F486706
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 955 | 295 | 1910 | 117 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100248258|Ga0068855_1002482582 |
| Length | 134 |
| Sequence | MGPDQNDELRKKERDEMSAVKDAPTIDFAKMDGLVPGIVQDAKTGEMLMLGFLNETSYAKTLESGFVTFWSRTRQKLWMKGETSGNRLKIVSAATDCDNDALLFRVDVEGDGLVCHEGTVSCFTKPISVSAEGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 88 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 89 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 90 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 142 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 143 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 144 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 145 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 146 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 147 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 148 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 149 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 150 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 151 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 152 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 154 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 155 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 156 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 157 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 158 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 159 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 160 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 161 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 162 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 163 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 165 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 166 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 167 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 169 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 170 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 171 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 172 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 173 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 174 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 176 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 177 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 178 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 179 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 180 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 181 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 182 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 183 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 184 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 185 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 186 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 187 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 188 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 189 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 190 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 191 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 192 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 261 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 262 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 263 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 265 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 266 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 267 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 268 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 269 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 270 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 291 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 292 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 293 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 294 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 295 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.37 |
| Metatranscriptomes | 0.52 |
| Isolates | 0.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.84 |
| Nodule | 0 |
| Rhizoplane | 1.36 |
| Rhizosphere | 96.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068855_100248258 | 3300005563 | Bacteria | 1986 |
| 2 | LJNas_1006912 | 3300000546 | Bacteria | 1229 |
| 3 | JGI24743J22301_10071283 | 3300001991 | Bacteria | 725 |
| 4 | rootH2_10171401 | 3300003320 | Bacteria | 1378 |
| 5 | rootH1_10203955 | 3300003323 | Bacteria | 1639 |
| 6 | Ga0070658_10000121 | 3300005327 | Bacteria | 70439 |
| 7 | Ga0070658_10013505 | 3300005327 | Bacteria | 6554 |
| 8 | Ga0070658_10037114 | 3300005327 | Bacteria | 3927 |
| 9 | Ga0070658_10038584 | 3300005327 | Bacteria | 3851 |
| 10 | Ga0070658_10049430 | 3300005327 | Bacteria | 3407 |
| 11 | Ga0070658_10134937 | 3300005327 | Bacteria | 2058 |
| 12 | Ga0070658_10150612 | 3300005327 | Bacteria | 1947 |
| 13 | Ga0070658_10341705 | 3300005327 | Bacteria | 1280 |
| 14 | Ga0070658_10429461 | 3300005327 | Bacteria | 1137 |
| 15 | Ga0070658_10921455 | 3300005327 | Bacteria | 760 |
| 16 | Ga0070676_10229857 | 3300005328 | Bacteria | 1229 |
| 17 | Ga0070683_100002041 | 3300005329 | Bacteria | 15901 |
| 18 | Ga0070683_100015021 | 3300005329 | Bacteria | 6793 |
| 19 | Ga0070683_100015398 | 3300005329 | Bacteria | 6717 |
| 20 | Ga0070683_100028772 | 3300005329 | Bacteria | 5025 |
| 21 | Ga0070683_100135740 | 3300005329 | Bacteria | 2330 |
| 22 | Ga0070683_100183443 | 3300005329 | Bacteria | 1986 |
| 23 | Ga0070683_100779235 | 3300005329 | Bacteria | 916 |
| 24 | Ga0070683_100898533 | 3300005329 | Bacteria | 850 |
| 25 | Ga0070670_100005099 | 3300005331 | Bacteria | 11055 |
| 26 | Ga0068869_100002456 | 3300005334 | Bacteria | 11175 |
| 27 | Ga0068869_100503734 | 3300005334 | Bacteria | 1011 |
| 28 | Ga0070666_10071003 | 3300005335 | Bacteria | 2369 |
| 29 | Ga0070666_10285534 | 3300005335 | Bacteria | 1173 |
| 30 | Ga0070680_100007018 | 3300005336 | Bacteria | 8584 |
| 31 | Ga0070680_100032000 | 3300005336 | Bacteria | 4231 |
| 32 | Ga0070682_100345088 | 3300005337 | Bacteria | 1108 |
| 33 | Ga0068868_100000066 | 3300005338 | Bacteria | 59945 |
| 34 | Ga0068868_100030705 | 3300005338 | Bacteria | 4121 |
| 35 | Ga0068868_100202417 | 3300005338 | Bacteria | 1656 |
| 36 | Ga0068868_100251736 | 3300005338 | Bacteria | 1487 |
| 37 | Ga0068868_100955371 | 3300005338 | Bacteria | 782 |
| 38 | Ga0070660_100008313 | 3300005339 | Bacteria | 7255 |
| 39 | Ga0070660_100185531 | 3300005339 | Bacteria | 1684 |
| 40 | Ga0070660_101936061 | 3300005339 | Bacteria | 503 |
| 41 | Ga0070691_10410588 | 3300005341 | Bacteria | 765 |
| 42 | Ga0070691_10820556 | 3300005341 | Bacteria | 568 |
| 43 | Ga0070661_100016527 | 3300005344 | Bacteria | 5220 |
| 44 | Ga0070661_100018919 | 3300005344 | Bacteria | 4905 |
| 45 | Ga0070661_100111867 | 3300005344 | Bacteria | 2040 |
| 46 | Ga0070661_100112059 | 3300005344 | Unclassified | 2038 |
| 47 | Ga0070661_100198292 | 3300005344 | Bacteria | 1533 |
| 48 | Ga0070661_100230310 | 3300005344 | Bacteria | 1424 |
| 49 | Ga0070661_100542850 | 3300005344 | Bacteria | 934 |
| 50 | Ga0070661_100838680 | 3300005344 | Bacteria | 756 |
| 51 | Ga0070661_101035467 | 3300005344 | Bacteria | 682 |
| 52 | Ga0070661_101631218 | 3300005344 | Bacteria | 546 |
| 53 | Ga0070692_10972062 | 3300005345 | Bacteria | 592 |
| 54 | Ga0070668_100215320 | 3300005347 | Bacteria | 1582 |
| 55 | Ga0070669_101089400 | 3300005353 | Bacteria | 688 |
| 56 | Ga0070671_100000411 | 3300005355 | Bacteria | 29652 |
| 57 | Ga0070671_100003123 | 3300005355 | Bacteria | 12901 |
| 58 | Ga0070671_100027039 | 3300005355 | Bacteria | 4720 |
| 59 | Ga0070674_100431124 | 3300005356 | Bacteria | 1084 |
| 60 | Ga0070659_100004580 | 3300005366 | Bacteria | 9889 |
| 61 | Ga0070659_100030029 | 3300005366 | Bacteria | 4204 |
| 62 | Ga0070667_100002645 | 3300005367 | Bacteria | 15516 |
| 63 | Ga0070709_10949888 | 3300005434 | Bacteria | 682 |
| 64 | Ga0070709_11714150 | 3300005434 | Bacteria | 513 |
| 65 | Ga0070714_100002654 | 3300005435 | Bacteria | 13178 |
| 66 | Ga0070714_100099406 | 3300005435 | Bacteria | 2560 |
| 67 | Ga0070713_100033702 | 3300005436 | Bacteria | 4106 |
| 68 | Ga0070713_100095055 | 3300005436 | Bacteria | 2570 |
| 69 | Ga0070713_100306613 | 3300005436 | Bacteria | 1463 |
| 70 | Ga0070713_100374302 | 3300005436 | Bacteria | 1326 |
| 71 | Ga0070713_100423960 | 3300005436 | Bacteria | 1246 |
| 72 | Ga0070713_100980652 | 3300005436 | Bacteria | 815 |
| 73 | Ga0070713_101505149 | 3300005436 | Bacteria | 653 |
| 74 | Ga0070710_10226393 | 3300005437 | Bacteria | 1192 |
| 75 | Ga0070711_100316224 | 3300005439 | Bacteria | 1246 |
| 76 | Ga0070711_100547276 | 3300005439 | Bacteria | 960 |
| 77 | Ga0070711_100733469 | 3300005439 | Bacteria | 834 |
| 78 | Ga0070663_100019192 | 3300005455 | Bacteria | 4500 |
| 79 | Ga0070663_100019345 | 3300005455 | Bacteria | 4485 |
| 80 | Ga0070663_100070653 | 3300005455 | Bacteria | 2539 |
| 81 | Ga0070663_100143609 | 3300005455 | Bacteria | 1824 |
| 82 | Ga0070678_100854730 | 3300005456 | Bacteria | 829 |
| 83 | Ga0070678_101766683 | 3300005456 | Bacteria | 583 |
| 84 | Ga0070681_10001050 | 3300005458 | Bacteria | 23493 |
| 85 | Ga0070681_10053249 | 3300005458 | Bacteria | 4032 |
| 86 | Ga0070681_10103095 | 3300005458 | Bacteria | 2798 |
| 87 | Ga0070681_10215158 | 3300005458 | Bacteria | 1838 |
| 88 | Ga0070679_100000968 | 3300005530 | Bacteria | 24975 |
| 89 | Ga0070679_100003993 | 3300005530 | Bacteria | 13587 |
| 90 | Ga0070679_100006128 | 3300005530 | Bacteria | 11185 |
| 91 | Ga0070679_100057253 | 3300005530 | Bacteria | 3885 |
| 92 | Ga0070679_101944246 | 3300005530 | Unclassified | 537 |
| 93 | Ga0070684_100016109 | 3300005535 | Bacteria | 6107 |
| 94 | Ga0070684_100054432 | 3300005535 | Bacteria | 3487 |
| 95 | Ga0070684_100184604 | 3300005535 | Bacteria | 1897 |
| 96 | Ga0070684_100200183 | 3300005535 | Bacteria | 1819 |
| 97 | Ga0070684_100610250 | 3300005535 | Bacteria | 1015 |
| 98 | Ga0070684_100782645 | 3300005535 | Bacteria | 891 |
| 99 | Ga0068853_100000222 | 3300005539 | Bacteria | 40206 |
| 100 | Ga0068853_100000367 | 3300005539 | Bacteria | 31060 |
| 101 | Ga0068853_100078090 | 3300005539 | Bacteria | 2893 |
| 102 | Ga0068853_100178099 | 3300005539 | Unclassified | 1927 |
| 103 | Ga0068853_100241876 | 3300005539 | Bacteria | 1654 |
| 104 | Ga0068853_100371177 | 3300005539 | Bacteria | 1335 |
| 105 | Ga0068853_100582516 | 3300005539 | Bacteria | 1062 |
| 106 | Ga0068853_101323874 | 3300005539 | Bacteria | 696 |
| 107 | Ga0068853_101482488 | 3300005539 | Unclassified | 657 |
| 108 | Ga0070672_100006275 | 3300005543 | Bacteria | 7967 |
| 109 | Ga0070672_100519923 | 3300005543 | Bacteria | 1031 |
| 110 | Ga0070693_101636169 | 3300005547 | Bacteria | 506 |
| 111 | Ga0070665_100044594 | 3300005548 | Bacteria | 4453 |
| 112 | Ga0070665_100230859 | 3300005548 | Bacteria | 1850 |
| 113 | Ga0070665_100296619 | 3300005548 | Bacteria | 1619 |
| 114 | Ga0070665_100431607 | 3300005548 | Bacteria | 1326 |
| 115 | Ga0070665_100538074 | 3300005548 | Bacteria | 1180 |
| 116 | Ga0070665_101341878 | 3300005548 | Bacteria | 725 |
| 117 | Ga0068855_100000277 | 3300005563 | Bacteria | 63213 |
| 118 | Ga0068855_100002688 | 3300005563 | Bacteria | 21925 |
| 119 | Ga0068855_100003653 | 3300005563 | Bacteria | 18822 |
| 120 | Ga0068855_100010384 | 3300005563 | Bacteria | 11233 |
| 121 | Ga0068855_100012571 | 3300005563 | Bacteria | 10218 |
| 122 | Ga0068855_100022187 | 3300005563 | Bacteria | 7607 |
| 123 | Ga0068855_100036038 | 3300005563 | Bacteria | 5890 |
| 124 | Ga0068855_100057885 | 3300005563 | Bacteria | 4542 |
| 125 | Ga0068855_100135969 | 3300005563 | Bacteria | 2804 |
| 126 | Ga0068855_100348240 | 3300005563 | Bacteria | 1632 |
| 127 | Ga0068855_100366863 | 3300005563 | Bacteria | 1583 |
| 128 | Ga0068855_100400348 | 3300005563 | Bacteria | 1504 |
| 129 | Ga0068855_100442404 | 3300005563 | Bacteria | 1419 |
| 130 | Ga0068855_100967794 | 3300005563 | Bacteria | 896 |
| 131 | Ga0068855_101161343 | 3300005563 | Bacteria | 804 |
| 132 | Ga0070664_100127912 | 3300005564 | Bacteria | 2230 |
| 133 | Ga0070664_100167202 | 3300005564 | Bacteria | 1949 |
| 134 | Ga0070664_100598772 | 3300005564 | Bacteria | 1022 |
| 135 | Ga0070664_102051637 | 3300005564 | Bacteria | 543 |
| 136 | Ga0068857_100013234 | 3300005577 | Bacteria | 7188 |
| 137 | Ga0068857_100015817 | 3300005577 | Bacteria | 6601 |
| 138 | Ga0068857_100016334 | 3300005577 | Bacteria | 6505 |
| 139 | Ga0068857_100120350 | 3300005577 | Bacteria | 2363 |
| 140 | Ga0068857_100202072 | 3300005577 | Bacteria | 1812 |
| 141 | Ga0068857_100373500 | 3300005577 | Bacteria | 1323 |
| 142 | Ga0068854_100000019 | 3300005578 | Bacteria | 134145 |
| 143 | Ga0068854_100008770 | 3300005578 | Bacteria | 6510 |
| 144 | Ga0068854_100042728 | 3300005578 | Bacteria | 3209 |
| 145 | Ga0068854_100311570 | 3300005578 | Bacteria | 1277 |
| 146 | Ga0068854_100422016 | 3300005578 | Bacteria | 1108 |
| 147 | Ga0068856_100003529 | 3300005614 | Bacteria | 15773 |
| 148 | Ga0068856_100006467 | 3300005614 | Bacteria | 11493 |
| 149 | Ga0068856_100019915 | 3300005614 | Bacteria | 6512 |
| 150 | Ga0068856_100028379 | 3300005614 | Bacteria | 5464 |
| 151 | Ga0068856_100037527 | 3300005614 | Bacteria | 4754 |
| 152 | Ga0068856_100054362 | 3300005614 | Bacteria | 3949 |
| 153 | Ga0068856_100258107 | 3300005614 | Bacteria | 1758 |
| 154 | Ga0068856_100702563 | 3300005614 | Bacteria | 1031 |
| 155 | Ga0068856_102227158 | 3300005614 | Bacteria | 557 |
| 156 | Ga0068852_100000019 | 3300005616 | Bacteria | 129021 |
| 157 | Ga0068852_100000097 | 3300005616 | Bacteria | 59430 |
| 158 | Ga0068852_100001535 | 3300005616 | Bacteria | 15668 |
| 159 | Ga0068852_100006965 | 3300005616 | Bacteria | 8225 |
| 160 | Ga0068852_100015924 | 3300005616 | Bacteria | 5850 |
| 161 | Ga0068852_100027564 | 3300005616 | Bacteria | 4631 |
| 162 | Ga0068852_100050084 | 3300005616 | Bacteria | 3577 |
| 163 | Ga0068852_100059108 | 3300005616 | Bacteria | 3324 |
| 164 | Ga0068852_100213509 | 3300005616 | Bacteria | 1832 |
| 165 | Ga0068852_100241388 | 3300005616 | Unclassified | 1727 |
| 166 | Ga0068852_100471619 | 3300005616 | Bacteria | 1246 |
| 167 | Ga0068859_100006530 | 3300005617 | Bacteria | 11843 |
| 168 | Ga0068864_100002762 | 3300005618 | Bacteria | 14478 |
| 169 | Ga0068864_100012167 | 3300005618 | Bacteria | 7112 |
| 170 | Ga0068864_102329345 | 3300005618 | Bacteria | 542 |
| 171 | Ga0068866_10437894 | 3300005718 | Bacteria | 852 |
| 172 | Ga0068851_10001766 | 3300005834 | Bacteria | 9449 |
| 173 | Ga0068851_10010381 | 3300005834 | Bacteria | 4348 |
| 174 | Ga0068851_10083174 | 3300005834 | Bacteria | 1674 |
| 175 | Ga0068851_10139420 | 3300005834 | Bacteria | 1318 |
| 176 | Ga0068863_100001753 | 3300005841 | Bacteria | 21524 |
| 177 | Ga0068863_100001814 | 3300005841 | Bacteria | 21208 |
| 178 | Ga0068863_100120289 | 3300005841 | Bacteria | 2503 |
| 179 | Ga0068858_100003316 | 3300005842 | Bacteria | 16031 |
| 180 | Ga0068858_100015914 | 3300005842 | Bacteria | 7067 |
| 181 | Ga0068858_100278903 | 3300005842 | Bacteria | 1591 |
| 182 | Ga0068860_100000689 | 3300005843 | Bacteria | 38878 |
| 183 | Ga0070717_10011904 | 3300006028 | Bacteria | 6620 |
| 184 | Ga0070717_10481961 | 3300006028 | Bacteria | 1120 |
| 185 | Ga0070717_10830751 | 3300006028 | Bacteria | 841 |
| 186 | Ga0070716_100189133 | 3300006173 | Bacteria | 1359 |
| 187 | Ga0070716_100341836 | 3300006173 | Bacteria | 1056 |
| 188 | Ga0070712_100122617 | 3300006175 | Bacteria | 1958 |
| 189 | Ga0070712_101271073 | 3300006175 | Bacteria | 641 |
| 190 | Ga0070712_101995940 | 3300006175 | Bacteria | 508 |
| 191 | Ga0097621_100000349 | 3300006237 | Bacteria | 31779 |
| 192 | Ga0097621_100048467 | 3300006237 | Bacteria | 3447 |
| 193 | Ga0097621_100165375 | 3300006237 | Bacteria | 1904 |
| 194 | Ga0068871_100035557 | 3300006358 | Bacteria | 3960 |
| 195 | Ga0068871_100675555 | 3300006358 | Bacteria | 944 |
| 196 | Ga0068865_100268881 | 3300006881 | Bacteria | 1353 |
| 197 | Ga0075436_100198902 | 3300006914 | Bacteria | 1419 |
| 198 | Ga0097620_100006530 | 3300006931 | Bacteria | 11843 |
| 199 | Ga0099794_10444218 | 3300007265 | Bacteria | 680 |
| 200 | Ga0105240_10000001 | 3300009093 | Bacteria | 2887840 |
| 201 | Ga0105240_10000372 | 3300009093 | Bacteria | 84325 |
| 202 | Ga0105240_10000496 | 3300009093 | Bacteria | 72575 |
| 203 | Ga0105240_10001875 | 3300009093 | Bacteria | 34957 |
| 204 | Ga0105240_10003485 | 3300009093 | Bacteria | 24396 |
| 205 | Ga0105240_10010838 | 3300009093 | Bacteria | 12767 |
| 206 | Ga0105240_10033184 | 3300009093 | Bacteria | 6673 |
| 207 | Ga0105240_10034761 | 3300009093 | Bacteria | 6498 |
| 208 | Ga0105240_10057886 | 3300009093 | Bacteria | 4839 |
| 209 | Ga0105240_10060708 | 3300009093 | Bacteria | 4712 |
| 210 | Ga0105240_10122963 | 3300009093 | Bacteria | 3123 |
| 211 | Ga0105240_10234142 | 3300009093 | Bacteria | 2132 |
| 212 | Ga0105240_10393531 | 3300009093 | Bacteria | 1562 |
| 213 | Ga0105240_10395370 | 3300009093 | Bacteria | 1558 |
| 214 | Ga0105240_10425874 | 3300009093 | Bacteria | 1490 |
| 215 | Ga0105240_10714988 | 3300009093 | Bacteria | 1092 |
| 216 | Ga0105240_10898876 | 3300009093 | Bacteria | 953 |
| 217 | Ga0105240_11331624 | 3300009093 | Bacteria | 757 |
| 218 | Ga0105240_11656657 | 3300009093 | Bacteria | 668 |
| 219 | Ga0105245_10000486 | 3300009098 | Bacteria | 36378 |
| 220 | Ga0105245_10146696 | 3300009098 | Unclassified | 2227 |
| 221 | Ga0105245_10271912 | 3300009098 | Bacteria | 1653 |
| 222 | Ga0105245_10417255 | 3300009098 | Bacteria | 1344 |
| 223 | Ga0105245_11363681 | 3300009098 | Bacteria | 759 |
| 224 | Ga0105245_12015127 | 3300009098 | Bacteria | 631 |
| 225 | Ga0105247_10004009 | 3300009101 | Bacteria | 9473 |
| 226 | Ga0105247_10012271 | 3300009101 | Bacteria | 5146 |
| 227 | Ga0105247_10299210 | 3300009101 | Bacteria | 1116 |
| 228 | Ga0105241_10000026 | 3300009174 | Bacteria | 132695 |
| 229 | Ga0105241_10000121 | 3300009174 | Bacteria | 57041 |
| 230 | Ga0105241_10002032 | 3300009174 | Bacteria | 15308 |
| 231 | Ga0105241_10006994 | 3300009174 | Bacteria | 8301 |
| 232 | Ga0105241_10043980 | 3300009174 | Bacteria | 3383 |
| 233 | Ga0105241_10449796 | 3300009174 | Bacteria | 1139 |
| 234 | Ga0105241_10454102 | 3300009174 | Bacteria | 1134 |
| 235 | Ga0105241_10539986 | 3300009174 | Bacteria | 1045 |
| 236 | Ga0105241_10644488 | 3300009174 | Bacteria | 961 |
| 237 | Ga0105241_10790322 | 3300009174 | Bacteria | 873 |
| 238 | Ga0105241_10847964 | 3300009174 | Bacteria | 845 |
| 239 | Ga0105241_11499106 | 3300009174 | Bacteria | 649 |
| 240 | Ga0105242_10223056 | 3300009176 | Bacteria | 1685 |
| 241 | Ga0105248_10000019 | 3300009177 | Bacteria | 285766 |
| 242 | Ga0105248_10007017 | 3300009177 | Bacteria | 12337 |
| 243 | Ga0105248_10021944 | 3300009177 | Bacteria | 7075 |
| 244 | Ga0105248_10022327 | 3300009177 | Bacteria | 7018 |
| 245 | Ga0105248_10042895 | 3300009177 | Bacteria | 5072 |
| 246 | Ga0105248_10293698 | 3300009177 | Bacteria | 1830 |
| 247 | Ga0105248_11168149 | 3300009177 | Bacteria | 870 |
| 248 | Ga0105248_11357570 | 3300009177 | Bacteria | 804 |
| 249 | Ga0105237_10000590 | 3300009545 | Bacteria | 50564 |
| 250 | Ga0105237_10006331 | 3300009545 | Bacteria | 13155 |
| 251 | Ga0105237_10049769 | 3300009545 | Unclassified | 4211 |
| 252 | Ga0105237_10352143 | 3300009545 | Bacteria | 1477 |
| 253 | Ga0105237_10555839 | 3300009545 | Bacteria | 1154 |
| 254 | Ga0105237_10556785 | 3300009545 | Bacteria | 1153 |
| 255 | Ga0105237_10805760 | 3300009545 | Bacteria | 946 |
| 256 | Ga0105237_11092793 | 3300009545 | Bacteria | 804 |
| 257 | Ga0105238_10000197 | 3300009551 | Bacteria | 66637 |
| 258 | Ga0105238_10000509 | 3300009551 | Bacteria | 40868 |
| 259 | Ga0105238_10016125 | 3300009551 | Bacteria | 7558 |
| 260 | Ga0105238_10023794 | 3300009551 | Bacteria | 6244 |
| 261 | Ga0105238_10029605 | 3300009551 | Bacteria | 5576 |
| 262 | Ga0105238_10051802 | 3300009551 | Bacteria | 4127 |
| 263 | Ga0105238_10064831 | 3300009551 | Bacteria | 3653 |
| 264 | Ga0105238_10065916 | 3300009551 | Bacteria | 3622 |
| 265 | Ga0105238_10145620 | 3300009551 | Bacteria | 2345 |
| 266 | Ga0105238_10485097 | 3300009551 | Bacteria | 1236 |
| 267 | Ga0105238_10522005 | 3300009551 | Bacteria | 1190 |
| 268 | Ga0105238_10781075 | 3300009551 | Bacteria | 970 |
| 269 | Ga0105238_11877914 | 3300009551 | Bacteria | 632 |
| 270 | Ga0105238_12299666 | 3300009551 | Bacteria | 574 |
| 271 | Ga0105238_12957677 | 3300009551 | Bacteria | 511 |
| 272 | Ga0105249_10067686 | 3300009553 | Bacteria | 3291 |
| 273 | Ga0099796_10089586 | 3300010159 | Bacteria | 1142 |
| 274 | Ga0105239_10001533 | 3300010375 | Bacteria | 30534 |
| 275 | Ga0105239_10003046 | 3300010375 | Bacteria | 20836 |
| 276 | Ga0105239_10013636 | 3300010375 | Bacteria | 9023 |
| 277 | Ga0105239_10075980 | 3300010375 | Bacteria | 3694 |
| 278 | Ga0105239_10336483 | 3300010375 | Bacteria | 1703 |
| 279 | Ga0105239_10877344 | 3300010375 | Bacteria | 1029 |
| 280 | Ga0105239_11576054 | 3300010375 | Bacteria | 759 |
| 281 | Ga0105239_11893339 | 3300010375 | Bacteria | 692 |
| 282 | Ga0105246_10002384 | 3300011119 | Bacteria | 11337 |
| 283 | Ga0157373_10104825 | 3300013100 | Bacteria | 1989 |
| 284 | Ga0157373_10219018 | 3300013100 | Bacteria | 1343 |
| 285 | Ga0157373_10757558 | 3300013100 | Bacteria | 714 |
| 286 | Ga0157373_10782411 | 3300013100 | Bacteria | 703 |
| 287 | Ga0157371_10030600 | 3300013102 | Bacteria | 3883 |
| 288 | Ga0157371_10407929 | 3300013102 | Bacteria | 995 |
| 289 | Ga0157371_10778244 | 3300013102 | Bacteria | 720 |
| 290 | Ga0157370_10000170 | 3300013104 | Bacteria | 80529 |
| 291 | Ga0157370_10006614 | 3300013104 | Bacteria | 12739 |
| 292 | Ga0157370_10010879 | 3300013104 | Bacteria | 9556 |
| 293 | Ga0157370_10012988 | 3300013104 | Bacteria | 8605 |
| 294 | Ga0157370_10017219 | 3300013104 | Bacteria | 7293 |
| 295 | Ga0157370_10030063 | 3300013104 | Bacteria | 5324 |
| 296 | Ga0157370_10090149 | 3300013104 | Bacteria | 2879 |
| 297 | Ga0157370_10210145 | 3300013104 | Bacteria | 1804 |
| 298 | Ga0157370_10608338 | 3300013104 | Bacteria | 1000 |
| 299 | Ga0157370_11601331 | 3300013104 | Bacteria | 585 |
| 300 | Ga0157369_10000085 | 3300013105 | Bacteria | 129025 |
| 301 | Ga0157369_10000430 | 3300013105 | Bacteria | 55736 |
| 302 | Ga0157369_10009218 | 3300013105 | Bacteria | 11289 |
| 303 | Ga0157369_10010533 | 3300013105 | Bacteria | 10523 |
| 304 | Ga0157369_10012659 | 3300013105 | Bacteria | 9566 |
| 305 | Ga0157369_10012685 | 3300013105 | Bacteria | 9557 |
| 306 | Ga0157369_10018737 | 3300013105 | Bacteria | 7760 |
| 307 | Ga0157369_10021889 | 3300013105 | Bacteria | 7146 |
| 308 | Ga0157369_10028989 | 3300013105 | Bacteria | 6121 |
| 309 | Ga0157369_10042189 | 3300013105 | Bacteria | 4977 |
| 310 | Ga0157369_10049457 | 3300013105 | Bacteria | 4558 |
| 311 | Ga0157369_10051486 | 3300013105 | Bacteria | 4456 |
| 312 | Ga0157369_10067688 | 3300013105 | Bacteria | 3838 |
| 313 | Ga0157369_10115554 | 3300013105 | Bacteria | 2850 |
| 314 | Ga0157369_10261492 | 3300013105 | Bacteria | 1805 |
| 315 | Ga0157369_10416121 | 3300013105 | Bacteria | 1394 |
| 316 | Ga0157369_10666779 | 3300013105 | Bacteria | 1072 |
| 317 | Ga0157369_12066327 | 3300013105 | Bacteria | 578 |
| 318 | Ga0157374_10005033 | 3300013296 | Bacteria | 11085 |
| 319 | Ga0157374_10011606 | 3300013296 | Bacteria | 7637 |
| 320 | Ga0157374_10025961 | 3300013296 | Bacteria | 5266 |
| 321 | Ga0157374_10058477 | 3300013296 | Bacteria | 3603 |
| 322 | Ga0157374_10177740 | 3300013296 | Bacteria | 2078 |
| 323 | Ga0157374_10347322 | 3300013296 | Bacteria | 1474 |
| 324 | Ga0157374_10429621 | 3300013296 | Bacteria | 1320 |
| 325 | Ga0157374_10459620 | 3300013296 | Bacteria | 1275 |
| 326 | Ga0157374_10497804 | 3300013296 | Bacteria | 1223 |
| 327 | Ga0157374_10664257 | 3300013296 | Bacteria | 1054 |
| 328 | Ga0157374_10753782 | 3300013296 | Bacteria | 988 |
| 329 | Ga0157374_10850894 | 3300013296 | Bacteria | 929 |
| 330 | Ga0157374_11748663 | 3300013296 | Bacteria | 647 |
| 331 | Ga0157378_10003314 | 3300013297 | Bacteria | 14319 |
| 332 | Ga0157378_10023973 | 3300013297 | Bacteria | 5367 |
| 333 | Ga0157378_10028269 | 3300013297 | Bacteria | 4945 |
| 334 | Ga0157378_10108517 | 3300013297 | Bacteria | 2541 |
| 335 | Ga0157378_10307547 | 3300013297 | Bacteria | 1536 |
| 336 | Ga0157378_10431981 | 3300013297 | Bacteria | 1303 |
| 337 | Ga0157378_11984848 | 3300013297 | Bacteria | 632 |
| 338 | Ga0163162_10027442 | 3300013306 | Bacteria | 5631 |
| 339 | Ga0163162_10084767 | 3300013306 | Bacteria | 3245 |
| 340 | Ga0163162_10209135 | 3300013306 | Bacteria | 2081 |
| 341 | Ga0163162_13191369 | 3300013306 | Unclassified | 526 |
| 342 | Ga0157372_10000217 | 3300013307 | Bacteria | 63667 |
| 343 | Ga0157372_10002601 | 3300013307 | Bacteria | 19543 |
| 344 | Ga0157372_10007271 | 3300013307 | Bacteria | 11791 |
| 345 | Ga0157372_10010870 | 3300013307 | Bacteria | 9688 |
| 346 | Ga0157372_10027828 | 3300013307 | Bacteria | 6161 |
| 347 | Ga0157372_10048038 | 3300013307 | Bacteria | 4744 |
| 348 | Ga0157372_10120685 | 3300013307 | Bacteria | 3010 |
| 349 | Ga0157372_10265383 | 3300013307 | Bacteria | 1994 |
| 350 | Ga0157372_10355994 | 3300013307 | Bacteria | 1705 |
| 351 | Ga0157372_10541137 | 3300013307 | Bacteria | 1358 |
| 352 | Ga0157372_11069037 | 3300013307 | Bacteria | 934 |
| 353 | Ga0157372_11562612 | 3300013307 | Bacteria | 760 |
| 354 | Ga0157372_11585463 | 3300013307 | Bacteria | 754 |
| 355 | Ga0157375_10029487 | 3300013308 | Bacteria | 5161 |
| 356 | Ga0157375_10162945 | 3300013308 | Unclassified | 2373 |
| 357 | Ga0157375_10264835 | 3300013308 | Bacteria | 1880 |
| 358 | Ga0157375_10753952 | 3300013308 | Bacteria | 1125 |
| 359 | Ga0163163_10001161 | 3300014325 | Bacteria | 22403 |
| 360 | Ga0163163_10028784 | 3300014325 | Bacteria | 5340 |
| 361 | Ga0157377_10224766 | 3300014745 | Bacteria | 1204 |
| 362 | Ga0157379_10002312 | 3300014968 | Bacteria | 15882 |
| 363 | Ga0157379_10043255 | 3300014968 | Bacteria | 4021 |
| 364 | Ga0157379_10067424 | 3300014968 | Bacteria | 3199 |
| 365 | Ga0157379_10227617 | 3300014968 | Bacteria | 1690 |
| 366 | Ga0157379_10393819 | 3300014968 | Bacteria | 1272 |
| 367 | Ga0157379_11687805 | 3300014968 | Bacteria | 620 |
| 368 | Ga0157379_12334041 | 3300014968 | Bacteria | 533 |
| 369 | Ga0157376_10004372 | 3300014969 | Bacteria | 9831 |
| 370 | Ga0157376_10061471 | 3300014969 | Bacteria | 3158 |
| 371 | Ga0157376_10134284 | 3300014969 | Unclassified | 2212 |
| 372 | Ga0157376_10240761 | 3300014969 | Bacteria | 1685 |
| 373 | Ga0157376_10318257 | 3300014969 | Bacteria | 1478 |
| 374 | Ga0157376_10955211 | 3300014969 | Bacteria | 878 |
| 375 | Ga0157376_11119609 | 3300014969 | Bacteria | 813 |
| 376 | Ga0157376_11340204 | 3300014969 | Bacteria | 746 |
| 377 | Ga0182006_1055967 | 3300015261 | Bacteria | 1504 |
| 378 | Ga0163161_10492088 | 3300017792 | Bacteria | 997 |
| 379 | Ga0213872_10025009 | 3300021361 | Bacteria | 2746 |
| 380 | Ga0213872_10062353 | 3300021361 | Bacteria | 1685 |
| 381 | Ga0213872_10410650 | 3300021361 | Bacteria | 548 |
| 382 | Ga0213871_10039548 | 3300021441 | Bacteria | 1262 |
| 383 | Ga0224572_1045103 | 3300024225 | Bacteria | 826 |
| 384 | Ga0209233_1005604 | 3300025261 | Bacteria | 4152 |
| 385 | Ga0207656_10001489 | 3300025321 | Bacteria | 7754 |
| 386 | Ga0207656_10008960 | 3300025321 | Unclassified | 3706 |
| 387 | Ga0207656_10011691 | 3300025321 | Bacteria | 3321 |
| 388 | Ga0207656_10109919 | 3300025321 | Bacteria | 1273 |
| 389 | Ga0207656_10199314 | 3300025321 | Bacteria | 966 |
| 390 | Ga0207642_10739637 | 3300025899 | Bacteria | 622 |
| 391 | Ga0207710_10000912 | 3300025900 | Bacteria | 15813 |
| 392 | Ga0207710_10032646 | 3300025900 | Bacteria | 2280 |
| 393 | Ga0207710_10227618 | 3300025900 | Bacteria | 927 |
| 394 | Ga0207710_10449031 | 3300025900 | Bacteria | 665 |
| 395 | Ga0207680_10562814 | 3300025903 | Bacteria | 814 |
| 396 | Ga0207647_10093187 | 3300025904 | Bacteria | 1795 |
| 397 | Ga0207647_10130745 | 3300025904 | Bacteria | 1475 |
| 398 | Ga0207699_10314431 | 3300025906 | Bacteria | 1097 |
| 399 | Ga0207699_11185985 | 3300025906 | Bacteria | 565 |
| 400 | Ga0207645_10075799 | 3300025907 | Bacteria | 2153 |
| 401 | Ga0207705_10000021 | 3300025909 | Bacteria | 309436 |
| 402 | Ga0207705_10002923 | 3300025909 | Bacteria | 13059 |
| 403 | Ga0207705_10019392 | 3300025909 | Bacteria | 4862 |
| 404 | Ga0207705_10031673 | 3300025909 | Bacteria | 3776 |
| 405 | Ga0207705_10032002 | 3300025909 | Bacteria | 3757 |
| 406 | Ga0207705_10091974 | 3300025909 | Bacteria | 2222 |
| 407 | Ga0207705_10157529 | 3300025909 | Bacteria | 1704 |
| 408 | Ga0207705_10301422 | 3300025909 | Bacteria | 1229 |
| 409 | Ga0207705_10644617 | 3300025909 | Bacteria | 824 |
| 410 | Ga0207705_11343888 | 3300025909 | Bacteria | 545 |
| 411 | Ga0207654_10000054 | 3300025911 | Bacteria | 82347 |
| 412 | Ga0207654_10000281 | 3300025911 | Bacteria | 30979 |
| 413 | Ga0207654_10000808 | 3300025911 | Bacteria | 17242 |
| 414 | Ga0207654_10086212 | 3300025911 | Bacteria | 1903 |
| 415 | Ga0207654_10268477 | 3300025911 | Bacteria | 1150 |
| 416 | Ga0207654_10527968 | 3300025911 | Bacteria | 836 |
| 417 | Ga0207654_11084317 | 3300025911 | Bacteria | 583 |
| 418 | Ga0207654_11159358 | 3300025911 | Bacteria | 563 |
| 419 | Ga0207707_10003864 | 3300025912 | Bacteria | 13285 |
| 420 | Ga0207707_10088884 | 3300025912 | Bacteria | 2699 |
| 421 | Ga0207707_10475820 | 3300025912 | Bacteria | 1067 |
| 422 | Ga0207695_10000001 | 3300025913 | Bacteria | 2888630 |
| 423 | Ga0207695_10000080 | 3300025913 | Bacteria | 287868 |
| 424 | Ga0207695_10000113 | 3300025913 | Bacteria | 247240 |
| 425 | Ga0207695_10000167 | 3300025913 | Bacteria | 194371 |
| 426 | Ga0207695_10000263 | 3300025913 | Bacteria | 132894 |
| 427 | Ga0207695_10001106 | 3300025913 | Bacteria | 46871 |
| 428 | Ga0207695_10001762 | 3300025913 | Bacteria | 34278 |
| 429 | Ga0207695_10007109 | 3300025913 | Bacteria | 14340 |
| 430 | Ga0207695_10025431 | 3300025913 | Bacteria | 6627 |
| 431 | Ga0207695_10047228 | 3300025913 | Bacteria | 4558 |
| 432 | Ga0207695_10050757 | 3300025913 | Bacteria | 4361 |
| 433 | Ga0207695_10067630 | 3300025913 | Bacteria | 3664 |
| 434 | Ga0207695_10090899 | 3300025913 | Bacteria | 3067 |
| 435 | Ga0207695_10587824 | 3300025913 | Bacteria | 994 |
| 436 | Ga0207695_10825204 | 3300025913 | Bacteria | 807 |
| 437 | Ga0207671_10000065 | 3300025914 | Bacteria | 166743 |
| 438 | Ga0207671_10000123 | 3300025914 | Bacteria | 119385 |
| 439 | Ga0207671_10000139 | 3300025914 | Bacteria | 111786 |
| 440 | Ga0207671_10037214 | 3300025914 | Bacteria | 3609 |
| 441 | Ga0207671_10093033 | 3300025914 | Bacteria | 2274 |
| 442 | Ga0207671_10101032 | 3300025914 | Bacteria | 2185 |
| 443 | Ga0207671_10285240 | 3300025914 | Bacteria | 1303 |
| 444 | Ga0207671_10314634 | 3300025914 | Bacteria | 1238 |
| 445 | Ga0207671_10544343 | 3300025914 | Bacteria | 925 |
| 446 | Ga0207671_10816103 | 3300025914 | Bacteria | 739 |
| 447 | Ga0207693_10195339 | 3300025915 | Bacteria | 1592 |
| 448 | Ga0207693_11218377 | 3300025915 | Bacteria | 567 |
| 449 | Ga0207663_11063731 | 3300025916 | Bacteria | 650 |
| 450 | Ga0207660_10034872 | 3300025917 | Bacteria | 3490 |
| 451 | Ga0207660_10529731 | 3300025917 | Bacteria | 957 |
| 452 | Ga0207657_10004623 | 3300025919 | Bacteria | 14538 |
| 453 | Ga0207657_10019482 | 3300025919 | Bacteria | 6442 |
| 454 | Ga0207657_10023308 | 3300025919 | Bacteria | 5767 |
| 455 | Ga0207657_10063948 | 3300025919 | Bacteria | 3143 |
| 456 | Ga0207657_10273173 | 3300025919 | Bacteria | 1343 |
| 457 | Ga0207657_10516848 | 3300025919 | Bacteria | 935 |
| 458 | Ga0207657_10584200 | 3300025919 | Bacteria | 872 |
| 459 | Ga0207649_10009868 | 3300025920 | Bacteria | 5233 |
| 460 | Ga0207649_10011442 | 3300025920 | Bacteria | 4893 |
| 461 | Ga0207649_10036761 | 3300025920 | Bacteria | 2952 |
| 462 | Ga0207649_10045929 | 3300025920 | Bacteria | 2680 |
| 463 | Ga0207649_10051713 | 3300025920 | Bacteria | 2545 |
| 464 | Ga0207649_10123143 | 3300025920 | Bacteria | 1751 |
| 465 | Ga0207649_10355185 | 3300025920 | Bacteria | 1086 |
| 466 | Ga0207649_11594458 | 3300025920 | Bacteria | 517 |
| 467 | Ga0207652_10001535 | 3300025921 | Bacteria | 20348 |
| 468 | Ga0207652_10002459 | 3300025921 | Bacteria | 15619 |
| 469 | Ga0207652_10033782 | 3300025921 | Bacteria | 4308 |
| 470 | Ga0207652_10045706 | 3300025921 | Bacteria | 3733 |
| 471 | Ga0207652_10456639 | 3300025921 | Bacteria | 1151 |
| 472 | Ga0207694_10000248 | 3300025924 | Bacteria | 51461 |
| 473 | Ga0207694_10000711 | 3300025924 | Bacteria | 29920 |
| 474 | Ga0207694_10007157 | 3300025924 | Bacteria | 8478 |
| 475 | Ga0207694_10010664 | 3300025924 | Bacteria | 6933 |
| 476 | Ga0207694_10042410 | 3300025924 | Bacteria | 3509 |
| 477 | Ga0207694_10131100 | 3300025924 | Unclassified | 2009 |
| 478 | Ga0207694_10277292 | 3300025924 | Bacteria | 1376 |
| 479 | Ga0207694_10474030 | 3300025924 | Bacteria | 1046 |
| 480 | Ga0207694_10534797 | 3300025924 | Bacteria | 983 |
| 481 | Ga0207694_10924621 | 3300025924 | Bacteria | 738 |
| 482 | Ga0207694_11311516 | 3300025924 | Bacteria | 612 |
| 483 | Ga0207694_11564067 | 3300025924 | Bacteria | 556 |
| 484 | Ga0207694_11849546 | 3300025924 | Bacteria | 507 |
| 485 | Ga0207650_10003582 | 3300025925 | Bacteria | 10655 |
| 486 | Ga0207659_10116300 | 3300025926 | Unclassified | 2042 |
| 487 | Ga0207687_10000978 | 3300025927 | Bacteria | 19404 |
| 488 | Ga0207687_10030621 | 3300025927 | Unclassified | 3629 |
| 489 | Ga0207687_10086790 | 3300025927 | Bacteria | 2273 |
| 490 | Ga0207687_10276493 | 3300025927 | Bacteria | 1344 |
| 491 | Ga0207700_10015711 | 3300025928 | Bacteria | 5005 |
| 492 | Ga0207700_10071880 | 3300025928 | Bacteria | 2665 |
| 493 | Ga0207700_10159411 | 3300025928 | Bacteria | 1873 |
| 494 | Ga0207700_10214980 | 3300025928 | Bacteria | 1627 |
| 495 | Ga0207700_10887044 | 3300025928 | Bacteria | 798 |
| 496 | Ga0207664_10068128 | 3300025929 | Bacteria | 2858 |
| 497 | Ga0207664_10135073 | 3300025929 | Bacteria | 2081 |
| 498 | Ga0207644_10002160 | 3300025931 | Bacteria | 12753 |
| 499 | Ga0207644_10013665 | 3300025931 | Bacteria | 5418 |
| 500 | Ga0207644_10075210 | 3300025931 | Bacteria | 2481 |
| 501 | Ga0207644_10271224 | 3300025931 | Bacteria | 1360 |
| 502 | Ga0207690_10010429 | 3300025932 | Bacteria | 5522 |
| 503 | Ga0207690_10564670 | 3300025932 | Bacteria | 926 |
| 504 | Ga0207706_10064710 | 3300025933 | Unclassified | 3220 |
| 505 | Ga0207665_10584863 | 3300025939 | Bacteria | 870 |
| 506 | Ga0207691_10075960 | 3300025940 | Bacteria | 3028 |
| 507 | Ga0207691_10770386 | 3300025940 | Bacteria | 809 |
| 508 | Ga0207711_10000014 | 3300025941 | Bacteria | 506753 |
| 509 | Ga0207711_10004781 | 3300025941 | Bacteria | 11494 |
| 510 | Ga0207711_10024659 | 3300025941 | Bacteria | 5043 |
| 511 | Ga0207711_10095034 | 3300025941 | Bacteria | 2628 |
| 512 | Ga0207711_10190978 | 3300025941 | Bacteria | 1866 |
| 513 | Ga0207711_10305502 | 3300025941 | Bacteria | 1468 |
| 514 | Ga0207711_10343779 | 3300025941 | Bacteria | 1381 |
| 515 | Ga0207711_10349532 | 3300025941 | Bacteria | 1369 |
| 516 | Ga0207711_11198331 | 3300025941 | Bacteria | 701 |
| 517 | Ga0207711_11646135 | 3300025941 | Bacteria | 585 |
| 518 | Ga0207689_10004019 | 3300025942 | Bacteria | 13370 |
| 519 | Ga0207689_10051194 | 3300025942 | Bacteria | 3404 |
| 520 | Ga0207689_10524464 | 3300025942 | Bacteria | 994 |
| 521 | Ga0207661_10001283 | 3300025944 | Bacteria | 16799 |
| 522 | Ga0207661_10010483 | 3300025944 | Bacteria | 6670 |
| 523 | Ga0207661_10025842 | 3300025944 | Bacteria | 4468 |
| 524 | Ga0207661_10083585 | 3300025944 | Bacteria | 2642 |
| 525 | Ga0207661_10099228 | 3300025944 | Bacteria | 2442 |
| 526 | Ga0207661_10105999 | 3300025944 | Bacteria | 2369 |
| 527 | Ga0207661_10220368 | 3300025944 | Bacteria | 1677 |
| 528 | Ga0207661_10237426 | 3300025944 | Bacteria | 1616 |
| 529 | Ga0207679_10079256 | 3300025945 | Bacteria | 2504 |
| 530 | Ga0207679_10175492 | 3300025945 | Bacteria | 1768 |
| 531 | Ga0207679_10298874 | 3300025945 | Bacteria | 1387 |
| 532 | Ga0207667_10000468 | 3300025949 | Bacteria | 53974 |
| 533 | Ga0207667_10007018 | 3300025949 | Bacteria | 13604 |
| 534 | Ga0207667_10007159 | 3300025949 | Bacteria | 13469 |
| 535 | Ga0207667_10007633 | 3300025949 | Bacteria | 12958 |
| 536 | Ga0207667_10009516 | 3300025949 | Bacteria | 11434 |
| 537 | Ga0207667_10023191 | 3300025949 | Bacteria | 6835 |
| 538 | Ga0207667_10028672 | 3300025949 | Bacteria | 6044 |
| 539 | Ga0207667_10057558 | 3300025949 | Bacteria | 4080 |
| 540 | Ga0207667_10089817 | 3300025949 | Bacteria | 3175 |
| 541 | Ga0207667_10113439 | 3300025949 | Bacteria | 2794 |
| 542 | Ga0207667_10118034 | 3300025949 | Unclassified | 2734 |
| 543 | Ga0207667_10136268 | 3300025949 | Bacteria | 2528 |
| 544 | Ga0207667_10237086 | 3300025949 | Bacteria | 1867 |
| 545 | Ga0207667_10774145 | 3300025949 | Bacteria | 958 |
| 546 | Ga0207712_10040395 | 3300025961 | Bacteria | 3201 |
| 547 | Ga0207712_10879094 | 3300025961 | Bacteria | 791 |
| 548 | Ga0207640_10000028 | 3300025981 | Bacteria | 135727 |
| 549 | Ga0207640_10008642 | 3300025981 | Bacteria | 5661 |
| 550 | Ga0207640_10155415 | 3300025981 | Bacteria | 1685 |
| 551 | Ga0207640_10159963 | 3300025981 | Bacteria | 1665 |
| 552 | Ga0207640_10555853 | 3300025981 | Bacteria | 965 |
| 553 | Ga0207640_10568780 | 3300025981 | Bacteria | 955 |
| 554 | Ga0207640_10722052 | 3300025981 | Bacteria | 856 |
| 555 | Ga0207658_10050436 | 3300025986 | Bacteria | 3062 |
| 556 | Ga0207658_10458795 | 3300025986 | Bacteria | 1129 |
| 557 | Ga0207677_10000143 | 3300026023 | Bacteria | 58337 |
| 558 | Ga0207677_10006547 | 3300026023 | Bacteria | 6395 |
| 559 | Ga0207677_10716717 | 3300026023 | Bacteria | 889 |
| 560 | Ga0207703_10011246 | 3300026035 | Bacteria | 6963 |
| 561 | Ga0207703_10133597 | 3300026035 | Bacteria | 2146 |
| 562 | Ga0207639_10000088 | 3300026041 | Bacteria | 78742 |
| 563 | Ga0207639_10000371 | 3300026041 | Bacteria | 31074 |
| 564 | Ga0207639_10014115 | 3300026041 | Bacteria | 5610 |
| 565 | Ga0207639_10145334 | 3300026041 | Bacteria | 1980 |
| 566 | Ga0207639_10221987 | 3300026041 | Bacteria | 1633 |
| 567 | Ga0207639_10287632 | 3300026041 | Unclassified | 1448 |
| 568 | Ga0207639_10320037 | 3300026041 | Bacteria | 1377 |
| 569 | Ga0207639_10423579 | 3300026041 | Bacteria | 1204 |
| 570 | Ga0207639_10464315 | 3300026041 | Bacteria | 1151 |
| 571 | Ga0207639_10951559 | 3300026041 | Bacteria | 804 |
| 572 | Ga0207678_10006398 | 3300026067 | Bacteria | 10461 |
| 573 | Ga0207678_10015091 | 3300026067 | Bacteria | 6797 |
| 574 | Ga0207678_10015141 | 3300026067 | Bacteria | 6784 |
| 575 | Ga0207678_10036879 | 3300026067 | Bacteria | 4256 |
| 576 | Ga0207678_10231765 | 3300026067 | Bacteria | 1581 |
| 577 | Ga0207702_10004705 | 3300026078 | Bacteria | 12064 |
| 578 | Ga0207702_10005816 | 3300026078 | Bacteria | 10726 |
| 579 | Ga0207702_10036280 | 3300026078 | Bacteria | 4123 |
| 580 | Ga0207702_10085078 | 3300026078 | Bacteria | 2755 |
| 581 | Ga0207702_10095418 | 3300026078 | Bacteria | 2613 |
| 582 | Ga0207702_10258301 | 3300026078 | Bacteria | 1639 |
| 583 | Ga0207702_10401123 | 3300026078 | Bacteria | 1322 |
| 584 | Ga0207702_10866328 | 3300026078 | Bacteria | 894 |
| 585 | Ga0207702_10976553 | 3300026078 | Bacteria | 840 |
| 586 | Ga0207702_11236913 | 3300026078 | Bacteria | 741 |
| 587 | Ga0207702_11534067 | 3300026078 | Bacteria | 660 |
| 588 | Ga0207702_12254025 | 3300026078 | Bacteria | 533 |
| 589 | Ga0207641_10005346 | 3300026088 | Bacteria | 10965 |
| 590 | Ga0207641_10021598 | 3300026088 | Bacteria | 5289 |
| 591 | Ga0207641_10139167 | 3300026088 | Bacteria | 2188 |
| 592 | Ga0207648_11286414 | 3300026089 | Bacteria | 687 |
| 593 | Ga0207676_10002667 | 3300026095 | Bacteria | 12678 |
| 594 | Ga0207676_10125439 | 3300026095 | Bacteria | 2173 |
| 595 | Ga0207674_10000669 | 3300026116 | Bacteria | 44573 |
| 596 | Ga0207674_10012983 | 3300026116 | Bacteria | 9285 |
| 597 | Ga0207674_10120391 | 3300026116 | Bacteria | 2593 |
| 598 | Ga0207674_10328801 | 3300026116 | Bacteria | 1478 |
| 599 | Ga0207674_10525944 | 3300026116 | Bacteria | 1142 |
| 600 | Ga0207674_10557698 | 3300026116 | Bacteria | 1107 |
| 601 | Ga0207683_10028240 | 3300026121 | Bacteria | 4851 |
| 602 | Ga0207683_10364041 | 3300026121 | Bacteria | 1328 |
| 603 | Ga0207698_10000003 | 3300026142 | Bacteria | 321303 |
| 604 | Ga0207698_10000225 | 3300026142 | Bacteria | 35169 |
| 605 | Ga0207698_10003525 | 3300026142 | Bacteria | 9436 |
| 606 | Ga0207698_10007959 | 3300026142 | Bacteria | 6677 |
| 607 | Ga0207698_10045131 | 3300026142 | Bacteria | 3318 |
| 608 | Ga0207698_10132091 | 3300026142 | Bacteria | 2135 |
| 609 | Ga0207698_10165017 | 3300026142 | Bacteria | 1942 |
| 610 | Ga0207698_10417287 | 3300026142 | Bacteria | 1287 |
| 611 | Ga0207698_11190819 | 3300026142 | Bacteria | 776 |
| 612 | Ga0268266_10005265 | 3300028379 | Bacteria | 12146 |
| 613 | Ga0268266_10006399 | 3300028379 | Bacteria | 10792 |
| 614 | Ga0268266_10014122 | 3300028379 | Bacteria | 6876 |
| 615 | Ga0268266_10046731 | 3300028379 | Bacteria | 3706 |
| 616 | Ga0268266_10173024 | 3300028379 | Unclassified | 1961 |
| 617 | Ga0268266_10233875 | 3300028379 | Bacteria | 1693 |
| 618 | Ga0268266_10256469 | 3300028379 | Bacteria | 1619 |
| 619 | Ga0268266_10393919 | 3300028379 | Bacteria | 1308 |
| 620 | Ga0268264_10000598 | 3300028381 | Bacteria | 43640 |
| 621 | Ga0265319_1081737 | 3300028563 | Bacteria | 1026 |
| 622 | Ga0265318_10006364 | 3300028577 | Bacteria | 5448 |
| 623 | Ga0265336_10001048 | 3300028666 | Bacteria | 13512 |
| 624 | Ga0265336_10005708 | 3300028666 | Bacteria | 4561 |
| 625 | Ga0307517_10515974 | 3300028786 | Bacteria | 605 |
| 626 | Ga0265338_10004495 | 3300028800 | Bacteria | 18805 |
| 627 | Ga0265338_10009284 | 3300028800 | Bacteria | 11764 |
| 628 | Ga0265338_10017734 | 3300028800 | Bacteria | 7656 |
| 629 | Ga0265338_10158684 | 3300028800 | Bacteria | 1749 |
| 630 | Ga0265338_10163443 | 3300028800 | Bacteria | 1717 |
| 631 | Ga0265338_10259448 | 3300028800 | Bacteria | 1278 |
| 632 | Ga0265338_10337026 | 3300028800 | Bacteria | 1088 |
| 633 | Ga0265338_10721670 | 3300028800 | Bacteria | 687 |
| 634 | Ga0265324_10137725 | 3300029957 | Bacteria | 829 |
| 635 | Ga0307512_10315872 | 3300030522 | Bacteria | 715 |
| 636 | Ga0265762_1176753 | 3300030760 | Unclassified | 523 |
| 637 | Ga0265770_1105662 | 3300030878 | Unclassified | 578 |
| 638 | Ga0265770_1122170 | 3300030878 | Bacteria | 549 |
| 639 | Ga0265760_10086498 | 3300031090 | Bacteria | 976 |
| 640 | Ga0265760_10141667 | 3300031090 | Bacteria | 783 |
| 641 | Ga0265330_10000273 | 3300031235 | Bacteria | 38107 |
| 642 | Ga0265330_10001219 | 3300031235 | Bacteria | 15180 |
| 643 | Ga0265330_10013742 | 3300031235 | Bacteria | 3767 |
| 644 | Ga0265330_10036360 | 3300031235 | Bacteria | 2196 |
| 645 | Ga0265330_10097036 | 3300031235 | Bacteria | 1263 |
| 646 | Ga0265330_10111823 | 3300031235 | Unclassified | 1166 |
| 647 | Ga0265330_10245175 | 3300031235 | Bacteria | 755 |
| 648 | Ga0265332_10025859 | 3300031238 | Bacteria | 2576 |
| 649 | Ga0265332_10196168 | 3300031238 | Bacteria | 840 |
| 650 | Ga0265328_10007521 | 3300031239 | Bacteria | 4537 |
| 651 | Ga0265328_10015554 | 3300031239 | Bacteria | 2977 |
| 652 | Ga0265328_10024482 | 3300031239 | Bacteria | 2280 |
| 653 | Ga0265320_10003664 | 3300031240 | Bacteria | 10255 |
| 654 | Ga0265320_10084221 | 3300031240 | Bacteria | 1481 |
| 655 | Ga0265320_10249266 | 3300031240 | Bacteria | 788 |
| 656 | Ga0265325_10000266 | 3300031241 | Bacteria | 37071 |
| 657 | Ga0265325_10000695 | 3300031241 | Bacteria | 24506 |
| 658 | Ga0265325_10005858 | 3300031241 | Bacteria | 7531 |
| 659 | Ga0265325_10060625 | 3300031241 | Bacteria | 1921 |
| 660 | Ga0265329_10003354 | 3300031242 | Bacteria | 7004 |
| 661 | Ga0265340_10001072 | 3300031247 | Bacteria | 15563 |
| 662 | Ga0265340_10019622 | 3300031247 | Bacteria | 3481 |
| 663 | Ga0265340_10061429 | 3300031247 | Bacteria | 1797 |
| 664 | Ga0265339_10000114 | 3300031249 | Bacteria | 65609 |
| 665 | Ga0265339_10000124 | 3300031249 | Bacteria | 64124 |
| 666 | Ga0265339_10000194 | 3300031249 | Bacteria | 50375 |
| 667 | Ga0265339_10003213 | 3300031249 | Bacteria | 11471 |
| 668 | Ga0265339_10005214 | 3300031249 | Bacteria | 8693 |
| 669 | Ga0265339_10029804 | 3300031249 | Bacteria | 3093 |
| 670 | Ga0265339_10037617 | 3300031249 | Bacteria | 2704 |
| 671 | Ga0265339_10199047 | 3300031249 | Bacteria | 989 |
| 672 | Ga0265339_10386727 | 3300031249 | Bacteria | 655 |
| 673 | Ga0265331_10046545 | 3300031250 | Bacteria | 2090 |
| 674 | Ga0265331_10094950 | 3300031250 | Bacteria | 1376 |
| 675 | Ga0265331_10429126 | 3300031250 | Bacteria | 593 |
| 676 | Ga0265331_10585898 | 3300031250 | Bacteria | 504 |
| 677 | Ga0265327_10177457 | 3300031251 | Bacteria | 976 |
| 678 | Ga0265316_10000712 | 3300031344 | Bacteria | 36687 |
| 679 | Ga0265316_10003675 | 3300031344 | Bacteria | 15459 |
| 680 | Ga0265316_10008382 | 3300031344 | Bacteria | 9600 |
| 681 | Ga0265316_10022232 | 3300031344 | Bacteria | 5355 |
| 682 | Ga0265316_10027725 | 3300031344 | Bacteria | 4683 |
| 683 | Ga0265316_10048835 | 3300031344 | Bacteria | 3337 |
| 684 | Ga0265316_10054568 | 3300031344 | Bacteria | 3128 |
| 685 | Ga0265316_10169512 | 3300031344 | Bacteria | 1629 |
| 686 | Ga0265316_10190926 | 3300031344 | Bacteria | 1522 |
| 687 | Ga0265316_10192501 | 3300031344 | Bacteria | 1514 |
| 688 | Ga0265316_10351036 | 3300031344 | Bacteria | 1068 |
| 689 | Ga0265313_10013393 | 3300031595 | Bacteria | 4924 |
| 690 | Ga0265313_10016618 | 3300031595 | Bacteria | 4223 |
| 691 | Ga0265313_10018882 | 3300031595 | Bacteria | 3858 |
| 692 | Ga0265313_10019581 | 3300031595 | Bacteria | 3761 |
| 693 | Ga0265313_10028929 | 3300031595 | Bacteria | 2873 |
| 694 | Ga0265314_10000504 | 3300031711 | Bacteria | 50376 |
| 695 | Ga0265314_10002987 | 3300031711 | Bacteria | 16745 |
| 696 | Ga0265314_10046866 | 3300031711 | Bacteria | 3047 |
| 697 | Ga0265314_10080947 | 3300031711 | Bacteria | 2142 |
| 698 | Ga0265314_10160089 | 3300031711 | Bacteria | 1371 |
| 699 | Ga0265314_10288196 | 3300031711 | Bacteria | 926 |
| 700 | Ga0265342_10000225 | 3300031712 | Bacteria | 63822 |
| 701 | Ga0265342_10001536 | 3300031712 | Bacteria | 21355 |
| 702 | Ga0265342_10004360 | 3300031712 | Bacteria | 11190 |
| 703 | Ga0265342_10014131 | 3300031712 | Bacteria | 5311 |
| 704 | Ga0265342_10015276 | 3300031712 | Bacteria | 5056 |
| 705 | Ga0265342_10042663 | 3300031712 | Bacteria | 2740 |
| 706 | Ga0265342_10113795 | 3300031712 | Unclassified | 1529 |
| 707 | Ga0265342_10173752 | 3300031712 | Bacteria | 1183 |
| 708 | Ga0316583_10181098 | 3300032133 | Bacteria | 733 |
| 709 | Ga0307510_10010774 | 3300033180 | Bacteria | 10874 |
| 710 | Ga0307510_10071804 | 3300033180 | Bacteria | 3444 |
| 711 | Ga0307510_10220392 | 3300033180 | Bacteria | 1409 |
| 712 | Ga0373923_0266985 | 3300035111 | Bacteria | 804 |
| 713 | Ga0373936_0187261 | 3300035113 | Bacteria | 910 |
| 714 | Ga0373943_0018586 | 3300035170 | Bacteria | 3195 |
| 715 | Ga0373935_0251905 | 3300035692 | Bacteria | 1236 |
| 716 | Ga0373927_0683844 | 3300035695 | Bacteria | 678 |
| 717 | Ga0373933_0634675 | 3300035724 | Bacteria | 702 |
| 718 | Ga0373947_0036325 | 3300035725 | Bacteria | 2922 |
| 719 | Ga0373937_0138090 | 3300036401 | Bacteria | 2280 |
| 720 | Ga0373937_0510221 | 3300036401 | Bacteria | 1142 |
| 721 | Ga0373937_1742955 | 3300036401 | Bacteria | 570 |
| 722 | Ga0395900_0849267 | 3300037418 | Unclassified | 839 |
| 723 | Ga0395900_1361652 | 3300037418 | Bacteria | 623 |
| 724 | Ga0395901_0583687 | 3300038443 | Bacteria | 1129 |
| 725 | Ga0436360_0170154 | 3300039438 | Bacteria | 4187 |
| 726 | Ga0436360_0361712 | 3300039438 | Bacteria | 4177 |
| 727 | Ga0436360_0826850 | 3300039438 | Bacteria | 741 |
| 728 | Ga0436360_0871656 | 3300039438 | Bacteria | 935 |
| 729 | Ga0436360_1008743 | 3300039438 | Bacteria | 877 |
| 730 | Ga0436360_1308109 | 3300039438 | Bacteria | 562 |
| 731 | Ga0436361_0226605 | 3300039447 | Bacteria | 1330 |
| 732 | Ga0436361_0318263 | 3300039447 | Bacteria | 10520 |
| 733 | Ga0436361_0526984 | 3300039447 | Bacteria | 4268 |
| 734 | Ga0436361_0585232 | 3300039447 | Bacteria | 1108 |
| 735 | Ga0436361_0757992 | 3300039447 | Bacteria | 2636 |
| 736 | Ga0436361_0776284 | 3300039447 | Bacteria | 1039 |
| 737 | Ga0436363_0701240 | 3300039450 | Bacteria | 842 |
| 738 | Ga0451839_0265344 | 3300041496 | Bacteria | 530 |
| 739 | Ga0451839_0397595 | 3300041496 | Bacteria | 533 |
| 740 | Ga0439448_0148476 | 3300042005 | Bacteria | 813 |
| 741 | Ga0451577_0979553 | 3300042876 | Bacteria | 760 |
| 742 | Ga0466969_0299729 | 3300044656 | Bacteria | 727 |
| 743 | Ga0466969_0533994 | 3300044656 | Bacteria | 536 |
| 744 | Ga0453683_0515345 | 3300044673 | Bacteria | 777 |
| 745 | Ga0466966_0043334 | 3300044684 | Bacteria | 2885 |
| 746 | Ga0466966_0201614 | 3300044684 | Bacteria | 1204 |
| 747 | Ga0466961_0062967 | 3300044693 | Bacteria | 2357 |
| 748 | Ga0466961_0372195 | 3300044693 | Bacteria | 868 |
| 749 | Ga0466961_0499937 | 3300044693 | Bacteria | 734 |
| 750 | Ga0466963_0000494 | 3300044694 | Bacteria | 18341 |
| 751 | Ga0466963_0732759 | 3300044694 | Bacteria | 697 |
| 752 | Ga0466957_0445001 | 3300044842 | Bacteria | 892 |
| 753 | Ga0466957_0972147 | 3300044842 | Bacteria | 609 |
| 754 | Ga0466959_0159618 | 3300045049 | Bacteria | 1586 |
| 755 | Ga0466959_0254613 | 3300045049 | Bacteria | 1210 |
| 756 | Ga0466959_1198274 | 3300045049 | Bacteria | 505 |
| 757 | Ga0466958_0372077 | 3300045836 | Bacteria | 921 |
| 758 | Ga0466967_0001401 | 3300045976 | Bacteria | 13938 |
| 759 | Ga0466967_0226226 | 3300045976 | Bacteria | 1780 |
| 760 | Ga0466967_0433944 | 3300045976 | Unclassified | 1282 |
| 761 | Ga0466967_0549800 | 3300045976 | Bacteria | 1136 |
| 762 | Ga0495617_242766 | 3300046452 | Bacteria | 556 |
| 763 | Ga0495592_0170605 | 3300046454 | Bacteria | 1490 |
| 764 | Ga0495592_0361325 | 3300046454 | Bacteria | 928 |
| 765 | Ga0495592_0378286 | 3300046454 | Bacteria | 902 |
| 766 | Ga0495603_0111033 | 3300046455 | Bacteria | 1599 |
| 767 | Ga0495603_0122471 | 3300046455 | Bacteria | 1515 |
| 768 | Ga0495629_0018026 | 3300046459 | Bacteria | 5060 |
| 769 | Ga0495638_0447890 | 3300046460 | Bacteria | 660 |
| 770 | Ga0495651_0015018 | 3300046462 | Bacteria | 5985 |
| 771 | Ga0495651_0031839 | 3300046462 | Bacteria | 4112 |
| 772 | Ga0495653_0010749 | 3300046463 | Bacteria | 7495 |
| 773 | Ga0495650_0000038 | 3300046471 | Bacteria | 377530 |
| 774 | Ga0495650_0008733 | 3300046471 | Bacteria | 5865 |
| 775 | Ga0495580_0097351 | 3300046472 | Bacteria | 2046 |
| 776 | Ga0495582_0049065 | 3300046473 | Bacteria | 2325 |
| 777 | Ga0495639_0001675 | 3300046475 | Bacteria | 9836 |
| 778 | Ga0495662_0005660 | 3300046476 | Bacteria | 6246 |
| 779 | Ga0495664_0001348 | 3300046477 | Bacteria | 12929 |
| 780 | Ga0495664_0028071 | 3300046477 | Bacteria | 3285 |
| 781 | Ga0495664_0045809 | 3300046477 | Bacteria | 2594 |
| 782 | Ga0495664_0209206 | 3300046477 | Bacteria | 1181 |
| 783 | Ga0495585_0016774 | 3300046492 | Bacteria | 4243 |
| 784 | Ga0495594_0000388 | 3300046499 | Bacteria | 22139 |
| 785 | Ga0495594_0001190 | 3300046499 | Bacteria | 13614 |
| 786 | Ga0495594_0881111 | 3300046499 | Bacteria | 503 |
| 787 | Ga0495583_0013317 | 3300046506 | Bacteria | 4593 |
| 788 | Ga0495583_0033314 | 3300046506 | Bacteria | 2478 |
| 789 | Ga0495606_0077834 | 3300046507 | Bacteria | 2070 |
| 790 | Ga0495606_0095370 | 3300046507 | Bacteria | 1822 |
| 791 | Ga0495606_0162623 | 3300046507 | Bacteria | 1301 |
| 792 | Ga0495606_0216104 | 3300046507 | Bacteria | 1083 |
| 793 | Ga0495628_0007402 | 3300046516 | Bacteria | 9504 |
| 794 | Ga0495628_0011061 | 3300046516 | Bacteria | 7637 |
| 795 | Ga0495628_0694799 | 3300046516 | Bacteria | 719 |
| 796 | Ga0495630_0264458 | 3300046517 | Bacteria | 1314 |
| 797 | Ga0495631_0051109 | 3300046518 | Bacteria | 1807 |
| 798 | Ga0495631_0241780 | 3300046518 | Bacteria | 770 |
| 799 | Ga0495632_0301110 | 3300046519 | Bacteria | 711 |
| 800 | Ga0495644_0000048 | 3300046523 | Bacteria | 57696 |
| 801 | Ga0495648_0167762 | 3300046524 | Bacteria | 1128 |
| 802 | Ga0495648_0207165 | 3300046524 | Bacteria | 977 |
| 803 | Ga0495666_0001196 | 3300046526 | Bacteria | 12524 |
| 804 | Ga0495642_0009023 | 3300046528 | Bacteria | 3816 |
| 805 | Ga0495642_0389701 | 3300046528 | Bacteria | 614 |
| 806 | Ga0495652_0009907 | 3300046529 | Bacteria | 8641 |
| 807 | Ga0495652_0039259 | 3300046529 | Bacteria | 4093 |
| 808 | Ga0495652_0448030 | 3300046529 | Bacteria | 904 |
| 809 | Ga0495652_0620027 | 3300046529 | Bacteria | 736 |
| 810 | Ga0495665_0001828 | 3300046531 | Bacteria | 11486 |
| 811 | Ga0495665_0321308 | 3300046531 | Bacteria | 790 |
| 812 | Ga0495640_0060924 | 3300046533 | Bacteria | 2565 |
| 813 | Ga0495640_0096637 | 3300046533 | Bacteria | 1943 |
| 814 | Ga0495586_0163121 | 3300046535 | Bacteria | 1257 |
| 815 | Ga0495586_0521142 | 3300046535 | Bacteria | 686 |
| 816 | Ga0495587_0008155 | 3300046536 | Bacteria | 6753 |
| 817 | Ga0495609_0036518 | 3300046538 | Bacteria | 2218 |
| 818 | Ga0495609_0180783 | 3300046538 | Bacteria | 888 |
| 819 | Ga0495609_0326845 | 3300046538 | Bacteria | 621 |
| 820 | Ga0495645_0001770 | 3300046543 | Bacteria | 14694 |
| 821 | Ga0495645_0005517 | 3300046543 | Bacteria | 8694 |
| 822 | Ga0495645_0007804 | 3300046543 | Bacteria | 7444 |
| 823 | Ga0495645_0022284 | 3300046543 | Bacteria | 4582 |
| 824 | Ga0495667_0084571 | 3300046559 | Bacteria | 2059 |
| 825 | Ga0495667_0374459 | 3300046559 | Bacteria | 898 |
| 826 | Ga0495668_0044535 | 3300046616 | Bacteria | 2466 |
| 827 | Ga0495668_0514669 | 3300046616 | Bacteria | 660 |
| 828 | Ga0495634_0006225 | 3300046642 | Bacteria | 9093 |
| 829 | Ga0495611_0383414 | 3300046648 | Bacteria | 643 |
| 830 | Ga0495625_0000985 | 3300046660 | Bacteria | 37750 |
| 831 | Ga0495625_0007833 | 3300046660 | Bacteria | 9208 |
| 832 | Ga0495625_0019175 | 3300046660 | Bacteria | 5316 |
| 833 | Ga0495625_0045052 | 3300046660 | Bacteria | 3191 |
| 834 | Ga0495625_0511048 | 3300046660 | Bacteria | 733 |
| 835 | Ga0495635_0002836 | 3300046663 | Bacteria | 11904 |
| 836 | Ga0495635_0086686 | 3300046663 | Bacteria | 2142 |
| 837 | Ga0495635_0470186 | 3300046663 | Bacteria | 830 |
| 838 | Ga0495659_0066790 | 3300046664 | Bacteria | 1340 |
| 839 | Ga0495588_0028867 | 3300046674 | Bacteria | 2780 |
| 840 | Ga0495657_0467111 | 3300046675 | Bacteria | 738 |
| 841 | Ga0495599_0017587 | 3300046678 | Bacteria | 4445 |
| 842 | Ga0495599_0051590 | 3300046678 | Bacteria | 2577 |
| 843 | Ga0495599_0605156 | 3300046678 | Bacteria | 638 |
| 844 | Ga0495623_0050948 | 3300046679 | Bacteria | 2621 |
| 845 | Ga0495623_0056771 | 3300046679 | Bacteria | 2464 |
| 846 | Ga0495623_0058009 | 3300046679 | Bacteria | 2435 |
| 847 | Ga0495623_0082244 | 3300046679 | Bacteria | 1990 |
| 848 | Ga0495646_0077284 | 3300046680 | Bacteria | 1947 |
| 849 | Ga0495646_0124321 | 3300046680 | Bacteria | 1457 |
| 850 | Ga0495646_0346219 | 3300046680 | Bacteria | 779 |
| 851 | Ga0495646_0450865 | 3300046680 | Bacteria | 664 |
| 852 | Ga0495646_0542208 | 3300046680 | Bacteria | 594 |
| 853 | Ga0495669_0004252 | 3300046684 | Bacteria | 5901 |
| 854 | Ga0495613_0003966 | 3300046689 | Bacteria | 11081 |
| 855 | Ga0495613_0012222 | 3300046689 | Bacteria | 6380 |
| 856 | Ga0495624_0007524 | 3300046690 | Bacteria | 7641 |
| 857 | Ga0495670_0038859 | 3300046691 | Bacteria | 2373 |
| 858 | Ga0495671_0153236 | 3300046692 | Bacteria | 1122 |
| 859 | Ga0495671_0493283 | 3300046692 | Bacteria | 584 |
| 860 | Ga0495649_0064738 | 3300046694 | Bacteria | 1963 |
| 861 | Ga0495649_0490026 | 3300046694 | Bacteria | 612 |
| 862 | Ga0495600_0002909 | 3300046809 | Bacteria | 9975 |
| 863 | Ga0495600_0302730 | 3300046809 | Bacteria | 1008 |
| 864 | Ga0495581_0050879 | 3300047315 | Bacteria | 2393 |
| 865 | Ga0495581_0245692 | 3300047315 | Bacteria | 1046 |
| 866 | Ga0495581_0366883 | 3300047315 | Bacteria | 840 |
| 867 | Ga0495581_0885072 | 3300047315 | Bacteria | 510 |
| 868 | Ga0495604_0002834 | 3300047317 | Bacteria | 13912 |
| 869 | Ga0495604_0015522 | 3300047317 | Bacteria | 6079 |
| 870 | Ga0495604_0069051 | 3300047317 | Bacteria | 2679 |
| 871 | Ga0495636_0056644 | 3300047318 | Bacteria | 1651 |
| 872 | Ga0495674_0014334 | 3300047319 | Bacteria | 7423 |
| 873 | Ga0495674_0152317 | 3300047319 | Bacteria | 1938 |
| 874 | Ga0495674_0539358 | 3300047319 | Unclassified | 930 |
| 875 | Ga0495672_0030990 | 3300047320 | Bacteria | 3344 |
| 876 | Ga0495676_0008961 | 3300047321 | Bacteria | 9134 |
| 877 | Ga0495676_0114867 | 3300047321 | Bacteria | 1969 |
| 878 | Ga0495680_0076425 | 3300047322 | Bacteria | 2539 |
| 879 | Ga0495675_0003222 | 3300047444 | Bacteria | 9816 |
| 880 | Ga0495675_0012790 | 3300047444 | Bacteria | 5286 |
| 881 | Ga0495677_0020984 | 3300047445 | Bacteria | 2368 |
| 882 | Ga0495673_0072246 | 3300047469 | Bacteria | 1449 |
| 883 | Ga0495684_0049723 | 3300047471 | Bacteria | 3203 |
| 884 | Ga0495684_0101338 | 3300047471 | Bacteria | 2177 |
| 885 | Ga0495686_0004566 | 3300047472 | Bacteria | 11335 |
| 886 | Ga0495686_0008419 | 3300047472 | Bacteria | 7568 |
| 887 | Ga0495686_0012438 | 3300047472 | Bacteria | 5951 |
| 888 | Ga0495686_0014007 | 3300047472 | Bacteria | 5541 |
| 889 | Ga0495686_0044764 | 3300047472 | Bacteria | 2801 |
| 890 | Ga0495686_0067112 | 3300047472 | Bacteria | 2215 |
| 891 | Ga0495686_0187235 | 3300047472 | Bacteria | 1195 |
| 892 | Ga0495593_0019638 | 3300047673 | Bacteria | 3788 |
| 893 | Ga0495593_0040852 | 3300047673 | Bacteria | 2496 |
| 894 | Ga0495602_0773591 | 3300048088 | Bacteria | 646 |
| 895 | Ga0495614_0000972 | 3300048089 | Bacteria | 12208 |
| 896 | Ga0496100_0575375 | 3300048903 | Bacteria | 873 |
| 897 | Ga0496100_1034106 | 3300048903 | Bacteria | 647 |
| 898 | Ga0496101_0659155 | 3300048904 | Bacteria | 827 |
| 899 | Ga0496102_0777646 | 3300048905 | Bacteria | 880 |
| 900 | Ga0496103_0741566 | 3300048906 | Bacteria | 621 |
| 901 | Ga0496104_0000053 | 3300048907 | Bacteria | 135895 |
| 902 | Ga0496104_0057613 | 3300048907 | Bacteria | 3676 |
| 903 | Ga0496104_0875113 | 3300048907 | Bacteria | 804 |
| 904 | Ga0496108_0111209 | 3300048911 | Bacteria | 2343 |
| 905 | Ga0496112_0165026 | 3300048915 | Bacteria | 2181 |
| 906 | Ga0496114_0096351 | 3300048917 | Bacteria | 2519 |
| 907 | Ga0496115_0202171 | 3300048918 | Bacteria | 1641 |
| 908 | Ga0496115_0301250 | 3300048918 | Bacteria | 1313 |
| 909 | Ga0496120_0134276 | 3300048923 | Bacteria | 1264 |
| 910 | Ga0496120_0260024 | 3300048923 | Bacteria | 811 |
| 911 | Ga0496121_0492821 | 3300048924 | Bacteria | 780 |
| 912 | Ga0496126_0000014 | 3300048929 | Bacteria | 686881 |
| 913 | Ga0496126_0000154 | 3300048929 | Bacteria | 159983 |
| 914 | Ga0496126_0739092 | 3300048929 | Bacteria | 761 |
| 915 | Ga0496126_1287352 | 3300048929 | Unclassified | 533 |
| 916 | Ga0495682_0041693 | 3300049460 | Bacteria | 1682 |
| 917 | Ga0501031_0027688 | 3300049568 | Bacteria | 3695 |
| 918 | Ga0501032_0001912 | 3300049569 | Bacteria | 16446 |
| 919 | Ga0501033_0010946 | 3300049570 | Bacteria | 6952 |
| 920 | Ga0501033_0045842 | 3300049570 | Bacteria | 3253 |
| 921 | Ga0501034_0014111 | 3300049571 | Bacteria | 8232 |
| 922 | Ga0501037_0025359 | 3300049573 | Bacteria | 4381 |
| 923 | Ga0501037_0471859 | 3300049573 | Bacteria | 854 |
| 924 | Ga0501038_0033174 | 3300049574 | Bacteria | 4548 |
| 925 | Ga0501038_0098016 | 3300049574 | Bacteria | 2445 |
| 926 | Ga0501038_0110075 | 3300049574 | Bacteria | 2283 |
| 927 | Ga0501039_0154809 | 3300049575 | Bacteria | 1801 |
| 928 | Ga0501043_0057147 | 3300049579 | Bacteria | 3064 |
| 929 | Ga0501046_0000056 | 3300049580 | Bacteria | 129342 |
| 930 | Ga0501047_0008947 | 3300049581 | Bacteria | 9454 |
| 931 | Ga0501047_0017729 | 3300049581 | Bacteria | 6821 |
| 932 | Ga0501070_0124247 | 3300049586 | Bacteria | 2133 |
| 933 | Ga0501070_0254155 | 3300049586 | Bacteria | 1437 |
| 934 | Ga0501073_0008329 | 3300049589 | Bacteria | 7690 |
| 935 | Ga0501073_1108370 | 3300049589 | Bacteria | 544 |
| 936 | Ga0501074_0524312 | 3300049590 | Bacteria | 839 |
| 937 | Ga0501079_0275238 | 3300049741 | Bacteria | 1316 |
| 938 | Ga0501080_0310054 | 3300049742 | Bacteria | 1430 |
| 939 | Ga0501080_0960686 | 3300049742 | Bacteria | 743 |
| 940 | Ga0501035_0086954 | 3300049822 | Bacteria | 2754 |
| 941 | Ga0501035_0350448 | 3300049822 | Bacteria | 1235 |
| 942 | Ga0501044_0171643 | 3300049823 | Bacteria | 2140 |
| 943 | Ga0501044_0184233 | 3300049823 | Bacteria | 2053 |
| 944 | nmdc:mga08x19_161497_c1 | 3300050514 | Bacteria | 1522 |
| 945 | nmdc:mga08x19_164936_c1 | 3300050514 | Bacteria | 1506 |
| 946 | nmdc:mga08x19_30704_c1 | 3300050514 | Bacteria | 3377 |
| 947 | Ga0495612_0308136 | 3300053078 | Bacteria | 711 |
| 948 | Ga0500643_028144 | 3300053087 | Bacteria | 1740 |
| 949 | Ga0500644_0156516 | 3300053088 | Bacteria | 918 |
| 950 | Ga0500651_0000005 | 3300053093 | Bacteria | 384761 |
| 951 | Ga0500595_000004 | 3300053119 | Bacteria | 410922 |
| 952 | Ga0500595_013665 | 3300053119 | Bacteria | 3105 |
| 953 | Ga0500595_016226 | 3300053119 | Bacteria | 2778 |
| 954 | Ga0500661_001216 | 3300055283 | Bacteria | 4809 |
| 955 | 2884217794 | 2884215851 | Bacteria | 4554841 |
| 956 | Ga0068855_100248258 | |||
| 957 | LJNas_1006912 | |||
| 958 | JGI24743J22301_10071283 | |||
| 959 | rootH2_10171401 | |||
| 960 | rootH1_10203955 | |||
| 961 | Ga0070658_10000121 | |||
| 962 | Ga0070658_10013505 | |||
| 963 | Ga0070658_10037114 | |||
| 964 | Ga0070658_10038584 | |||
| 965 | Ga0070658_10049430 | |||
| 966 | Ga0070658_10134937 | |||
| 967 | Ga0070658_10150612 | |||
| 968 | Ga0070658_10341705 | |||
| 969 | Ga0070658_10429461 | |||
| 970 | Ga0070658_10921455 | |||
| 971 | Ga0070676_10229857 | |||
| 972 | Ga0070683_100002041 | |||
| 973 | Ga0070683_100015021 | |||
| 974 | Ga0070683_100015398 | |||
| 975 | Ga0070683_100028772 | |||
| 976 | Ga0070683_100135740 | |||
| 977 | Ga0070683_100183443 | |||
| 978 | Ga0070683_100779235 | |||
| 979 | Ga0070683_100898533 | |||
| 980 | Ga0070670_100005099 | |||
| 981 | Ga0068869_100002456 | |||
| 982 | Ga0068869_100503734 | |||
| 983 | Ga0070666_10071003 | |||
| 984 | Ga0070666_10285534 | |||
| 985 | Ga0070680_100007018 | |||
| 986 | Ga0070680_100032000 | |||
| 987 | Ga0070682_100345088 | |||
| 988 | Ga0068868_100000066 | |||
| 989 | Ga0068868_100030705 | |||
| 990 | Ga0068868_100202417 | |||
| 991 | Ga0068868_100251736 | |||
| 992 | Ga0068868_100955371 | |||
| 993 | Ga0070660_100008313 | |||
| 994 | Ga0070660_100185531 | |||
| 995 | Ga0070660_101936061 | |||
| 996 | Ga0070691_10410588 | |||
| 997 | Ga0070691_10820556 | |||
| 998 | Ga0070661_100016527 | |||
| 999 | Ga0070661_100018919 | |||
| 1000 | Ga0070661_100111867 | |||
| 1001 | Ga0070661_100112059 | |||
| 1002 | Ga0070661_100198292 | |||
| 1003 | Ga0070661_100230310 | |||
| 1004 | Ga0070661_100542850 | |||
| 1005 | Ga0070661_100838680 | |||
| 1006 | Ga0070661_101035467 | |||
| 1007 | Ga0070661_101631218 | |||
| 1008 | Ga0070692_10972062 | |||
| 1009 | Ga0070668_100215320 | |||
| 1010 | Ga0070669_101089400 | |||
| 1011 | Ga0070671_100000411 | |||
| 1012 | Ga0070671_100003123 | |||
| 1013 | Ga0070671_100027039 | |||
| 1014 | Ga0070674_100431124 | |||
| 1015 | Ga0070659_100004580 | |||
| 1016 | Ga0070659_100030029 | |||
| 1017 | Ga0070667_100002645 | |||
| 1018 | Ga0070709_10949888 | |||
| 1019 | Ga0070709_11714150 | |||
| 1020 | Ga0070714_100002654 | |||
| 1021 | Ga0070714_100099406 | |||
| 1022 | Ga0070713_100033702 | |||
| 1023 | Ga0070713_100095055 | |||
| 1024 | Ga0070713_100306613 | |||
| 1025 | Ga0070713_100374302 | |||
| 1026 | Ga0070713_100423960 | |||
| 1027 | Ga0070713_100980652 | |||
| 1028 | Ga0070713_101505149 | |||
| 1029 | Ga0070710_10226393 | |||
| 1030 | Ga0070711_100316224 | |||
| 1031 | Ga0070711_100547276 | |||
| 1032 | Ga0070711_100733469 | |||
| 1033 | Ga0070663_100019192 | |||
| 1034 | Ga0070663_100019345 | |||
| 1035 | Ga0070663_100070653 | |||
| 1036 | Ga0070663_100143609 | |||
| 1037 | Ga0070678_100854730 | |||
| 1038 | Ga0070678_101766683 | |||
| 1039 | Ga0070681_10001050 | |||
| 1040 | Ga0070681_10053249 | |||
| 1041 | Ga0070681_10103095 | |||
| 1042 | Ga0070681_10215158 | |||
| 1043 | Ga0070679_100000968 | |||
| 1044 | Ga0070679_100003993 | |||
| 1045 | Ga0070679_100006128 | |||
| 1046 | Ga0070679_100057253 | |||
| 1047 | Ga0070679_101944246 | |||
| 1048 | Ga0070684_100016109 | |||
| 1049 | Ga0070684_100054432 | |||
| 1050 | Ga0070684_100184604 | |||
| 1051 | Ga0070684_100200183 | |||
| 1052 | Ga0070684_100610250 | |||
| 1053 | Ga0070684_100782645 | |||
| 1054 | Ga0068853_100000222 | |||
| 1055 | Ga0068853_100000367 | |||
| 1056 | Ga0068853_100078090 | |||
| 1057 | Ga0068853_100178099 | |||
| 1058 | Ga0068853_100241876 | |||
| 1059 | Ga0068853_100371177 | |||
| 1060 | Ga0068853_100582516 | |||
| 1061 | Ga0068853_101323874 | |||
| 1062 | Ga0068853_101482488 | |||
| 1063 | Ga0070672_100006275 | |||
| 1064 | Ga0070672_100519923 | |||
| 1065 | Ga0070693_101636169 | |||
| 1066 | Ga0070665_100044594 | |||
| 1067 | Ga0070665_100230859 | |||
| 1068 | Ga0070665_100296619 | |||
| 1069 | Ga0070665_100431607 | |||
| 1070 | Ga0070665_100538074 | |||
| 1071 | Ga0070665_101341878 | |||
| 1072 | Ga0068855_100000277 | |||
| 1073 | Ga0068855_100002688 | |||
| 1074 | Ga0068855_100003653 | |||
| 1075 | Ga0068855_100010384 | |||
| 1076 | Ga0068855_100012571 | |||
| 1077 | Ga0068855_100022187 | |||
| 1078 | Ga0068855_100036038 | |||
| 1079 | Ga0068855_100057885 | |||
| 1080 | Ga0068855_100135969 | |||
| 1081 | Ga0068855_100348240 | |||
| 1082 | Ga0068855_100366863 | |||
| 1083 | Ga0068855_100400348 | |||
| 1084 | Ga0068855_100442404 | |||
| 1085 | Ga0068855_100967794 | |||
| 1086 | Ga0068855_101161343 | |||
| 1087 | Ga0070664_100127912 | |||
| 1088 | Ga0070664_100167202 | |||
| 1089 | Ga0070664_100598772 | |||
| 1090 | Ga0070664_102051637 | |||
| 1091 | Ga0068857_100013234 | |||
| 1092 | Ga0068857_100015817 | |||
| 1093 | Ga0068857_100016334 | |||
| 1094 | Ga0068857_100120350 | |||
| 1095 | Ga0068857_100202072 | |||
| 1096 | Ga0068857_100373500 | |||
| 1097 | Ga0068854_100000019 | |||
| 1098 | Ga0068854_100008770 | |||
| 1099 | Ga0068854_100042728 | |||
| 1100 | Ga0068854_100311570 | |||
| 1101 | Ga0068854_100422016 | |||
| 1102 | Ga0068856_100003529 | |||
| 1103 | Ga0068856_100006467 | |||
| 1104 | Ga0068856_100019915 | |||
| 1105 | Ga0068856_100028379 | |||
| 1106 | Ga0068856_100037527 | |||
| 1107 | Ga0068856_100054362 | |||
| 1108 | Ga0068856_100258107 | |||
| 1109 | Ga0068856_100702563 | |||
| 1110 | Ga0068856_102227158 | |||
| 1111 | Ga0068852_100000019 | |||
| 1112 | Ga0068852_100000097 | |||
| 1113 | Ga0068852_100001535 | |||
| 1114 | Ga0068852_100006965 | |||
| 1115 | Ga0068852_100015924 | |||
| 1116 | Ga0068852_100027564 | |||
| 1117 | Ga0068852_100050084 | |||
| 1118 | Ga0068852_100059108 | |||
| 1119 | Ga0068852_100213509 | |||
| 1120 | Ga0068852_100241388 | |||
| 1121 | Ga0068852_100471619 | |||
| 1122 | Ga0068859_100006530 | |||
| 1123 | Ga0068864_100002762 | |||
| 1124 | Ga0068864_100012167 | |||
| 1125 | Ga0068864_102329345 | |||
| 1126 | Ga0068866_10437894 | |||
| 1127 | Ga0068851_10001766 | |||
| 1128 | Ga0068851_10010381 | |||
| 1129 | Ga0068851_10083174 | |||
| 1130 | Ga0068851_10139420 | |||
| 1131 | Ga0068863_100001753 | |||
| 1132 | Ga0068863_100001814 | |||
| 1133 | Ga0068863_100120289 | |||
| 1134 | Ga0068858_100003316 | |||
| 1135 | Ga0068858_100015914 | |||
| 1136 | Ga0068858_100278903 | |||
| 1137 | Ga0068860_100000689 | |||
| 1138 | Ga0070717_10011904 | |||
| 1139 | Ga0070717_10481961 | |||
| 1140 | Ga0070717_10830751 | |||
| 1141 | Ga0070716_100189133 | |||
| 1142 | Ga0070716_100341836 | |||
| 1143 | Ga0070712_100122617 | |||
| 1144 | Ga0070712_101271073 | |||
| 1145 | Ga0070712_101995940 | |||
| 1146 | Ga0097621_100000349 | |||
| 1147 | Ga0097621_100048467 | |||
| 1148 | Ga0097621_100165375 | |||
| 1149 | Ga0068871_100035557 | |||
| 1150 | Ga0068871_100675555 | |||
| 1151 | Ga0068865_100268881 | |||
| 1152 | Ga0075436_100198902 | |||
| 1153 | Ga0097620_100006530 | |||
| 1154 | Ga0099794_10444218 | |||
| 1155 | Ga0105240_10000001 | |||
| 1156 | Ga0105240_10000372 | |||
| 1157 | Ga0105240_10000496 | |||
| 1158 | Ga0105240_10001875 | |||
| 1159 | Ga0105240_10003485 | |||
| 1160 | Ga0105240_10010838 | |||
| 1161 | Ga0105240_10033184 | |||
| 1162 | Ga0105240_10034761 | |||
| 1163 | Ga0105240_10057886 | |||
| 1164 | Ga0105240_10060708 | |||
| 1165 | Ga0105240_10122963 | |||
| 1166 | Ga0105240_10234142 | |||
| 1167 | Ga0105240_10393531 | |||
| 1168 | Ga0105240_10395370 | |||
| 1169 | Ga0105240_10425874 | |||
| 1170 | Ga0105240_10714988 | |||
| 1171 | Ga0105240_10898876 | |||
| 1172 | Ga0105240_11331624 | |||
| 1173 | Ga0105240_11656657 | |||
| 1174 | Ga0105245_10000486 | |||
| 1175 | Ga0105245_10146696 | |||
| 1176 | Ga0105245_10271912 | |||
| 1177 | Ga0105245_10417255 | |||
| 1178 | Ga0105245_11363681 | |||
| 1179 | Ga0105245_12015127 | |||
| 1180 | Ga0105247_10004009 | |||
| 1181 | Ga0105247_10012271 | |||
| 1182 | Ga0105247_10299210 | |||
| 1183 | Ga0105241_10000026 | |||
| 1184 | Ga0105241_10000121 | |||
| 1185 | Ga0105241_10002032 | |||
| 1186 | Ga0105241_10006994 | |||
| 1187 | Ga0105241_10043980 | |||
| 1188 | Ga0105241_10449796 | |||
| 1189 | Ga0105241_10454102 | |||
| 1190 | Ga0105241_10539986 | |||
| 1191 | Ga0105241_10644488 | |||
| 1192 | Ga0105241_10790322 | |||
| 1193 | Ga0105241_10847964 | |||
| 1194 | Ga0105241_11499106 | |||
| 1195 | Ga0105242_10223056 | |||
| 1196 | Ga0105248_10000019 | |||
| 1197 | Ga0105248_10007017 | |||
| 1198 | Ga0105248_10021944 | |||
| 1199 | Ga0105248_10022327 | |||
| 1200 | Ga0105248_10042895 | |||
| 1201 | Ga0105248_10293698 | |||
| 1202 | Ga0105248_11168149 | |||
| 1203 | Ga0105248_11357570 | |||
| 1204 | Ga0105237_10000590 | |||
| 1205 | Ga0105237_10006331 | |||
| 1206 | Ga0105237_10049769 | |||
| 1207 | Ga0105237_10352143 | |||
| 1208 | Ga0105237_10555839 | |||
| 1209 | Ga0105237_10556785 | |||
| 1210 | Ga0105237_10805760 | |||
| 1211 | Ga0105237_11092793 | |||
| 1212 | Ga0105238_10000197 | |||
| 1213 | Ga0105238_10000509 | |||
| 1214 | Ga0105238_10016125 | |||
| 1215 | Ga0105238_10023794 | |||
| 1216 | Ga0105238_10029605 | |||
| 1217 | Ga0105238_10051802 | |||
| 1218 | Ga0105238_10064831 | |||
| 1219 | Ga0105238_10065916 | |||
| 1220 | Ga0105238_10145620 | |||
| 1221 | Ga0105238_10485097 | |||
| 1222 | Ga0105238_10522005 | |||
| 1223 | Ga0105238_10781075 | |||
| 1224 | Ga0105238_11877914 | |||
| 1225 | Ga0105238_12299666 | |||
| 1226 | Ga0105238_12957677 | |||
| 1227 | Ga0105249_10067686 | |||
| 1228 | Ga0099796_10089586 | |||
| 1229 | Ga0105239_10001533 | |||
| 1230 | Ga0105239_10003046 | |||
| 1231 | Ga0105239_10013636 | |||
| 1232 | Ga0105239_10075980 | |||
| 1233 | Ga0105239_10336483 | |||
| 1234 | Ga0105239_10877344 | |||
| 1235 | Ga0105239_11576054 | |||
| 1236 | Ga0105239_11893339 | |||
| 1237 | Ga0105246_10002384 | |||
| 1238 | Ga0157373_10104825 | |||
| 1239 | Ga0157373_10219018 | |||
| 1240 | Ga0157373_10757558 | |||
| 1241 | Ga0157373_10782411 | |||
| 1242 | Ga0157371_10030600 | |||
| 1243 | Ga0157371_10407929 | |||
| 1244 | Ga0157371_10778244 | |||
| 1245 | Ga0157370_10000170 | |||
| 1246 | Ga0157370_10006614 | |||
| 1247 | Ga0157370_10010879 | |||
| 1248 | Ga0157370_10012988 | |||
| 1249 | Ga0157370_10017219 | |||
| 1250 | Ga0157370_10030063 | |||
| 1251 | Ga0157370_10090149 | |||
| 1252 | Ga0157370_10210145 | |||
| 1253 | Ga0157370_10608338 | |||
| 1254 | Ga0157370_11601331 | |||
| 1255 | Ga0157369_10000085 | |||
| 1256 | Ga0157369_10000430 | |||
| 1257 | Ga0157369_10009218 | |||
| 1258 | Ga0157369_10010533 | |||
| 1259 | Ga0157369_10012659 | |||
| 1260 | Ga0157369_10012685 | |||
| 1261 | Ga0157369_10018737 | |||
| 1262 | Ga0157369_10021889 | |||
| 1263 | Ga0157369_10028989 | |||
| 1264 | Ga0157369_10042189 | |||
| 1265 | Ga0157369_10049457 | |||
| 1266 | Ga0157369_10051486 | |||
| 1267 | Ga0157369_10067688 | |||
| 1268 | Ga0157369_10115554 | |||
| 1269 | Ga0157369_10261492 | |||
| 1270 | Ga0157369_10416121 | |||
| 1271 | Ga0157369_10666779 | |||
| 1272 | Ga0157369_12066327 | |||
| 1273 | Ga0157374_10005033 | |||
| 1274 | Ga0157374_10011606 | |||
| 1275 | Ga0157374_10025961 | |||
| 1276 | Ga0157374_10058477 | |||
| 1277 | Ga0157374_10177740 | |||
| 1278 | Ga0157374_10347322 | |||
| 1279 | Ga0157374_10429621 | |||
| 1280 | Ga0157374_10459620 | |||
| 1281 | Ga0157374_10497804 | |||
| 1282 | Ga0157374_10664257 | |||
| 1283 | Ga0157374_10753782 | |||
| 1284 | Ga0157374_10850894 | |||
| 1285 | Ga0157374_11748663 | |||
| 1286 | Ga0157378_10003314 | |||
| 1287 | Ga0157378_10023973 | |||
| 1288 | Ga0157378_10028269 | |||
| 1289 | Ga0157378_10108517 | |||
| 1290 | Ga0157378_10307547 | |||
| 1291 | Ga0157378_10431981 | |||
| 1292 | Ga0157378_11984848 | |||
| 1293 | Ga0163162_10027442 | |||
| 1294 | Ga0163162_10084767 | |||
| 1295 | Ga0163162_10209135 | |||
| 1296 | Ga0163162_13191369 | |||
| 1297 | Ga0157372_10000217 | |||
| 1298 | Ga0157372_10002601 | |||
| 1299 | Ga0157372_10007271 | |||
| 1300 | Ga0157372_10010870 | |||
| 1301 | Ga0157372_10027828 | |||
| 1302 | Ga0157372_10048038 | |||
| 1303 | Ga0157372_10120685 | |||
| 1304 | Ga0157372_10265383 | |||
| 1305 | Ga0157372_10355994 | |||
| 1306 | Ga0157372_10541137 | |||
| 1307 | Ga0157372_11069037 | |||
| 1308 | Ga0157372_11562612 | |||
| 1309 | Ga0157372_11585463 | |||
| 1310 | Ga0157375_10029487 | |||
| 1311 | Ga0157375_10162945 | |||
| 1312 | Ga0157375_10264835 | |||
| 1313 | Ga0157375_10753952 | |||
| 1314 | Ga0163163_10001161 | |||
| 1315 | Ga0163163_10028784 | |||
| 1316 | Ga0157377_10224766 | |||
| 1317 | Ga0157379_10002312 | |||
| 1318 | Ga0157379_10043255 | |||
| 1319 | Ga0157379_10067424 | |||
| 1320 | Ga0157379_10227617 | |||
| 1321 | Ga0157379_10393819 | |||
| 1322 | Ga0157379_11687805 | |||
| 1323 | Ga0157379_12334041 | |||
| 1324 | Ga0157376_10004372 | |||
| 1325 | Ga0157376_10061471 | |||
| 1326 | Ga0157376_10134284 | |||
| 1327 | Ga0157376_10240761 | |||
| 1328 | Ga0157376_10318257 | |||
| 1329 | Ga0157376_10955211 | |||
| 1330 | Ga0157376_11119609 | |||
| 1331 | Ga0157376_11340204 | |||
| 1332 | Ga0182006_1055967 | |||
| 1333 | Ga0163161_10492088 | |||
| 1334 | Ga0213872_10025009 | |||
| 1335 | Ga0213872_10062353 | |||
| 1336 | Ga0213872_10410650 | |||
| 1337 | Ga0213871_10039548 | |||
| 1338 | Ga0224572_1045103 | |||
| 1339 | Ga0209233_1005604 | |||
| 1340 | Ga0207656_10001489 | |||
| 1341 | Ga0207656_10008960 | |||
| 1342 | Ga0207656_10011691 | |||
| 1343 | Ga0207656_10109919 | |||
| 1344 | Ga0207656_10199314 | |||
| 1345 | Ga0207642_10739637 | |||
| 1346 | Ga0207710_10000912 | |||
| 1347 | Ga0207710_10032646 | |||
| 1348 | Ga0207710_10227618 | |||
| 1349 | Ga0207710_10449031 | |||
| 1350 | Ga0207680_10562814 | |||
| 1351 | Ga0207647_10093187 | |||
| 1352 | Ga0207647_10130745 | |||
| 1353 | Ga0207699_10314431 | |||
| 1354 | Ga0207699_11185985 | |||
| 1355 | Ga0207645_10075799 | |||
| 1356 | Ga0207705_10000021 | |||
| 1357 | Ga0207705_10002923 | |||
| 1358 | Ga0207705_10019392 | |||
| 1359 | Ga0207705_10031673 | |||
| 1360 | Ga0207705_10032002 | |||
| 1361 | Ga0207705_10091974 | |||
| 1362 | Ga0207705_10157529 | |||
| 1363 | Ga0207705_10301422 | |||
| 1364 | Ga0207705_10644617 | |||
| 1365 | Ga0207705_11343888 | |||
| 1366 | Ga0207654_10000054 | |||
| 1367 | Ga0207654_10000281 | |||
| 1368 | Ga0207654_10000808 | |||
| 1369 | Ga0207654_10086212 | |||
| 1370 | Ga0207654_10268477 | |||
| 1371 | Ga0207654_10527968 | |||
| 1372 | Ga0207654_11084317 | |||
| 1373 | Ga0207654_11159358 | |||
| 1374 | Ga0207707_10003864 | |||
| 1375 | Ga0207707_10088884 | |||
| 1376 | Ga0207707_10475820 | |||
| 1377 | Ga0207695_10000001 | |||
| 1378 | Ga0207695_10000080 | |||
| 1379 | Ga0207695_10000113 | |||
| 1380 | Ga0207695_10000167 | |||
| 1381 | Ga0207695_10000263 | |||
| 1382 | Ga0207695_10001106 | |||
| 1383 | Ga0207695_10001762 | |||
| 1384 | Ga0207695_10007109 | |||
| 1385 | Ga0207695_10025431 | |||
| 1386 | Ga0207695_10047228 | |||
| 1387 | Ga0207695_10050757 | |||
| 1388 | Ga0207695_10067630 | |||
| 1389 | Ga0207695_10090899 | |||
| 1390 | Ga0207695_10587824 | |||
| 1391 | Ga0207695_10825204 | |||
| 1392 | Ga0207671_10000065 | |||
| 1393 | Ga0207671_10000123 | |||
| 1394 | Ga0207671_10000139 | |||
| 1395 | Ga0207671_10037214 | |||
| 1396 | Ga0207671_10093033 | |||
| 1397 | Ga0207671_10101032 | |||
| 1398 | Ga0207671_10285240 | |||
| 1399 | Ga0207671_10314634 | |||
| 1400 | Ga0207671_10544343 | |||
| 1401 | Ga0207671_10816103 | |||
| 1402 | Ga0207693_10195339 | |||
| 1403 | Ga0207693_11218377 | |||
| 1404 | Ga0207663_11063731 | |||
| 1405 | Ga0207660_10034872 | |||
| 1406 | Ga0207660_10529731 | |||
| 1407 | Ga0207657_10004623 | |||
| 1408 | Ga0207657_10019482 | |||
| 1409 | Ga0207657_10023308 | |||
| 1410 | Ga0207657_10063948 | |||
| 1411 | Ga0207657_10273173 | |||
| 1412 | Ga0207657_10516848 | |||
| 1413 | Ga0207657_10584200 | |||
| 1414 | Ga0207649_10009868 | |||
| 1415 | Ga0207649_10011442 | |||
| 1416 | Ga0207649_10036761 | |||
| 1417 | Ga0207649_10045929 | |||
| 1418 | Ga0207649_10051713 | |||
| 1419 | Ga0207649_10123143 | |||
| 1420 | Ga0207649_10355185 | |||
| 1421 | Ga0207649_11594458 | |||
| 1422 | Ga0207652_10001535 | |||
| 1423 | Ga0207652_10002459 | |||
| 1424 | Ga0207652_10033782 | |||
| 1425 | Ga0207652_10045706 | |||
| 1426 | Ga0207652_10456639 | |||
| 1427 | Ga0207694_10000248 | |||
| 1428 | Ga0207694_10000711 | |||
| 1429 | Ga0207694_10007157 | |||
| 1430 | Ga0207694_10010664 | |||
| 1431 | Ga0207694_10042410 | |||
| 1432 | Ga0207694_10131100 | |||
| 1433 | Ga0207694_10277292 | |||
| 1434 | Ga0207694_10474030 | |||
| 1435 | Ga0207694_10534797 | |||
| 1436 | Ga0207694_10924621 | |||
| 1437 | Ga0207694_11311516 | |||
| 1438 | Ga0207694_11564067 | |||
| 1439 | Ga0207694_11849546 | |||
| 1440 | Ga0207650_10003582 | |||
| 1441 | Ga0207659_10116300 | |||
| 1442 | Ga0207687_10000978 | |||
| 1443 | Ga0207687_10030621 | |||
| 1444 | Ga0207687_10086790 | |||
| 1445 | Ga0207687_10276493 | |||
| 1446 | Ga0207700_10015711 | |||
| 1447 | Ga0207700_10071880 | |||
| 1448 | Ga0207700_10159411 | |||
| 1449 | Ga0207700_10214980 | |||
| 1450 | Ga0207700_10887044 | |||
| 1451 | Ga0207664_10068128 | |||
| 1452 | Ga0207664_10135073 | |||
| 1453 | Ga0207644_10002160 | |||
| 1454 | Ga0207644_10013665 | |||
| 1455 | Ga0207644_10075210 | |||
| 1456 | Ga0207644_10271224 | |||
| 1457 | Ga0207690_10010429 | |||
| 1458 | Ga0207690_10564670 | |||
| 1459 | Ga0207706_10064710 | |||
| 1460 | Ga0207665_10584863 | |||
| 1461 | Ga0207691_10075960 | |||
| 1462 | Ga0207691_10770386 | |||
| 1463 | Ga0207711_10000014 | |||
| 1464 | Ga0207711_10004781 | |||
| 1465 | Ga0207711_10024659 | |||
| 1466 | Ga0207711_10095034 | |||
| 1467 | Ga0207711_10190978 | |||
| 1468 | Ga0207711_10305502 | |||
| 1469 | Ga0207711_10343779 | |||
| 1470 | Ga0207711_10349532 | |||
| 1471 | Ga0207711_11198331 | |||
| 1472 | Ga0207711_11646135 | |||
| 1473 | Ga0207689_10004019 | |||
| 1474 | Ga0207689_10051194 | |||
| 1475 | Ga0207689_10524464 | |||
| 1476 | Ga0207661_10001283 | |||
| 1477 | Ga0207661_10010483 | |||
| 1478 | Ga0207661_10025842 | |||
| 1479 | Ga0207661_10083585 | |||
| 1480 | Ga0207661_10099228 | |||
| 1481 | Ga0207661_10105999 | |||
| 1482 | Ga0207661_10220368 | |||
| 1483 | Ga0207661_10237426 | |||
| 1484 | Ga0207679_10079256 | |||
| 1485 | Ga0207679_10175492 | |||
| 1486 | Ga0207679_10298874 | |||
| 1487 | Ga0207667_10000468 | |||
| 1488 | Ga0207667_10007018 | |||
| 1489 | Ga0207667_10007159 | |||
| 1490 | Ga0207667_10007633 | |||
| 1491 | Ga0207667_10009516 | |||
| 1492 | Ga0207667_10023191 | |||
| 1493 | Ga0207667_10028672 | |||
| 1494 | Ga0207667_10057558 | |||
| 1495 | Ga0207667_10089817 | |||
| 1496 | Ga0207667_10113439 | |||
| 1497 | Ga0207667_10118034 | |||
| 1498 | Ga0207667_10136268 | |||
| 1499 | Ga0207667_10237086 | |||
| 1500 | Ga0207667_10774145 | |||
| 1501 | Ga0207712_10040395 | |||
| 1502 | Ga0207712_10879094 | |||
| 1503 | Ga0207640_10000028 | |||
| 1504 | Ga0207640_10008642 | |||
| 1505 | Ga0207640_10155415 | |||
| 1506 | Ga0207640_10159963 | |||
| 1507 | Ga0207640_10555853 | |||
| 1508 | Ga0207640_10568780 | |||
| 1509 | Ga0207640_10722052 | |||
| 1510 | Ga0207658_10050436 | |||
| 1511 | Ga0207658_10458795 | |||
| 1512 | Ga0207677_10000143 | |||
| 1513 | Ga0207677_10006547 | |||
| 1514 | Ga0207677_10716717 | |||
| 1515 | Ga0207703_10011246 | |||
| 1516 | Ga0207703_10133597 | |||
| 1517 | Ga0207639_10000088 | |||
| 1518 | Ga0207639_10000371 | |||
| 1519 | Ga0207639_10014115 | |||
| 1520 | Ga0207639_10145334 | |||
| 1521 | Ga0207639_10221987 | |||
| 1522 | Ga0207639_10287632 | |||
| 1523 | Ga0207639_10320037 | |||
| 1524 | Ga0207639_10423579 | |||
| 1525 | Ga0207639_10464315 | |||
| 1526 | Ga0207639_10951559 | |||
| 1527 | Ga0207678_10006398 | |||
| 1528 | Ga0207678_10015091 | |||
| 1529 | Ga0207678_10015141 | |||
| 1530 | Ga0207678_10036879 | |||
| 1531 | Ga0207678_10231765 | |||
| 1532 | Ga0207702_10004705 | |||
| 1533 | Ga0207702_10005816 | |||
| 1534 | Ga0207702_10036280 | |||
| 1535 | Ga0207702_10085078 | |||
| 1536 | Ga0207702_10095418 | |||
| 1537 | Ga0207702_10258301 | |||
| 1538 | Ga0207702_10401123 | |||
| 1539 | Ga0207702_10866328 | |||
| 1540 | Ga0207702_10976553 | |||
| 1541 | Ga0207702_11236913 | |||
| 1542 | Ga0207702_11534067 | |||
| 1543 | Ga0207702_12254025 | |||
| 1544 | Ga0207641_10005346 | |||
| 1545 | Ga0207641_10021598 | |||
| 1546 | Ga0207641_10139167 | |||
| 1547 | Ga0207648_11286414 | |||
| 1548 | Ga0207676_10002667 | |||
| 1549 | Ga0207676_10125439 | |||
| 1550 | Ga0207674_10000669 | |||
| 1551 | Ga0207674_10012983 | |||
| 1552 | Ga0207674_10120391 | |||
| 1553 | Ga0207674_10328801 | |||
| 1554 | Ga0207674_10525944 | |||
| 1555 | Ga0207674_10557698 | |||
| 1556 | Ga0207683_10028240 | |||
| 1557 | Ga0207683_10364041 | |||
| 1558 | Ga0207698_10000003 | |||
| 1559 | Ga0207698_10000225 | |||
| 1560 | Ga0207698_10003525 | |||
| 1561 | Ga0207698_10007959 | |||
| 1562 | Ga0207698_10045131 | |||
| 1563 | Ga0207698_10132091 | |||
| 1564 | Ga0207698_10165017 | |||
| 1565 | Ga0207698_10417287 | |||
| 1566 | Ga0207698_11190819 | |||
| 1567 | Ga0268266_10005265 | |||
| 1568 | Ga0268266_10006399 | |||
| 1569 | Ga0268266_10014122 | |||
| 1570 | Ga0268266_10046731 | |||
| 1571 | Ga0268266_10173024 | |||
| 1572 | Ga0268266_10233875 | |||
| 1573 | Ga0268266_10256469 | |||
| 1574 | Ga0268266_10393919 | |||
| 1575 | Ga0268264_10000598 | |||
| 1576 | Ga0265319_1081737 | |||
| 1577 | Ga0265318_10006364 | |||
| 1578 | Ga0265336_10001048 | |||
| 1579 | Ga0265336_10005708 | |||
| 1580 | Ga0307517_10515974 | |||
| 1581 | Ga0265338_10004495 | |||
| 1582 | Ga0265338_10009284 | |||
| 1583 | Ga0265338_10017734 | |||
| 1584 | Ga0265338_10158684 | |||
| 1585 | Ga0265338_10163443 | |||
| 1586 | Ga0265338_10259448 | |||
| 1587 | Ga0265338_10337026 | |||
| 1588 | Ga0265338_10721670 | |||
| 1589 | Ga0265324_10137725 | |||
| 1590 | Ga0307512_10315872 | |||
| 1591 | Ga0265762_1176753 | |||
| 1592 | Ga0265770_1105662 | |||
| 1593 | Ga0265770_1122170 | |||
| 1594 | Ga0265760_10086498 | |||
| 1595 | Ga0265760_10141667 | |||
| 1596 | Ga0265330_10000273 | |||
| 1597 | Ga0265330_10001219 | |||
| 1598 | Ga0265330_10013742 | |||
| 1599 | Ga0265330_10036360 | |||
| 1600 | Ga0265330_10097036 | |||
| 1601 | Ga0265330_10111823 | |||
| 1602 | Ga0265330_10245175 | |||
| 1603 | Ga0265332_10025859 | |||
| 1604 | Ga0265332_10196168 | |||
| 1605 | Ga0265328_10007521 | |||
| 1606 | Ga0265328_10015554 | |||
| 1607 | Ga0265328_10024482 | |||
| 1608 | Ga0265320_10003664 | |||
| 1609 | Ga0265320_10084221 | |||
| 1610 | Ga0265320_10249266 | |||
| 1611 | Ga0265325_10000266 | |||
| 1612 | Ga0265325_10000695 | |||
| 1613 | Ga0265325_10005858 | |||
| 1614 | Ga0265325_10060625 | |||
| 1615 | Ga0265329_10003354 | |||
| 1616 | Ga0265340_10001072 | |||
| 1617 | Ga0265340_10019622 | |||
| 1618 | Ga0265340_10061429 | |||
| 1619 | Ga0265339_10000114 | |||
| 1620 | Ga0265339_10000124 | |||
| 1621 | Ga0265339_10000194 | |||
| 1622 | Ga0265339_10003213 | |||
| 1623 | Ga0265339_10005214 | |||
| 1624 | Ga0265339_10029804 | |||
| 1625 | Ga0265339_10037617 | |||
| 1626 | Ga0265339_10199047 | |||
| 1627 | Ga0265339_10386727 | |||
| 1628 | Ga0265331_10046545 | |||
| 1629 | Ga0265331_10094950 | |||
| 1630 | Ga0265331_10429126 | |||
| 1631 | Ga0265331_10585898 | |||
| 1632 | Ga0265327_10177457 | |||
| 1633 | Ga0265316_10000712 | |||
| 1634 | Ga0265316_10003675 | |||
| 1635 | Ga0265316_10008382 | |||
| 1636 | Ga0265316_10022232 | |||
| 1637 | Ga0265316_10027725 | |||
| 1638 | Ga0265316_10048835 | |||
| 1639 | Ga0265316_10054568 | |||
| 1640 | Ga0265316_10169512 | |||
| 1641 | Ga0265316_10190926 | |||
| 1642 | Ga0265316_10192501 | |||
| 1643 | Ga0265316_10351036 | |||
| 1644 | Ga0265313_10013393 | |||
| 1645 | Ga0265313_10016618 | |||
| 1646 | Ga0265313_10018882 | |||
| 1647 | Ga0265313_10019581 | |||
| 1648 | Ga0265313_10028929 | |||
| 1649 | Ga0265314_10000504 | |||
| 1650 | Ga0265314_10002987 | |||
| 1651 | Ga0265314_10046866 | |||
| 1652 | Ga0265314_10080947 | |||
| 1653 | Ga0265314_10160089 | |||
| 1654 | Ga0265314_10288196 | |||
| 1655 | Ga0265342_10000225 | |||
| 1656 | Ga0265342_10001536 | |||
| 1657 | Ga0265342_10004360 | |||
| 1658 | Ga0265342_10014131 | |||
| 1659 | Ga0265342_10015276 | |||
| 1660 | Ga0265342_10042663 | |||
| 1661 | Ga0265342_10113795 | |||
| 1662 | Ga0265342_10173752 | |||
| 1663 | Ga0316583_10181098 | |||
| 1664 | Ga0307510_10010774 | |||
| 1665 | Ga0307510_10071804 | |||
| 1666 | Ga0307510_10220392 | |||
| 1667 | Ga0373923_0266985 | |||
| 1668 | Ga0373936_0187261 | |||
| 1669 | Ga0373943_0018586 | |||
| 1670 | Ga0373935_0251905 | |||
| 1671 | Ga0373927_0683844 | |||
| 1672 | Ga0373933_0634675 | |||
| 1673 | Ga0373947_0036325 | |||
| 1674 | Ga0373937_0138090 | |||
| 1675 | Ga0373937_0510221 | |||
| 1676 | Ga0373937_1742955 | |||
| 1677 | Ga0395900_0849267 | |||
| 1678 | Ga0395900_1361652 | |||
| 1679 | Ga0395901_0583687 | |||
| 1680 | Ga0436360_0170154 | |||
| 1681 | Ga0436360_0361712 | |||
| 1682 | Ga0436360_0826850 | |||
| 1683 | Ga0436360_0871656 | |||
| 1684 | Ga0436360_1008743 | |||
| 1685 | Ga0436360_1308109 | |||
| 1686 | Ga0436361_0226605 | |||
| 1687 | Ga0436361_0318263 | |||
| 1688 | Ga0436361_0526984 | |||
| 1689 | Ga0436361_0585232 | |||
| 1690 | Ga0436361_0757992 | |||
| 1691 | Ga0436361_0776284 | |||
| 1692 | Ga0436363_0701240 | |||
| 1693 | Ga0451839_0265344 | |||
| 1694 | Ga0451839_0397595 | |||
| 1695 | Ga0439448_0148476 | |||
| 1696 | Ga0451577_0979553 | |||
| 1697 | Ga0466969_0299729 | |||
| 1698 | Ga0466969_0533994 | |||
| 1699 | Ga0453683_0515345 | |||
| 1700 | Ga0466966_0043334 | |||
| 1701 | Ga0466966_0201614 | |||
| 1702 | Ga0466961_0062967 | |||
| 1703 | Ga0466961_0372195 | |||
| 1704 | Ga0466961_0499937 | |||
| 1705 | Ga0466963_0000494 | |||
| 1706 | Ga0466963_0732759 | |||
| 1707 | Ga0466957_0445001 | |||
| 1708 | Ga0466957_0972147 | |||
| 1709 | Ga0466959_0159618 | |||
| 1710 | Ga0466959_0254613 | |||
| 1711 | Ga0466959_1198274 | |||
| 1712 | Ga0466958_0372077 | |||
| 1713 | Ga0466967_0001401 | |||
| 1714 | Ga0466967_0226226 | |||
| 1715 | Ga0466967_0433944 | |||
| 1716 | Ga0466967_0549800 | |||
| 1717 | Ga0495617_242766 | |||
| 1718 | Ga0495592_0170605 | |||
| 1719 | Ga0495592_0361325 | |||
| 1720 | Ga0495592_0378286 | |||
| 1721 | Ga0495603_0111033 | |||
| 1722 | Ga0495603_0122471 | |||
| 1723 | Ga0495629_0018026 | |||
| 1724 | Ga0495638_0447890 | |||
| 1725 | Ga0495651_0015018 | |||
| 1726 | Ga0495651_0031839 | |||
| 1727 | Ga0495653_0010749 | |||
| 1728 | Ga0495650_0000038 | |||
| 1729 | Ga0495650_0008733 | |||
| 1730 | Ga0495580_0097351 | |||
| 1731 | Ga0495582_0049065 | |||
| 1732 | Ga0495639_0001675 | |||
| 1733 | Ga0495662_0005660 | |||
| 1734 | Ga0495664_0001348 | |||
| 1735 | Ga0495664_0028071 | |||
| 1736 | Ga0495664_0045809 | |||
| 1737 | Ga0495664_0209206 | |||
| 1738 | Ga0495585_0016774 | |||
| 1739 | Ga0495594_0000388 | |||
| 1740 | Ga0495594_0001190 | |||
| 1741 | Ga0495594_0881111 | |||
| 1742 | Ga0495583_0013317 | |||
| 1743 | Ga0495583_0033314 | |||
| 1744 | Ga0495606_0077834 | |||
| 1745 | Ga0495606_0095370 | |||
| 1746 | Ga0495606_0162623 | |||
| 1747 | Ga0495606_0216104 | |||
| 1748 | Ga0495628_0007402 | |||
| 1749 | Ga0495628_0011061 | |||
| 1750 | Ga0495628_0694799 | |||
| 1751 | Ga0495630_0264458 | |||
| 1752 | Ga0495631_0051109 | |||
| 1753 | Ga0495631_0241780 | |||
| 1754 | Ga0495632_0301110 | |||
| 1755 | Ga0495644_0000048 | |||
| 1756 | Ga0495648_0167762 | |||
| 1757 | Ga0495648_0207165 | |||
| 1758 | Ga0495666_0001196 | |||
| 1759 | Ga0495642_0009023 | |||
| 1760 | Ga0495642_0389701 | |||
| 1761 | Ga0495652_0009907 | |||
| 1762 | Ga0495652_0039259 | |||
| 1763 | Ga0495652_0448030 | |||
| 1764 | Ga0495652_0620027 | |||
| 1765 | Ga0495665_0001828 | |||
| 1766 | Ga0495665_0321308 | |||
| 1767 | Ga0495640_0060924 | |||
| 1768 | Ga0495640_0096637 | |||
| 1769 | Ga0495586_0163121 | |||
| 1770 | Ga0495586_0521142 | |||
| 1771 | Ga0495587_0008155 | |||
| 1772 | Ga0495609_0036518 | |||
| 1773 | Ga0495609_0180783 | |||
| 1774 | Ga0495609_0326845 | |||
| 1775 | Ga0495645_0001770 | |||
| 1776 | Ga0495645_0005517 | |||
| 1777 | Ga0495645_0007804 | |||
| 1778 | Ga0495645_0022284 | |||
| 1779 | Ga0495667_0084571 | |||
| 1780 | Ga0495667_0374459 | |||
| 1781 | Ga0495668_0044535 | |||
| 1782 | Ga0495668_0514669 | |||
| 1783 | Ga0495634_0006225 | |||
| 1784 | Ga0495611_0383414 | |||
| 1785 | Ga0495625_0000985 | |||
| 1786 | Ga0495625_0007833 | |||
| 1787 | Ga0495625_0019175 | |||
| 1788 | Ga0495625_0045052 | |||
| 1789 | Ga0495625_0511048 | |||
| 1790 | Ga0495635_0002836 | |||
| 1791 | Ga0495635_0086686 | |||
| 1792 | Ga0495635_0470186 | |||
| 1793 | Ga0495659_0066790 | |||
| 1794 | Ga0495588_0028867 | |||
| 1795 | Ga0495657_0467111 | |||
| 1796 | Ga0495599_0017587 | |||
| 1797 | Ga0495599_0051590 | |||
| 1798 | Ga0495599_0605156 | |||
| 1799 | Ga0495623_0050948 | |||
| 1800 | Ga0495623_0056771 | |||
| 1801 | Ga0495623_0058009 | |||
| 1802 | Ga0495623_0082244 | |||
| 1803 | Ga0495646_0077284 | |||
| 1804 | Ga0495646_0124321 | |||
| 1805 | Ga0495646_0346219 | |||
| 1806 | Ga0495646_0450865 | |||
| 1807 | Ga0495646_0542208 | |||
| 1808 | Ga0495669_0004252 | |||
| 1809 | Ga0495613_0003966 | |||
| 1810 | Ga0495613_0012222 | |||
| 1811 | Ga0495624_0007524 | |||
| 1812 | Ga0495670_0038859 | |||
| 1813 | Ga0495671_0153236 | |||
| 1814 | Ga0495671_0493283 | |||
| 1815 | Ga0495649_0064738 | |||
| 1816 | Ga0495649_0490026 | |||
| 1817 | Ga0495600_0002909 | |||
| 1818 | Ga0495600_0302730 | |||
| 1819 | Ga0495581_0050879 | |||
| 1820 | Ga0495581_0245692 | |||
| 1821 | Ga0495581_0366883 | |||
| 1822 | Ga0495581_0885072 | |||
| 1823 | Ga0495604_0002834 | |||
| 1824 | Ga0495604_0015522 | |||
| 1825 | Ga0495604_0069051 | |||
| 1826 | Ga0495636_0056644 | |||
| 1827 | Ga0495674_0014334 | |||
| 1828 | Ga0495674_0152317 | |||
| 1829 | Ga0495674_0539358 | |||
| 1830 | Ga0495672_0030990 | |||
| 1831 | Ga0495676_0008961 | |||
| 1832 | Ga0495676_0114867 | |||
| 1833 | Ga0495680_0076425 | |||
| 1834 | Ga0495675_0003222 | |||
| 1835 | Ga0495675_0012790 | |||
| 1836 | Ga0495677_0020984 | |||
| 1837 | Ga0495673_0072246 | |||
| 1838 | Ga0495684_0049723 | |||
| 1839 | Ga0495684_0101338 | |||
| 1840 | Ga0495686_0004566 | |||
| 1841 | Ga0495686_0008419 | |||
| 1842 | Ga0495686_0012438 | |||
| 1843 | Ga0495686_0014007 | |||
| 1844 | Ga0495686_0044764 | |||
| 1845 | Ga0495686_0067112 | |||
| 1846 | Ga0495686_0187235 | |||
| 1847 | Ga0495593_0019638 | |||
| 1848 | Ga0495593_0040852 | |||
| 1849 | Ga0495602_0773591 | |||
| 1850 | Ga0495614_0000972 | |||
| 1851 | Ga0496100_0575375 | |||
| 1852 | Ga0496100_1034106 | |||
| 1853 | Ga0496101_0659155 | |||
| 1854 | Ga0496102_0777646 | |||
| 1855 | Ga0496103_0741566 | |||
| 1856 | Ga0496104_0000053 | |||
| 1857 | Ga0496104_0057613 | |||
| 1858 | Ga0496104_0875113 | |||
| 1859 | Ga0496108_0111209 | |||
| 1860 | Ga0496112_0165026 | |||
| 1861 | Ga0496114_0096351 | |||
| 1862 | Ga0496115_0202171 | |||
| 1863 | Ga0496115_0301250 | |||
| 1864 | Ga0496120_0134276 | |||
| 1865 | Ga0496120_0260024 | |||
| 1866 | Ga0496121_0492821 | |||
| 1867 | Ga0496126_0000014 | |||
| 1868 | Ga0496126_0000154 | |||
| 1869 | Ga0496126_0739092 | |||
| 1870 | Ga0496126_1287352 | |||
| 1871 | Ga0495682_0041693 | |||
| 1872 | Ga0501031_0027688 | |||
| 1873 | Ga0501032_0001912 | |||
| 1874 | Ga0501033_0010946 | |||
| 1875 | Ga0501033_0045842 | |||
| 1876 | Ga0501034_0014111 | |||
| 1877 | Ga0501037_0025359 | |||
| 1878 | Ga0501037_0471859 | |||
| 1879 | Ga0501038_0033174 | |||
| 1880 | Ga0501038_0098016 | |||
| 1881 | Ga0501038_0110075 | |||
| 1882 | Ga0501039_0154809 | |||
| 1883 | Ga0501043_0057147 | |||
| 1884 | Ga0501046_0000056 | |||
| 1885 | Ga0501047_0008947 | |||
| 1886 | Ga0501047_0017729 | |||
| 1887 | Ga0501070_0124247 | |||
| 1888 | Ga0501070_0254155 | |||
| 1889 | Ga0501073_0008329 | |||
| 1890 | Ga0501073_1108370 | |||
| 1891 | Ga0501074_0524312 | |||
| 1892 | Ga0501079_0275238 | |||
| 1893 | Ga0501080_0310054 | |||
| 1894 | Ga0501080_0960686 | |||
| 1895 | Ga0501035_0086954 | |||
| 1896 | Ga0501035_0350448 | |||
| 1897 | Ga0501044_0171643 | |||
| 1898 | Ga0501044_0184233 | |||
| 1899 | nmdc:mga08x19_161497_c1 | |||
| 1900 | nmdc:mga08x19_164936_c1 | |||
| 1901 | nmdc:mga08x19_30704_c1 | |||
| 1902 | Ga0495612_0308136 | |||
| 1903 | Ga0500643_028144 | |||
| 1904 | Ga0500644_0156516 | |||
| 1905 | Ga0500651_0000005 | |||
| 1906 | Ga0500595_000004 | |||
| 1907 | Ga0500595_013665 | |||
| 1908 | Ga0500595_016226 | |||
| 1909 | Ga0500661_001216 | |||
| 1910 | 2884217794 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1zps-assembly1.cif.gz_A | crystal structure of methanobacterium thermoautotrophicum phosphoribosyl-amp cyclohydrolase hisi | 0.9431 | 12 | 101 |
| 6j22-assembly1.cif.gz_A | crystal structure of bi-functional enzyme | 0.9186 | 4 | 105 |
| 6j2l-assembly1.cif.gz_A | crystal structure of bi-functional enzyme | 0.9167 | 4 | 105 |
| 6j22-assembly1.cif.gz_B | crystal structure of bi-functional enzyme | 0.9088 | 4 | 105 |
| 7bgm-assembly1.cif.gz_A | crystal structure of mthisn2, a bifunctional enzyme from the histidine biosynthetic pathway | 0.904 | 2 | 105 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FUU3_250_343_3.10.20.810 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase | 0.9591 | 2 | 88 | 3.10.20.810 |
| 1zpsA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase | 0.9462 | 12 | 93 | 3.10.20.810 |
| af_C6TGF5_46_140_3.10.20.810 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase | 0.925 | 2 | 93 | 3.10.20.810 |
| af_P9WMM7_1_97_3.10.20.810 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase | 0.9081 | 2 | 88 | 3.10.20.810 |
| af_A0A1D8PKY7_169_272_3.10.20.810 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase | 0.887 | 4 | 93 | 3.10.20.810 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M1DQ05-F1-model_v4 | phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) | 0.965 | 1 | 94 |
GO:0000105
GO:0004635 |
| AF-A0A1I6L727-F1-model_v4 | phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) | 0.962 | 2 | 107 |
GO:0000105
GO:0004635 |
| AF-A0A841JW93-F1-model_v4 | phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) | 0.9612 | 3 | 110 |
GO:0000105
GO:0004635 |
| AF-A0A6A7L9V1-F1-model_v4 | phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) | 0.9607 | 4 | 105 |
GO:0000105
GO:0004635 |
| AF-A0A382RME8-F1-model_v4 | Histidine biosynthesis bifunctional protein HisIE (EC 3.5.4.19) | 0.9602 | 3 | 105 |
GO:0000105
GO:0004635 GO:0005737 |