244 JGI24742J22300_10056069 JGI24742J22300_100560691 163
110 3300002459 JGI24751J29686_10021313 JGI24751J29686_100213131 163
111 3300002459 JGI24751J29686_10071553 JGI24751J29686_100715531 163
112 3300005288 Ga0065714_10246408 Ga0065714_102464081 163
113 3300005290 Ga0065712_10071048 Ga0065712_100710485 163
114 3300005290 Ga0065712_10109914 Ga0065712_101099142 163
115 3300005290 Ga0065712_10166660 Ga0065712_101666601 163
116 3300005290 Ga0065712_10459928 Ga0065712_104599281 163
117 3300005293 Ga0065715_10089390 Ga0065715_100893902 163
118 3300005293 Ga0065715_10121419 Ga0065715_101214192 163
119 3300005293 Ga0065715_10306988 Ga0065715_103069882 163
120 3300005293 Ga0065715_10439293 Ga0065715_104392932 163
121 3300005293 Ga0065715_10497343 Ga0065715_104973432 163
122 3300005327 Ga0070658_10019314 Ga0070658_100193143 163
123 3300005327 Ga0070658_10038048 Ga0070658_100380481 163
124 3300005328 Ga0070676_10004434 Ga0070676_100044343 163
125 3300005328 Ga0070676_10031323 Ga0070676_100313233 163
126 3300005328 Ga0070676_10144249 Ga0070676_101442492 163
127 3300005328 Ga0070676_10617475 Ga0070676_106174752 163
128 3300005330 Ga0070690_100810994 Ga0070690_1008109941 163
129 3300005330 Ga0070690_101016570 Ga0070690_1010165701 163
130 3300005331 Ga0070670_100000558 Ga0070670_10000055810 163
131 3300005331 Ga0070670_100002114 Ga0070670_10000211414 163
132 3300005331 Ga0070670_100059973 Ga0070670_1000599733 163
133 3300005331 Ga0070670_100070610 Ga0070670_1000706103 163
134 3300005331 Ga0070670_100113020 Ga0070670_1001130203 163
135 3300005331 Ga0070670_100167181 Ga0070670_1001671812 163
136 3300005331 Ga0070670_100299065 Ga0070670_1002990652 163
137 3300005331 Ga0070670_100374464 Ga0070670_1003744642 163
138 3300005331 Ga0070670_100397915 Ga0070670_1003979152 163
139 3300005331 Ga0070670_101317509 Ga0070670_1013175092 163
140 3300005333 Ga0070677_10000835 Ga0070677_100008353 163
141 3300005333 Ga0070677_10001376 Ga0070677_100013766 163
142 3300005333 Ga0070677_10106845 Ga0070677_101068452 163
143 3300005333 Ga0070677_10172584 Ga0070677_101725842 163
144 3300005334 Ga0068869_100132628 Ga0068869_1001326283 163
145 3300005334 Ga0068869_100699821 Ga0068869_1006998211 163
146 3300005334 Ga0068869_101050005 Ga0068869_1010500051 163
147 3300005335 Ga0070666_10060359 Ga0070666_100603592 163
148 3300005335 Ga0070666_10070929 Ga0070666_100709292 163
149 3300005335 Ga0070666_10547777 Ga0070666_105477772 163
150 3300005336 Ga0070680_100311648 Ga0070680_1003116482 163
151 3300005338 Ga0068868_100000036 Ga0068868_10000003642 163
152 3300005338 Ga0068868_100024267 Ga0068868_1000242673 163
153 3300005338 Ga0068868_100031015 Ga0068868_1000310153 163
154 3300005338 Ga0068868_100341007 Ga0068868_1003410072 163
155 3300005339 Ga0070660_100011134 Ga0070660_1000111341 163
156 3300005339 Ga0070660_100021649 Ga0070660_1000216493 163
157 3300005339 Ga0070660_100067902 Ga0070660_1000679023 163
158 3300005339 Ga0070660_100420183 Ga0070660_1004201832 163
159 3300005339 Ga0070660_100423193 Ga0070660_1004231932 163
160 3300005339 Ga0070660_100602960 Ga0070660_1006029601 163
161 3300005340 Ga0070689_100384305 Ga0070689_1003843052 163
162 3300005340 Ga0070689_100410488 Ga0070689_1004104881 163
163 3300005343 Ga0070687_100038295 Ga0070687_1000382952 163
164 3300005343 Ga0070687_100066580 Ga0070687_1000665803 163
165 3300005343 Ga0070687_100631402 Ga0070687_1006314021 163
166 3300005344 Ga0070661_100213785 Ga0070661_1002137851 163
167 3300005344 Ga0070661_100319545 Ga0070661_1003195452 163
168 3300005344 Ga0070661_100354424 Ga0070661_1003544242 163
169 3300005344 Ga0070661_100356800 Ga0070661_1003568002 163
170 3300005345 Ga0070692_10024695 Ga0070692_100246952 163
171 3300005347 Ga0070668_100013438 Ga0070668_1000134383 163
172 3300005347 Ga0070668_100027703 Ga0070668_1000277036 163
173 3300005347 Ga0070668_100050650 Ga0070668_1000506504 163
174 3300005347 Ga0070668_100423070 Ga0070668_1004230701 163
175 3300005347 Ga0070668_100458571 Ga0070668_1004585712 163
176 3300005353 Ga0070669_100016815 Ga0070669_1000168154 163
177 3300005353 Ga0070669_100100659 Ga0070669_1001006594 163
178 3300005353 Ga0070669_100138667 Ga0070669_1001386672 163
179 3300005353 Ga0070669_100194474 Ga0070669_1001944744 163
180 3300005353 Ga0070669_100490718 Ga0070669_1004907182 163
181 3300005353 Ga0070669_100600728 Ga0070669_1006007282 163
182 3300005353 Ga0070669_101212429 Ga0070669_1012124292 163
183 3300005354 Ga0070675_100000985 Ga0070675_10000098511 163
184 3300005354 Ga0070675_100002386 Ga0070675_1000023863 163
185 3300005354 Ga0070675_100008116 Ga0070675_1000081164 163
186 3300005354 Ga0070675_100017593 Ga0070675_1000175937 163
187 3300005354 Ga0070675_100118180 Ga0070675_1001181802 163
188 3300005354 Ga0070675_100158842 Ga0070675_1001588423 163
189 3300005354 Ga0070675_100203758 Ga0070675_1002037583 163
190 3300005354 Ga0070675_100292374 Ga0070675_1002923742 163
191 3300005354 Ga0070675_100653017 Ga0070675_1006530172 163
192 3300005354 Ga0070675_101398628 Ga0070675_1013986281 163
193 3300005355 Ga0070671_100003600 Ga0070671_10000360010 163
194 3300005355 Ga0070671_100032842 Ga0070671_1000328423 163
195 3300005355 Ga0070671_100036831 Ga0070671_1000368312 163
196 3300005355 Ga0070671_100148174 Ga0070671_1001481743 163
197 3300005355 Ga0070671_100240461 Ga0070671_1002404611 163
198 3300005355 Ga0070671_100394291 Ga0070671_1003942912 163
199 3300005355 Ga0070671_100524620 Ga0070671_1005246202 163
200 3300005355 Ga0070671_100745956 Ga0070671_1007459562 163
201 3300005356 Ga0070674_100001003 Ga0070674_1000010036 163
202 3300005356 Ga0070674_100041908 Ga0070674_1000419082 163
203 3300005356 Ga0070674_100065921 Ga0070674_1000659212 163
204 3300005364 Ga0070673_100026106 Ga0070673_1000261064 163
205 3300005364 Ga0070673_100070084 Ga0070673_1000700842 163
206 3300005364 Ga0070673_100249507 Ga0070673_1002495073 163
207 3300005364 Ga0070673_100263707 Ga0070673_1002637072 163
208 3300005364 Ga0070673_100267167 Ga0070673_1002671672 163
209 3300005364 Ga0070673_100393189 Ga0070673_1003931892 163
210 3300005364 Ga0070673_100394184 Ga0070673_1003941842 163
211 3300005364 Ga0070673_101666848 Ga0070673_1016668481 163
212 3300005364 Ga0070673_101730854 Ga0070673_1017308541 163
213 3300005366 Ga0070659_100000025 Ga0070659_100000025119 163
214 3300005366 Ga0070659_100003057 Ga0070659_1000030579 163
215 3300005366 Ga0070659_100007001 Ga0070659_1000070017 163
216 3300005366 Ga0070659_100026834 Ga0070659_1000268343 163
217 3300005366 Ga0070659_100065177 Ga0070659_1000651774 163
218 3300005366 Ga0070659_100113232 Ga0070659_1001132323 163
219 3300005366 Ga0070659_100742530 Ga0070659_1007425302 163
220 3300005367 Ga0070667_100021253 Ga0070667_1000212533 163
221 3300005367 Ga0070667_100414949 Ga0070667_1004149492 163
222 3300005436 Ga0070713_101237747 Ga0070713_1012377471 163
223 3300005438 Ga0070701_10056401 Ga0070701_100564011 163
224 3300005441 Ga0070700_100444011 Ga0070700_1004440112 163
225 3300005444 Ga0070694_100002873 Ga0070694_1000028736 163
226 3300005455 Ga0070663_100005892 Ga0070663_1000058923 163
227 3300005455 Ga0070663_100439949 Ga0070663_1004399491 163
228 3300005455 Ga0070663_100652356 Ga0070663_1006523562 163
229 3300005455 Ga0070663_101073266 Ga0070663_1010732661 163
230 3300005456 Ga0070678_100224449 Ga0070678_1002244492 163
231 3300005456 Ga0070678_100983773 Ga0070678_1009837731 163
232 3300005457 Ga0070662_100000435 Ga0070662_10000043518 163
233 3300005457 Ga0070662_100002110 Ga0070662_1000021105 163
234 3300005457 Ga0070662_100007360 Ga0070662_1000073602 163
235 3300005457 Ga0070662_100017721 Ga0070662_1000177215 163
236 3300005457 Ga0070662_100026264 Ga0070662_1000262643 163
237 3300005457 Ga0070662_100036581 Ga0070662_1000365812 163
238 3300005457 Ga0070662_100043184 Ga0070662_1000431843 163
239 3300005457 Ga0070662_100156809 Ga0070662_1001568093 163
240 3300005457 Ga0070662_100199658 Ga0070662_1001996582 163
241 3300005457 Ga0070662_100366958 Ga0070662_1003669582 163
242 3300005457 Ga0070662_100770476 Ga0070662_1007704761 163
243 3300005458 Ga0070681_10032642 Ga0070681_100326424 163
244 3300005458 Ga0070681_10471092 Ga0070681_104710922 163
245 3300005459 Ga0068867_100070470 Ga0068867_1000704701 163
246 3300005459 Ga0068867_100322817 Ga0068867_1003228172 163
247 3300005530 Ga0070679_101040210 Ga0070679_1010402101 163
248 3300005539 Ga0068853_100118998 Ga0068853_1001189982 163
249 3300005539 Ga0068853_100185596 Ga0068853_1001855961 163
250 3300005539 Ga0068853_100759812 Ga0068853_1007598122 163
251 3300005543 Ga0070672_100001035 Ga0070672_10000103513 163
252 3300005543 Ga0070672_100001785 Ga0070672_1000017854 163
253 3300005543 Ga0070672_100032749 Ga0070672_1000327492 163
254 3300005543 Ga0070672_100046058 Ga0070672_1000460583 163
255 3300005545 Ga0070695_100127581 Ga0070695_1001275812 163
256 3300005545 Ga0070695_100238832 Ga0070695_1002388321 163
257 3300005546 Ga0070696_100006917 Ga0070696_1000069174 163
258 3300005547 Ga0070693_100017274 Ga0070693_1000172743 163
259 3300005547 Ga0070693_100182468 Ga0070693_1001824683 163
260 3300005548 Ga0070665_100001627 Ga0070665_10000162721 163
261 3300005548 Ga0070665_100015670 Ga0070665_1000156704 163
262 3300005548 Ga0070665_100089762 Ga0070665_1000897622 163
263 3300005548 Ga0070665_100153761 Ga0070665_1001537614 163
264 3300005548 Ga0070665_101187166 Ga0070665_1011871662 163
265 3300005563 Ga0068855_100025567 Ga0068855_1000255676 163
266 3300005563 Ga0068855_100530726 Ga0068855_1005307261 163
267 3300005564 Ga0070664_100003664 Ga0070664_1000036643 163
268 3300005564 Ga0070664_100107432 Ga0070664_1001074323 163
269 3300005564 Ga0070664_100121811 Ga0070664_1001218112 163
270 3300005564 Ga0070664_100386122 Ga0070664_1003861222 163
271 3300005564 Ga0070664_100425219 Ga0070664_1004252192 163
272 3300005564 Ga0070664_100520448 Ga0070664_1005204482 163
273 3300005564 Ga0070664_100932134 Ga0070664_1009321342 163
274 3300005577 Ga0068857_100005983 Ga0068857_1000059834 163
275 3300005577 Ga0068857_100030988 Ga0068857_1000309884 163
276 3300005577 Ga0068857_100031238 Ga0068857_1000312384 163
277 3300005577 Ga0068857_100049836 Ga0068857_1000498365 163
278 3300005577 Ga0068857_101012195 Ga0068857_1010121952 163
279 3300005578 Ga0068854_100133384 Ga0068854_1001333842 163
280 3300005578 Ga0068854_100227832 Ga0068854_1002278322 163
281 3300005578 Ga0068854_100332766 Ga0068854_1003327662 163
282 3300005578 Ga0068854_100688918 Ga0068854_1006889181 163
283 3300005614 Ga0068856_100757732 Ga0068856_1007577321 163
284 3300005616 Ga0068852_100010799 Ga0068852_1000107997 163
285 3300005616 Ga0068852_100183880 Ga0068852_1001838802 163
286 3300005616 Ga0068852_100264370 Ga0068852_1002643702 163
287 3300005617 Ga0068859_100033191 Ga0068859_1000331913 163
288 3300005617 Ga0068859_100052189 Ga0068859_1000521894 163
289 3300005617 Ga0068859_100058069 Ga0068859_1000580692 163
290 3300005617 Ga0068859_100580103 Ga0068859_1005801031 163
291 3300005618 Ga0068864_100055650 Ga0068864_1000556502 163
292 3300005618 Ga0068864_100099352 Ga0068864_1000993523 163
293 3300005618 Ga0068864_100117137 Ga0068864_1001171373 163
294 3300005618 Ga0068864_100251155 Ga0068864_1002511552 163
295 3300005618 Ga0068864_100891951 Ga0068864_1008919512 163
296 3300005618 Ga0068864_101570504 Ga0068864_1015705042 163
297 3300005718 Ga0068866_10730583 Ga0068866_107305832 163
298 3300005719 Ga0068861_100049373 Ga0068861_1000493733 163
299 3300005719 Ga0068861_100096713 Ga0068861_1000967132 163
300 3300005719 Ga0068861_100616168 Ga0068861_1006161682 163
301 3300005719 Ga0068861_101410382 Ga0068861_1014103821 163
302 3300005841 Ga0068863_100006559 Ga0068863_1000065598 163
303 3300005841 Ga0068863_100014719 Ga0068863_1000147195 163
304 3300005841 Ga0068863_100564022 Ga0068863_1005640221 163
305 3300005842 Ga0068858_100007474 Ga0068858_1000074743 163
306 3300005842 Ga0068858_100018374 Ga0068858_10001837410 163
307 3300005842 Ga0068858_100113023 Ga0068858_1001130234 163
308 3300005842 Ga0068858_100837044 Ga0068858_1008370442 163
309 3300005843 Ga0068860_100020068 Ga0068860_1000200686 163
310 3300005843 Ga0068860_100023289 Ga0068860_1000232896 163
311 3300005843 Ga0068860_100034183 Ga0068860_1000341834 163
312 3300005843 Ga0068860_100185203 Ga0068860_1001852033 163
313 3300005844 Ga0068862_100001114 Ga0068862_10000111416 163
314 3300005844 Ga0068862_100001902 Ga0068862_1000019023 163
315 3300005844 Ga0068862_100009745 Ga0068862_1000097455 163
316 3300005844 Ga0068862_100052987 Ga0068862_1000529874 163
317 3300005844 Ga0068862_100063881 Ga0068862_1000638813 163
318 3300005844 Ga0068862_100357455 Ga0068862_1003574552 163
319 3300005985 Ga0081539_10056861 Ga0081539_100568614 163
320 3300006051 Ga0075364_10381666 Ga0075364_103816661 163
321 3300006051 Ga0075364_10385664 Ga0075364_103856642 163
322 3300006051 Ga0075364_10508364 Ga0075364_105083642 163
323 3300006177 Ga0075362_10250993 Ga0075362_102509932 163
324 3300006195 Ga0075366_10100257 Ga0075366_101002572 163
325 3300006237 Ga0097621_100069022 Ga0097621_1000690223 163
326 3300006237 Ga0097621_100083883 Ga0097621_1000838832 163
327 3300006358 Ga0068871_100053949 Ga0068871_1000539493 163
328 3300006358 Ga0068871_100340918 Ga0068871_1003409182 163
329 3300006844 Ga0075428_100135257 Ga0075428_1001352572 163
330 3300006846 Ga0075430_100752235 Ga0075430_1007522352 163
331 3300006847 Ga0075431_100077167 Ga0075431_1000771674 163
332 3300006852 Ga0075433_10003509 Ga0075433_1000350916 163
333 3300006871 Ga0075434_101206200 Ga0075434_1012062001 163
334 3300006880 Ga0075429_101327121 Ga0075429_1013271211 163
335 3300006881 Ga0068865_100096387 Ga0068865_1000963873 163
336 3300006931 Ga0097620_100033192 Ga0097620_1000331923 163
337 3300006931 Ga0097620_100052188 Ga0097620_1000521882 163
338 3300006931 Ga0097620_100058069 Ga0097620_1000580692 163
339 3300006931 Ga0097620_100580055 Ga0097620_1005800553 163
340 3300009093 Ga0105240_10764768 Ga0105240_107647682 163
341 3300009094 Ga0111539_10288288 Ga0111539_102882884 163
342 3300009094 Ga0111539_10454878 Ga0111539_104548782 163
343 3300009098 Ga0105245_10053211 Ga0105245_100532115 163
344 3300009098 Ga0105245_10208509 Ga0105245_102085093 163
345 3300009098 Ga0105245_10382139 Ga0105245_103821392 163
346 3300009098 Ga0105245_10912541 Ga0105245_109125412 163
347 3300009147 Ga0114129_11209654 Ga0114129_112096542 163
348 3300009148 Ga0105243_10153806 Ga0105243_101538063 163
349 3300009174 Ga0105241_10196008 Ga0105241_101960082 163
350 3300009177 Ga0105248_10014420 Ga0105248_100144205 163
351 3300009177 Ga0105248_10060129 Ga0105248_100601293 163
352 3300009177 Ga0105248_10073709 Ga0105248_100737093 163
353 3300009177 Ga0105248_10237202 Ga0105248_102372023 163
354 3300009177 Ga0105248_11091511 Ga0105248_110915112 163
355 3300009551 Ga0105238_10084942 Ga0105238_100849424 163
356 3300009553 Ga0105249_10022558 Ga0105249_100225586 163
357 3300009553 Ga0105249_10091809 Ga0105249_100918094 163
358 3300009553 Ga0105249_10150285 Ga0105249_101502852 163
359 3300009553 Ga0105249_10588969 Ga0105249_105889692 163
360 3300010375 Ga0105239_10164811 Ga0105239_101648113 163
361 3300011119 Ga0105246_10072138 Ga0105246_100721385 163
362 3300011119 Ga0105246_10386074 Ga0105246_103860741 163
363 3300011119 Ga0105246_10451415 Ga0105246_104514152 163
364 3300012510 Ga0157316_1005979 Ga0157316_10059792 163
365 3300013100 Ga0157373_10024258 Ga0157373_100242585 163
366 3300013100 Ga0157373_10080028 Ga0157373_100800284 163
367 3300013100 Ga0157373_10086890 Ga0157373_100868903 163
368 3300013100 Ga0157373_10528102 Ga0157373_105281021 163
369 3300013102 Ga0157371_10069194 Ga0157371_100691942 163
370 3300013102 Ga0157371_10077393 Ga0157371_100773933 163
371 3300013104 Ga0157370_10014333 Ga0157370_100143337 163
372 3300013104 Ga0157370_10224176 Ga0157370_102241763 163
373 3300013105 Ga0157369_10005512 Ga0157369_1000551217 163
374 3300013296 Ga0157374_10384378 Ga0157374_103843782 163
375 3300013297 Ga0157378_10216506 Ga0157378_102165062 163
376 3300013297 Ga0157378_10335579 Ga0157378_103355792 163
377 3300013306 Ga0163162_10023647 Ga0163162_100236476 163
378 3300013306 Ga0163162_10191961 Ga0163162_101919613 163
379 3300013306 Ga0163162_10604914 Ga0163162_106049141 163
380 3300013307 Ga0157372_10073164 Ga0157372_100731644 163
381 3300013307 Ga0157372_10437423 Ga0157372_104374232 163
382 3300013308 Ga0157375_10020096 Ga0157375_100200966 163
383 3300013308 Ga0157375_10036902 Ga0157375_100369023 163
384 3300013308 Ga0157375_10095432 Ga0157375_100954325 163
385 3300013308 Ga0157375_10605058 Ga0157375_106050582 163
386 3300013308 Ga0157375_10867233 Ga0157375_108672332 163
387 3300014325 Ga0163163_10011391 Ga0163163_100113919 163
388 3300014325 Ga0163163_10157261 Ga0163163_101572613 163
389 3300014325 Ga0163163_10911318 Ga0163163_109113182 163
390 3300014326 Ga0157380_10005666 Ga0157380_100056666 163
391 3300014326 Ga0157380_10007456 Ga0157380_100074564 163
392 3300014326 Ga0157380_10076484 Ga0157380_100764842 163
393 3300014326 Ga0157380_10187015 Ga0157380_101870152 163
394 3300014745 Ga0157377_10025692 Ga0157377_100256923 163
395 3300014745 Ga0157377_10119155 Ga0157377_101191552 163
396 3300014968 Ga0157379_10265558 Ga0157379_102655583 163
397 3300014968 Ga0157379_10537509 Ga0157379_105375091 163
398 3300017792 Ga0163161_10036821 Ga0163161_100368213 163
399 3300017792 Ga0163161_10039145 Ga0163161_100391452 163
400 3300017792 Ga0163161_10614693 Ga0163161_106146932 163
401 3300025315 Ga0207697_10000872 Ga0207697_1000087217 163
402 3300025315 Ga0207697_10045407 Ga0207697_100454072 163
403 3300025893 Ga0207682_10002944 Ga0207682_100029443 163
404 3300025893 Ga0207682_10023187 Ga0207682_100231873 163
405 3300025901 Ga0207688_10011568 Ga0207688_100115685 163
406 3300025901 Ga0207688_10020097 Ga0207688_100200974 163
407 3300025901 Ga0207688_10096098 Ga0207688_100960981 163
408 3300025901 Ga0207688_10146006 Ga0207688_101460062 163
409 3300025901 Ga0207688_10241600 Ga0207688_102416002 163
410 3300025901 Ga0207688_10282353 Ga0207688_102823532 163
411 3300025901 Ga0207688_10493723 Ga0207688_104937232 163
412 3300025903 Ga0207680_10027901 Ga0207680_100279014 163
413 3300025904 Ga0207647_10000304 Ga0207647_1000030414 163
414 3300025904 Ga0207647_10023827 Ga0207647_100238273 163
415 3300025904 Ga0207647_10051566 Ga0207647_100515662 163
416 3300025904 Ga0207647_10160373 Ga0207647_101603732 163
417 3300025904 Ga0207647_10271031 Ga0207647_102710311 163
418 3300025904 Ga0207647_10460059 Ga0207647_104600592 163
419 3300025904 Ga0207647_10754153 Ga0207647_107541531 163
420 3300025907 Ga0207645_10013271 Ga0207645_100132713 163
421 3300025907 Ga0207645_10100959 Ga0207645_101009592 163
422 3300025907 Ga0207645_10118246 Ga0207645_101182463 163
423 3300025907 Ga0207645_10430187 Ga0207645_104301872 163
424 3300025908 Ga0207643_10187008 Ga0207643_101870083 163
425 3300025909 Ga0207705_10025958 Ga0207705_100259583 163
426 3300025909 Ga0207705_10042065 Ga0207705_100420651 163
427 3300025912 Ga0207707_10052736 Ga0207707_100527364 163
428 3300025912 Ga0207707_10750399 Ga0207707_107503992 163
429 3300025913 Ga0207695_10559536 Ga0207695_105595362 163
430 3300025917 Ga0207660_11239313 Ga0207660_112393131 163
431 3300025918 Ga0207662_10048828 Ga0207662_100488282 163
432 3300025918 Ga0207662_10058199 Ga0207662_100581993 163
433 3300025919 Ga0207657_10004622 Ga0207657_1000462210 163
434 3300025919 Ga0207657_10019578 Ga0207657_100195789 163
435 3300025919 Ga0207657_10196355 Ga0207657_101963552 163
436 3300025919 Ga0207657_10465522 Ga0207657_104655222 163
437 3300025919 Ga0207657_10860596 Ga0207657_108605962 163
438 3300025920 Ga0207649_10202769 Ga0207649_102027692 163
439 3300025920 Ga0207649_10367375 Ga0207649_103673752 163
440 3300025923 Ga0207681_10001202 Ga0207681_1000120219 163
441 3300025923 Ga0207681_10037400 Ga0207681_100374002 163
442 3300025923 Ga0207681_10047827 Ga0207681_100478274 163
443 3300025923 Ga0207681_10570718 Ga0207681_105707182 163
444 3300025923 Ga0207681_11145713 Ga0207681_111457131 163
445 3300025924 Ga0207694_10130208 Ga0207694_101302082 163
446 3300025925 Ga0207650_10002617 Ga0207650_100026177 163
447 3300025925 Ga0207650_10079010 Ga0207650_100790102 163
448 3300025925 Ga0207650_10097894 Ga0207650_100978943 163
449 3300025925 Ga0207650_10107144 Ga0207650_101071443 163
450 3300025925 Ga0207650_10107395 Ga0207650_101073953 163
451 3300025925 Ga0207650_10392147 Ga0207650_103921472 163
452 3300025926 Ga0207659_10000979 Ga0207659_1000097917 163
453 3300025926 Ga0207659_10004864 Ga0207659_100048644 163
454 3300025926 Ga0207659_10209799 Ga0207659_102097992 163
455 3300025926 Ga0207659_10251249 Ga0207659_102512492 163
456 3300025926 Ga0207659_10297523 Ga0207659_102975232 163
457 3300025926 Ga0207659_10340039 Ga0207659_103400392 163
458 3300025926 Ga0207659_10350787 Ga0207659_103507873 163
459 3300025926 Ga0207659_11131015 Ga0207659_111310151 163
460 3300025927 Ga0207687_10119334 Ga0207687_101193342 163
461 3300025927 Ga0207687_10224756 Ga0207687_102247562 163
462 3300025927 Ga0207687_10248340 Ga0207687_102483401 163
463 3300025931 Ga0207644_10006138 Ga0207644_100061384 163
464 3300025931 Ga0207644_10363017 Ga0207644_103630173 163
465 3300025931 Ga0207644_10527648 Ga0207644_105276482 163
466 3300025931 Ga0207644_10653945 Ga0207644_106539452 163
467 3300025931 Ga0207644_10796512 Ga0207644_107965121 163
468 3300025932 Ga0207690_10000005 Ga0207690_10000005355 163
469 3300025932 Ga0207690_10002267 Ga0207690_100022677 163
470 3300025932 Ga0207690_10006400 Ga0207690_100064007 163
471 3300025932 Ga0207690_10041857 Ga0207690_100418572 163
472 3300025932 Ga0207690_10047947 Ga0207690_100479474 163
473 3300025932 Ga0207690_10049712 Ga0207690_100497125 163
474 3300025932 Ga0207690_10501579 Ga0207690_105015792 163
475 3300025933 Ga0207706_10001629 Ga0207706_100016296 163
476 3300025933 Ga0207706_10003866 Ga0207706_100038666 163
477 3300025933 Ga0207706_10009055 Ga0207706_100090552 163
478 3300025933 Ga0207706_10009959 Ga0207706_100099599 163
479 3300025933 Ga0207706_10015193 Ga0207706_100151936 163
480 3300025933 Ga0207706_10069320 Ga0207706_100693204 163
481 3300025933 Ga0207706_10222033 Ga0207706_102220332 163
482 3300025933 Ga0207706_10237704 Ga0207706_102377042 163
483 3300025933 Ga0207706_10280476 Ga0207706_102804763 163
484 3300025933 Ga0207706_10416309 Ga0207706_104163092 163
485 3300025935 Ga0207709_10312934 Ga0207709_103129341 163
486 3300025936 Ga0207670_10300293 Ga0207670_103002932 163
487 3300025936 Ga0207670_10383520 Ga0207670_103835202 163
488 3300025937 Ga0207669_10041884 Ga0207669_100418842 163
489 3300025937 Ga0207669_10045242 Ga0207669_100452423 163
490 3300025937 Ga0207669_10255919 Ga0207669_102559193 163
491 3300025938 Ga0207704_10445806 Ga0207704_104458061 163
492 3300025940 Ga0207691_10003132 Ga0207691_100031327 163
493 3300025940 Ga0207691_10008707 Ga0207691_100087076 163
494 3300025940 Ga0207691_10039371 Ga0207691_100393713 163
495 3300025940 Ga0207691_10183083 Ga0207691_101830833 163
496 3300025940 Ga0207691_10542081 Ga0207691_105420811 163
497 3300025941 Ga0207711_10024292 Ga0207711_100242923 163
498 3300025941 Ga0207711_10050585 Ga0207711_100505853 163
499 3300025941 Ga0207711_10056329 Ga0207711_100563293 163
500 3300025942 Ga0207689_10678058 Ga0207689_106780582 163
501 3300025945 Ga0207679_10024758 Ga0207679_100247584 163
502 3300025945 Ga0207679_10028133 Ga0207679_100281333 163
503 3300025945 Ga0207679_10032629 Ga0207679_100326293 163
504 3300025945 Ga0207679_10227758 Ga0207679_102277582 163
505 3300025945 Ga0207679_10333048 Ga0207679_103330483 163
506 3300025945 Ga0207679_10467572 Ga0207679_104675722 163
507 3300025949 Ga0207667_10025784 Ga0207667_100257842 163
508 3300025960 Ga0207651_10031994 Ga0207651_100319943 163
509 3300025960 Ga0207651_10425389 Ga0207651_104253892 163
510 3300025961 Ga0207712_10000195 Ga0207712_100001957 163
511 3300025961 Ga0207712_10126102 Ga0207712_101261023 163
512 3300025972 Ga0207668_10002536 Ga0207668_100025369 163
513 3300025972 Ga0207668_10081270 Ga0207668_100812704 163
514 3300025972 Ga0207668_10099173 Ga0207668_100991732 163
515 3300025972 Ga0207668_10381084 Ga0207668_103810842 163
516 3300025981 Ga0207640_10022993 Ga0207640_100229932 163
517 3300025981 Ga0207640_10374474 Ga0207640_103744742 163
518 3300025981 Ga0207640_11163231 Ga0207640_111632312 163
519 3300025981 Ga0207640_11185408 Ga0207640_111854081 163
520 3300025986 Ga0207658_10007131 Ga0207658_100071316 163
521 3300025986 Ga0207658_10019289 Ga0207658_100192892 163
522 3300026023 Ga0207677_10000044 Ga0207677_100000449 163
523 3300026023 Ga0207677_10027383 Ga0207677_100273833 163
524 3300026023 Ga0207677_10166374 Ga0207677_101663742 163
525 3300026023 Ga0207677_10293227 Ga0207677_102932272 163
526 3300026023 Ga0207677_10349564 Ga0207677_103495641 163
527 3300026035 Ga0207703_10012934 Ga0207703_100129345 163
528 3300026035 Ga0207703_10032033 Ga0207703_100320333 163
529 3300026035 Ga0207703_10858571 Ga0207703_108585711 163
530 3300026041 Ga0207639_10110017 Ga0207639_101100172 163
531 3300026041 Ga0207639_10781960 Ga0207639_107819601 163
532 3300026041 Ga0207639_11168276 Ga0207639_111682761 163
533 3300026067 Ga0207678_10001437 Ga0207678_100014377 163
534 3300026067 Ga0207678_10026141 Ga0207678_100261414 163
535 3300026067 Ga0207678_10065278 Ga0207678_100652784 163
536 3300026067 Ga0207678_10456101 Ga0207678_104561011 163
537 3300026067 Ga0207678_10605920 Ga0207678_106059202 163
538 3300026075 Ga0207708_10209607 Ga0207708_102096073 163
539 3300026075 Ga0207708_10566266 Ga0207708_105662662 163
540 3300026078 Ga0207702_10194615 Ga0207702_101946151 163
541 3300026088 Ga0207641_10076459 Ga0207641_100764594 163
542 3300026088 Ga0207641_10418790 Ga0207641_104187902 163
543 3300026089 Ga0207648_10132865 Ga0207648_101328652 163
544 3300026089 Ga0207648_10193697 Ga0207648_101936972 163
545 3300026095 Ga0207676_10221250 Ga0207676_102212503 163
546 3300026095 Ga0207676_10266542 Ga0207676_102665423 163
547 3300026095 Ga0207676_10610516 Ga0207676_106105162 163
548 3300026095 Ga0207676_11040605 Ga0207676_110406052 163
549 3300026116 Ga0207674_10000082 Ga0207674_1000008259 163
550 3300026116 Ga0207674_10000742 Ga0207674_1000074222 163
551 3300026116 Ga0207674_10021934 Ga0207674_100219345 163
552 3300026116 Ga0207674_10039213 Ga0207674_100392134 163
553 3300026116 Ga0207674_11405553 Ga0207674_114055531 163
554 3300026118 Ga0207675_100118250 Ga0207675_1001182503 163
555 3300026118 Ga0207675_100254848 Ga0207675_1002548482 163
556 3300026118 Ga0207675_100374588 Ga0207675_1003745883 163
557 3300026118 Ga0207675_100533263 Ga0207675_1005332632 163
558 3300026118 Ga0207675_100572267 Ga0207675_1005722672 163
559 3300026121 Ga0207683_10039447 Ga0207683_100394474 163
560 3300026121 Ga0207683_10124907 Ga0207683_101249072 163
561 3300026121 Ga0207683_10593936 Ga0207683_105939362 163
562 3300026142 Ga0207698_10016251 Ga0207698_100162517 163
563 3300026142 Ga0207698_10755462 Ga0207698_107554622 163
564 3300027665 Ga0209983_1049604 Ga0209983_10496041 163
565 3300027876 Ga0209974_10060753 Ga0209974_100607532 163
566 3300027876 Ga0209974_10145744 Ga0209974_101457441 163
567 3300027876 Ga0209974_10202678 Ga0209974_102026781 163
568 3300028379 Ga0268266_10000998 Ga0268266_1000099832 163
569 3300028379 Ga0268266_10014168 Ga0268266_100141688 163
570 3300028379 Ga0268266_10076810 Ga0268266_100768104 163
571 3300028379 Ga0268266_10165258 Ga0268266_101652583 163
572 3300028380 Ga0268265_10000904 Ga0268265_1000090418 163
573 3300028380 Ga0268265_10001512 Ga0268265_100015126 163
574 3300028380 Ga0268265_10031556 Ga0268265_100315563 163
575 3300028380 Ga0268265_10068935 Ga0268265_100689352 163
576 3300028380 Ga0268265_10071917 Ga0268265_100719174 163
577 3300028380 Ga0268265_10137565 Ga0268265_101375652 163
578 3300028380 Ga0268265_10414514 Ga0268265_104145142 163
579 3300028380 Ga0268265_10435077 Ga0268265_104350773 163
580 3300028380 Ga0268265_11177260 Ga0268265_111772601 163
581 3300028380 Ga0268265_11517088 Ga0268265_115170881 163
582 3300028381 Ga0268264_10001156 Ga0268264_1000115618 163
583 3300028381 Ga0268264_10016372 Ga0268264_100163726 163
584 3300028381 Ga0268264_10082038 Ga0268264_100820384 163
585 3300028381 Ga0268264_10424242 Ga0268264_104242421 163
586 3300030734 Ga0316179_1056112 Ga0316179_10561121 163
587 3300030735 Ga0316178_1062952 Ga0316178_10629522 163
588 3300030742 Ga0316183_1160958 Ga0316183_11609582 163
589 3300030745 Ga0316182_1344640 Ga0316182_13446401 163
590 3300031548 Ga0307408_100019904 Ga0307408_1000199042 163
591 3300031548 Ga0307408_100035684 Ga0307408_1000356843 163
592 3300031548 Ga0307408_100043480 Ga0307408_1000434803 163
593 3300031548 Ga0307408_100061767 Ga0307408_1000617673 163
594 3300031548 Ga0307408_100072183 Ga0307408_1000721833 163
595 3300031548 Ga0307408_100311447 Ga0307408_1003114472 163
596 3300031548 Ga0307408_100330488 Ga0307408_1003304882 163
597 3300031548 Ga0307408_100389029 Ga0307408_1003890291 163
598 3300031548 Ga0307408_100432551 Ga0307408_1004325512 163
599 3300031548 Ga0307408_100574806 Ga0307408_1005748062 163
600 3300031548 Ga0307408_100623078 Ga0307408_1006230782 163
601 3300031548 Ga0307408_100639890 Ga0307408_1006398901 163
602 3300031548 Ga0307408_100976075 Ga0307408_1009760752 163
603 3300031548 Ga0307408_101098701 Ga0307408_1010987012 163
604 3300031731 Ga0307405_10008446 Ga0307405_100084464 163
605 3300031731 Ga0307405_10013596 Ga0307405_100135962 163
606 3300031731 Ga0307405_10022923 Ga0307405_100229233 163
607 3300031731 Ga0307405_10023179 Ga0307405_100231793 163
608 3300031731 Ga0307405_10034602 Ga0307405_100346022 163
609 3300031731 Ga0307405_10057311 Ga0307405_100573115 163
610 3300031731 Ga0307405_10078740 Ga0307405_100787403 163
611 3300031731 Ga0307405_10132311 Ga0307405_101323113 163
612 3300031731 Ga0307405_10360603 Ga0307405_103606032 163
613 3300031731 Ga0307405_10430862 Ga0307405_104308622 163
614 3300031731 Ga0307405_10515705 Ga0307405_105157052 163
615 3300031731 Ga0307405_10903722 Ga0307405_109037222 163
616 3300031824 Ga0307413_10000319 Ga0307413_1000031910 163
617 3300031824 Ga0307413_10008490 Ga0307413_100084908 163
618 3300031824 Ga0307413_10009685 Ga0307413_100096854 163
619 3300031824 Ga0307413_10023295 Ga0307413_100232954 163
620 3300031824 Ga0307413_10066071 Ga0307413_100660711 163
621 3300031824 Ga0307413_10071081 Ga0307413_100710813 163
622 3300031824 Ga0307413_10082162 Ga0307413_100821623 163
623 3300031824 Ga0307413_10108962 Ga0307413_101089622 163
624 3300031824 Ga0307413_10147705 Ga0307413_101477052 163
625 3300031824 Ga0307413_10151384 Ga0307413_101513842 163
626 3300031824 Ga0307413_10306658 Ga0307413_103066582 163
627 3300031824 Ga0307413_10435205 Ga0307413_104352052 163
628 3300031824 Ga0307413_10627171 Ga0307413_106271712 163
629 3300031824 Ga0307413_10663729 Ga0307413_106637292 163
630 3300031824 Ga0307413_11237145 Ga0307413_112371452 163
631 3300031852 Ga0307410_10002711 Ga0307410_100027113 163
632 3300031852 Ga0307410_10004584 Ga0307410_100045846 163
633 3300031852 Ga0307410_10005320 Ga0307410_100053208 163
634 3300031852 Ga0307410_10016702 Ga0307410_100167025 163
635 3300031852 Ga0307410_10025787 Ga0307410_100257874 163
636 3300031852 Ga0307410_10040427 Ga0307410_100404273 163
637 3300031852 Ga0307410_10054710 Ga0307410_100547105 163
638 3300031852 Ga0307410_10070650 Ga0307410_100706505 163
639 3300031852 Ga0307410_10122112 Ga0307410_101221122 163
640 3300031852 Ga0307410_10130862 Ga0307410_101308622 163
641 3300031852 Ga0307410_10144070 Ga0307410_101440702 163
642 3300031852 Ga0307410_10161100 Ga0307410_101611002 163
643 3300031852 Ga0307410_10297937 Ga0307410_102979372 163
644 3300031852 Ga0307410_10308761 Ga0307410_103087612 163
645 3300031852 Ga0307410_10356986 Ga0307410_103569861 163
646 3300031852 Ga0307410_10375629 Ga0307410_103756292 163
647 3300031852 Ga0307410_10514884 Ga0307410_105148842 163
648 3300031852 Ga0307410_10983949 Ga0307410_109839492 163
649 3300031901 Ga0307406_10020360 Ga0307406_100203602 163
650 3300031901 Ga0307406_10026376 Ga0307406_100263763 163
651 3300031901 Ga0307406_10310496 Ga0307406_103104962 163
652 3300031901 Ga0307406_10351337 Ga0307406_103513372 163
653 3300031901 Ga0307406_10382494 Ga0307406_103824942 163
654 3300031901 Ga0307406_10530577 Ga0307406_105305771 163
655 3300031901 Ga0307406_10639311 Ga0307406_106393111 163
656 3300031901 Ga0307406_10749816 Ga0307406_107498162 163
657 3300031901 Ga0307406_11233935 Ga0307406_112339352 163
658 3300031903 Ga0307407_10001271 Ga0307407_100012712 163
659 3300031903 Ga0307407_10007630 Ga0307407_100076303 163
660 3300031903 Ga0307407_10015882 Ga0307407_100158824 163
661 3300031903 Ga0307407_10057832 Ga0307407_100578322 163
662 3300031903 Ga0307407_10063805 Ga0307407_100638053 163
663 3300031903 Ga0307407_10300651 Ga0307407_103006512 163
664 3300031903 Ga0307407_10325458 Ga0307407_103254581 163
665 3300031903 Ga0307407_10384735 Ga0307407_103847351 163
666 3300031903 Ga0307407_10522056 Ga0307407_105220562 163
667 3300031903 Ga0307407_11025696 Ga0307407_110256961 163
668 3300031903 Ga0307407_11041620 Ga0307407_110416201 163
669 3300031903 Ga0307407_11227274 Ga0307407_112272741 163
670 3300031911 Ga0307412_10012093 Ga0307412_100120933 163
671 3300031911 Ga0307412_10022909 Ga0307412_100229094 163
672 3300031911 Ga0307412_10025242 Ga0307412_100252423 163
673 3300031911 Ga0307412_10027237 Ga0307412_100272373 163
674 3300031911 Ga0307412_10028208 Ga0307412_100282082 163
675 3300031911 Ga0307412_10182292 Ga0307412_101822922 163
676 3300031911 Ga0307412_10207483 Ga0307412_102074832 163
677 3300031911 Ga0307412_10261446 Ga0307412_102614463 163
678 3300031911 Ga0307412_10360935 Ga0307412_103609353 163
679 3300031911 Ga0307412_10373222 Ga0307412_103732222 163
680 3300031911 Ga0307412_10473286 Ga0307412_104732862 163
681 3300031911 Ga0307412_10797968 Ga0307412_107979681 163
682 3300031911 Ga0307412_10865982 Ga0307412_108659822 163
683 3300031995 Ga0307409_100001246 Ga0307409_1000012463 163
684 3300031995 Ga0307409_100005066 Ga0307409_1000050668 163
685 3300031995 Ga0307409_100008713 Ga0307409_1000087135 163
686 3300031995 Ga0307409_100009020 Ga0307409_1000090206 163
687 3300031995 Ga0307409_100010184 Ga0307409_1000101846 163
688 3300031995 Ga0307409_100023711 Ga0307409_1000237112 163
689 3300031995 Ga0307409_100026480 Ga0307409_1000264805 163
690 3300031995 Ga0307409_100027250 Ga0307409_1000272503 163
691 3300031995 Ga0307409_100028293 Ga0307409_1000282931 163
692 3300031995 Ga0307409_100032981 Ga0307409_1000329812 163
693 3300031995 Ga0307409_100046073 Ga0307409_1000460732 163
694 3300031995 Ga0307409_100124659 Ga0307409_1001246593 163
695 3300031995 Ga0307409_100179781 Ga0307409_1001797814 163
696 3300031995 Ga0307409_100200258 Ga0307409_1002002583 163
697 3300031995 Ga0307409_100515620 Ga0307409_1005156202 163
698 3300031995 Ga0307409_100608442 Ga0307409_1006084422 163
699 3300031995 Ga0307409_100616188 Ga0307409_1006161882 163
700 3300031995 Ga0307409_100672312 Ga0307409_1006723122 163
701 3300031995 Ga0307409_100843267 Ga0307409_1008432672 163
702 3300031995 Ga0307409_102368127 Ga0307409_1023681271 163
703 3300032002 Ga0307416_100023149 Ga0307416_1000231497 163
704 3300032002 Ga0307416_100025962 Ga0307416_1000259624 163
705 3300032002 Ga0307416_100031424 Ga0307416_1000314243 163
706 3300032002 Ga0307416_100041998 Ga0307416_1000419982 163
707 3300032002 Ga0307416_100068215 Ga0307416_1000682153 163
708 3300032002 Ga0307416_100134485 Ga0307416_1001344853 163
709 3300032002 Ga0307416_100165618 Ga0307416_1001656183 163
710 3300032002 Ga0307416_100228851 Ga0307416_1002288511 163
711 3300032002 Ga0307416_100263505 Ga0307416_1002635054 163
712 3300032002 Ga0307416_100271308 Ga0307416_1002713082 163
713 3300032002 Ga0307416_100315136 Ga0307416_1003151361 163
714 3300032002 Ga0307416_100368095 Ga0307416_1003680952 163
715 3300032002 Ga0307416_100615778 Ga0307416_1006157783 163
716 3300032002 Ga0307416_101000005 Ga0307416_1010000052 163
717 3300032002 Ga0307416_101075690 Ga0307416_1010756902 163
718 3300032002 Ga0307416_101191247 Ga0307416_1011912472 163
719 3300032002 Ga0307416_101199617 Ga0307416_1011996172 163
720 3300032002 Ga0307416_101430796 Ga0307416_1014307961 163
721 3300032002 Ga0307416_101702028 Ga0307416_1017020281 163
722 3300032004 Ga0307414_10003327 Ga0307414_100033277 163
723 3300032004 Ga0307414_10006791 Ga0307414_100067915 163
724 3300032004 Ga0307414_10006964 Ga0307414_100069644 163
725 3300032004 Ga0307414_10016846 Ga0307414_100168462 163
726 3300032004 Ga0307414_10025948 Ga0307414_100259486 163
727 3300032004 Ga0307414_10026489 Ga0307414_100264896 163
728 3300032004 Ga0307414_10037860 Ga0307414_100378603 163
729 3300032004 Ga0307414_10051077 Ga0307414_100510772 163
730 3300032004 Ga0307414_10131034 Ga0307414_101310342 163
731 3300032004 Ga0307414_10167642 Ga0307414_101676423 163
732 3300032004 Ga0307414_10172571 Ga0307414_101725713 163
733 3300032004 Ga0307414_10199146 Ga0307414_101991463 163
734 3300032004 Ga0307414_10239853 Ga0307414_102398532 163
735 3300032004 Ga0307414_10288225 Ga0307414_102882253 163
736 3300032004 Ga0307414_10326095 Ga0307414_103260953 163
737 3300032004 Ga0307414_10330477 Ga0307414_103304772 163
738 3300032004 Ga0307414_10453262 Ga0307414_104532622 163
739 3300032004 Ga0307414_10661206 Ga0307414_106612062 163
740 3300032004 Ga0307414_10828917 Ga0307414_108289172 163
741 3300032004 Ga0307414_10917547 Ga0307414_109175472 163
742 3300032004 Ga0307414_10943336 Ga0307414_109433362 163
743 3300032004 Ga0307414_11306250 Ga0307414_113062501 163
744 3300032005 Ga0307411_10001005 Ga0307411_100010056 163
745 3300032005 Ga0307411_10001575 Ga0307411_100015755 163
746 3300032005 Ga0307411_10001921 Ga0307411_100019218 163
747 3300032005 Ga0307411_10008808 Ga0307411_100088086 163
748 3300032005 Ga0307411_10009521 Ga0307411_100095213 163
749 3300032005 Ga0307411_10011850 Ga0307411_100118504 163
750 3300032005 Ga0307411_10014233 Ga0307411_100142335 163
751 3300032005 Ga0307411_10017316 Ga0307411_100173162 163
752 3300032005 Ga0307411_10022483 Ga0307411_100224835 163
753 3300032005 Ga0307411_10025884 Ga0307411_100258843 163
754 3300032005 Ga0307411_10026777 Ga0307411_100267774 163
755 3300032005 Ga0307411_10041864 Ga0307411_100418643 163
756 3300032005 Ga0307411_10059709 Ga0307411_100597094 163
757 3300032005 Ga0307411_10083042 Ga0307411_100830423 163
758 3300032005 Ga0307411_10116120 Ga0307411_101161203 163
759 3300032005 Ga0307411_10145995 Ga0307411_101459953 163
760 3300032005 Ga0307411_10194872 Ga0307411_101948721 163
761 3300032005 Ga0307411_10214329 Ga0307411_102143292 163
762 3300032005 Ga0307411_10289936 Ga0307411_102899363 163
763 3300032005 Ga0307411_11089570 Ga0307411_110895702 163
764 3300032005 Ga0307411_11103354 Ga0307411_111033542 163
765 3300032005 Ga0307411_11660088 Ga0307411_116600881 163
766 3300032126 Ga0307415_100001667 Ga0307415_10000166710 163
767 3300032126 Ga0307415_100005954 Ga0307415_1000059545 163
768 3300032126 Ga0307415_100027881 Ga0307415_1000278812 163
769 3300032126 Ga0307415_100056224 Ga0307415_1000562243 163
770 3300032126 Ga0307415_100081327 Ga0307415_1000813273 163
771 3300032126 Ga0307415_100118017 Ga0307415_1001180172 163
772 3300032126 Ga0307415_100139339 Ga0307415_1001393392 163
773 3300032126 Ga0307415_100354775 Ga0307415_1003547752 163
774 3300032126 Ga0307415_100455107 Ga0307415_1004551072 163
775 3300032126 Ga0307415_100558678 Ga0307415_1005586782 163
776 3300032126 Ga0307415_100632863 Ga0307415_1006328632 163
777 3300032126 Ga0307415_100666268 Ga0307415_1006662682 163
778 3300032126 Ga0307415_100696523 Ga0307415_1006965232 163
779 3300032126 Ga0307415_100802005 Ga0307415_1008020052 163
780 3300032126 Ga0307415_100902747 Ga0307415_1009027472 163
781 3300032126 Ga0307415_100986397 Ga0307415_1009863972 163
782 3300032126 Ga0307415_100997809 Ga0307415_1009978092 163
783 3300032126 Ga0307415_101443971 Ga0307415_1014439712 163
784 3300032126 Ga0307415_101444874 Ga0307415_1014448741 163
785 3300032126 Ga0307415_101811480 Ga0307415_1018114801 163
786 3300035085 Ga0373929_0040180 Ga0373929_0040180_449_949 163
787 3300035088 Ga0373940_0081264 Ga0373940_0081264_329_829 163
788 3300035170 Ga0373943_0633214 Ga0373943_0633214_111_608 163
789 3300035241 Ga0373961_0043720 Ga0373961_0043720_739_1233 163
790 3300037068 Ga0373925_1325710 Ga0373925_1325710_40_537 163
791 3300037312 Ga0395899_0001981 Ga0395899_0001981_343_840 163
792 3300037312 Ga0395899_0034165 Ga0395899_0034165_2122_2619 163
793 3300037312 Ga0395899_0113561 Ga0395899_0113561_1097_1597 163
794 3300037312 Ga0395899_0237272 Ga0395899_0237272_554_1054 163
795 3300037312 Ga0395899_0384441 Ga0395899_0384441_65_565 163
796 3300037312 Ga0395899_0385080 Ga0395899_0385080_53_553 163
797 3300037418 Ga0395900_0004556 Ga0395900_0004556_9003_9503 163
798 3300037418 Ga0395900_0011699 Ga0395900_0011699_2873_3373 163
799 3300037418 Ga0395900_0046262 Ga0395900_0046262_141_638 163
800 3300037418 Ga0395900_0053286 Ga0395900_0053286_2108_2605 163
801 3300037418 Ga0395900_0069803 Ga0395900_0069803_933_1433 163
802 3300037418 Ga0395900_0073606 Ga0395900_0073606_617_1114 163
803 3300037418 Ga0395900_0092984 Ga0395900_0092984_1426_1923 163
804 3300037418 Ga0395900_0107834 Ga0395900_0107834_1371_1871 163
805 3300037418 Ga0395900_0130171 Ga0395900_0130171_283_783 163
806 3300037418 Ga0395900_0139530 Ga0395900_0139530_640_1140 163
807 3300037418 Ga0395900_0155170 Ga0395900_0155170_184_684 163
808 3300037418 Ga0395900_0497812 Ga0395900_0497812_463_963 163
809 3300037418 Ga0395900_0559124 Ga0395900_0559124_431_931 163
810 3300037418 Ga0395900_0849700 Ga0395900_0849700_184_684 163
811 3300037466 Ga0395898_0014031 Ga0395898_0014031_7322_7819 163
812 3300037466 Ga0395898_0133510 Ga0395898_0133510_475_975 163
813 3300037466 Ga0395898_0168167 Ga0395898_0168167_445_945 163
814 3300037466 Ga0395898_0349295 Ga0395898_0349295_346_846 163
815 3300037466 Ga0395898_0760318 Ga0395898_0760318_140_637 163
816 3300037466 Ga0395898_0851867 Ga0395898_0851867_45_545 163
817 3300037471 Ga0395905_0001242 Ga0395905_0001242_7686_8183 163
818 3300037471 Ga0395905_0001527 Ga0395905_0001527_3925_4425 163
819 3300037471 Ga0395905_0002470 Ga0395905_0002470_1798_2298 163
820 3300037471 Ga0395905_0004038 Ga0395905_0004038_1247_1744 163
821 3300037471 Ga0395905_0019750 Ga0395905_0019750_4714_5211 163
822 3300037471 Ga0395905_0059625 Ga0395905_0059625_2734_3231 163
823 3300037471 Ga0395905_0065629 Ga0395905_0065629_1627_2124 163
824 3300037471 Ga0395905_0084043 Ga0395905_0084043_2302_2802 163
825 3300037471 Ga0395905_0122767 Ga0395905_0122767_1457_1957 163
826 3300037471 Ga0395905_0127992 Ga0395905_0127992_1023_1523 163
827 3300037471 Ga0395905_0193016 Ga0395905_0193016_272_769 163
828 3300037471 Ga0395905_0338046 Ga0395905_0338046_852_1352 163
829 3300037471 Ga0395905_0536177 Ga0395905_0536177_546_1046 163
830 3300037471 Ga0395905_0695347 Ga0395905_0695347_291_791 163
831 3300038443 Ga0395901_0001188 Ga0395901_0001188_6519_7019 163
832 3300038443 Ga0395901_0014280 Ga0395901_0014280_3735_4235 163
833 3300038443 Ga0395901_0024056 Ga0395901_0024056_4586_5086 163
834 3300038443 Ga0395901_0030229 Ga0395901_0030229_2826_3326 163
835 3300038443 Ga0395901_0033440 Ga0395901_0033440_438_938 163
836 3300038443 Ga0395901_0078177 Ga0395901_0078177_2093_2593 163
837 3300038443 Ga0395901_0143071 Ga0395901_0143071_38_538 163
838 3300038443 Ga0395901_0149387 Ga0395901_0149387_491_991 163
839 3300038443 Ga0395901_0173846 Ga0395901_0173846_243_740 163
840 3300038443 Ga0395901_0177652 Ga0395901_0177652_984_1481 163
841 3300038443 Ga0395901_0210855 Ga0395901_0210855_1311_1811 163
842 3300038443 Ga0395901_0675132 Ga0395901_0675132_285_782 163
843 3300038443 Ga0395901_0997261 Ga0395901_0997261_90_590 163
844 3300041408 Ga0439453_0070174 Ga0439453_0070174_69_569 163
845 3300041413 Ga0439465_0258952 Ga0439465_0258952_91_588 163
846 3300041453 Ga0451797_0630063 Ga0451797_0630063_35_532 163
847 3300041512 Ga0451853_3080815 Ga0451853_3080815_211_708 163
848 3300042004 Ga0439445_0000012 Ga0439445_0000012_20121_20621 163
849 3300042006 Ga0439432_009664 Ga0439432_009664_1409_1906 163
850 3300042006 Ga0439432_044080 Ga0439432_044080_168_665 163
851 3300042010 Ga0439452_127219 Ga0439452_127219_14_514 163
852 3300042015 Ga0439462_0160594 Ga0439462_0160594_49_546 163
853 3300042122 Ga0450920_041391 Ga0450920_041391_237_734 163
854 3300042144 Ga0450889_043135 Ga0450889_043135_29_526 163
855 3300042439 Ga0439464_0001790 Ga0439464_0001790_3698_4198 163
856 3300046492 Ga0495585_0040405 Ga0495585_0040405_855_1355 163
857 3300046492 Ga0495585_0502373 Ga0495585_0502373_48_554 163
858 3300046522 Ga0495643_0084158 Ga0495643_0084158_364_861 163
859 3300046525 Ga0495663_0001128 Ga0495663_0001128_2045_2545 163
860 3300046525 Ga0495663_0053707 Ga0495663_0053707_690_1193 163
861 3300046539 Ga0495621_0000662 Ga0495621_0000662_4604_5107 163
862 3300046539 Ga0495621_0001074 Ga0495621_0001074_1455_1955 163
863 3300046539 Ga0495621_0395426 Ga0495621_0395426_41_541 163
864 3300046558 Ga0495633_0018106 Ga0495633_0018106_957_1457 163
865 3300046558 Ga0495633_0204119 Ga0495633_0204119_53_553 163
866 3300046615 Ga0495656_0210682 Ga0495656_0210682_40_540 163
867 3300046616 Ga0495668_0035874 Ga0495668_0035874_1265_1762 163
868 3300046664 Ga0495659_0081053 Ga0495659_0081053_378_878 163
869 3300046684 Ga0495669_0022815 Ga0495669_0022815_72_569 163
870 3300046684 Ga0495669_0029756 Ga0495669_0029756_1829_2326 163
871 3300046684 Ga0495669_0033465 Ga0495669_0033465_1372_1878 163
872 3300046684 Ga0495669_0060000 Ga0495669_0060000_296_796 163
873 3300046684 Ga0495669_0103219 Ga0495669_0103219_170_667 163
874 3300046684 Ga0495669_0122661 Ga0495669_0122661_604_1101 163
875 3300046684 Ga0495669_0130680 Ga0495669_0130680_536_1036 163
876 3300046684 Ga0495669_0355305 Ga0495669_0355305_109_609 163
877 3300046691 Ga0495670_0017115 Ga0495670_0017115_1497_1997 163
878 3300046691 Ga0495670_0035432 Ga0495670_0035432_1945_2445 163
879 3300046691 Ga0495670_0062461 Ga0495670_0062461_763_1266 163
880 3300046691 Ga0495670_0066826 Ga0495670_0066826_165_671 163
881 3300046691 Ga0495670_0132639 Ga0495670_0132639_623_1123 163
882 3300046691 Ga0495670_0133657 Ga0495670_0133657_568_1074 163
883 3300046691 Ga0495670_0214395 Ga0495670_0214395_394_900 163
884 3300046691 Ga0495670_0218956 Ga0495670_0218956_37_534 163
885 3300046691 Ga0495670_0272484 Ga0495670_0272484_28_525 163
886 3300046691 Ga0495670_0459956 Ga0495670_0459956_161_661 163
887 3300046691 Ga0495670_0650425 Ga0495670_0650425_32_532 163
888 3300047445 Ga0495677_0035788 Ga0495677_0035788_859_1359 163
889 3300047445 Ga0495677_0149316 Ga0495677_0149316_55_561 163
890 3300047445 Ga0495677_0177323 Ga0495677_0177323_123_623 163
891 3300048904 Ga0496101_0313061 Ga0496101_0313061_711_1208 163
892 3300048906 Ga0496103_0075721 Ga0496103_0075721_211_708 163
893 3300048910 Ga0496107_0057217 Ga0496107_0057217_390_887 163
894 3300048911 Ga0496108_0503963 Ga0496108_0503963_362_859 163
895 3300048912 Ga0496109_0280417 Ga0496109_0280417_882_1379 163
896 3300048912 Ga0496109_1149241 Ga0496109_1149241_137_634 163
897 3300048913 Ga0496110_0020696 Ga0496110_0020696_772_1269 163
898 3300048913 Ga0496110_0026486 Ga0496110_0026486_2260_2757 163
899 3300048913 Ga0496110_0070286 Ga0496110_0070286_1447_1944 163
900 3300048914 Ga0496111_0005000 Ga0496111_0005000_4696_5193 163
901 3300048914 Ga0496111_0121349 Ga0496111_0121349_945_1442 163
902 3300048914 Ga0496111_0446879 Ga0496111_0446879_196_693 163
903 3300048917 Ga0496114_0494829 Ga0496114_0494829_344_841 163
904 3300049515 Ga0501292_006633 Ga0501292_006633_938_1435 163
905 3300049521 Ga0501298_076989 Ga0501298_076989_208_705 163
906 3300049651 Ga0501201_001558 Ga0501201_001558_1281_1778 163
907 3300049660 Ga0501216_003241 Ga0501216_003241_1510_2007 163
908 3300049661 Ga0501217_002297 Ga0501217_002297_352_852 163
909 3300049661 Ga0501217_005889 Ga0501217_005889_1588_2085 163
910 3300049663 Ga0501223_002150 Ga0501223_002150_786_1286 163
911 3300049663 Ga0501223_044313 Ga0501223_044313_246_746 163
912 3300049664 Ga0501224_003228 Ga0501224_003228_1258_1755 163
913 3300049668 Ga0501233_009012 Ga0501233_009012_381_881 163
914 3300049668 Ga0501233_043148 Ga0501233_043148_404_901 163
915 3300049669 Ga0501235_002957 Ga0501235_002957_2819_3319 163
916 3300049669 Ga0501235_002977 Ga0501235_002977_1345_1842 163
917 3300049672 Ga0501239_014929 Ga0501239_014929_235_735 163
918 3300049674 Ga0501242_002043 Ga0501242_002043_468_965 163
919 3300049675 Ga0501243_007634 Ga0501243_007634_84_581 163
920 3300049677 Ga0501247_001257 Ga0501247_001257_277_774 163
921 3300049679 Ga0501249_001192 Ga0501249_001192_1941_2441 163
922 3300049679 Ga0501249_003332 Ga0501249_003332_1049_1546 163
923 3300049686 Ga0501257_006689 Ga0501257_006689_586_1086 163
924 3300049686 Ga0501257_012293 Ga0501257_012293_191_688 163
925 3300049687 Ga0501258_003203 Ga0501258_003203_797_1294 163
926 3300049687 Ga0501258_019933 Ga0501258_019933_86_586 163
927 3300049688 Ga0501259_017571 Ga0501259_017571_521_1021 163
928 3300049688 Ga0501259_084693 Ga0501259_084693_109_606 163
929 3300049689 Ga0501260_012994 Ga0501260_012994_290_787 163
930 3300049705 Ga0501225_0005177 Ga0501225_0005177_1999_2496 163
931 3300049705 Ga0501225_0005402 Ga0501225_0005402_83_583 163
932 3300049706 Ga0501229_007951 Ga0501229_007951_285_782 163
933 3300049708 Ga0501245_035791 Ga0501245_035791_245_745 163
934 3300049765 Ga0501268_001804 Ga0501268_001804_1830_2327 163
935 3300049765 Ga0501268_022476 Ga0501268_022476_406_903 163
936 3300049767 Ga0501270_093263 Ga0501270_093263_40_543 163
937 3300049769 Ga0501272_004623 Ga0501272_004623_353_850 163
938 3300049770 Ga0501273_000219 Ga0501273_000219_1886_2386 163
939 3300049775 Ga0501279_049857 Ga0501279_049857_71_571 163
940 3300049779 Ga0501283_011441 Ga0501283_011441_41_541 163
941 3300049850 Ga0501204_002087 Ga0501204_002087_487_984 163
942 3300049850 Ga0501204_003941 Ga0501204_003941_941_1441 163
943 3300049851 Ga0501212_010090 Ga0501212_010090_325_825 163
944 3300050491 nmdc:mga00v17_299183_c1 nmdc:mga00v17_299183_c1_118_621 163
945 3300050491 nmdc:mga00v17_390237_c1 nmdc:mga00v17_390237_c1_275_775 163
946 3300050509 nmdc:mga0qj67_800384_c1 nmdc:mga0qj67_800384_c1_223_723 163
947 3300050510 nmdc:mga06r32_5441_c1 nmdc:mga06r32_5441_c1_2186_2704 163
948 3300050511 nmdc:mga08y16_140640_c1 nmdc:mga08y16_140640_c1_906_1412 163
949 3300050511 nmdc:mga08y16_368194_c1 nmdc:mga08y16_368194_c1_381_884 163
950 3300050512 nmdc:mga0n895_1568891_c1 nmdc:mga0n895_1568891_c1_73_570 163
951 3300050512 nmdc:mga0n895_171861_c1 nmdc:mga0n895_171861_c1_791_1282 163
952 3300050513 nmdc:mga0rr50_362822_c1 nmdc:mga0rr50_362822_c1_603_1109 163
953 3300050515 nmdc:mga0a205_696_c1 nmdc:mga0a205_696_c1_10798_11289 163
954 3300053134 Ga0500658_0000022 Ga0500658_0000022_99896_100393 163
955 3300054114 Ga0501084_1472116 Ga0501084_1472116_10_507 163

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

21

167

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xfs-assembly1.cif.gz_A x-ray crystal structure of protein ne0264 from nitrosomonas europaea. northeast structural genomics consortium target ner5. 0.9544 2 161
1xfs-assembly1.cif.gz_B x-ray crystal structure of protein ne0264 from nitrosomonas europaea. northeast structural genomics consortium target ner5. 0.9418 2 158
1xfs-assembly1.cif.gz_A x-ray crystal structure of protein ne0264 from nitrosomonas europaea. northeast structural genomics consortium target ner5. 0.9242 2 161
1xfs-assembly1.cif.gz_B x-ray crystal structure of protein ne0264 from nitrosomonas europaea. northeast structural genomics consortium target ner5. 0.8944 2 158
1xuv-assembly2.cif.gz_B-2 x-ray crystal structure of protein mm0500 from methanosarcina mazei. northeast structural genomics consortium target mar10. 0.8873 3 162
ID Description Score Start End Superfamily
1xfsB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9135 2 158 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8742 3 163 3.30.530.20
1xfsB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8665 2 158 3.30.530.20
af_Q2G1U9_1_155_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8652 3 156 3.30.530.20
3pu2H00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8307 1 157 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A0N1BWG0-F1-model_v4 Polyketide cyclase 0.9686 2 158
AF-A0A7S6MG77-F1-model_v4 SRPBCC family protein 0.9656 2 158
AF-A0A1I5U1B1-F1-model_v4 Uncharacterized conserved protein YndB, AHSA1/START domain 0.9649 2 158
AF-A0A1W9HRG3-F1-model_v4 Polyketide cyclase 0.9638 7 158
AF-A0A239FDU8-F1-model_v4 Uncharacterized conserved protein YndB, AHSA1/START domain 0.9637 2 161

Feature Viewer

pLDDT pTM Quality
92.44 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map