F486706

General Info

Members Datasets Scaffolds Average Seq Length
955 295 1910 117

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100248258|Ga0068855_1002482582
Length 134
Sequence MGPDQNDELRKKERDEMSAVKDAPTIDFAKMDGLVPGIVQDAKTGEMLMLGFLNETSYAKTLESGFVTFWSRTRQKLWMKGETSGNRLKIVSAATDCDNDALLFRVDVEGDGLVCHEGTVSCFTKPISVSAEGK

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
89 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
142 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
143 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
144 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
147 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
148 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
152 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
153 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
154 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
155 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
156 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
157 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
158 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
159 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
160 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
161 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
162 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
165 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
166 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
167 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
178 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
181 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
184 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
202 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
203 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
204 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
205 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
206 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
207 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
208 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
212 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
213 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
214 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
215 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
216 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
217 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
218 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
219 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
220 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
221 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
222 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
223 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
224 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
225 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
226 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
227 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
228 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
229 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
230 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
231 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
232 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
233 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
234 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
235 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
236 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
237 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
238 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
239 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
240 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
241 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
242 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
243 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
244 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
245 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
248 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
249 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
250 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
251 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
252 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
253 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
254 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
255 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
256 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
257 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
264 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
268 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
269 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
270 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
271 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
282 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
283 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
284 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
285 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
286 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
288 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
289 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
290 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
291 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
292 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
293 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
294 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
295 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0.52
Isolates 0.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.84
Nodule 0
Rhizoplane 1.36
Rhizosphere 96.02
Stem 0
Stem Tuber 0
Unclassified 2.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100248258 3300005563 Bacteria 1986
2 LJNas_1006912 3300000546 Bacteria 1229
3 JGI24743J22301_10071283 3300001991 Bacteria 725
4 rootH2_10171401 3300003320 Bacteria 1378
5 rootH1_10203955 3300003323 Bacteria 1639
6 Ga0070658_10000121 3300005327 Bacteria 70439
7 Ga0070658_10013505 3300005327 Bacteria 6554
8 Ga0070658_10037114 3300005327 Bacteria 3927
9 Ga0070658_10038584 3300005327 Bacteria 3851
10 Ga0070658_10049430 3300005327 Bacteria 3407
11 Ga0070658_10134937 3300005327 Bacteria 2058
12 Ga0070658_10150612 3300005327 Bacteria 1947
13 Ga0070658_10341705 3300005327 Bacteria 1280
14 Ga0070658_10429461 3300005327 Bacteria 1137
15 Ga0070658_10921455 3300005327 Bacteria 760
16 Ga0070676_10229857 3300005328 Bacteria 1229
17 Ga0070683_100002041 3300005329 Bacteria 15901
18 Ga0070683_100015021 3300005329 Bacteria 6793
19 Ga0070683_100015398 3300005329 Bacteria 6717
20 Ga0070683_100028772 3300005329 Bacteria 5025
21 Ga0070683_100135740 3300005329 Bacteria 2330
22 Ga0070683_100183443 3300005329 Bacteria 1986
23 Ga0070683_100779235 3300005329 Bacteria 916
24 Ga0070683_100898533 3300005329 Bacteria 850
25 Ga0070670_100005099 3300005331 Bacteria 11055
26 Ga0068869_100002456 3300005334 Bacteria 11175
27 Ga0068869_100503734 3300005334 Bacteria 1011
28 Ga0070666_10071003 3300005335 Bacteria 2369
29 Ga0070666_10285534 3300005335 Bacteria 1173
30 Ga0070680_100007018 3300005336 Bacteria 8584
31 Ga0070680_100032000 3300005336 Bacteria 4231
32 Ga0070682_100345088 3300005337 Bacteria 1108
33 Ga0068868_100000066 3300005338 Bacteria 59945
34 Ga0068868_100030705 3300005338 Bacteria 4121
35 Ga0068868_100202417 3300005338 Bacteria 1656
36 Ga0068868_100251736 3300005338 Bacteria 1487
37 Ga0068868_100955371 3300005338 Bacteria 782
38 Ga0070660_100008313 3300005339 Bacteria 7255
39 Ga0070660_100185531 3300005339 Bacteria 1684
40 Ga0070660_101936061 3300005339 Bacteria 503
41 Ga0070691_10410588 3300005341 Bacteria 765
42 Ga0070691_10820556 3300005341 Bacteria 568
43 Ga0070661_100016527 3300005344 Bacteria 5220
44 Ga0070661_100018919 3300005344 Bacteria 4905
45 Ga0070661_100111867 3300005344 Bacteria 2040
46 Ga0070661_100112059 3300005344 Unclassified 2038
47 Ga0070661_100198292 3300005344 Bacteria 1533
48 Ga0070661_100230310 3300005344 Bacteria 1424
49 Ga0070661_100542850 3300005344 Bacteria 934
50 Ga0070661_100838680 3300005344 Bacteria 756
51 Ga0070661_101035467 3300005344 Bacteria 682
52 Ga0070661_101631218 3300005344 Bacteria 546
53 Ga0070692_10972062 3300005345 Bacteria 592
54 Ga0070668_100215320 3300005347 Bacteria 1582
55 Ga0070669_101089400 3300005353 Bacteria 688
56 Ga0070671_100000411 3300005355 Bacteria 29652
57 Ga0070671_100003123 3300005355 Bacteria 12901
58 Ga0070671_100027039 3300005355 Bacteria 4720
59 Ga0070674_100431124 3300005356 Bacteria 1084
60 Ga0070659_100004580 3300005366 Bacteria 9889
61 Ga0070659_100030029 3300005366 Bacteria 4204
62 Ga0070667_100002645 3300005367 Bacteria 15516
63 Ga0070709_10949888 3300005434 Bacteria 682
64 Ga0070709_11714150 3300005434 Bacteria 513
65 Ga0070714_100002654 3300005435 Bacteria 13178
66 Ga0070714_100099406 3300005435 Bacteria 2560
67 Ga0070713_100033702 3300005436 Bacteria 4106
68 Ga0070713_100095055 3300005436 Bacteria 2570
69 Ga0070713_100306613 3300005436 Bacteria 1463
70 Ga0070713_100374302 3300005436 Bacteria 1326
71 Ga0070713_100423960 3300005436 Bacteria 1246
72 Ga0070713_100980652 3300005436 Bacteria 815
73 Ga0070713_101505149 3300005436 Bacteria 653
74 Ga0070710_10226393 3300005437 Bacteria 1192
75 Ga0070711_100316224 3300005439 Bacteria 1246
76 Ga0070711_100547276 3300005439 Bacteria 960
77 Ga0070711_100733469 3300005439 Bacteria 834
78 Ga0070663_100019192 3300005455 Bacteria 4500
79 Ga0070663_100019345 3300005455 Bacteria 4485
80 Ga0070663_100070653 3300005455 Bacteria 2539
81 Ga0070663_100143609 3300005455 Bacteria 1824
82 Ga0070678_100854730 3300005456 Bacteria 829
83 Ga0070678_101766683 3300005456 Bacteria 583
84 Ga0070681_10001050 3300005458 Bacteria 23493
85 Ga0070681_10053249 3300005458 Bacteria 4032
86 Ga0070681_10103095 3300005458 Bacteria 2798
87 Ga0070681_10215158 3300005458 Bacteria 1838
88 Ga0070679_100000968 3300005530 Bacteria 24975
89 Ga0070679_100003993 3300005530 Bacteria 13587
90 Ga0070679_100006128 3300005530 Bacteria 11185
91 Ga0070679_100057253 3300005530 Bacteria 3885
92 Ga0070679_101944246 3300005530 Unclassified 537
93 Ga0070684_100016109 3300005535 Bacteria 6107
94 Ga0070684_100054432 3300005535 Bacteria 3487
95 Ga0070684_100184604 3300005535 Bacteria 1897
96 Ga0070684_100200183 3300005535 Bacteria 1819
97 Ga0070684_100610250 3300005535 Bacteria 1015
98 Ga0070684_100782645 3300005535 Bacteria 891
99 Ga0068853_100000222 3300005539 Bacteria 40206
100 Ga0068853_100000367 3300005539 Bacteria 31060
101 Ga0068853_100078090 3300005539 Bacteria 2893
102 Ga0068853_100178099 3300005539 Unclassified 1927
103 Ga0068853_100241876 3300005539 Bacteria 1654
104 Ga0068853_100371177 3300005539 Bacteria 1335
105 Ga0068853_100582516 3300005539 Bacteria 1062
106 Ga0068853_101323874 3300005539 Bacteria 696
107 Ga0068853_101482488 3300005539 Unclassified 657
108 Ga0070672_100006275 3300005543 Bacteria 7967
109 Ga0070672_100519923 3300005543 Bacteria 1031
110 Ga0070693_101636169 3300005547 Bacteria 506
111 Ga0070665_100044594 3300005548 Bacteria 4453
112 Ga0070665_100230859 3300005548 Bacteria 1850
113 Ga0070665_100296619 3300005548 Bacteria 1619
114 Ga0070665_100431607 3300005548 Bacteria 1326
115 Ga0070665_100538074 3300005548 Bacteria 1180
116 Ga0070665_101341878 3300005548 Bacteria 725
117 Ga0068855_100000277 3300005563 Bacteria 63213
118 Ga0068855_100002688 3300005563 Bacteria 21925
119 Ga0068855_100003653 3300005563 Bacteria 18822
120 Ga0068855_100010384 3300005563 Bacteria 11233
121 Ga0068855_100012571 3300005563 Bacteria 10218
122 Ga0068855_100022187 3300005563 Bacteria 7607
123 Ga0068855_100036038 3300005563 Bacteria 5890
124 Ga0068855_100057885 3300005563 Bacteria 4542
125 Ga0068855_100135969 3300005563 Bacteria 2804
126 Ga0068855_100348240 3300005563 Bacteria 1632
127 Ga0068855_100366863 3300005563 Bacteria 1583
128 Ga0068855_100400348 3300005563 Bacteria 1504
129 Ga0068855_100442404 3300005563 Bacteria 1419
130 Ga0068855_100967794 3300005563 Bacteria 896
131 Ga0068855_101161343 3300005563 Bacteria 804
132 Ga0070664_100127912 3300005564 Bacteria 2230
133 Ga0070664_100167202 3300005564 Bacteria 1949
134 Ga0070664_100598772 3300005564 Bacteria 1022
135 Ga0070664_102051637 3300005564 Bacteria 543
136 Ga0068857_100013234 3300005577 Bacteria 7188
137 Ga0068857_100015817 3300005577 Bacteria 6601
138 Ga0068857_100016334 3300005577 Bacteria 6505
139 Ga0068857_100120350 3300005577 Bacteria 2363
140 Ga0068857_100202072 3300005577 Bacteria 1812
141 Ga0068857_100373500 3300005577 Bacteria 1323
142 Ga0068854_100000019 3300005578 Bacteria 134145
143 Ga0068854_100008770 3300005578 Bacteria 6510
144 Ga0068854_100042728 3300005578 Bacteria 3209
145 Ga0068854_100311570 3300005578 Bacteria 1277
146 Ga0068854_100422016 3300005578 Bacteria 1108
147 Ga0068856_100003529 3300005614 Bacteria 15773
148 Ga0068856_100006467 3300005614 Bacteria 11493
149 Ga0068856_100019915 3300005614 Bacteria 6512
150 Ga0068856_100028379 3300005614 Bacteria 5464
151 Ga0068856_100037527 3300005614 Bacteria 4754
152 Ga0068856_100054362 3300005614 Bacteria 3949
153 Ga0068856_100258107 3300005614 Bacteria 1758
154 Ga0068856_100702563 3300005614 Bacteria 1031
155 Ga0068856_102227158 3300005614 Bacteria 557
156 Ga0068852_100000019 3300005616 Bacteria 129021
157 Ga0068852_100000097 3300005616 Bacteria 59430
158 Ga0068852_100001535 3300005616 Bacteria 15668
159 Ga0068852_100006965 3300005616 Bacteria 8225
160 Ga0068852_100015924 3300005616 Bacteria 5850
161 Ga0068852_100027564 3300005616 Bacteria 4631
162 Ga0068852_100050084 3300005616 Bacteria 3577
163 Ga0068852_100059108 3300005616 Bacteria 3324
164 Ga0068852_100213509 3300005616 Bacteria 1832
165 Ga0068852_100241388 3300005616 Unclassified 1727
166 Ga0068852_100471619 3300005616 Bacteria 1246
167 Ga0068859_100006530 3300005617 Bacteria 11843
168 Ga0068864_100002762 3300005618 Bacteria 14478
169 Ga0068864_100012167 3300005618 Bacteria 7112
170 Ga0068864_102329345 3300005618 Bacteria 542
171 Ga0068866_10437894 3300005718 Bacteria 852
172 Ga0068851_10001766 3300005834 Bacteria 9449
173 Ga0068851_10010381 3300005834 Bacteria 4348
174 Ga0068851_10083174 3300005834 Bacteria 1674
175 Ga0068851_10139420 3300005834 Bacteria 1318
176 Ga0068863_100001753 3300005841 Bacteria 21524
177 Ga0068863_100001814 3300005841 Bacteria 21208
178 Ga0068863_100120289 3300005841 Bacteria 2503
179 Ga0068858_100003316 3300005842 Bacteria 16031
180 Ga0068858_100015914 3300005842 Bacteria 7067
181 Ga0068858_100278903 3300005842 Bacteria 1591
182 Ga0068860_100000689 3300005843 Bacteria 38878
183 Ga0070717_10011904 3300006028 Bacteria 6620
184 Ga0070717_10481961 3300006028 Bacteria 1120
185 Ga0070717_10830751 3300006028 Bacteria 841
186 Ga0070716_100189133 3300006173 Bacteria 1359
187 Ga0070716_100341836 3300006173 Bacteria 1056
188 Ga0070712_100122617 3300006175 Bacteria 1958
189 Ga0070712_101271073 3300006175 Bacteria 641
190 Ga0070712_101995940 3300006175 Bacteria 508
191 Ga0097621_100000349 3300006237 Bacteria 31779
192 Ga0097621_100048467 3300006237 Bacteria 3447
193 Ga0097621_100165375 3300006237 Bacteria 1904
194 Ga0068871_100035557 3300006358 Bacteria 3960
195 Ga0068871_100675555 3300006358 Bacteria 944
196 Ga0068865_100268881 3300006881 Bacteria 1353
197 Ga0075436_100198902 3300006914 Bacteria 1419
198 Ga0097620_100006530 3300006931 Bacteria 11843
199 Ga0099794_10444218 3300007265 Bacteria 680
200 Ga0105240_10000001 3300009093 Bacteria 2887840
201 Ga0105240_10000372 3300009093 Bacteria 84325
202 Ga0105240_10000496 3300009093 Bacteria 72575
203 Ga0105240_10001875 3300009093 Bacteria 34957
204 Ga0105240_10003485 3300009093 Bacteria 24396
205 Ga0105240_10010838 3300009093 Bacteria 12767
206 Ga0105240_10033184 3300009093 Bacteria 6673
207 Ga0105240_10034761 3300009093 Bacteria 6498
208 Ga0105240_10057886 3300009093 Bacteria 4839
209 Ga0105240_10060708 3300009093 Bacteria 4712
210 Ga0105240_10122963 3300009093 Bacteria 3123
211 Ga0105240_10234142 3300009093 Bacteria 2132
212 Ga0105240_10393531 3300009093 Bacteria 1562
213 Ga0105240_10395370 3300009093 Bacteria 1558
214 Ga0105240_10425874 3300009093 Bacteria 1490
215 Ga0105240_10714988 3300009093 Bacteria 1092
216 Ga0105240_10898876 3300009093 Bacteria 953
217 Ga0105240_11331624 3300009093 Bacteria 757
218 Ga0105240_11656657 3300009093 Bacteria 668
219 Ga0105245_10000486 3300009098 Bacteria 36378
220 Ga0105245_10146696 3300009098 Unclassified 2227
221 Ga0105245_10271912 3300009098 Bacteria 1653
222 Ga0105245_10417255 3300009098 Bacteria 1344
223 Ga0105245_11363681 3300009098 Bacteria 759
224 Ga0105245_12015127 3300009098 Bacteria 631
225 Ga0105247_10004009 3300009101 Bacteria 9473
226 Ga0105247_10012271 3300009101 Bacteria 5146
227 Ga0105247_10299210 3300009101 Bacteria 1116
228 Ga0105241_10000026 3300009174 Bacteria 132695
229 Ga0105241_10000121 3300009174 Bacteria 57041
230 Ga0105241_10002032 3300009174 Bacteria 15308
231 Ga0105241_10006994 3300009174 Bacteria 8301
232 Ga0105241_10043980 3300009174 Bacteria 3383
233 Ga0105241_10449796 3300009174 Bacteria 1139
234 Ga0105241_10454102 3300009174 Bacteria 1134
235 Ga0105241_10539986 3300009174 Bacteria 1045
236 Ga0105241_10644488 3300009174 Bacteria 961
237 Ga0105241_10790322 3300009174 Bacteria 873
238 Ga0105241_10847964 3300009174 Bacteria 845
239 Ga0105241_11499106 3300009174 Bacteria 649
240 Ga0105242_10223056 3300009176 Bacteria 1685
241 Ga0105248_10000019 3300009177 Bacteria 285766
242 Ga0105248_10007017 3300009177 Bacteria 12337
243 Ga0105248_10021944 3300009177 Bacteria 7075
244 Ga0105248_10022327 3300009177 Bacteria 7018
245 Ga0105248_10042895 3300009177 Bacteria 5072
246 Ga0105248_10293698 3300009177 Bacteria 1830
247 Ga0105248_11168149 3300009177 Bacteria 870
248 Ga0105248_11357570 3300009177 Bacteria 804
249 Ga0105237_10000590 3300009545 Bacteria 50564
250 Ga0105237_10006331 3300009545 Bacteria 13155
251 Ga0105237_10049769 3300009545 Unclassified 4211
252 Ga0105237_10352143 3300009545 Bacteria 1477
253 Ga0105237_10555839 3300009545 Bacteria 1154
254 Ga0105237_10556785 3300009545 Bacteria 1153
255 Ga0105237_10805760 3300009545 Bacteria 946
256 Ga0105237_11092793 3300009545 Bacteria 804
257 Ga0105238_10000197 3300009551 Bacteria 66637
258 Ga0105238_10000509 3300009551 Bacteria 40868
259 Ga0105238_10016125 3300009551 Bacteria 7558
260 Ga0105238_10023794 3300009551 Bacteria 6244
261 Ga0105238_10029605 3300009551 Bacteria 5576
262 Ga0105238_10051802 3300009551 Bacteria 4127
263 Ga0105238_10064831 3300009551 Bacteria 3653
264 Ga0105238_10065916 3300009551 Bacteria 3622
265 Ga0105238_10145620 3300009551 Bacteria 2345
266 Ga0105238_10485097 3300009551 Bacteria 1236
267 Ga0105238_10522005 3300009551 Bacteria 1190
268 Ga0105238_10781075 3300009551 Bacteria 970
269 Ga0105238_11877914 3300009551 Bacteria 632
270 Ga0105238_12299666 3300009551 Bacteria 574
271 Ga0105238_12957677 3300009551 Bacteria 511
272 Ga0105249_10067686 3300009553 Bacteria 3291
273 Ga0099796_10089586 3300010159 Bacteria 1142
274 Ga0105239_10001533 3300010375 Bacteria 30534
275 Ga0105239_10003046 3300010375 Bacteria 20836
276 Ga0105239_10013636 3300010375 Bacteria 9023
277 Ga0105239_10075980 3300010375 Bacteria 3694
278 Ga0105239_10336483 3300010375 Bacteria 1703
279 Ga0105239_10877344 3300010375 Bacteria 1029
280 Ga0105239_11576054 3300010375 Bacteria 759
281 Ga0105239_11893339 3300010375 Bacteria 692
282 Ga0105246_10002384 3300011119 Bacteria 11337
283 Ga0157373_10104825 3300013100 Bacteria 1989
284 Ga0157373_10219018 3300013100 Bacteria 1343
285 Ga0157373_10757558 3300013100 Bacteria 714
286 Ga0157373_10782411 3300013100 Bacteria 703
287 Ga0157371_10030600 3300013102 Bacteria 3883
288 Ga0157371_10407929 3300013102 Bacteria 995
289 Ga0157371_10778244 3300013102 Bacteria 720
290 Ga0157370_10000170 3300013104 Bacteria 80529
291 Ga0157370_10006614 3300013104 Bacteria 12739
292 Ga0157370_10010879 3300013104 Bacteria 9556
293 Ga0157370_10012988 3300013104 Bacteria 8605
294 Ga0157370_10017219 3300013104 Bacteria 7293
295 Ga0157370_10030063 3300013104 Bacteria 5324
296 Ga0157370_10090149 3300013104 Bacteria 2879
297 Ga0157370_10210145 3300013104 Bacteria 1804
298 Ga0157370_10608338 3300013104 Bacteria 1000
299 Ga0157370_11601331 3300013104 Bacteria 585
300 Ga0157369_10000085 3300013105 Bacteria 129025
301 Ga0157369_10000430 3300013105 Bacteria 55736
302 Ga0157369_10009218 3300013105 Bacteria 11289
303 Ga0157369_10010533 3300013105 Bacteria 10523
304 Ga0157369_10012659 3300013105 Bacteria 9566
305 Ga0157369_10012685 3300013105 Bacteria 9557
306 Ga0157369_10018737 3300013105 Bacteria 7760
307 Ga0157369_10021889 3300013105 Bacteria 7146
308 Ga0157369_10028989 3300013105 Bacteria 6121
309 Ga0157369_10042189 3300013105 Bacteria 4977
310 Ga0157369_10049457 3300013105 Bacteria 4558
311 Ga0157369_10051486 3300013105 Bacteria 4456
312 Ga0157369_10067688 3300013105 Bacteria 3838
313 Ga0157369_10115554 3300013105 Bacteria 2850
314 Ga0157369_10261492 3300013105 Bacteria 1805
315 Ga0157369_10416121 3300013105 Bacteria 1394
316 Ga0157369_10666779 3300013105 Bacteria 1072
317 Ga0157369_12066327 3300013105 Bacteria 578
318 Ga0157374_10005033 3300013296 Bacteria 11085
319 Ga0157374_10011606 3300013296 Bacteria 7637
320 Ga0157374_10025961 3300013296 Bacteria 5266
321 Ga0157374_10058477 3300013296 Bacteria 3603
322 Ga0157374_10177740 3300013296 Bacteria 2078
323 Ga0157374_10347322 3300013296 Bacteria 1474
324 Ga0157374_10429621 3300013296 Bacteria 1320
325 Ga0157374_10459620 3300013296 Bacteria 1275
326 Ga0157374_10497804 3300013296 Bacteria 1223
327 Ga0157374_10664257 3300013296 Bacteria 1054
328 Ga0157374_10753782 3300013296 Bacteria 988
329 Ga0157374_10850894 3300013296 Bacteria 929
330 Ga0157374_11748663 3300013296 Bacteria 647
331 Ga0157378_10003314 3300013297 Bacteria 14319
332 Ga0157378_10023973 3300013297 Bacteria 5367
333 Ga0157378_10028269 3300013297 Bacteria 4945
334 Ga0157378_10108517 3300013297 Bacteria 2541
335 Ga0157378_10307547 3300013297 Bacteria 1536
336 Ga0157378_10431981 3300013297 Bacteria 1303
337 Ga0157378_11984848 3300013297 Bacteria 632
338 Ga0163162_10027442 3300013306 Bacteria 5631
339 Ga0163162_10084767 3300013306 Bacteria 3245
340 Ga0163162_10209135 3300013306 Bacteria 2081
341 Ga0163162_13191369 3300013306 Unclassified 526
342 Ga0157372_10000217 3300013307 Bacteria 63667
343 Ga0157372_10002601 3300013307 Bacteria 19543
344 Ga0157372_10007271 3300013307 Bacteria 11791
345 Ga0157372_10010870 3300013307 Bacteria 9688
346 Ga0157372_10027828 3300013307 Bacteria 6161
347 Ga0157372_10048038 3300013307 Bacteria 4744
348 Ga0157372_10120685 3300013307 Bacteria 3010
349 Ga0157372_10265383 3300013307 Bacteria 1994
350 Ga0157372_10355994 3300013307 Bacteria 1705
351 Ga0157372_10541137 3300013307 Bacteria 1358
352 Ga0157372_11069037 3300013307 Bacteria 934
353 Ga0157372_11562612 3300013307 Bacteria 760
354 Ga0157372_11585463 3300013307 Bacteria 754
355 Ga0157375_10029487 3300013308 Bacteria 5161
356 Ga0157375_10162945 3300013308 Unclassified 2373
357 Ga0157375_10264835 3300013308 Bacteria 1880
358 Ga0157375_10753952 3300013308 Bacteria 1125
359 Ga0163163_10001161 3300014325 Bacteria 22403
360 Ga0163163_10028784 3300014325 Bacteria 5340
361 Ga0157377_10224766 3300014745 Bacteria 1204
362 Ga0157379_10002312 3300014968 Bacteria 15882
363 Ga0157379_10043255 3300014968 Bacteria 4021
364 Ga0157379_10067424 3300014968 Bacteria 3199
365 Ga0157379_10227617 3300014968 Bacteria 1690
366 Ga0157379_10393819 3300014968 Bacteria 1272
367 Ga0157379_11687805 3300014968 Bacteria 620
368 Ga0157379_12334041 3300014968 Bacteria 533
369 Ga0157376_10004372 3300014969 Bacteria 9831
370 Ga0157376_10061471 3300014969 Bacteria 3158
371 Ga0157376_10134284 3300014969 Unclassified 2212
372 Ga0157376_10240761 3300014969 Bacteria 1685
373 Ga0157376_10318257 3300014969 Bacteria 1478
374 Ga0157376_10955211 3300014969 Bacteria 878
375 Ga0157376_11119609 3300014969 Bacteria 813
376 Ga0157376_11340204 3300014969 Bacteria 746
377 Ga0182006_1055967 3300015261 Bacteria 1504
378 Ga0163161_10492088 3300017792 Bacteria 997
379 Ga0213872_10025009 3300021361 Bacteria 2746
380 Ga0213872_10062353 3300021361 Bacteria 1685
381 Ga0213872_10410650 3300021361 Bacteria 548
382 Ga0213871_10039548 3300021441 Bacteria 1262
383 Ga0224572_1045103 3300024225 Bacteria 826
384 Ga0209233_1005604 3300025261 Bacteria 4152
385 Ga0207656_10001489 3300025321 Bacteria 7754
386 Ga0207656_10008960 3300025321 Unclassified 3706
387 Ga0207656_10011691 3300025321 Bacteria 3321
388 Ga0207656_10109919 3300025321 Bacteria 1273
389 Ga0207656_10199314 3300025321 Bacteria 966
390 Ga0207642_10739637 3300025899 Bacteria 622
391 Ga0207710_10000912 3300025900 Bacteria 15813
392 Ga0207710_10032646 3300025900 Bacteria 2280
393 Ga0207710_10227618 3300025900 Bacteria 927
394 Ga0207710_10449031 3300025900 Bacteria 665
395 Ga0207680_10562814 3300025903 Bacteria 814
396 Ga0207647_10093187 3300025904 Bacteria 1795
397 Ga0207647_10130745 3300025904 Bacteria 1475
398 Ga0207699_10314431 3300025906 Bacteria 1097
399 Ga0207699_11185985 3300025906 Bacteria 565
400 Ga0207645_10075799 3300025907 Bacteria 2153
401 Ga0207705_10000021 3300025909 Bacteria 309436
402 Ga0207705_10002923 3300025909 Bacteria 13059
403 Ga0207705_10019392 3300025909 Bacteria 4862
404 Ga0207705_10031673 3300025909 Bacteria 3776
405 Ga0207705_10032002 3300025909 Bacteria 3757
406 Ga0207705_10091974 3300025909 Bacteria 2222
407 Ga0207705_10157529 3300025909 Bacteria 1704
408 Ga0207705_10301422 3300025909 Bacteria 1229
409 Ga0207705_10644617 3300025909 Bacteria 824
410 Ga0207705_11343888 3300025909 Bacteria 545
411 Ga0207654_10000054 3300025911 Bacteria 82347
412 Ga0207654_10000281 3300025911 Bacteria 30979
413 Ga0207654_10000808 3300025911 Bacteria 17242
414 Ga0207654_10086212 3300025911 Bacteria 1903
415 Ga0207654_10268477 3300025911 Bacteria 1150
416 Ga0207654_10527968 3300025911 Bacteria 836
417 Ga0207654_11084317 3300025911 Bacteria 583
418 Ga0207654_11159358 3300025911 Bacteria 563
419 Ga0207707_10003864 3300025912 Bacteria 13285
420 Ga0207707_10088884 3300025912 Bacteria 2699
421 Ga0207707_10475820 3300025912 Bacteria 1067
422 Ga0207695_10000001 3300025913 Bacteria 2888630
423 Ga0207695_10000080 3300025913 Bacteria 287868
424 Ga0207695_10000113 3300025913 Bacteria 247240
425 Ga0207695_10000167 3300025913 Bacteria 194371
426 Ga0207695_10000263 3300025913 Bacteria 132894
427 Ga0207695_10001106 3300025913 Bacteria 46871
428 Ga0207695_10001762 3300025913 Bacteria 34278
429 Ga0207695_10007109 3300025913 Bacteria 14340
430 Ga0207695_10025431 3300025913 Bacteria 6627
431 Ga0207695_10047228 3300025913 Bacteria 4558
432 Ga0207695_10050757 3300025913 Bacteria 4361
433 Ga0207695_10067630 3300025913 Bacteria 3664
434 Ga0207695_10090899 3300025913 Bacteria 3067
435 Ga0207695_10587824 3300025913 Bacteria 994
436 Ga0207695_10825204 3300025913 Bacteria 807
437 Ga0207671_10000065 3300025914 Bacteria 166743
438 Ga0207671_10000123 3300025914 Bacteria 119385
439 Ga0207671_10000139 3300025914 Bacteria 111786
440 Ga0207671_10037214 3300025914 Bacteria 3609
441 Ga0207671_10093033 3300025914 Bacteria 2274
442 Ga0207671_10101032 3300025914 Bacteria 2185
443 Ga0207671_10285240 3300025914 Bacteria 1303
444 Ga0207671_10314634 3300025914 Bacteria 1238
445 Ga0207671_10544343 3300025914 Bacteria 925
446 Ga0207671_10816103 3300025914 Bacteria 739
447 Ga0207693_10195339 3300025915 Bacteria 1592
448 Ga0207693_11218377 3300025915 Bacteria 567
449 Ga0207663_11063731 3300025916 Bacteria 650
450 Ga0207660_10034872 3300025917 Bacteria 3490
451 Ga0207660_10529731 3300025917 Bacteria 957
452 Ga0207657_10004623 3300025919 Bacteria 14538
453 Ga0207657_10019482 3300025919 Bacteria 6442
454 Ga0207657_10023308 3300025919 Bacteria 5767
455 Ga0207657_10063948 3300025919 Bacteria 3143
456 Ga0207657_10273173 3300025919 Bacteria 1343
457 Ga0207657_10516848 3300025919 Bacteria 935
458 Ga0207657_10584200 3300025919 Bacteria 872
459 Ga0207649_10009868 3300025920 Bacteria 5233
460 Ga0207649_10011442 3300025920 Bacteria 4893
461 Ga0207649_10036761 3300025920 Bacteria 2952
462 Ga0207649_10045929 3300025920 Bacteria 2680
463 Ga0207649_10051713 3300025920 Bacteria 2545
464 Ga0207649_10123143 3300025920 Bacteria 1751
465 Ga0207649_10355185 3300025920 Bacteria 1086
466 Ga0207649_11594458 3300025920 Bacteria 517
467 Ga0207652_10001535 3300025921 Bacteria 20348
468 Ga0207652_10002459 3300025921 Bacteria 15619
469 Ga0207652_10033782 3300025921 Bacteria 4308
470 Ga0207652_10045706 3300025921 Bacteria 3733
471 Ga0207652_10456639 3300025921 Bacteria 1151
472 Ga0207694_10000248 3300025924 Bacteria 51461
473 Ga0207694_10000711 3300025924 Bacteria 29920
474 Ga0207694_10007157 3300025924 Bacteria 8478
475 Ga0207694_10010664 3300025924 Bacteria 6933
476 Ga0207694_10042410 3300025924 Bacteria 3509
477 Ga0207694_10131100 3300025924 Unclassified 2009
478 Ga0207694_10277292 3300025924 Bacteria 1376
479 Ga0207694_10474030 3300025924 Bacteria 1046
480 Ga0207694_10534797 3300025924 Bacteria 983
481 Ga0207694_10924621 3300025924 Bacteria 738
482 Ga0207694_11311516 3300025924 Bacteria 612
483 Ga0207694_11564067 3300025924 Bacteria 556
484 Ga0207694_11849546 3300025924 Bacteria 507
485 Ga0207650_10003582 3300025925 Bacteria 10655
486 Ga0207659_10116300 3300025926 Unclassified 2042
487 Ga0207687_10000978 3300025927 Bacteria 19404
488 Ga0207687_10030621 3300025927 Unclassified 3629
489 Ga0207687_10086790 3300025927 Bacteria 2273
490 Ga0207687_10276493 3300025927 Bacteria 1344
491 Ga0207700_10015711 3300025928 Bacteria 5005
492 Ga0207700_10071880 3300025928 Bacteria 2665
493 Ga0207700_10159411 3300025928 Bacteria 1873
494 Ga0207700_10214980 3300025928 Bacteria 1627
495 Ga0207700_10887044 3300025928 Bacteria 798
496 Ga0207664_10068128 3300025929 Bacteria 2858
497 Ga0207664_10135073 3300025929 Bacteria 2081
498 Ga0207644_10002160 3300025931 Bacteria 12753
499 Ga0207644_10013665 3300025931 Bacteria 5418
500 Ga0207644_10075210 3300025931 Bacteria 2481
501 Ga0207644_10271224 3300025931 Bacteria 1360
502 Ga0207690_10010429 3300025932 Bacteria 5522
503 Ga0207690_10564670 3300025932 Bacteria 926
504 Ga0207706_10064710 3300025933 Unclassified 3220
505 Ga0207665_10584863 3300025939 Bacteria 870
506 Ga0207691_10075960 3300025940 Bacteria 3028
507 Ga0207691_10770386 3300025940 Bacteria 809
508 Ga0207711_10000014 3300025941 Bacteria 506753
509 Ga0207711_10004781 3300025941 Bacteria 11494
510 Ga0207711_10024659 3300025941 Bacteria 5043
511 Ga0207711_10095034 3300025941 Bacteria 2628
512 Ga0207711_10190978 3300025941 Bacteria 1866
513 Ga0207711_10305502 3300025941 Bacteria 1468
514 Ga0207711_10343779 3300025941 Bacteria 1381
515 Ga0207711_10349532 3300025941 Bacteria 1369
516 Ga0207711_11198331 3300025941 Bacteria 701
517 Ga0207711_11646135 3300025941 Bacteria 585
518 Ga0207689_10004019 3300025942 Bacteria 13370
519 Ga0207689_10051194 3300025942 Bacteria 3404
520 Ga0207689_10524464 3300025942 Bacteria 994
521 Ga0207661_10001283 3300025944 Bacteria 16799
522 Ga0207661_10010483 3300025944 Bacteria 6670
523 Ga0207661_10025842 3300025944 Bacteria 4468
524 Ga0207661_10083585 3300025944 Bacteria 2642
525 Ga0207661_10099228 3300025944 Bacteria 2442
526 Ga0207661_10105999 3300025944 Bacteria 2369
527 Ga0207661_10220368 3300025944 Bacteria 1677
528 Ga0207661_10237426 3300025944 Bacteria 1616
529 Ga0207679_10079256 3300025945 Bacteria 2504
530 Ga0207679_10175492 3300025945 Bacteria 1768
531 Ga0207679_10298874 3300025945 Bacteria 1387
532 Ga0207667_10000468 3300025949 Bacteria 53974
533 Ga0207667_10007018 3300025949 Bacteria 13604
534 Ga0207667_10007159 3300025949 Bacteria 13469
535 Ga0207667_10007633 3300025949 Bacteria 12958
536 Ga0207667_10009516 3300025949 Bacteria 11434
537 Ga0207667_10023191 3300025949 Bacteria 6835
538 Ga0207667_10028672 3300025949 Bacteria 6044
539 Ga0207667_10057558 3300025949 Bacteria 4080
540 Ga0207667_10089817 3300025949 Bacteria 3175
541 Ga0207667_10113439 3300025949 Bacteria 2794
542 Ga0207667_10118034 3300025949 Unclassified 2734
543 Ga0207667_10136268 3300025949 Bacteria 2528
544 Ga0207667_10237086 3300025949 Bacteria 1867
545 Ga0207667_10774145 3300025949 Bacteria 958
546 Ga0207712_10040395 3300025961 Bacteria 3201
547 Ga0207712_10879094 3300025961 Bacteria 791
548 Ga0207640_10000028 3300025981 Bacteria 135727
549 Ga0207640_10008642 3300025981 Bacteria 5661
550 Ga0207640_10155415 3300025981 Bacteria 1685
551 Ga0207640_10159963 3300025981 Bacteria 1665
552 Ga0207640_10555853 3300025981 Bacteria 965
553 Ga0207640_10568780 3300025981 Bacteria 955
554 Ga0207640_10722052 3300025981 Bacteria 856
555 Ga0207658_10050436 3300025986 Bacteria 3062
556 Ga0207658_10458795 3300025986 Bacteria 1129
557 Ga0207677_10000143 3300026023 Bacteria 58337
558 Ga0207677_10006547 3300026023 Bacteria 6395
559 Ga0207677_10716717 3300026023 Bacteria 889
560 Ga0207703_10011246 3300026035 Bacteria 6963
561 Ga0207703_10133597 3300026035 Bacteria 2146
562 Ga0207639_10000088 3300026041 Bacteria 78742
563 Ga0207639_10000371 3300026041 Bacteria 31074
564 Ga0207639_10014115 3300026041 Bacteria 5610
565 Ga0207639_10145334 3300026041 Bacteria 1980
566 Ga0207639_10221987 3300026041 Bacteria 1633
567 Ga0207639_10287632 3300026041 Unclassified 1448
568 Ga0207639_10320037 3300026041 Bacteria 1377
569 Ga0207639_10423579 3300026041 Bacteria 1204
570 Ga0207639_10464315 3300026041 Bacteria 1151
571 Ga0207639_10951559 3300026041 Bacteria 804
572 Ga0207678_10006398 3300026067 Bacteria 10461
573 Ga0207678_10015091 3300026067 Bacteria 6797
574 Ga0207678_10015141 3300026067 Bacteria 6784
575 Ga0207678_10036879 3300026067 Bacteria 4256
576 Ga0207678_10231765 3300026067 Bacteria 1581
577 Ga0207702_10004705 3300026078 Bacteria 12064
578 Ga0207702_10005816 3300026078 Bacteria 10726
579 Ga0207702_10036280 3300026078 Bacteria 4123
580 Ga0207702_10085078 3300026078 Bacteria 2755
581 Ga0207702_10095418 3300026078 Bacteria 2613
582 Ga0207702_10258301 3300026078 Bacteria 1639
583 Ga0207702_10401123 3300026078 Bacteria 1322
584 Ga0207702_10866328 3300026078 Bacteria 894
585 Ga0207702_10976553 3300026078 Bacteria 840
586 Ga0207702_11236913 3300026078 Bacteria 741
587 Ga0207702_11534067 3300026078 Bacteria 660
588 Ga0207702_12254025 3300026078 Bacteria 533
589 Ga0207641_10005346 3300026088 Bacteria 10965
590 Ga0207641_10021598 3300026088 Bacteria 5289
591 Ga0207641_10139167 3300026088 Bacteria 2188
592 Ga0207648_11286414 3300026089 Bacteria 687
593 Ga0207676_10002667 3300026095 Bacteria 12678
594 Ga0207676_10125439 3300026095 Bacteria 2173
595 Ga0207674_10000669 3300026116 Bacteria 44573
596 Ga0207674_10012983 3300026116 Bacteria 9285
597 Ga0207674_10120391 3300026116 Bacteria 2593
598 Ga0207674_10328801 3300026116 Bacteria 1478
599 Ga0207674_10525944 3300026116 Bacteria 1142
600 Ga0207674_10557698 3300026116 Bacteria 1107
601 Ga0207683_10028240 3300026121 Bacteria 4851
602 Ga0207683_10364041 3300026121 Bacteria 1328
603 Ga0207698_10000003 3300026142 Bacteria 321303
604 Ga0207698_10000225 3300026142 Bacteria 35169
605 Ga0207698_10003525 3300026142 Bacteria 9436
606 Ga0207698_10007959 3300026142 Bacteria 6677
607 Ga0207698_10045131 3300026142 Bacteria 3318
608 Ga0207698_10132091 3300026142 Bacteria 2135
609 Ga0207698_10165017 3300026142 Bacteria 1942
610 Ga0207698_10417287 3300026142 Bacteria 1287
611 Ga0207698_11190819 3300026142 Bacteria 776
612 Ga0268266_10005265 3300028379 Bacteria 12146
613 Ga0268266_10006399 3300028379 Bacteria 10792
614 Ga0268266_10014122 3300028379 Bacteria 6876
615 Ga0268266_10046731 3300028379 Bacteria 3706
616 Ga0268266_10173024 3300028379 Unclassified 1961
617 Ga0268266_10233875 3300028379 Bacteria 1693
618 Ga0268266_10256469 3300028379 Bacteria 1619
619 Ga0268266_10393919 3300028379 Bacteria 1308
620 Ga0268264_10000598 3300028381 Bacteria 43640
621 Ga0265319_1081737 3300028563 Bacteria 1026
622 Ga0265318_10006364 3300028577 Bacteria 5448
623 Ga0265336_10001048 3300028666 Bacteria 13512
624 Ga0265336_10005708 3300028666 Bacteria 4561
625 Ga0307517_10515974 3300028786 Bacteria 605
626 Ga0265338_10004495 3300028800 Bacteria 18805
627 Ga0265338_10009284 3300028800 Bacteria 11764
628 Ga0265338_10017734 3300028800 Bacteria 7656
629 Ga0265338_10158684 3300028800 Bacteria 1749
630 Ga0265338_10163443 3300028800 Bacteria 1717
631 Ga0265338_10259448 3300028800 Bacteria 1278
632 Ga0265338_10337026 3300028800 Bacteria 1088
633 Ga0265338_10721670 3300028800 Bacteria 687
634 Ga0265324_10137725 3300029957 Bacteria 829
635 Ga0307512_10315872 3300030522 Bacteria 715
636 Ga0265762_1176753 3300030760 Unclassified 523
637 Ga0265770_1105662 3300030878 Unclassified 578
638 Ga0265770_1122170 3300030878 Bacteria 549
639 Ga0265760_10086498 3300031090 Bacteria 976
640 Ga0265760_10141667 3300031090 Bacteria 783
641 Ga0265330_10000273 3300031235 Bacteria 38107
642 Ga0265330_10001219 3300031235 Bacteria 15180
643 Ga0265330_10013742 3300031235 Bacteria 3767
644 Ga0265330_10036360 3300031235 Bacteria 2196
645 Ga0265330_10097036 3300031235 Bacteria 1263
646 Ga0265330_10111823 3300031235 Unclassified 1166
647 Ga0265330_10245175 3300031235 Bacteria 755
648 Ga0265332_10025859 3300031238 Bacteria 2576
649 Ga0265332_10196168 3300031238 Bacteria 840
650 Ga0265328_10007521 3300031239 Bacteria 4537
651 Ga0265328_10015554 3300031239 Bacteria 2977
652 Ga0265328_10024482 3300031239 Bacteria 2280
653 Ga0265320_10003664 3300031240 Bacteria 10255
654 Ga0265320_10084221 3300031240 Bacteria 1481
655 Ga0265320_10249266 3300031240 Bacteria 788
656 Ga0265325_10000266 3300031241 Bacteria 37071
657 Ga0265325_10000695 3300031241 Bacteria 24506
658 Ga0265325_10005858 3300031241 Bacteria 7531
659 Ga0265325_10060625 3300031241 Bacteria 1921
660 Ga0265329_10003354 3300031242 Bacteria 7004
661 Ga0265340_10001072 3300031247 Bacteria 15563
662 Ga0265340_10019622 3300031247 Bacteria 3481
663 Ga0265340_10061429 3300031247 Bacteria 1797
664 Ga0265339_10000114 3300031249 Bacteria 65609
665 Ga0265339_10000124 3300031249 Bacteria 64124
666 Ga0265339_10000194 3300031249 Bacteria 50375
667 Ga0265339_10003213 3300031249 Bacteria 11471
668 Ga0265339_10005214 3300031249 Bacteria 8693
669 Ga0265339_10029804 3300031249 Bacteria 3093
670 Ga0265339_10037617 3300031249 Bacteria 2704
671 Ga0265339_10199047 3300031249 Bacteria 989
672 Ga0265339_10386727 3300031249 Bacteria 655
673 Ga0265331_10046545 3300031250 Bacteria 2090
674 Ga0265331_10094950 3300031250 Bacteria 1376
675 Ga0265331_10429126 3300031250 Bacteria 593
676 Ga0265331_10585898 3300031250 Bacteria 504
677 Ga0265327_10177457 3300031251 Bacteria 976
678 Ga0265316_10000712 3300031344 Bacteria 36687
679 Ga0265316_10003675 3300031344 Bacteria 15459
680 Ga0265316_10008382 3300031344 Bacteria 9600
681 Ga0265316_10022232 3300031344 Bacteria 5355
682 Ga0265316_10027725 3300031344 Bacteria 4683
683 Ga0265316_10048835 3300031344 Bacteria 3337
684 Ga0265316_10054568 3300031344 Bacteria 3128
685 Ga0265316_10169512 3300031344 Bacteria 1629
686 Ga0265316_10190926 3300031344 Bacteria 1522
687 Ga0265316_10192501 3300031344 Bacteria 1514
688 Ga0265316_10351036 3300031344 Bacteria 1068
689 Ga0265313_10013393 3300031595 Bacteria 4924
690 Ga0265313_10016618 3300031595 Bacteria 4223
691 Ga0265313_10018882 3300031595 Bacteria 3858
692 Ga0265313_10019581 3300031595 Bacteria 3761
693 Ga0265313_10028929 3300031595 Bacteria 2873
694 Ga0265314_10000504 3300031711 Bacteria 50376
695 Ga0265314_10002987 3300031711 Bacteria 16745
696 Ga0265314_10046866 3300031711 Bacteria 3047
697 Ga0265314_10080947 3300031711 Bacteria 2142
698 Ga0265314_10160089 3300031711 Bacteria 1371
699 Ga0265314_10288196 3300031711 Bacteria 926
700 Ga0265342_10000225 3300031712 Bacteria 63822
701 Ga0265342_10001536 3300031712 Bacteria 21355
702 Ga0265342_10004360 3300031712 Bacteria 11190
703 Ga0265342_10014131 3300031712 Bacteria 5311
704 Ga0265342_10015276 3300031712 Bacteria 5056
705 Ga0265342_10042663 3300031712 Bacteria 2740
706 Ga0265342_10113795 3300031712 Unclassified 1529
707 Ga0265342_10173752 3300031712 Bacteria 1183
708 Ga0316583_10181098 3300032133 Bacteria 733
709 Ga0307510_10010774 3300033180 Bacteria 10874
710 Ga0307510_10071804 3300033180 Bacteria 3444
711 Ga0307510_10220392 3300033180 Bacteria 1409
712 Ga0373923_0266985 3300035111 Bacteria 804
713 Ga0373936_0187261 3300035113 Bacteria 910
714 Ga0373943_0018586 3300035170 Bacteria 3195
715 Ga0373935_0251905 3300035692 Bacteria 1236
716 Ga0373927_0683844 3300035695 Bacteria 678
717 Ga0373933_0634675 3300035724 Bacteria 702
718 Ga0373947_0036325 3300035725 Bacteria 2922
719 Ga0373937_0138090 3300036401 Bacteria 2280
720 Ga0373937_0510221 3300036401 Bacteria 1142
721 Ga0373937_1742955 3300036401 Bacteria 570
722 Ga0395900_0849267 3300037418 Unclassified 839
723 Ga0395900_1361652 3300037418 Bacteria 623
724 Ga0395901_0583687 3300038443 Bacteria 1129
725 Ga0436360_0170154 3300039438 Bacteria 4187
726 Ga0436360_0361712 3300039438 Bacteria 4177
727 Ga0436360_0826850 3300039438 Bacteria 741
728 Ga0436360_0871656 3300039438 Bacteria 935
729 Ga0436360_1008743 3300039438 Bacteria 877
730 Ga0436360_1308109 3300039438 Bacteria 562
731 Ga0436361_0226605 3300039447 Bacteria 1330
732 Ga0436361_0318263 3300039447 Bacteria 10520
733 Ga0436361_0526984 3300039447 Bacteria 4268
734 Ga0436361_0585232 3300039447 Bacteria 1108
735 Ga0436361_0757992 3300039447 Bacteria 2636
736 Ga0436361_0776284 3300039447 Bacteria 1039
737 Ga0436363_0701240 3300039450 Bacteria 842
738 Ga0451839_0265344 3300041496 Bacteria 530
739 Ga0451839_0397595 3300041496 Bacteria 533
740 Ga0439448_0148476 3300042005 Bacteria 813
741 Ga0451577_0979553 3300042876 Bacteria 760
742 Ga0466969_0299729 3300044656 Bacteria 727
743 Ga0466969_0533994 3300044656 Bacteria 536
744 Ga0453683_0515345 3300044673 Bacteria 777
745 Ga0466966_0043334 3300044684 Bacteria 2885
746 Ga0466966_0201614 3300044684 Bacteria 1204
747 Ga0466961_0062967 3300044693 Bacteria 2357
748 Ga0466961_0372195 3300044693 Bacteria 868
749 Ga0466961_0499937 3300044693 Bacteria 734
750 Ga0466963_0000494 3300044694 Bacteria 18341
751 Ga0466963_0732759 3300044694 Bacteria 697
752 Ga0466957_0445001 3300044842 Bacteria 892
753 Ga0466957_0972147 3300044842 Bacteria 609
754 Ga0466959_0159618 3300045049 Bacteria 1586
755 Ga0466959_0254613 3300045049 Bacteria 1210
756 Ga0466959_1198274 3300045049 Bacteria 505
757 Ga0466958_0372077 3300045836 Bacteria 921
758 Ga0466967_0001401 3300045976 Bacteria 13938
759 Ga0466967_0226226 3300045976 Bacteria 1780
760 Ga0466967_0433944 3300045976 Unclassified 1282
761 Ga0466967_0549800 3300045976 Bacteria 1136
762 Ga0495617_242766 3300046452 Bacteria 556
763 Ga0495592_0170605 3300046454 Bacteria 1490
764 Ga0495592_0361325 3300046454 Bacteria 928
765 Ga0495592_0378286 3300046454 Bacteria 902
766 Ga0495603_0111033 3300046455 Bacteria 1599
767 Ga0495603_0122471 3300046455 Bacteria 1515
768 Ga0495629_0018026 3300046459 Bacteria 5060
769 Ga0495638_0447890 3300046460 Bacteria 660
770 Ga0495651_0015018 3300046462 Bacteria 5985
771 Ga0495651_0031839 3300046462 Bacteria 4112
772 Ga0495653_0010749 3300046463 Bacteria 7495
773 Ga0495650_0000038 3300046471 Bacteria 377530
774 Ga0495650_0008733 3300046471 Bacteria 5865
775 Ga0495580_0097351 3300046472 Bacteria 2046
776 Ga0495582_0049065 3300046473 Bacteria 2325
777 Ga0495639_0001675 3300046475 Bacteria 9836
778 Ga0495662_0005660 3300046476 Bacteria 6246
779 Ga0495664_0001348 3300046477 Bacteria 12929
780 Ga0495664_0028071 3300046477 Bacteria 3285
781 Ga0495664_0045809 3300046477 Bacteria 2594
782 Ga0495664_0209206 3300046477 Bacteria 1181
783 Ga0495585_0016774 3300046492 Bacteria 4243
784 Ga0495594_0000388 3300046499 Bacteria 22139
785 Ga0495594_0001190 3300046499 Bacteria 13614
786 Ga0495594_0881111 3300046499 Bacteria 503
787 Ga0495583_0013317 3300046506 Bacteria 4593
788 Ga0495583_0033314 3300046506 Bacteria 2478
789 Ga0495606_0077834 3300046507 Bacteria 2070
790 Ga0495606_0095370 3300046507 Bacteria 1822
791 Ga0495606_0162623 3300046507 Bacteria 1301
792 Ga0495606_0216104 3300046507 Bacteria 1083
793 Ga0495628_0007402 3300046516 Bacteria 9504
794 Ga0495628_0011061 3300046516 Bacteria 7637
795 Ga0495628_0694799 3300046516 Bacteria 719
796 Ga0495630_0264458 3300046517 Bacteria 1314
797 Ga0495631_0051109 3300046518 Bacteria 1807
798 Ga0495631_0241780 3300046518 Bacteria 770
799 Ga0495632_0301110 3300046519 Bacteria 711
800 Ga0495644_0000048 3300046523 Bacteria 57696
801 Ga0495648_0167762 3300046524 Bacteria 1128
802 Ga0495648_0207165 3300046524 Bacteria 977
803 Ga0495666_0001196 3300046526 Bacteria 12524
804 Ga0495642_0009023 3300046528 Bacteria 3816
805 Ga0495642_0389701 3300046528 Bacteria 614
806 Ga0495652_0009907 3300046529 Bacteria 8641
807 Ga0495652_0039259 3300046529 Bacteria 4093
808 Ga0495652_0448030 3300046529 Bacteria 904
809 Ga0495652_0620027 3300046529 Bacteria 736
810 Ga0495665_0001828 3300046531 Bacteria 11486
811 Ga0495665_0321308 3300046531 Bacteria 790
812 Ga0495640_0060924 3300046533 Bacteria 2565
813 Ga0495640_0096637 3300046533 Bacteria 1943
814 Ga0495586_0163121 3300046535 Bacteria 1257
815 Ga0495586_0521142 3300046535 Bacteria 686
816 Ga0495587_0008155 3300046536 Bacteria 6753
817 Ga0495609_0036518 3300046538 Bacteria 2218
818 Ga0495609_0180783 3300046538 Bacteria 888
819 Ga0495609_0326845 3300046538 Bacteria 621
820 Ga0495645_0001770 3300046543 Bacteria 14694
821 Ga0495645_0005517 3300046543 Bacteria 8694
822 Ga0495645_0007804 3300046543 Bacteria 7444
823 Ga0495645_0022284 3300046543 Bacteria 4582
824 Ga0495667_0084571 3300046559 Bacteria 2059
825 Ga0495667_0374459 3300046559 Bacteria 898
826 Ga0495668_0044535 3300046616 Bacteria 2466
827 Ga0495668_0514669 3300046616 Bacteria 660
828 Ga0495634_0006225 3300046642 Bacteria 9093
829 Ga0495611_0383414 3300046648 Bacteria 643
830 Ga0495625_0000985 3300046660 Bacteria 37750
831 Ga0495625_0007833 3300046660 Bacteria 9208
832 Ga0495625_0019175 3300046660 Bacteria 5316
833 Ga0495625_0045052 3300046660 Bacteria 3191
834 Ga0495625_0511048 3300046660 Bacteria 733
835 Ga0495635_0002836 3300046663 Bacteria 11904
836 Ga0495635_0086686 3300046663 Bacteria 2142
837 Ga0495635_0470186 3300046663 Bacteria 830
838 Ga0495659_0066790 3300046664 Bacteria 1340
839 Ga0495588_0028867 3300046674 Bacteria 2780
840 Ga0495657_0467111 3300046675 Bacteria 738
841 Ga0495599_0017587 3300046678 Bacteria 4445
842 Ga0495599_0051590 3300046678 Bacteria 2577
843 Ga0495599_0605156 3300046678 Bacteria 638
844 Ga0495623_0050948 3300046679 Bacteria 2621
845 Ga0495623_0056771 3300046679 Bacteria 2464
846 Ga0495623_0058009 3300046679 Bacteria 2435
847 Ga0495623_0082244 3300046679 Bacteria 1990
848 Ga0495646_0077284 3300046680 Bacteria 1947
849 Ga0495646_0124321 3300046680 Bacteria 1457
850 Ga0495646_0346219 3300046680 Bacteria 779
851 Ga0495646_0450865 3300046680 Bacteria 664
852 Ga0495646_0542208 3300046680 Bacteria 594
853 Ga0495669_0004252 3300046684 Bacteria 5901
854 Ga0495613_0003966 3300046689 Bacteria 11081
855 Ga0495613_0012222 3300046689 Bacteria 6380
856 Ga0495624_0007524 3300046690 Bacteria 7641
857 Ga0495670_0038859 3300046691 Bacteria 2373
858 Ga0495671_0153236 3300046692 Bacteria 1122
859 Ga0495671_0493283 3300046692 Bacteria 584
860 Ga0495649_0064738 3300046694 Bacteria 1963
861 Ga0495649_0490026 3300046694 Bacteria 612
862 Ga0495600_0002909 3300046809 Bacteria 9975
863 Ga0495600_0302730 3300046809 Bacteria 1008
864 Ga0495581_0050879 3300047315 Bacteria 2393
865 Ga0495581_0245692 3300047315 Bacteria 1046
866 Ga0495581_0366883 3300047315 Bacteria 840
867 Ga0495581_0885072 3300047315 Bacteria 510
868 Ga0495604_0002834 3300047317 Bacteria 13912
869 Ga0495604_0015522 3300047317 Bacteria 6079
870 Ga0495604_0069051 3300047317 Bacteria 2679
871 Ga0495636_0056644 3300047318 Bacteria 1651
872 Ga0495674_0014334 3300047319 Bacteria 7423
873 Ga0495674_0152317 3300047319 Bacteria 1938
874 Ga0495674_0539358 3300047319 Unclassified 930
875 Ga0495672_0030990 3300047320 Bacteria 3344
876 Ga0495676_0008961 3300047321 Bacteria 9134
877 Ga0495676_0114867 3300047321 Bacteria 1969
878 Ga0495680_0076425 3300047322 Bacteria 2539
879 Ga0495675_0003222 3300047444 Bacteria 9816
880 Ga0495675_0012790 3300047444 Bacteria 5286
881 Ga0495677_0020984 3300047445 Bacteria 2368
882 Ga0495673_0072246 3300047469 Bacteria 1449
883 Ga0495684_0049723 3300047471 Bacteria 3203
884 Ga0495684_0101338 3300047471 Bacteria 2177
885 Ga0495686_0004566 3300047472 Bacteria 11335
886 Ga0495686_0008419 3300047472 Bacteria 7568
887 Ga0495686_0012438 3300047472 Bacteria 5951
888 Ga0495686_0014007 3300047472 Bacteria 5541
889 Ga0495686_0044764 3300047472 Bacteria 2801
890 Ga0495686_0067112 3300047472 Bacteria 2215
891 Ga0495686_0187235 3300047472 Bacteria 1195
892 Ga0495593_0019638 3300047673 Bacteria 3788
893 Ga0495593_0040852 3300047673 Bacteria 2496
894 Ga0495602_0773591 3300048088 Bacteria 646
895 Ga0495614_0000972 3300048089 Bacteria 12208
896 Ga0496100_0575375 3300048903 Bacteria 873
897 Ga0496100_1034106 3300048903 Bacteria 647
898 Ga0496101_0659155 3300048904 Bacteria 827
899 Ga0496102_0777646 3300048905 Bacteria 880
900 Ga0496103_0741566 3300048906 Bacteria 621
901 Ga0496104_0000053 3300048907 Bacteria 135895
902 Ga0496104_0057613 3300048907 Bacteria 3676
903 Ga0496104_0875113 3300048907 Bacteria 804
904 Ga0496108_0111209 3300048911 Bacteria 2343
905 Ga0496112_0165026 3300048915 Bacteria 2181
906 Ga0496114_0096351 3300048917 Bacteria 2519
907 Ga0496115_0202171 3300048918 Bacteria 1641
908 Ga0496115_0301250 3300048918 Bacteria 1313
909 Ga0496120_0134276 3300048923 Bacteria 1264
910 Ga0496120_0260024 3300048923 Bacteria 811
911 Ga0496121_0492821 3300048924 Bacteria 780
912 Ga0496126_0000014 3300048929 Bacteria 686881
913 Ga0496126_0000154 3300048929 Bacteria 159983
914 Ga0496126_0739092 3300048929 Bacteria 761
915 Ga0496126_1287352 3300048929 Unclassified 533
916 Ga0495682_0041693 3300049460 Bacteria 1682
917 Ga0501031_0027688 3300049568 Bacteria 3695
918 Ga0501032_0001912 3300049569 Bacteria 16446
919 Ga0501033_0010946 3300049570 Bacteria 6952
920 Ga0501033_0045842 3300049570 Bacteria 3253
921 Ga0501034_0014111 3300049571 Bacteria 8232
922 Ga0501037_0025359 3300049573 Bacteria 4381
923 Ga0501037_0471859 3300049573 Bacteria 854
924 Ga0501038_0033174 3300049574 Bacteria 4548
925 Ga0501038_0098016 3300049574 Bacteria 2445
926 Ga0501038_0110075 3300049574 Bacteria 2283
927 Ga0501039_0154809 3300049575 Bacteria 1801
928 Ga0501043_0057147 3300049579 Bacteria 3064
929 Ga0501046_0000056 3300049580 Bacteria 129342
930 Ga0501047_0008947 3300049581 Bacteria 9454
931 Ga0501047_0017729 3300049581 Bacteria 6821
932 Ga0501070_0124247 3300049586 Bacteria 2133
933 Ga0501070_0254155 3300049586 Bacteria 1437
934 Ga0501073_0008329 3300049589 Bacteria 7690
935 Ga0501073_1108370 3300049589 Bacteria 544
936 Ga0501074_0524312 3300049590 Bacteria 839
937 Ga0501079_0275238 3300049741 Bacteria 1316
938 Ga0501080_0310054 3300049742 Bacteria 1430
939 Ga0501080_0960686 3300049742 Bacteria 743
940 Ga0501035_0086954 3300049822 Bacteria 2754
941 Ga0501035_0350448 3300049822 Bacteria 1235
942 Ga0501044_0171643 3300049823 Bacteria 2140
943 Ga0501044_0184233 3300049823 Bacteria 2053
944 nmdc:mga08x19_161497_c1 3300050514 Bacteria 1522
945 nmdc:mga08x19_164936_c1 3300050514 Bacteria 1506
946 nmdc:mga08x19_30704_c1 3300050514 Bacteria 3377
947 Ga0495612_0308136 3300053078 Bacteria 711
948 Ga0500643_028144 3300053087 Bacteria 1740
949 Ga0500644_0156516 3300053088 Bacteria 918
950 Ga0500651_0000005 3300053093 Bacteria 384761
951 Ga0500595_000004 3300053119 Bacteria 410922
952 Ga0500595_013665 3300053119 Bacteria 3105
953 Ga0500595_016226 3300053119 Bacteria 2778
954 Ga0500661_001216 3300055283 Bacteria 4809
955 2884217794 2884215851 Bacteria 4554841
956 Ga0068855_100248258
957 LJNas_1006912
958 JGI24743J22301_10071283
959 rootH2_10171401
960 rootH1_10203955
961 Ga0070658_10000121
962 Ga0070658_10013505
963 Ga0070658_10037114
964 Ga0070658_10038584
965 Ga0070658_10049430
966 Ga0070658_10134937
967 Ga0070658_10150612
968 Ga0070658_10341705
969 Ga0070658_10429461
970 Ga0070658_10921455
971 Ga0070676_10229857
972 Ga0070683_100002041
973 Ga0070683_100015021
974 Ga0070683_100015398
975 Ga0070683_100028772
976 Ga0070683_100135740
977 Ga0070683_100183443
978 Ga0070683_100779235
979 Ga0070683_100898533
980 Ga0070670_100005099
981 Ga0068869_100002456
982 Ga0068869_100503734
983 Ga0070666_10071003
984 Ga0070666_10285534
985 Ga0070680_100007018
986 Ga0070680_100032000
987 Ga0070682_100345088
988 Ga0068868_100000066
989 Ga0068868_100030705
990 Ga0068868_100202417
991 Ga0068868_100251736
992 Ga0068868_100955371
993 Ga0070660_100008313
994 Ga0070660_100185531
995 Ga0070660_101936061
996 Ga0070691_10410588
997 Ga0070691_10820556
998 Ga0070661_100016527
999 Ga0070661_100018919
1000 Ga0070661_100111867
1001 Ga0070661_100112059
1002 Ga0070661_100198292
1003 Ga0070661_100230310
1004 Ga0070661_100542850
1005 Ga0070661_100838680
1006 Ga0070661_101035467
1007 Ga0070661_101631218
1008 Ga0070692_10972062
1009 Ga0070668_100215320
1010 Ga0070669_101089400
1011 Ga0070671_100000411
1012 Ga0070671_100003123
1013 Ga0070671_100027039
1014 Ga0070674_100431124
1015 Ga0070659_100004580
1016 Ga0070659_100030029
1017 Ga0070667_100002645
1018 Ga0070709_10949888
1019 Ga0070709_11714150
1020 Ga0070714_100002654
1021 Ga0070714_100099406
1022 Ga0070713_100033702
1023 Ga0070713_100095055
1024 Ga0070713_100306613
1025 Ga0070713_100374302
1026 Ga0070713_100423960
1027 Ga0070713_100980652
1028 Ga0070713_101505149
1029 Ga0070710_10226393
1030 Ga0070711_100316224
1031 Ga0070711_100547276
1032 Ga0070711_100733469
1033 Ga0070663_100019192
1034 Ga0070663_100019345
1035 Ga0070663_100070653
1036 Ga0070663_100143609
1037 Ga0070678_100854730
1038 Ga0070678_101766683
1039 Ga0070681_10001050
1040 Ga0070681_10053249
1041 Ga0070681_10103095
1042 Ga0070681_10215158
1043 Ga0070679_100000968
1044 Ga0070679_100003993
1045 Ga0070679_100006128
1046 Ga0070679_100057253
1047 Ga0070679_101944246
1048 Ga0070684_100016109
1049 Ga0070684_100054432
1050 Ga0070684_100184604
1051 Ga0070684_100200183
1052 Ga0070684_100610250
1053 Ga0070684_100782645
1054 Ga0068853_100000222
1055 Ga0068853_100000367
1056 Ga0068853_100078090
1057 Ga0068853_100178099
1058 Ga0068853_100241876
1059 Ga0068853_100371177
1060 Ga0068853_100582516
1061 Ga0068853_101323874
1062 Ga0068853_101482488
1063 Ga0070672_100006275
1064 Ga0070672_100519923
1065 Ga0070693_101636169
1066 Ga0070665_100044594
1067 Ga0070665_100230859
1068 Ga0070665_100296619
1069 Ga0070665_100431607
1070 Ga0070665_100538074
1071 Ga0070665_101341878
1072 Ga0068855_100000277
1073 Ga0068855_100002688
1074 Ga0068855_100003653
1075 Ga0068855_100010384
1076 Ga0068855_100012571
1077 Ga0068855_100022187
1078 Ga0068855_100036038
1079 Ga0068855_100057885
1080 Ga0068855_100135969
1081 Ga0068855_100348240
1082 Ga0068855_100366863
1083 Ga0068855_100400348
1084 Ga0068855_100442404
1085 Ga0068855_100967794
1086 Ga0068855_101161343
1087 Ga0070664_100127912
1088 Ga0070664_100167202
1089 Ga0070664_100598772
1090 Ga0070664_102051637
1091 Ga0068857_100013234
1092 Ga0068857_100015817
1093 Ga0068857_100016334
1094 Ga0068857_100120350
1095 Ga0068857_100202072
1096 Ga0068857_100373500
1097 Ga0068854_100000019
1098 Ga0068854_100008770
1099 Ga0068854_100042728
1100 Ga0068854_100311570
1101 Ga0068854_100422016
1102 Ga0068856_100003529
1103 Ga0068856_100006467
1104 Ga0068856_100019915
1105 Ga0068856_100028379
1106 Ga0068856_100037527
1107 Ga0068856_100054362
1108 Ga0068856_100258107
1109 Ga0068856_100702563
1110 Ga0068856_102227158
1111 Ga0068852_100000019
1112 Ga0068852_100000097
1113 Ga0068852_100001535
1114 Ga0068852_100006965
1115 Ga0068852_100015924
1116 Ga0068852_100027564
1117 Ga0068852_100050084
1118 Ga0068852_100059108
1119 Ga0068852_100213509
1120 Ga0068852_100241388
1121 Ga0068852_100471619
1122 Ga0068859_100006530
1123 Ga0068864_100002762
1124 Ga0068864_100012167
1125 Ga0068864_102329345
1126 Ga0068866_10437894
1127 Ga0068851_10001766
1128 Ga0068851_10010381
1129 Ga0068851_10083174
1130 Ga0068851_10139420
1131 Ga0068863_100001753
1132 Ga0068863_100001814
1133 Ga0068863_100120289
1134 Ga0068858_100003316
1135 Ga0068858_100015914
1136 Ga0068858_100278903
1137 Ga0068860_100000689
1138 Ga0070717_10011904
1139 Ga0070717_10481961
1140 Ga0070717_10830751
1141 Ga0070716_100189133
1142 Ga0070716_100341836
1143 Ga0070712_100122617
1144 Ga0070712_101271073
1145 Ga0070712_101995940
1146 Ga0097621_100000349
1147 Ga0097621_100048467
1148 Ga0097621_100165375
1149 Ga0068871_100035557
1150 Ga0068871_100675555
1151 Ga0068865_100268881
1152 Ga0075436_100198902
1153 Ga0097620_100006530
1154 Ga0099794_10444218
1155 Ga0105240_10000001
1156 Ga0105240_10000372
1157 Ga0105240_10000496
1158 Ga0105240_10001875
1159 Ga0105240_10003485
1160 Ga0105240_10010838
1161 Ga0105240_10033184
1162 Ga0105240_10034761
1163 Ga0105240_10057886
1164 Ga0105240_10060708
1165 Ga0105240_10122963
1166 Ga0105240_10234142
1167 Ga0105240_10393531
1168 Ga0105240_10395370
1169 Ga0105240_10425874
1170 Ga0105240_10714988
1171 Ga0105240_10898876
1172 Ga0105240_11331624
1173 Ga0105240_11656657
1174 Ga0105245_10000486
1175 Ga0105245_10146696
1176 Ga0105245_10271912
1177 Ga0105245_10417255
1178 Ga0105245_11363681
1179 Ga0105245_12015127
1180 Ga0105247_10004009
1181 Ga0105247_10012271
1182 Ga0105247_10299210
1183 Ga0105241_10000026
1184 Ga0105241_10000121
1185 Ga0105241_10002032
1186 Ga0105241_10006994
1187 Ga0105241_10043980
1188 Ga0105241_10449796
1189 Ga0105241_10454102
1190 Ga0105241_10539986
1191 Ga0105241_10644488
1192 Ga0105241_10790322
1193 Ga0105241_10847964
1194 Ga0105241_11499106
1195 Ga0105242_10223056
1196 Ga0105248_10000019
1197 Ga0105248_10007017
1198 Ga0105248_10021944
1199 Ga0105248_10022327
1200 Ga0105248_10042895
1201 Ga0105248_10293698
1202 Ga0105248_11168149
1203 Ga0105248_11357570
1204 Ga0105237_10000590
1205 Ga0105237_10006331
1206 Ga0105237_10049769
1207 Ga0105237_10352143
1208 Ga0105237_10555839
1209 Ga0105237_10556785
1210 Ga0105237_10805760
1211 Ga0105237_11092793
1212 Ga0105238_10000197
1213 Ga0105238_10000509
1214 Ga0105238_10016125
1215 Ga0105238_10023794
1216 Ga0105238_10029605
1217 Ga0105238_10051802
1218 Ga0105238_10064831
1219 Ga0105238_10065916
1220 Ga0105238_10145620
1221 Ga0105238_10485097
1222 Ga0105238_10522005
1223 Ga0105238_10781075
1224 Ga0105238_11877914
1225 Ga0105238_12299666
1226 Ga0105238_12957677
1227 Ga0105249_10067686
1228 Ga0099796_10089586
1229 Ga0105239_10001533
1230 Ga0105239_10003046
1231 Ga0105239_10013636
1232 Ga0105239_10075980
1233 Ga0105239_10336483
1234 Ga0105239_10877344
1235 Ga0105239_11576054
1236 Ga0105239_11893339
1237 Ga0105246_10002384
1238 Ga0157373_10104825
1239 Ga0157373_10219018
1240 Ga0157373_10757558
1241 Ga0157373_10782411
1242 Ga0157371_10030600
1243 Ga0157371_10407929
1244 Ga0157371_10778244
1245 Ga0157370_10000170
1246 Ga0157370_10006614
1247 Ga0157370_10010879
1248 Ga0157370_10012988
1249 Ga0157370_10017219
1250 Ga0157370_10030063
1251 Ga0157370_10090149
1252 Ga0157370_10210145
1253 Ga0157370_10608338
1254 Ga0157370_11601331
1255 Ga0157369_10000085
1256 Ga0157369_10000430
1257 Ga0157369_10009218
1258 Ga0157369_10010533
1259 Ga0157369_10012659
1260 Ga0157369_10012685
1261 Ga0157369_10018737
1262 Ga0157369_10021889
1263 Ga0157369_10028989
1264 Ga0157369_10042189
1265 Ga0157369_10049457
1266 Ga0157369_10051486
1267 Ga0157369_10067688
1268 Ga0157369_10115554
1269 Ga0157369_10261492
1270 Ga0157369_10416121
1271 Ga0157369_10666779
1272 Ga0157369_12066327
1273 Ga0157374_10005033
1274 Ga0157374_10011606
1275 Ga0157374_10025961
1276 Ga0157374_10058477
1277 Ga0157374_10177740
1278 Ga0157374_10347322
1279 Ga0157374_10429621
1280 Ga0157374_10459620
1281 Ga0157374_10497804
1282 Ga0157374_10664257
1283 Ga0157374_10753782
1284 Ga0157374_10850894
1285 Ga0157374_11748663
1286 Ga0157378_10003314
1287 Ga0157378_10023973
1288 Ga0157378_10028269
1289 Ga0157378_10108517
1290 Ga0157378_10307547
1291 Ga0157378_10431981
1292 Ga0157378_11984848
1293 Ga0163162_10027442
1294 Ga0163162_10084767
1295 Ga0163162_10209135
1296 Ga0163162_13191369
1297 Ga0157372_10000217
1298 Ga0157372_10002601
1299 Ga0157372_10007271
1300 Ga0157372_10010870
1301 Ga0157372_10027828
1302 Ga0157372_10048038
1303 Ga0157372_10120685
1304 Ga0157372_10265383
1305 Ga0157372_10355994
1306 Ga0157372_10541137
1307 Ga0157372_11069037
1308 Ga0157372_11562612
1309 Ga0157372_11585463
1310 Ga0157375_10029487
1311 Ga0157375_10162945
1312 Ga0157375_10264835
1313 Ga0157375_10753952
1314 Ga0163163_10001161
1315 Ga0163163_10028784
1316 Ga0157377_10224766
1317 Ga0157379_10002312
1318 Ga0157379_10043255
1319 Ga0157379_10067424
1320 Ga0157379_10227617
1321 Ga0157379_10393819
1322 Ga0157379_11687805
1323 Ga0157379_12334041
1324 Ga0157376_10004372
1325 Ga0157376_10061471
1326 Ga0157376_10134284
1327 Ga0157376_10240761
1328 Ga0157376_10318257
1329 Ga0157376_10955211
1330 Ga0157376_11119609
1331 Ga0157376_11340204
1332 Ga0182006_1055967
1333 Ga0163161_10492088
1334 Ga0213872_10025009
1335 Ga0213872_10062353
1336 Ga0213872_10410650
1337 Ga0213871_10039548
1338 Ga0224572_1045103
1339 Ga0209233_1005604
1340 Ga0207656_10001489
1341 Ga0207656_10008960
1342 Ga0207656_10011691
1343 Ga0207656_10109919
1344 Ga0207656_10199314
1345 Ga0207642_10739637
1346 Ga0207710_10000912
1347 Ga0207710_10032646
1348 Ga0207710_10227618
1349 Ga0207710_10449031
1350 Ga0207680_10562814
1351 Ga0207647_10093187
1352 Ga0207647_10130745
1353 Ga0207699_10314431
1354 Ga0207699_11185985
1355 Ga0207645_10075799
1356 Ga0207705_10000021
1357 Ga0207705_10002923
1358 Ga0207705_10019392
1359 Ga0207705_10031673
1360 Ga0207705_10032002
1361 Ga0207705_10091974
1362 Ga0207705_10157529
1363 Ga0207705_10301422
1364 Ga0207705_10644617
1365 Ga0207705_11343888
1366 Ga0207654_10000054
1367 Ga0207654_10000281
1368 Ga0207654_10000808
1369 Ga0207654_10086212
1370 Ga0207654_10268477
1371 Ga0207654_10527968
1372 Ga0207654_11084317
1373 Ga0207654_11159358
1374 Ga0207707_10003864
1375 Ga0207707_10088884
1376 Ga0207707_10475820
1377 Ga0207695_10000001
1378 Ga0207695_10000080
1379 Ga0207695_10000113
1380 Ga0207695_10000167
1381 Ga0207695_10000263
1382 Ga0207695_10001106
1383 Ga0207695_10001762
1384 Ga0207695_10007109
1385 Ga0207695_10025431
1386 Ga0207695_10047228
1387 Ga0207695_10050757
1388 Ga0207695_10067630
1389 Ga0207695_10090899
1390 Ga0207695_10587824
1391 Ga0207695_10825204
1392 Ga0207671_10000065
1393 Ga0207671_10000123
1394 Ga0207671_10000139
1395 Ga0207671_10037214
1396 Ga0207671_10093033
1397 Ga0207671_10101032
1398 Ga0207671_10285240
1399 Ga0207671_10314634
1400 Ga0207671_10544343
1401 Ga0207671_10816103
1402 Ga0207693_10195339
1403 Ga0207693_11218377
1404 Ga0207663_11063731
1405 Ga0207660_10034872
1406 Ga0207660_10529731
1407 Ga0207657_10004623
1408 Ga0207657_10019482
1409 Ga0207657_10023308
1410 Ga0207657_10063948
1411 Ga0207657_10273173
1412 Ga0207657_10516848
1413 Ga0207657_10584200
1414 Ga0207649_10009868
1415 Ga0207649_10011442
1416 Ga0207649_10036761
1417 Ga0207649_10045929
1418 Ga0207649_10051713
1419 Ga0207649_10123143
1420 Ga0207649_10355185
1421 Ga0207649_11594458
1422 Ga0207652_10001535
1423 Ga0207652_10002459
1424 Ga0207652_10033782
1425 Ga0207652_10045706
1426 Ga0207652_10456639
1427 Ga0207694_10000248
1428 Ga0207694_10000711
1429 Ga0207694_10007157
1430 Ga0207694_10010664
1431 Ga0207694_10042410
1432 Ga0207694_10131100
1433 Ga0207694_10277292
1434 Ga0207694_10474030
1435 Ga0207694_10534797
1436 Ga0207694_10924621
1437 Ga0207694_11311516
1438 Ga0207694_11564067
1439 Ga0207694_11849546
1440 Ga0207650_10003582
1441 Ga0207659_10116300
1442 Ga0207687_10000978
1443 Ga0207687_10030621
1444 Ga0207687_10086790
1445 Ga0207687_10276493
1446 Ga0207700_10015711
1447 Ga0207700_10071880
1448 Ga0207700_10159411
1449 Ga0207700_10214980
1450 Ga0207700_10887044
1451 Ga0207664_10068128
1452 Ga0207664_10135073
1453 Ga0207644_10002160
1454 Ga0207644_10013665
1455 Ga0207644_10075210
1456 Ga0207644_10271224
1457 Ga0207690_10010429
1458 Ga0207690_10564670
1459 Ga0207706_10064710
1460 Ga0207665_10584863
1461 Ga0207691_10075960
1462 Ga0207691_10770386
1463 Ga0207711_10000014
1464 Ga0207711_10004781
1465 Ga0207711_10024659
1466 Ga0207711_10095034
1467 Ga0207711_10190978
1468 Ga0207711_10305502
1469 Ga0207711_10343779
1470 Ga0207711_10349532
1471 Ga0207711_11198331
1472 Ga0207711_11646135
1473 Ga0207689_10004019
1474 Ga0207689_10051194
1475 Ga0207689_10524464
1476 Ga0207661_10001283
1477 Ga0207661_10010483
1478 Ga0207661_10025842
1479 Ga0207661_10083585
1480 Ga0207661_10099228
1481 Ga0207661_10105999
1482 Ga0207661_10220368
1483 Ga0207661_10237426
1484 Ga0207679_10079256
1485 Ga0207679_10175492
1486 Ga0207679_10298874
1487 Ga0207667_10000468
1488 Ga0207667_10007018
1489 Ga0207667_10007159
1490 Ga0207667_10007633
1491 Ga0207667_10009516
1492 Ga0207667_10023191
1493 Ga0207667_10028672
1494 Ga0207667_10057558
1495 Ga0207667_10089817
1496 Ga0207667_10113439
1497 Ga0207667_10118034
1498 Ga0207667_10136268
1499 Ga0207667_10237086
1500 Ga0207667_10774145
1501 Ga0207712_10040395
1502 Ga0207712_10879094
1503 Ga0207640_10000028
1504 Ga0207640_10008642
1505 Ga0207640_10155415
1506 Ga0207640_10159963
1507 Ga0207640_10555853
1508 Ga0207640_10568780
1509 Ga0207640_10722052
1510 Ga0207658_10050436
1511 Ga0207658_10458795
1512 Ga0207677_10000143
1513 Ga0207677_10006547
1514 Ga0207677_10716717
1515 Ga0207703_10011246
1516 Ga0207703_10133597
1517 Ga0207639_10000088
1518 Ga0207639_10000371
1519 Ga0207639_10014115
1520 Ga0207639_10145334
1521 Ga0207639_10221987
1522 Ga0207639_10287632
1523 Ga0207639_10320037
1524 Ga0207639_10423579
1525 Ga0207639_10464315
1526 Ga0207639_10951559
1527 Ga0207678_10006398
1528 Ga0207678_10015091
1529 Ga0207678_10015141
1530 Ga0207678_10036879
1531 Ga0207678_10231765
1532 Ga0207702_10004705
1533 Ga0207702_10005816
1534 Ga0207702_10036280
1535 Ga0207702_10085078
1536 Ga0207702_10095418
1537 Ga0207702_10258301
1538 Ga0207702_10401123
1539 Ga0207702_10866328
1540 Ga0207702_10976553
1541 Ga0207702_11236913
1542 Ga0207702_11534067
1543 Ga0207702_12254025
1544 Ga0207641_10005346
1545 Ga0207641_10021598
1546 Ga0207641_10139167
1547 Ga0207648_11286414
1548 Ga0207676_10002667
1549 Ga0207676_10125439
1550 Ga0207674_10000669
1551 Ga0207674_10012983
1552 Ga0207674_10120391
1553 Ga0207674_10328801
1554 Ga0207674_10525944
1555 Ga0207674_10557698
1556 Ga0207683_10028240
1557 Ga0207683_10364041
1558 Ga0207698_10000003
1559 Ga0207698_10000225
1560 Ga0207698_10003525
1561 Ga0207698_10007959
1562 Ga0207698_10045131
1563 Ga0207698_10132091
1564 Ga0207698_10165017
1565 Ga0207698_10417287
1566 Ga0207698_11190819
1567 Ga0268266_10005265
1568 Ga0268266_10006399
1569 Ga0268266_10014122
1570 Ga0268266_10046731
1571 Ga0268266_10173024
1572 Ga0268266_10233875
1573 Ga0268266_10256469
1574 Ga0268266_10393919
1575 Ga0268264_10000598
1576 Ga0265319_1081737
1577 Ga0265318_10006364
1578 Ga0265336_10001048
1579 Ga0265336_10005708
1580 Ga0307517_10515974
1581 Ga0265338_10004495
1582 Ga0265338_10009284
1583 Ga0265338_10017734
1584 Ga0265338_10158684
1585 Ga0265338_10163443
1586 Ga0265338_10259448
1587 Ga0265338_10337026
1588 Ga0265338_10721670
1589 Ga0265324_10137725
1590 Ga0307512_10315872
1591 Ga0265762_1176753
1592 Ga0265770_1105662
1593 Ga0265770_1122170
1594 Ga0265760_10086498
1595 Ga0265760_10141667
1596 Ga0265330_10000273
1597 Ga0265330_10001219
1598 Ga0265330_10013742
1599 Ga0265330_10036360
1600 Ga0265330_10097036
1601 Ga0265330_10111823
1602 Ga0265330_10245175
1603 Ga0265332_10025859
1604 Ga0265332_10196168
1605 Ga0265328_10007521
1606 Ga0265328_10015554
1607 Ga0265328_10024482
1608 Ga0265320_10003664
1609 Ga0265320_10084221
1610 Ga0265320_10249266
1611 Ga0265325_10000266
1612 Ga0265325_10000695
1613 Ga0265325_10005858
1614 Ga0265325_10060625
1615 Ga0265329_10003354
1616 Ga0265340_10001072
1617 Ga0265340_10019622
1618 Ga0265340_10061429
1619 Ga0265339_10000114
1620 Ga0265339_10000124
1621 Ga0265339_10000194
1622 Ga0265339_10003213
1623 Ga0265339_10005214
1624 Ga0265339_10029804
1625 Ga0265339_10037617
1626 Ga0265339_10199047
1627 Ga0265339_10386727
1628 Ga0265331_10046545
1629 Ga0265331_10094950
1630 Ga0265331_10429126
1631 Ga0265331_10585898
1632 Ga0265327_10177457
1633 Ga0265316_10000712
1634 Ga0265316_10003675
1635 Ga0265316_10008382
1636 Ga0265316_10022232
1637 Ga0265316_10027725
1638 Ga0265316_10048835
1639 Ga0265316_10054568
1640 Ga0265316_10169512
1641 Ga0265316_10190926
1642 Ga0265316_10192501
1643 Ga0265316_10351036
1644 Ga0265313_10013393
1645 Ga0265313_10016618
1646 Ga0265313_10018882
1647 Ga0265313_10019581
1648 Ga0265313_10028929
1649 Ga0265314_10000504
1650 Ga0265314_10002987
1651 Ga0265314_10046866
1652 Ga0265314_10080947
1653 Ga0265314_10160089
1654 Ga0265314_10288196
1655 Ga0265342_10000225
1656 Ga0265342_10001536
1657 Ga0265342_10004360
1658 Ga0265342_10014131
1659 Ga0265342_10015276
1660 Ga0265342_10042663
1661 Ga0265342_10113795
1662 Ga0265342_10173752
1663 Ga0316583_10181098
1664 Ga0307510_10010774
1665 Ga0307510_10071804
1666 Ga0307510_10220392
1667 Ga0373923_0266985
1668 Ga0373936_0187261
1669 Ga0373943_0018586
1670 Ga0373935_0251905
1671 Ga0373927_0683844
1672 Ga0373933_0634675
1673 Ga0373947_0036325
1674 Ga0373937_0138090
1675 Ga0373937_0510221
1676 Ga0373937_1742955
1677 Ga0395900_0849267
1678 Ga0395900_1361652
1679 Ga0395901_0583687
1680 Ga0436360_0170154
1681 Ga0436360_0361712
1682 Ga0436360_0826850
1683 Ga0436360_0871656
1684 Ga0436360_1008743
1685 Ga0436360_1308109
1686 Ga0436361_0226605
1687 Ga0436361_0318263
1688 Ga0436361_0526984
1689 Ga0436361_0585232
1690 Ga0436361_0757992
1691 Ga0436361_0776284
1692 Ga0436363_0701240
1693 Ga0451839_0265344
1694 Ga0451839_0397595
1695 Ga0439448_0148476
1696 Ga0451577_0979553
1697 Ga0466969_0299729
1698 Ga0466969_0533994
1699 Ga0453683_0515345
1700 Ga0466966_0043334
1701 Ga0466966_0201614
1702 Ga0466961_0062967
1703 Ga0466961_0372195
1704 Ga0466961_0499937
1705 Ga0466963_0000494
1706 Ga0466963_0732759
1707 Ga0466957_0445001
1708 Ga0466957_0972147
1709 Ga0466959_0159618
1710 Ga0466959_0254613
1711 Ga0466959_1198274
1712 Ga0466958_0372077
1713 Ga0466967_0001401
1714 Ga0466967_0226226
1715 Ga0466967_0433944
1716 Ga0466967_0549800
1717 Ga0495617_242766
1718 Ga0495592_0170605
1719 Ga0495592_0361325
1720 Ga0495592_0378286
1721 Ga0495603_0111033
1722 Ga0495603_0122471
1723 Ga0495629_0018026
1724 Ga0495638_0447890
1725 Ga0495651_0015018
1726 Ga0495651_0031839
1727 Ga0495653_0010749
1728 Ga0495650_0000038
1729 Ga0495650_0008733
1730 Ga0495580_0097351
1731 Ga0495582_0049065
1732 Ga0495639_0001675
1733 Ga0495662_0005660
1734 Ga0495664_0001348
1735 Ga0495664_0028071
1736 Ga0495664_0045809
1737 Ga0495664_0209206
1738 Ga0495585_0016774
1739 Ga0495594_0000388
1740 Ga0495594_0001190
1741 Ga0495594_0881111
1742 Ga0495583_0013317
1743 Ga0495583_0033314
1744 Ga0495606_0077834
1745 Ga0495606_0095370
1746 Ga0495606_0162623
1747 Ga0495606_0216104
1748 Ga0495628_0007402
1749 Ga0495628_0011061
1750 Ga0495628_0694799
1751 Ga0495630_0264458
1752 Ga0495631_0051109
1753 Ga0495631_0241780
1754 Ga0495632_0301110
1755 Ga0495644_0000048
1756 Ga0495648_0167762
1757 Ga0495648_0207165
1758 Ga0495666_0001196
1759 Ga0495642_0009023
1760 Ga0495642_0389701
1761 Ga0495652_0009907
1762 Ga0495652_0039259
1763 Ga0495652_0448030
1764 Ga0495652_0620027
1765 Ga0495665_0001828
1766 Ga0495665_0321308
1767 Ga0495640_0060924
1768 Ga0495640_0096637
1769 Ga0495586_0163121
1770 Ga0495586_0521142
1771 Ga0495587_0008155
1772 Ga0495609_0036518
1773 Ga0495609_0180783
1774 Ga0495609_0326845
1775 Ga0495645_0001770
1776 Ga0495645_0005517
1777 Ga0495645_0007804
1778 Ga0495645_0022284
1779 Ga0495667_0084571
1780 Ga0495667_0374459
1781 Ga0495668_0044535
1782 Ga0495668_0514669
1783 Ga0495634_0006225
1784 Ga0495611_0383414
1785 Ga0495625_0000985
1786 Ga0495625_0007833
1787 Ga0495625_0019175
1788 Ga0495625_0045052
1789 Ga0495625_0511048
1790 Ga0495635_0002836
1791 Ga0495635_0086686
1792 Ga0495635_0470186
1793 Ga0495659_0066790
1794 Ga0495588_0028867
1795 Ga0495657_0467111
1796 Ga0495599_0017587
1797 Ga0495599_0051590
1798 Ga0495599_0605156
1799 Ga0495623_0050948
1800 Ga0495623_0056771
1801 Ga0495623_0058009
1802 Ga0495623_0082244
1803 Ga0495646_0077284
1804 Ga0495646_0124321
1805 Ga0495646_0346219
1806 Ga0495646_0450865
1807 Ga0495646_0542208
1808 Ga0495669_0004252
1809 Ga0495613_0003966
1810 Ga0495613_0012222
1811 Ga0495624_0007524
1812 Ga0495670_0038859
1813 Ga0495671_0153236
1814 Ga0495671_0493283
1815 Ga0495649_0064738
1816 Ga0495649_0490026
1817 Ga0495600_0002909
1818 Ga0495600_0302730
1819 Ga0495581_0050879
1820 Ga0495581_0245692
1821 Ga0495581_0366883
1822 Ga0495581_0885072
1823 Ga0495604_0002834
1824 Ga0495604_0015522
1825 Ga0495604_0069051
1826 Ga0495636_0056644
1827 Ga0495674_0014334
1828 Ga0495674_0152317
1829 Ga0495674_0539358
1830 Ga0495672_0030990
1831 Ga0495676_0008961
1832 Ga0495676_0114867
1833 Ga0495680_0076425
1834 Ga0495675_0003222
1835 Ga0495675_0012790
1836 Ga0495677_0020984
1837 Ga0495673_0072246
1838 Ga0495684_0049723
1839 Ga0495684_0101338
1840 Ga0495686_0004566
1841 Ga0495686_0008419
1842 Ga0495686_0012438
1843 Ga0495686_0014007
1844 Ga0495686_0044764
1845 Ga0495686_0067112
1846 Ga0495686_0187235
1847 Ga0495593_0019638
1848 Ga0495593_0040852
1849 Ga0495602_0773591
1850 Ga0495614_0000972
1851 Ga0496100_0575375
1852 Ga0496100_1034106
1853 Ga0496101_0659155
1854 Ga0496102_0777646
1855 Ga0496103_0741566
1856 Ga0496104_0000053
1857 Ga0496104_0057613
1858 Ga0496104_0875113
1859 Ga0496108_0111209
1860 Ga0496112_0165026
1861 Ga0496114_0096351
1862 Ga0496115_0202171
1863 Ga0496115_0301250
1864 Ga0496120_0134276
1865 Ga0496120_0260024
1866 Ga0496121_0492821
1867 Ga0496126_0000014
1868 Ga0496126_0000154
1869 Ga0496126_0739092
1870 Ga0496126_1287352
1871 Ga0495682_0041693
1872 Ga0501031_0027688
1873 Ga0501032_0001912
1874 Ga0501033_0010946
1875 Ga0501033_0045842
1876 Ga0501034_0014111
1877 Ga0501037_0025359
1878 Ga0501037_0471859
1879 Ga0501038_0033174
1880 Ga0501038_0098016
1881 Ga0501038_0110075
1882 Ga0501039_0154809
1883 Ga0501043_0057147
1884 Ga0501046_0000056
1885 Ga0501047_0008947
1886 Ga0501047_0017729
1887 Ga0501070_0124247
1888 Ga0501070_0254155
1889 Ga0501073_0008329
1890 Ga0501073_1108370
1891 Ga0501074_0524312
1892 Ga0501079_0275238
1893 Ga0501080_0310054
1894 Ga0501080_0960686
1895 Ga0501035_0086954
1896 Ga0501035_0350448
1897 Ga0501044_0171643
1898 Ga0501044_0184233
1899 nmdc:mga08x19_161497_c1
1900 nmdc:mga08x19_164936_c1
1901 nmdc:mga08x19_30704_c1
1902 Ga0495612_0308136
1903 Ga0500643_028144
1904 Ga0500644_0156516
1905 Ga0500651_0000005
1906 Ga0500595_000004
1907 Ga0500595_013665
1908 Ga0500595_016226
1909 Ga0500661_001216
1910 2884217794

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01502

PRA-CH

Phosphoribosyl-AMP cyclohydrolase

49

124

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zps-assembly1.cif.gz_A crystal structure of methanobacterium thermoautotrophicum phosphoribosyl-amp cyclohydrolase hisi 0.9431 12 101
6j22-assembly1.cif.gz_A crystal structure of bi-functional enzyme 0.9186 4 105
6j2l-assembly1.cif.gz_A crystal structure of bi-functional enzyme 0.9167 4 105
6j22-assembly1.cif.gz_B crystal structure of bi-functional enzyme 0.9088 4 105
7bgm-assembly1.cif.gz_A crystal structure of mthisn2, a bifunctional enzyme from the histidine biosynthetic pathway 0.904 2 105
ID Description Score Start End Superfamily
af_Q2FUU3_250_343_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9591 2 88 3.10.20.810
1zpsA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9462 12 93 3.10.20.810
af_C6TGF5_46_140_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.925 2 93 3.10.20.810
af_P9WMM7_1_97_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9081 2 88 3.10.20.810
af_A0A1D8PKY7_169_272_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.887 4 93 3.10.20.810
ID Description Score Start End GO Terms
AF-A0A3M1DQ05-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.965 1 94 GO:0000105
GO:0004635
AF-A0A1I6L727-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.962 2 107 GO:0000105
GO:0004635
AF-A0A841JW93-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9612 3 110 GO:0000105
GO:0004635
AF-A0A6A7L9V1-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9607 4 105 GO:0000105
GO:0004635
AF-A0A382RME8-F1-model_v4 Histidine biosynthesis bifunctional protein HisIE (EC 3.5.4.19) 0.9602 3 105 GO:0000105
GO:0004635
GO:0005737

Map