F486519

General Info

Members Datasets Scaffolds Average Seq Length
948 280 1896 140

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0929913|Ga0501070_0929913_175_606
Length 143
Sequence VSERIQNRRIALVMALLAGCLAFNSASTFAHHSFAAEFDINKPVELHGTVTKVELINPHSWIHLEVADKDGNKESWMIEGGSPNQLLRKGFTKNSLPVGTEIVAIGYQARDGSKRAVGRTLKLANGSTLFFEATTTTTPEASH

Samples

Sample ID Description Type Environment
1 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
186 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
187 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
188 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
189 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
190 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
191 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
192 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
193 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
194 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
195 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
196 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
197 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
202 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
203 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
204 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
205 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
206 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
207 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
208 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
209 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
210 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
211 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
212 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
213 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
214 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
218 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
219 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
220 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
221 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
222 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
223 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
224 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
225 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
229 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
230 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
253 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
257 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
258 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
259 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
260 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
261 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
265 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
266 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
267 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
268 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
271 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
276 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
277 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
278 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
279 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
280 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.95
Rhizosphere 98.52
Stem 0
Stem Tuber 0
Unclassified 20.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501070_0929913 3300049586 Unclassified 677
2 SwRhRL2b_contig_1258267 2162886007 Unclassified 1840
3 rootH1_10332194 3300003323 Bacteria 1504
4 Ga0058859_11236937 3300004798 Unclassified 594
5 Ga0058859_11334503 3300004798 Bacteria 1028
6 Ga0058860_12103558 3300004801 Bacteria 885
7 Ga0065704_10012427 3300005289 Bacteria 2672
8 Ga0065704_10017203 3300005289 Bacteria 1515
9 Ga0065704_10090174 3300005289 Bacteria 2807
10 Ga0065712_10068024 3300005290 Bacteria 16849
11 Ga0065712_10114113 3300005290 Bacteria 1772
12 Ga0065712_10310957 3300005290 Bacteria 844
13 Ga0065712_10373566 3300005290 Unclassified 760
14 Ga0065715_10000766 3300005293 Bacteria 8488
15 Ga0065715_10004374 3300005293 Bacteria 5206
16 Ga0065715_10011502 3300005293 Bacteria 2405
17 Ga0065715_10113264 3300005293 Bacteria 2497
18 Ga0065707_10001773 3300005295 Bacteria 7292
19 Ga0065707_10004206 3300005295 Bacteria 6464
20 Ga0065707_10088576 3300005295 Bacteria 4576
21 Ga0065707_10190209 3300005295 Bacteria 1365
22 Ga0065707_10222241 3300005295 Bacteria 1214
23 Ga0065707_10421871 3300005295 Bacteria 830
24 Ga0065707_10990295 3300005295 Unclassified 542
25 Ga0070676_10002130 3300005328 Bacteria 10080
26 Ga0070676_10008509 3300005328 Bacteria 5532
27 Ga0070676_10196921 3300005328 Bacteria 1319
28 Ga0070676_10277113 3300005328 Bacteria 1129
29 Ga0070676_10448111 3300005328 Bacteria 907
30 Ga0070676_10774466 3300005328 Bacteria 706
31 Ga0070676_11174988 3300005328 Unclassified 582
32 Ga0070690_100006833 3300005330 Bacteria 6490
33 Ga0070690_100019611 3300005330 Bacteria 4109
34 Ga0070690_100035456 3300005330 Unclassified 3130
35 Ga0070670_100006214 3300005331 Bacteria 10102
36 Ga0070670_100019553 3300005331 Bacteria 5813
37 Ga0070677_10004228 3300005333 Unclassified 4679
38 Ga0068869_100004349 3300005334 Bacteria 8794
39 Ga0068869_100006944 3300005334 Bacteria 7206
40 Ga0068869_100188677 3300005334 Bacteria 1620
41 Ga0068869_100369038 3300005334 Bacteria 1174
42 Ga0068869_100523565 3300005334 Bacteria 993
43 Ga0068869_100657405 3300005334 Bacteria 890
44 Ga0068869_101189490 3300005334 Bacteria 670
45 Ga0068869_101203171 3300005334 Bacteria 666
46 Ga0068869_101696026 3300005334 Bacteria 564
47 Ga0068869_102054456 3300005334 Bacteria 513
48 Ga0070666_10004014 3300005335 Bacteria 8934
49 Ga0070666_10257807 3300005335 Bacteria 1236
50 Ga0070666_10940536 3300005335 Unclassified 640
51 Ga0070666_11337239 3300005335 Unclassified 535
52 Ga0070680_100266524 3300005336 Unclassified 1450
53 Ga0070680_100438756 3300005336 Bacteria 1115
54 Ga0070680_100754069 3300005336 Unclassified 838
55 Ga0068868_100122031 3300005338 Unclassified 2126
56 Ga0068868_100219482 3300005338 Bacteria 1591
57 Ga0070689_100007401 3300005340 Bacteria 7673
58 Ga0070689_100009672 3300005340 Bacteria 6840
59 Ga0070689_100013527 3300005340 Bacteria 5909
60 Ga0070689_100084397 3300005340 Bacteria 2496
61 Ga0070689_100179522 3300005340 Bacteria 1719
62 Ga0070689_100317711 3300005340 Bacteria 1300
63 Ga0070689_100486255 3300005340 Bacteria 1055
64 Ga0070689_101751131 3300005340 Unclassified 566
65 Ga0070691_10883709 3300005341 Bacteria 550
66 Ga0070687_100105926 3300005343 Bacteria 1583
67 Ga0070687_100204337 3300005343 Bacteria 1199
68 Ga0070661_100009957 3300005344 Bacteria 6593
69 Ga0070661_101390405 3300005344 Bacteria 590
70 Ga0070692_10016485 3300005345 Bacteria 3515
71 Ga0070692_10189938 3300005345 Unclassified 1196
72 Ga0070692_10578511 3300005345 Bacteria 740
73 Ga0070668_100045307 3300005347 Unclassified 3375
74 Ga0070668_100072618 3300005347 Bacteria 2681
75 Ga0070668_100205989 3300005347 Bacteria 1616
76 Ga0070668_101509747 3300005347 Bacteria 614
77 Ga0070669_100011599 3300005353 Bacteria 6251
78 Ga0070669_100014609 3300005353 Bacteria 5589
79 Ga0070669_100046196 3300005353 Bacteria 3175
80 Ga0070669_100049163 3300005353 Bacteria 3079
81 Ga0070669_100096307 3300005353 Bacteria 2226
82 Ga0070669_100468997 3300005353 Bacteria 1040
83 Ga0070669_100716712 3300005353 Bacteria 846
84 Ga0070669_101382842 3300005353 Bacteria 611
85 Ga0070675_100002265 3300005354 Bacteria 14278
86 Ga0070675_100002427 3300005354 Bacteria 13909
87 Ga0070675_100004043 3300005354 Bacteria 11135
88 Ga0070675_100006488 3300005354 Bacteria 8983
89 Ga0070675_100020169 3300005354 Bacteria 5319
90 Ga0070675_100049358 3300005354 Bacteria 3454
91 Ga0070675_100098495 3300005354 Bacteria 2460
92 Ga0070675_100122555 3300005354 Bacteria 2210
93 Ga0070675_100158624 3300005354 Bacteria 1944
94 Ga0070675_100168290 3300005354 Bacteria 1889
95 Ga0070675_100492599 3300005354 Bacteria 1104
96 Ga0070675_100558615 3300005354 Bacteria 1036
97 Ga0070675_101138543 3300005354 Bacteria 718
98 Ga0070671_100008742 3300005355 Bacteria 8124
99 Ga0070671_100052868 3300005355 Bacteria 3377
100 Ga0070671_100059946 3300005355 Bacteria 3168
101 Ga0070671_100412497 3300005355 Bacteria 1156
102 Ga0070671_101463564 3300005355 Bacteria 604
103 Ga0070674_100008366 3300005356 Bacteria 6159
104 Ga0070674_100028325 3300005356 Bacteria 3679
105 Ga0070674_100076325 3300005356 Bacteria 2382
106 Ga0070674_100208657 3300005356 Bacteria 1513
107 Ga0070674_100370335 3300005356 Bacteria 1162
108 Ga0070674_100557676 3300005356 Bacteria 962
109 Ga0070674_100912380 3300005356 Bacteria 766
110 Ga0070674_100962441 3300005356 Bacteria 747
111 Ga0070674_101670553 3300005356 Bacteria 575
112 Ga0070673_100013101 3300005364 Bacteria 5722
113 Ga0070673_100019662 3300005364 Bacteria 4853
114 Ga0070673_100024386 3300005364 Bacteria 4435
115 Ga0070673_100072817 3300005364 Unclassified 2764
116 Ga0070673_100268772 3300005364 Bacteria 1492
117 Ga0070673_100514080 3300005364 Bacteria 1084
118 Ga0070673_100663185 3300005364 Bacteria 956
119 Ga0070688_100004251 3300005365 Bacteria 7447
120 Ga0070688_100030597 3300005365 Bacteria 3232
121 Ga0070688_100284249 3300005365 Bacteria 1190
122 Ga0070688_100577600 3300005365 Bacteria 858
123 Ga0070688_101637661 3300005365 Bacteria 526
124 Ga0070659_100821726 3300005366 Unclassified 809
125 Ga0070659_101199680 3300005366 Unclassified 671
126 Ga0070667_100021283 3300005367 Bacteria 5387
127 Ga0070709_10697928 3300005434 Bacteria 789
128 Ga0070714_100006277 3300005435 Bacteria 9160
129 Ga0070713_100001089 3300005436 Bacteria 17388
130 Ga0070710_10409248 3300005437 Bacteria 911
131 Ga0070701_10007994 3300005438 Bacteria 4549
132 Ga0070701_10011952 3300005438 Bacteria 3900
133 Ga0070701_10052800 3300005438 Unclassified 2113
134 Ga0070701_10149205 3300005438 Bacteria 1345
135 Ga0070701_11337489 3300005438 Unclassified 513
136 Ga0070711_100030198 3300005439 Unclassified 3585
137 Ga0070711_100763122 3300005439 Bacteria 818
138 Ga0070705_100002851 3300005440 Bacteria 8619
139 Ga0070705_100011812 3300005440 Bacteria 4420
140 Ga0070705_100065077 3300005440 Unclassified 2181
141 Ga0070700_100002700 3300005441 Bacteria 9054
142 Ga0070700_100008474 3300005441 Bacteria 5598
143 Ga0070700_100075791 3300005441 Bacteria 2158
144 Ga0070700_100109781 3300005441 Bacteria 1832
145 Ga0070700_100572546 3300005441 Bacteria 881
146 Ga0070700_100591406 3300005441 Bacteria 868
147 Ga0070700_101055032 3300005441 Bacteria 671
148 Ga0070694_100001762 3300005444 Bacteria 12791
149 Ga0070694_100005154 3300005444 Bacteria 7879
150 Ga0070694_100029352 3300005444 Bacteria 3589
151 Ga0070694_100221530 3300005444 Unclassified 1419
152 Ga0070694_100222347 3300005444 Bacteria 1417
153 Ga0070694_100260206 3300005444 Bacteria 1316
154 Ga0070694_100281438 3300005444 Unclassified 1268
155 Ga0070694_100613499 3300005444 Bacteria 877
156 Ga0070694_100756998 3300005444 Unclassified 794
157 Ga0070708_100059084 3300005445 Bacteria 3418
158 Ga0070708_100585494 3300005445 Unclassified 1052
159 Ga0070663_100467382 3300005455 Bacteria 1042
160 Ga0070663_100602495 3300005455 Bacteria 924
161 Ga0070663_100800391 3300005455 Bacteria 808
162 Ga0070678_100004885 3300005456 Bacteria 7664
163 Ga0070678_100094772 3300005456 Unclassified 2299
164 Ga0070678_100224186 3300005456 Bacteria 1564
165 Ga0070662_100046881 3300005457 Unclassified 3106
166 Ga0070662_100061885 3300005457 Bacteria 2733
167 Ga0070662_100363014 3300005457 Bacteria 1189
168 Ga0070662_100366535 3300005457 Unclassified 1183
169 Ga0070681_11464175 3300005458 Unclassified 607
170 Ga0068867_100000229 3300005459 Bacteria 36660
171 Ga0068867_100002574 3300005459 Bacteria 12784
172 Ga0068867_100100152 3300005459 Bacteria 2212
173 Ga0068867_100471483 3300005459 Bacteria 1074
174 Ga0068867_101561603 3300005459 Unclassified 616
175 Ga0070685_10004167 3300005466 Bacteria 7292
176 Ga0070685_10059731 3300005466 Bacteria 2227
177 Ga0070685_10340581 3300005466 Bacteria 1022
178 Ga0070685_10443497 3300005466 Bacteria 908
179 Ga0070706_100939545 3300005467 Unclassified 798
180 Ga0070707_100015672 3300005468 Bacteria 7116
181 Ga0070707_100071294 3300005468 Unclassified 3348
182 Ga0070707_100157196 3300005468 Bacteria 2215
183 Ga0070707_100755647 3300005468 Bacteria 936
184 Ga0070707_100782439 3300005468 Unclassified 918
185 Ga0070698_100001553 3300005471 Bacteria 25481
186 Ga0070698_100003210 3300005471 Bacteria 18008
187 Ga0070698_100144917 3300005471 Bacteria 2325
188 Ga0070698_100486693 3300005471 Unclassified 1171
189 Ga0070698_100514760 3300005471 Bacteria 1135
190 Ga0070698_100518941 3300005471 Bacteria 1130
191 Ga0070698_101141623 3300005471 Bacteria 728
192 Ga0070698_101502185 3300005471 Unclassified 625
193 Ga0070699_100000567 3300005518 Bacteria 34941
194 Ga0070699_100014400 3300005518 Bacteria 6799
195 Ga0070699_100094291 3300005518 Bacteria 2620
196 Ga0070699_100946025 3300005518 Unclassified 789
197 Ga0070679_101787458 3300005530 Bacteria 563
198 Ga0070684_100162112 3300005535 Bacteria 2029
199 Ga0070697_100072873 3300005536 Bacteria 2819
200 Ga0070697_100114816 3300005536 Bacteria 2248
201 Ga0070697_100208335 3300005536 Bacteria 1664
202 Ga0070697_101925381 3300005536 Unclassified 529
203 Ga0068853_101925889 3300005539 Unclassified 573
204 Ga0068853_102229572 3300005539 Bacteria 531
205 Ga0070672_100002796 3300005543 Bacteria 11178
206 Ga0070672_100059499 3300005543 Bacteria 3006
207 Ga0070672_100075045 3300005543 Unclassified 2699
208 Ga0070672_100184472 3300005543 Bacteria 1740
209 Ga0070672_100199416 3300005543 Bacteria 1673
210 Ga0070672_100273278 3300005543 Bacteria 1427
211 Ga0070672_100314422 3300005543 Bacteria 1330
212 Ga0070672_100506553 3300005543 Bacteria 1045
213 Ga0070686_100008216 3300005544 Bacteria 5842
214 Ga0070686_100019208 3300005544 Bacteria 4023
215 Ga0070686_100419797 3300005544 Bacteria 1022
216 Ga0070686_100488134 3300005544 Bacteria 954
217 Ga0070695_100000224 3300005545 Bacteria 27792
218 Ga0070695_100047411 3300005545 Bacteria 2744
219 Ga0070695_100152944 3300005545 Unclassified 1612
220 Ga0070695_100530372 3300005545 Bacteria 915
221 Ga0070696_100005480 3300005546 Bacteria 8467
222 Ga0070696_100043739 3300005546 Bacteria 3099
223 Ga0070696_100073242 3300005546 Bacteria 2413
224 Ga0070696_100129190 3300005546 Bacteria 1837
225 Ga0070696_100433849 3300005546 Unclassified 1034
226 Ga0070696_101495916 3300005546 Unclassified 578
227 Ga0070665_101268475 3300005548 Bacteria 747
228 Ga0070704_100002482 3300005549 Bacteria 10363
229 Ga0070704_100010762 3300005549 Bacteria 5576
230 Ga0070704_100030713 3300005549 Bacteria 3603
231 Ga0070704_100097976 3300005549 Bacteria 2202
232 Ga0070704_100173574 3300005549 Bacteria 1717
233 Ga0070664_100005747 3300005564 Bacteria 10003
234 Ga0070664_100221993 3300005564 Bacteria 1691
235 Ga0070664_100228242 3300005564 Bacteria 1668
236 Ga0070664_100313440 3300005564 Unclassified 1420
237 Ga0068857_100626726 3300005577 Bacteria 1018
238 Ga0068857_100759174 3300005577 Bacteria 924
239 Ga0068857_100797550 3300005577 Bacteria 902
240 Ga0068854_100101312 3300005578 Bacteria 2159
241 Ga0068854_100368821 3300005578 Bacteria 1180
242 Ga0068854_101272929 3300005578 Unclassified 661
243 Ga0070702_100042808 3300005615 Unclassified 2548
244 Ga0070702_100068238 3300005615 Unclassified 2092
245 Ga0070702_100080722 3300005615 Bacteria 1947
246 Ga0070702_100138402 3300005615 Bacteria 1548
247 Ga0068852_100115953 3300005616 Bacteria 2443
248 Ga0068859_100002873 3300005617 Bacteria 17487
249 Ga0068859_100003933 3300005617 Bacteria 15174
250 Ga0068859_100022071 3300005617 Bacteria 6382
251 Ga0068859_100029033 3300005617 Bacteria 5549
252 Ga0068859_100064345 3300005617 Bacteria 3700
253 Ga0068859_100134284 3300005617 Unclassified 2546
254 Ga0068859_100925841 3300005617 Bacteria 956
255 Ga0068859_101403914 3300005617 Bacteria 770
256 Ga0068864_100029090 3300005618 Bacteria 4675
257 Ga0068864_100051552 3300005618 Bacteria 3546
258 Ga0068864_100244655 3300005618 Bacteria 1663
259 Ga0068864_100262786 3300005618 Bacteria 1606
260 Ga0068864_100430938 3300005618 Bacteria 1258
261 Ga0068864_100647179 3300005618 Bacteria 1029
262 Ga0068864_100921521 3300005618 Bacteria 864
263 Ga0068864_101191076 3300005618 Unclassified 760
264 Ga0068866_10154852 3300005718 Bacteria 1331
265 Ga0068861_100005161 3300005719 Bacteria 8811
266 Ga0068861_100017323 3300005719 Bacteria 5113
267 Ga0068861_100139134 3300005719 Bacteria 1979
268 Ga0068861_101167301 3300005719 Unclassified 743
269 Ga0068861_102282927 3300005719 Unclassified 543
270 Ga0068870_10000872 3300005840 Bacteria 11786
271 Ga0068870_10004262 3300005840 Bacteria 6147
272 Ga0068870_10076281 3300005840 Bacteria 1841
273 Ga0068870_10184558 3300005840 Bacteria 1255
274 Ga0068870_10244299 3300005840 Bacteria 1110
275 Ga0068870_10313683 3300005840 Bacteria 994
276 Ga0068870_10916190 3300005840 Unclassified 620
277 Ga0068863_100002061 3300005841 Bacteria 19922
278 Ga0068863_100052741 3300005841 Bacteria 3854
279 Ga0068863_100178488 3300005841 Bacteria 2038
280 Ga0068863_100333889 3300005841 Bacteria 1474
281 Ga0068863_100440924 3300005841 Bacteria 1277
282 Ga0068863_100810502 3300005841 Bacteria 934
283 Ga0068863_100875398 3300005841 Bacteria 898
284 Ga0068863_101580293 3300005841 Bacteria 665
285 Ga0068858_100008740 3300005842 Bacteria 9718
286 Ga0068858_100026137 3300005842 Bacteria 5428
287 Ga0068858_100178835 3300005842 Bacteria 2002
288 Ga0068858_100336001 3300005842 Bacteria 1445
289 Ga0068858_100643993 3300005842 Bacteria 1030
290 Ga0068860_100005513 3300005843 Bacteria 12809
291 Ga0068860_100038517 3300005843 Bacteria 4574
292 Ga0068860_100152118 3300005843 Bacteria 2228
293 Ga0068860_100226513 3300005843 Bacteria 1816
294 Ga0068860_100336732 3300005843 Bacteria 1483
295 Ga0068862_100003220 3300005844 Bacteria 14137
296 Ga0068862_100012749 3300005844 Bacteria 6957
297 Ga0068862_100118584 3300005844 Bacteria 2330
298 Ga0068862_101054733 3300005844 Bacteria 806
299 Ga0068862_101676820 3300005844 Unclassified 644
300 Ga0081455_10059130 3300005937 Bacteria 3238
301 Ga0070717_10008001 3300006028 Bacteria 7876
302 Ga0075432_10035274 3300006058 Bacteria 1738
303 Ga0070716_100142241 3300006173 Bacteria 1531
304 Ga0070716_100257184 3300006173 Unclassified 1193
305 Ga0097621_100065519 3300006237 Bacteria 2990
306 Ga0097621_100085250 3300006237 Bacteria 2634
307 Ga0097621_100231621 3300006237 Bacteria 1613
308 Ga0097621_100535913 3300006237 Unclassified 1064
309 Ga0097621_100976154 3300006237 Bacteria 792
310 Ga0068871_100079486 3300006358 Unclassified 2713
311 Ga0068871_100114530 3300006358 Bacteria 2272
312 Ga0068871_100118180 3300006358 Bacteria 2237
313 Ga0068871_101238524 3300006358 Bacteria 701
314 Ga0075428_100002730 3300006844 Bacteria 19206
315 Ga0075428_100015139 3300006844 Bacteria 8561
316 Ga0075428_100018622 3300006844 Bacteria 7674
317 Ga0075428_100072319 3300006844 Bacteria 3767
318 Ga0075428_100172891 3300006844 Unclassified 2341
319 Ga0075428_100379377 3300006844 Unclassified 1516
320 Ga0075428_100406631 3300006844 Unclassified 1458
321 Ga0075428_100876024 3300006844 Bacteria 953
322 Ga0075428_101640986 3300006844 Bacteria 672
323 Ga0075430_100003769 3300006846 Bacteria 12738
324 Ga0075430_100010183 3300006846 Bacteria 7962
325 Ga0075430_100035401 3300006846 Bacteria 4236
326 Ga0075430_100268119 3300006846 Bacteria 1413
327 Ga0075430_100297882 3300006846 Unclassified 1334
328 Ga0075430_100342591 3300006846 Unclassified 1235
329 Ga0075431_100021013 3300006847 Bacteria 6670
330 Ga0075431_100071107 3300006847 Bacteria 3589
331 Ga0075431_100114967 3300006847 Bacteria 2778
332 Ga0075431_100129847 3300006847 Unclassified 2600
333 Ga0075431_100564519 3300006847 Bacteria 1124
334 Ga0075431_100776865 3300006847 Bacteria 932
335 Ga0075433_10000616 3300006852 Bacteria 23761
336 Ga0075433_10002662 3300006852 Bacteria 13632
337 Ga0075433_10051543 3300006852 Bacteria 3584
338 Ga0075433_10158910 3300006852 Bacteria 2011
339 Ga0075433_10167183 3300006852 Bacteria 1957
340 Ga0075433_10387116 3300006852 Bacteria 1234
341 Ga0075433_10551605 3300006852 Bacteria 1013
342 Ga0075434_100000950 3300006871 Bacteria 23336
343 Ga0075434_100007177 3300006871 Bacteria 10302
344 Ga0075434_100024688 3300006871 Bacteria 5878
345 Ga0075434_100085384 3300006871 Unclassified 3155
346 Ga0075434_100086271 3300006871 Bacteria 3139
347 Ga0075434_100175032 3300006871 Bacteria 2166
348 Ga0075434_100520716 3300006871 Unclassified 1209
349 Ga0075434_100935801 3300006871 Bacteria 881
350 Ga0075429_100011117 3300006880 Bacteria 7792
351 Ga0075429_100049770 3300006880 Unclassified 3645
352 Ga0075429_100050986 3300006880 Bacteria 3601
353 Ga0075429_100051448 3300006880 Bacteria 3585
354 Ga0075429_100089006 3300006880 Unclassified 2691
355 Ga0075429_100123682 3300006880 Bacteria 2262
356 Ga0075429_100180591 3300006880 Bacteria 1849
357 Ga0075429_100187792 3300006880 Unclassified 1811
358 Ga0075429_100277802 3300006880 Bacteria 1467
359 Ga0068865_100063384 3300006881 Bacteria 2598
360 Ga0068865_100363506 3300006881 Bacteria 1176
361 Ga0068865_101404781 3300006881 Bacteria 623
362 Ga0075436_100274172 3300006914 Bacteria 1205
363 Ga0097620_100002872 3300006931 Bacteria 17487
364 Ga0097620_100003934 3300006931 Bacteria 15174
365 Ga0097620_100022068 3300006931 Bacteria 6382
366 Ga0097620_100029033 3300006931 Bacteria 5549
367 Ga0097620_100064346 3300006931 Bacteria 3700
368 Ga0097620_100134279 3300006931 Unclassified 2546
369 Ga0097620_100925855 3300006931 Bacteria 956
370 Ga0097620_101403901 3300006931 Bacteria 770
371 Ga0075435_100004577 3300007076 Bacteria 9520
372 Ga0075435_100143599 3300007076 Bacteria 2004
373 Ga0075435_100471944 3300007076 Bacteria 1083
374 Ga0075435_100621010 3300007076 Unclassified 938
375 Ga0075435_100825078 3300007076 Bacteria 808
376 Ga0099794_10029184 3300007265 Bacteria 2569
377 Ga0099794_10575416 3300007265 Unclassified 595
378 Ga0111539_10001555 3300009094 Bacteria 30549
379 Ga0111539_10013990 3300009094 Bacteria 10027
380 Ga0111539_10014413 3300009094 Bacteria 9867
381 Ga0111539_10044634 3300009094 Bacteria 5309
382 Ga0111539_10097812 3300009094 Bacteria 3448
383 Ga0111539_10136151 3300009094 Bacteria 2876
384 Ga0111539_10160393 3300009094 Unclassified 2630
385 Ga0111539_10175430 3300009094 Bacteria 2504
386 Ga0111539_10502944 3300009094 Bacteria 1412
387 Ga0105245_10706665 3300009098 Bacteria 1042
388 Ga0105247_10183276 3300009101 Bacteria 1398
389 Ga0105247_10266704 3300009101 Bacteria 1176
390 Ga0105247_11141394 3300009101 Unclassified 617
391 Ga0114129_10003246 3300009147 Bacteria 22822
392 Ga0114129_10014347 3300009147 Bacteria 11294
393 Ga0114129_10021698 3300009147 Bacteria 9113
394 Ga0114129_10043065 3300009147 Bacteria 6354
395 Ga0114129_10073691 3300009147 Bacteria 4757
396 Ga0114129_10074301 3300009147 Bacteria 4735
397 Ga0114129_10260538 3300009147 Bacteria 2324
398 Ga0114129_10667655 3300009147 Unclassified 1340
399 Ga0114129_10684241 3300009147 Bacteria 1320
400 Ga0114129_10931193 3300009147 Bacteria 1099
401 Ga0114129_11082329 3300009147 Unclassified 1005
402 Ga0114129_11112217 3300009147 Bacteria 989
403 Ga0114129_11674873 3300009147 Bacteria 777
404 Ga0114129_11865571 3300009147 Unclassified 730
405 Ga0114129_12056535 3300009147 Bacteria 690
406 Ga0114129_12411585 3300009147 Bacteria 630
407 Ga0114129_12546883 3300009147 Bacteria 611
408 Ga0105243_10006639 3300009148 Bacteria 8933
409 Ga0105243_10014126 3300009148 Bacteria 6040
410 Ga0105243_10356263 3300009148 Bacteria 1345
411 Ga0105243_10542055 3300009148 Unclassified 1110
412 Ga0105243_12158790 3300009148 Unclassified 593
413 Ga0105242_10022994 3300009176 Bacteria 4911
414 Ga0105242_10278753 3300009176 Bacteria 1518
415 Ga0105248_10188467 3300009177 Bacteria 2324
416 Ga0105248_10197798 3300009177 Unclassified 2265
417 Ga0105248_10353015 3300009177 Bacteria 1655
418 Ga0105248_10666924 3300009177 Bacteria 1173
419 Ga0105248_11720186 3300009177 Bacteria 711
420 Ga0105248_12143128 3300009177 Unclassified 636
421 Ga0105238_11571696 3300009551 Bacteria 687
422 Ga0105249_10001517 3300009553 Bacteria 20379
423 Ga0105249_10020569 3300009553 Bacteria 5902
424 Ga0105249_10271962 3300009553 Bacteria 1688
425 Ga0105249_11741905 3300009553 Bacteria 696
426 Ga0099796_10291993 3300010159 Bacteria 688
427 Ga0105246_10006946 3300011119 Bacteria 6924
428 Ga0105246_10164281 3300011119 Bacteria 1694
429 Ga0105246_11405743 3300011119 Bacteria 651
430 Ga0157339_1012642 3300012505 Unclassified 796
431 Ga0157371_10179565 3300013102 Bacteria 1514
432 Ga0157371_10379373 3300013102 Bacteria 1032
433 Ga0157374_10151079 3300013296 Bacteria 2258
434 Ga0157374_11013834 3300013296 Unclassified 849
435 Ga0157378_10249635 3300013297 Bacteria 1698
436 Ga0163162_10007906 3300013306 Bacteria 10363
437 Ga0163162_10228874 3300013306 Bacteria 1989
438 Ga0163162_10682927 3300013306 Bacteria 1149
439 Ga0163162_11331845 3300013306 Bacteria 816
440 Ga0157375_10073966 3300013308 Bacteria 3428
441 Ga0157375_10075434 3300013308 Bacteria 3397
442 Ga0157375_10101653 3300013308 Unclassified 2958
443 Ga0157375_10632570 3300013308 Bacteria 1227
444 Ga0157375_10706593 3300013308 Bacteria 1161
445 Ga0157375_10881249 3300013308 Bacteria 1040
446 Ga0163163_10008085 3300014325 Bacteria 9320
447 Ga0163163_10251832 3300014325 Bacteria 1816
448 Ga0163163_11826753 3300014325 Bacteria 668
449 Ga0163163_12027724 3300014325 Bacteria 635
450 Ga0163163_12040609 3300014325 Bacteria 633
451 Ga0157380_10012213 3300014326 Bacteria 6222
452 Ga0157380_10031871 3300014326 Bacteria 4049
453 Ga0157380_10033205 3300014326 Unclassified 3973
454 Ga0157380_10035075 3300014326 Bacteria 3873
455 Ga0157380_10054889 3300014326 Bacteria 3163
456 Ga0157380_10193539 3300014326 Bacteria 1798
457 Ga0157380_10318601 3300014326 Unclassified 1441
458 Ga0157380_10398774 3300014326 Unclassified 1305
459 Ga0157380_10470117 3300014326 Bacteria 1213
460 Ga0157380_10565883 3300014326 Bacteria 1118
461 Ga0157377_10016086 3300014745 Bacteria 3842
462 Ga0157377_10022423 3300014745 Bacteria 3334
463 Ga0157377_10140341 3300014745 Unclassified 1484
464 Ga0157377_10462394 3300014745 Bacteria 878
465 Ga0157379_10060936 3300014968 Bacteria 3374
466 Ga0157379_10095254 3300014968 Bacteria 2671
467 Ga0157376_10161608 3300014969 Bacteria 2031
468 Ga0157376_10480838 3300014969 Bacteria 1217
469 Ga0157376_10573489 3300014969 Bacteria 1120
470 Ga0163161_10094497 3300017792 Bacteria 2216
471 Ga0163161_10102008 3300017792 Bacteria 2137
472 Ga0163161_10222906 3300017792 Bacteria 1461
473 Ga0207673_1016061 3300025290 Unclassified 994
474 Ga0207697_10001790 3300025315 Bacteria 11496
475 Ga0207653_10070835 3300025885 Unclassified 1191
476 Ga0207653_10246993 3300025885 Bacteria 683
477 Ga0207682_10003881 3300025893 Bacteria 6393
478 Ga0207682_10054946 3300025893 Bacteria 1655
479 Ga0207682_10116478 3300025893 Bacteria 1181
480 Ga0207642_10027565 3300025899 Bacteria 2327
481 Ga0207642_10194821 3300025899 Bacteria 1115
482 Ga0207710_10115735 3300025900 Unclassified 1276
483 Ga0207688_10002313 3300025901 Bacteria 10244
484 Ga0207688_10136178 3300025901 Bacteria 1442
485 Ga0207688_10248161 3300025901 Bacteria 1078
486 Ga0207688_11020213 3300025901 Bacteria 523
487 Ga0207680_10148511 3300025903 Bacteria 1561
488 Ga0207680_10602821 3300025903 Bacteria 786
489 Ga0207647_10126430 3300025904 Bacteria 1504
490 Ga0207647_10209673 3300025904 Bacteria 1125
491 Ga0207699_10403318 3300025906 Bacteria 974
492 Ga0207645_10004825 3300025907 Bacteria 9904
493 Ga0207645_10012089 3300025907 Bacteria 5867
494 Ga0207645_10378167 3300025907 Bacteria 950
495 Ga0207645_10590991 3300025907 Bacteria 754
496 Ga0207645_10936653 3300025907 Unclassified 588
497 Ga0207643_10000719 3300025908 Bacteria 20342
498 Ga0207643_10008512 3300025908 Bacteria 5502
499 Ga0207643_10009042 3300025908 Bacteria 5350
500 Ga0207643_10057012 3300025908 Bacteria 2223
501 Ga0207643_10075341 3300025908 Bacteria 1947
502 Ga0207643_10180727 3300025908 Bacteria 1276
503 Ga0207643_10445792 3300025908 Bacteria 823
504 Ga0207684_10372795 3300025910 Bacteria 1228
505 Ga0207684_10677807 3300025910 Bacteria 877
506 Ga0207707_10566181 3300025912 Bacteria 964
507 Ga0207693_10138989 3300025915 Bacteria 1910
508 Ga0207663_10101275 3300025916 Bacteria 1935
509 Ga0207660_10298477 3300025917 Bacteria 1282
510 Ga0207660_10408746 3300025917 Unclassified 1094
511 Ga0207660_10495486 3300025917 Unclassified 991
512 Ga0207662_10004573 3300025918 Bacteria 7292
513 Ga0207662_10023004 3300025918 Bacteria 3576
514 Ga0207662_10055153 3300025918 Bacteria 2371
515 Ga0207649_10091822 3300025920 Bacteria 1989
516 Ga0207649_10387496 3300025920 Bacteria 1043
517 Ga0207649_10914034 3300025920 Bacteria 688
518 Ga0207646_10017561 3300025922 Bacteria 6689
519 Ga0207646_10036524 3300025922 Unclassified 4435
520 Ga0207646_10236938 3300025922 Bacteria 1649
521 Ga0207646_10321953 3300025922 Bacteria 1397
522 Ga0207646_10653006 3300025922 Bacteria 942
523 Ga0207681_10094096 3300025923 Bacteria 2146
524 Ga0207681_10156446 3300025923 Bacteria 1713
525 Ga0207681_10219731 3300025923 Unclassified 1469
526 Ga0207681_10259349 3300025923 Bacteria 1360
527 Ga0207681_10608425 3300025923 Bacteria 903
528 Ga0207681_10638965 3300025923 Unclassified 882
529 Ga0207681_10661638 3300025923 Bacteria 866
530 Ga0207650_10013492 3300025925 Bacteria 5661
531 Ga0207650_10169500 3300025925 Bacteria 1734
532 Ga0207650_10598234 3300025925 Bacteria 927
533 Ga0207659_10001109 3300025926 Bacteria 15962
534 Ga0207659_10003073 3300025926 Bacteria 9962
535 Ga0207659_10007393 3300025926 Bacteria 6751
536 Ga0207659_10008078 3300025926 Bacteria 6514
537 Ga0207659_10020702 3300025926 Bacteria 4353
538 Ga0207659_10061735 3300025926 Bacteria 2702
539 Ga0207659_10084112 3300025926 Bacteria 2360
540 Ga0207659_10141838 3300025926 Bacteria 1866
541 Ga0207659_10277468 3300025926 Bacteria 1369
542 Ga0207659_10969471 3300025926 Bacteria 731
543 Ga0207659_11304652 3300025926 Bacteria 623
544 Ga0207700_10003418 3300025928 Bacteria 9223
545 Ga0207664_10123930 3300025929 Unclassified 2167
546 Ga0207644_10023063 3300025931 Bacteria 4258
547 Ga0207644_10102964 3300025931 Unclassified 2148
548 Ga0207644_10214290 3300025931 Bacteria 1524
549 Ga0207644_10356650 3300025931 Bacteria 1188
550 Ga0207644_11080554 3300025931 Bacteria 674
551 Ga0207690_11459947 3300025932 Bacteria 572
552 Ga0207706_10009301 3300025933 Bacteria 9023
553 Ga0207706_10028229 3300025933 Bacteria 5012
554 Ga0207706_10137157 3300025933 Bacteria 2152
555 Ga0207706_10218950 3300025933 Bacteria 1667
556 Ga0207706_10234833 3300025933 Unclassified 1603
557 Ga0207686_10065287 3300025934 Bacteria 2320
558 Ga0207686_10649522 3300025934 Bacteria 834
559 Ga0207709_10006480 3300025935 Bacteria 6573
560 Ga0207709_10046532 3300025935 Bacteria 2633
561 Ga0207709_10289190 3300025935 Bacteria 1214
562 Ga0207709_10372004 3300025935 Bacteria 1085
563 Ga0207709_10622979 3300025935 Archaea 856
564 Ga0207670_10009697 3300025936 Bacteria 5508
565 Ga0207670_10080284 3300025936 Bacteria 2280
566 Ga0207670_10103355 3300025936 Bacteria 2039
567 Ga0207670_10364726 3300025936 Bacteria 1147
568 Ga0207670_10408426 3300025936 Bacteria 1087
569 Ga0207669_10244386 3300025937 Bacteria 1332
570 Ga0207669_10757789 3300025937 Bacteria 802
571 Ga0207669_11017080 3300025937 Bacteria 697
572 Ga0207669_11253302 3300025937 Bacteria 629
573 Ga0207704_10127595 3300025938 Bacteria 1755
574 Ga0207704_10319149 3300025938 Bacteria 1198
575 Ga0207704_10621973 3300025938 Bacteria 886
576 Ga0207665_10159792 3300025939 Bacteria 1620
577 Ga0207691_10043684 3300025940 Bacteria 4129
578 Ga0207691_10055697 3300025940 Bacteria 3603
579 Ga0207691_10063098 3300025940 Bacteria 3361
580 Ga0207691_10063756 3300025940 Unclassified 3342
581 Ga0207691_10145578 3300025940 Bacteria 2086
582 Ga0207691_10483483 3300025940 Bacteria 1052
583 Ga0207691_10489508 3300025940 Bacteria 1045
584 Ga0207711_10200732 3300025941 Bacteria 1820
585 Ga0207711_10508680 3300025941 Bacteria 1123
586 Ga0207711_11041091 3300025941 Bacteria 758
587 Ga0207689_10001069 3300025942 Bacteria 26389
588 Ga0207689_10009664 3300025942 Bacteria 8311
589 Ga0207689_10195850 3300025942 Bacteria 1668
590 Ga0207689_10348301 3300025942 Bacteria 1231
591 Ga0207689_11058466 3300025942 Bacteria 684
592 Ga0207689_11323075 3300025942 Bacteria 605
593 Ga0207689_11772148 3300025942 Bacteria 510
594 Ga0207661_10579930 3300025944 Bacteria 1029
595 Ga0207679_10021882 3300025945 Bacteria 4344
596 Ga0207679_10024068 3300025945 Unclassified 4172
597 Ga0207679_10220677 3300025945 Unclassified 1595
598 Ga0207651_10012062 3300025960 Bacteria 4868
599 Ga0207651_10042607 3300025960 Bacteria 3023
600 Ga0207651_10080713 3300025960 Unclassified 2342
601 Ga0207651_10100576 3300025960 Unclassified 2143
602 Ga0207651_10110987 3300025960 Bacteria 2059
603 Ga0207651_10476122 3300025960 Bacteria 1075
604 Ga0207651_10632920 3300025960 Bacteria 938
605 Ga0207712_10060348 3300025961 Bacteria 2688
606 Ga0207712_10067200 3300025961 Bacteria 2565
607 Ga0207712_10594295 3300025961 Bacteria 957
608 Ga0207668_10111199 3300025972 Bacteria 2056
609 Ga0207668_10143846 3300025972 Bacteria 1837
610 Ga0207668_10938308 3300025972 Unclassified 771
611 Ga0207668_11175777 3300025972 Bacteria 689
612 Ga0207640_10323796 3300025981 Bacteria 1228
613 Ga0207640_10618966 3300025981 Bacteria 919
614 Ga0207658_10247569 3300025986 Bacteria 1513
615 Ga0207658_10756704 3300025986 Bacteria 880
616 Ga0207658_11029403 3300025986 Unclassified 751
617 Ga0207658_11036730 3300025986 Bacteria 749
618 Ga0207677_10087334 3300026023 Unclassified 2257
619 Ga0207677_10464752 3300026023 Bacteria 1087
620 Ga0207677_11192386 3300026023 Bacteria 697
621 Ga0207677_11949181 3300026023 Bacteria 546
622 Ga0207703_10018309 3300026035 Bacteria 5470
623 Ga0207703_10488712 3300026035 Bacteria 1154
624 Ga0207703_10847568 3300026035 Unclassified 874
625 Ga0207703_11007335 3300026035 Bacteria 799
626 Ga0207639_12213150 3300026041 Bacteria 511
627 Ga0207678_10187933 3300026067 Bacteria 1765
628 Ga0207678_10566822 3300026067 Bacteria 994
629 Ga0207708_10003724 3300026075 Bacteria 11248
630 Ga0207708_10044031 3300026075 Bacteria 3401
631 Ga0207708_10069374 3300026075 Bacteria 2699
632 Ga0207708_10098955 3300026075 Bacteria 2255
633 Ga0207708_10282953 3300026075 Unclassified 1344
634 Ga0207641_10026606 3300026088 Bacteria 4776
635 Ga0207641_10075679 3300026088 Unclassified 2907
636 Ga0207641_10119671 3300026088 Bacteria 2348
637 Ga0207641_10309673 3300026088 Bacteria 1494
638 Ga0207641_10390122 3300026088 Bacteria 1335
639 Ga0207648_10000144 3300026089 Bacteria 70822
640 Ga0207648_10004637 3300026089 Bacteria 14075
641 Ga0207648_10464668 3300026089 Bacteria 1154
642 Ga0207676_10034387 3300026095 Bacteria 3837
643 Ga0207676_10040361 3300026095 Bacteria 3577
644 Ga0207676_10059474 3300026095 Unclassified 3018
645 Ga0207676_10167195 3300026095 Bacteria 1912
646 Ga0207676_10685681 3300026095 Bacteria 991
647 Ga0207674_10014747 3300026116 Bacteria 8622
648 Ga0207674_10041866 3300026116 Bacteria 4735
649 Ga0207674_10208078 3300026116 Bacteria 1905
650 Ga0207674_10486169 3300026116 Bacteria 1193
651 Ga0207674_10542407 3300026116 Bacteria 1124
652 Ga0207674_10773236 3300026116 Bacteria 927
653 Ga0207675_100009291 3300026118 Bacteria 9219
654 Ga0207675_100010261 3300026118 Bacteria 8777
655 Ga0207675_100017102 3300026118 Bacteria 6772
656 Ga0207675_100058080 3300026118 Bacteria 3610
657 Ga0207675_100188058 3300026118 Bacteria 1980
658 Ga0207675_100434274 3300026118 Bacteria 1299
659 Ga0207675_101391273 3300026118 Unclassified 722
660 Ga0207675_101987432 3300026118 Bacteria 599
661 Ga0207683_10009184 3300026121 Bacteria 8424
662 Ga0207683_10164565 3300026121 Bacteria 2007
663 Ga0207683_10184875 3300026121 Bacteria 1890
664 Ga0207683_10571601 3300026121 Bacteria 1045
665 Ga0207683_10619596 3300026121 Bacteria 1002
666 Ga0207698_10030727 3300026142 Unclassified 3868
667 Ga0209969_1054366 3300027360 Bacteria 630
668 Ga0209970_1074382 3300027614 Bacteria 633
669 Ga0209588_1089989 3300027671 Unclassified 989
670 Ga0209998_10026186 3300027717 Bacteria 1273
671 Ga0209974_10228929 3300027876 Bacteria 694
672 Ga0207428_10001961 3300027907 Bacteria 20884
673 Ga0207428_10002268 3300027907 Bacteria 19313
674 Ga0207428_10004387 3300027907 Bacteria 13451
675 Ga0207428_10007206 3300027907 Bacteria 10171
676 Ga0207428_10139775 3300027907 Bacteria 1849
677 Ga0207428_10537066 3300027907 Bacteria 847
678 Ga0207428_11055285 3300027907 Bacteria 569
679 Ga0268266_10015337 3300028379 Bacteria 6576
680 Ga0268266_10274382 3300028379 Unclassified 1566
681 Ga0268266_11065712 3300028379 Bacteria 782
682 Ga0268265_10001826 3300028380 Bacteria 17008
683 Ga0268265_10034431 3300028380 Bacteria 3692
684 Ga0268265_10133598 3300028380 Bacteria 2066
685 Ga0268265_10263578 3300028380 Unclassified 1533
686 Ga0268265_11713865 3300028380 Bacteria 634
687 Ga0268265_11754080 3300028380 Unclassified 627
688 Ga0268264_10005474 3300028381 Bacteria 10766
689 Ga0268264_10022129 3300028381 Bacteria 5189
690 Ga0268264_10241352 3300028381 Bacteria 1674
691 Ga0268264_10314169 3300028381 Bacteria 1479
692 Ga0268264_10417955 3300028381 Bacteria 1292
693 Ga0268264_10795990 3300028381 Bacteria 944
694 Ga0307412_10323481 3300031911 Bacteria 1228
695 Ga0307409_100154617 3300031995 Unclassified 1997
696 Ga0307416_100445012 3300032002 Archaea 1347
697 Ga0307416_100544760 3300032002 Bacteria 1233
698 Ga0307416_100713528 3300032002 Bacteria 1093
699 Ga0307416_100836611 3300032002 Unclassified 1018
700 Ga0307416_101341763 3300032002 Unclassified 821
701 Ga0307411_10496295 3300032005 Bacteria 1031
702 Ga0373948_0132751 3300034817 Bacteria 610
703 Ga0373950_0097878 3300034818 Unclassified 629
704 Ga0373958_0091664 3300034819 Bacteria 702
705 Ga0373959_0029708 3300034820 Bacteria 1098
706 Ga0373926_0014533 3300035083 Unclassified 2677
707 Ga0373928_0101492 3300035084 Bacteria 751
708 Ga0373951_0017699 3300035091 Bacteria 1614
709 Ga0373932_0003263 3300035112 Unclassified 3924
710 Ga0373939_0096588 3300035114 Bacteria 1007
711 Ga0373939_0173588 3300035114 Bacteria 799
712 Ga0373941_0229246 3300035115 Bacteria 717
713 Ga0373943_0023444 3300035170 Unclassified 2870
714 Ga0373942_0193580 3300035207 Bacteria 671
715 Ga0373962_0034641 3300035242 Bacteria 1399
716 Ga0373962_0124364 3300035242 Unclassified 825
717 Ga0373931_0141943 3300035691 Bacteria 1392
718 Ga0373931_0232460 3300035691 Bacteria 1114
719 Ga0373927_0002388 3300035695 Bacteria 13687
720 Ga0373947_0002666 3300035725 Bacteria 10725
721 Ga0373947_0140107 3300035725 Bacteria 1551
722 Ga0373947_0392198 3300035725 Bacteria 936
723 Ga0373925_0000143 3300037068 Bacteria 76104
724 Ga0373925_0345256 3300037068 Bacteria 1208
725 Ga0373925_1559459 3300037068 Unclassified 540
726 Ga0242420_039954 3300038996 Unclassified 894
727 Ga0436362_0306081 3300039453 Unclassified 764
728 Ga0436362_1282180 3300039453 Unclassified 1152
729 Ga0439453_0035315 3300041408 Unclassified 963
730 Ga0439453_0102205 3300041408 Bacteria 640
731 Ga0451804_0268028 3300041463 Bacteria 584
732 Ga0451853_2251524 3300041512 Bacteria 794
733 Ga0439451_084656 3300042009 Unclassified 638
734 Ga0450923_070569 3300042125 Bacteria 774
735 Ga0439446_0169923 3300042156 Unclassified 725
736 Ga0439434_0188127 3300042435 Bacteria 693
737 Ga0439435_0001066 3300042436 Bacteria 4855
738 Ga0439435_0324014 3300042436 Unclassified 531
739 Ga0439459_0081592 3300042438 Unclassified 764
740 Ga0439460_0050049 3300042461 Unclassified 1251
741 Ga0439440_0095765 3300042993 Bacteria 802
742 Ga0451576_0015029 3300045051 Bacteria 8599
743 Ga0451576_0020117 3300045051 Bacteria 7274
744 Ga0451576_0539471 3300045051 Bacteria 1225
745 Ga0451576_2651233 3300045051 Unclassified 511
746 Ga0495580_0011821 3300046472 Bacteria 6737
747 Ga0495580_0349385 3300046472 Bacteria 1002
748 Ga0495605_0365963 3300046474 Unclassified 603
749 Ga0495585_0546136 3300046492 Unclassified 548
750 Ga0495665_0435234 3300046531 Unclassified 664
751 Ga0495586_0077918 3300046535 Bacteria 1818
752 Ga0495598_0010836 3300046537 Unclassified 2195
753 Ga0495598_0161158 3300046537 Bacteria 789
754 Ga0495598_0461479 3300046537 Unclassified 504
755 Ga0495609_0128037 3300046538 Bacteria 1089
756 Ga0495609_0210896 3300046538 Bacteria 809
757 Ga0495621_0003642 3300046539 Bacteria 4254
758 Ga0495621_0090163 3300046539 Unclassified 1155
759 Ga0495621_0107379 3300046539 Bacteria 1068
760 Ga0495656_0191522 3300046615 Bacteria 1010
761 Ga0495656_0294992 3300046615 Bacteria 830
762 Ga0495656_0455625 3300046615 Unclassified 674
763 Ga0495659_0003235 3300046664 Bacteria 5220
764 Ga0495659_0025672 3300046664 Bacteria 2018
765 Ga0495659_0028645 3300046664 Unclassified 1929
766 Ga0495659_0162825 3300046664 Bacteria 901
767 Ga0495658_0178801 3300046683 Unclassified 1316
768 Ga0495669_0055259 3300046684 Bacteria 1788
769 Ga0495669_0083038 3300046684 Unclassified 1472
770 Ga0495669_0363686 3300046684 Bacteria 700
771 Ga0495669_0428566 3300046684 Unclassified 642
772 Ga0495636_0050818 3300047318 Bacteria 1736
773 Ga0495636_0052349 3300047318 Bacteria 1712
774 Ga0495677_0056686 3300047445 Bacteria 1448
775 Ga0495677_0260137 3300047445 Bacteria 679
776 Ga0495685_013084 3300047447 Unclassified 2814
777 Ga0496102_0735853 3300048905 Unclassified 909
778 Ga0496104_0210665 3300048907 Bacteria 1855
779 Ga0496106_0324898 3300048909 Bacteria 1235
780 Ga0496109_0304390 3300048912 Bacteria 1503
781 Ga0496110_0785149 3300048913 Unclassified 856
782 Ga0496112_0405482 3300048915 Bacteria 1303
783 Ga0496113_0085577 3300048916 Bacteria 2422
784 Ga0496114_0543142 3300048917 Bacteria 1027
785 Ga0501031_0316041 3300049568 Unclassified 1012
786 Ga0501033_0135580 3300049570 Bacteria 1781
787 Ga0501033_0560909 3300049570 Unclassified 786
788 Ga0501033_0718541 3300049570 Bacteria 679
789 Ga0501034_1284720 3300049571 Unclassified 609
790 Ga0501036_0006517 3300049572 Bacteria 9484
791 Ga0501036_0015546 3300049572 Bacteria 6359
792 Ga0501036_0043039 3300049572 Bacteria 3824
793 Ga0501037_0053504 3300049573 Bacteria 2953
794 Ga0501037_0377162 3300049573 Unclassified 975
795 Ga0501038_0415818 3300049574 Bacteria 1038
796 Ga0501039_0012801 3300049575 Bacteria 6413
797 Ga0501039_0168201 3300049575 Bacteria 1723
798 Ga0501039_1217611 3300049575 Bacteria 582
799 Ga0501040_0011449 3300049576 Bacteria 5808
800 Ga0501040_0012271 3300049576 Bacteria 5613
801 Ga0501040_0012274 3300049576 Bacteria 5612
802 Ga0501040_0026883 3300049576 Unclassified 3872
803 Ga0501041_0005678 3300049577 Bacteria 7292
804 Ga0501041_0005712 3300049577 Bacteria 7269
805 Ga0501041_0212142 3300049577 Unclassified 1214
806 Ga0501041_0482548 3300049577 Bacteria 788
807 Ga0501042_0001586 3300049578 Bacteria 13496
808 Ga0501042_0007901 3300049578 Bacteria 6997
809 Ga0501042_0014823 3300049578 Bacteria 5325
810 Ga0501042_0048198 3300049578 Unclassified 3038
811 Ga0501042_0984645 3300049578 Bacteria 614
812 Ga0501043_0036253 3300049579 Bacteria 3879
813 Ga0501043_0165115 3300049579 Unclassified 1729
814 Ga0501043_0353426 3300049579 Unclassified 1116
815 Ga0501046_0022494 3300049580 Bacteria 5194
816 Ga0501046_0034854 3300049580 Bacteria 4059
817 Ga0501046_0071352 3300049580 Unclassified 2699
818 Ga0501046_0235541 3300049580 Bacteria 1351
819 Ga0501048_0013516 3300049582 Bacteria 6057
820 Ga0501048_0045174 3300049582 Bacteria 3148
821 Ga0501067_0132290 3300049583 Bacteria 1389
822 Ga0501068_0022396 3300049584 Bacteria 3695
823 Ga0501070_0295328 3300049586 Bacteria 1321
824 Ga0501071_0010264 3300049587 Bacteria 6268
825 Ga0501071_0016080 3300049587 Bacteria 5143
826 Ga0501071_0561499 3300049587 Unclassified 877
827 Ga0501072_0014626 3300049588 Bacteria 6015
828 Ga0501072_0029045 3300049588 Bacteria 4317
829 Ga0501072_0905690 3300049588 Bacteria 689
830 Ga0501074_0069889 3300049590 Bacteria 2525
831 Ga0501074_0192198 3300049590 Bacteria 1455
832 Ga0501075_0000268 3300049591 Bacteria 28521
833 Ga0501075_0013423 3300049591 Bacteria 5844
834 Ga0501075_0077307 3300049591 Unclassified 2519
835 Ga0501075_0177902 3300049591 Unclassified 1623
836 Ga0501075_0807668 3300049591 Bacteria 714
837 Ga0501075_1114980 3300049591 Unclassified 599
838 Ga0501076_0004709 3300049592 Bacteria 9731
839 Ga0501076_0005998 3300049592 Bacteria 8776
840 Ga0501076_0256407 3300049592 Bacteria 1432
841 Ga0501077_0044953 3300049593 Bacteria 2805
842 Ga0501077_0384800 3300049593 Unclassified 896
843 Ga0501077_0482293 3300049593 Bacteria 795
844 Ga0501249_045699 3300049679 Bacteria 999
845 Ga0501245_004579 3300049708 Bacteria 1900
846 Ga0501079_0000628 3300049741 Bacteria 23440
847 Ga0501079_0002955 3300049741 Bacteria 12428
848 Ga0501079_0043815 3300049741 Bacteria 3454
849 Ga0501079_0388428 3300049741 Unclassified 1094
850 Ga0501079_1550035 3300049741 Unclassified 521
851 Ga0501080_0057691 3300049742 Bacteria 3615
852 Ga0501080_0084132 3300049742 Bacteria 2956
853 Ga0501080_1061816 3300049742 Unclassified 700
854 Ga0501081_0006126 3300049743 Bacteria 7795
855 Ga0501081_0021904 3300049743 Unclassified 4270
856 Ga0501081_0023491 3300049743 Bacteria 4132
857 Ga0501081_0482947 3300049743 Bacteria 922
858 Ga0501083_0383693 3300049744 Unclassified 914
859 Ga0501083_0488705 3300049744 Unclassified 801
860 Ga0501083_0986879 3300049744 Bacteria 548
861 Ga0501268_031902 3300049765 Bacteria 958
862 Ga0501283_012208 3300049779 Bacteria 1288
863 Ga0501045_0013214 3300049824 Bacteria 5824
864 Ga0501045_0013639 3300049824 Bacteria 5744
865 Ga0501045_0045171 3300049824 Unclassified 3208
866 Ga0501045_0113015 3300049824 Bacteria 2014
867 nmdc:mga05p37_1039442_c1 3300050507 Bacteria 865
868 nmdc:mga05p37_1081459_c1 3300050507 Unclassified 842
869 nmdc:mga05p37_1098_c1 3300050507 Bacteria 31079
870 nmdc:mga05p37_1321194_c1 3300050507 Bacteria 733
871 nmdc:mga05p37_173071_c1 3300050507 Bacteria 2632
872 nmdc:mga05p37_1800084_c1 3300050507 Unclassified 591
873 nmdc:mga05p37_182714_c1 3300050507 Bacteria 2551
874 nmdc:mga05p37_20113_c1 3300050507 Bacteria 8079
875 nmdc:mga05p37_217986_c1 3300050507 Bacteria 2304
876 nmdc:mga05p37_263869_c1 3300050507 Bacteria 2060
877 nmdc:mga05p37_31490_c2 3300050507 Bacteria 3729
878 nmdc:mga05p37_331663_c1 3300050507 Unclassified 1797
879 nmdc:mga05p37_339747_c1 3300050507 Bacteria 1771
880 nmdc:mga05p37_41099_c1 3300050507 Bacteria 5678
881 nmdc:mga05p37_967463_c1 3300050507 Bacteria 909
882 nmdc:mga09592_119986_c1 3300050508 Bacteria 2258
883 nmdc:mga09592_223441_c1 3300050508 Unclassified 1631
884 nmdc:mga09592_410769_c1 3300050508 Bacteria 1170
885 nmdc:mga09592_45067_c1 3300050508 Bacteria 3715
886 nmdc:mga09592_47639_c1 3300050508 Bacteria 3613
887 nmdc:mga09592_61465_c1 3300050508 Bacteria 3177
888 nmdc:mga09592_69703_c1 3300050508 Unclassified 2983
889 nmdc:mga09592_717546_c1 3300050508 Bacteria 850
890 nmdc:mga09592_898607_c1 3300050508 Bacteria 745
891 nmdc:mga09592_9774_c1 3300050508 Bacteria 7795
892 nmdc:mga0qj67_1031_c1 3300050509 Bacteria 19266
893 nmdc:mga0qj67_1147687_c1 3300050509 Unclassified 606
894 nmdc:mga0qj67_119828_c1 3300050509 Bacteria 2128
895 nmdc:mga0qj67_127418_c1 3300050509 Bacteria 2060
896 nmdc:mga0qj67_165669_c1 3300050509 Bacteria 1794
897 nmdc:mga0qj67_199896_c1 3300050509 Bacteria 1624
898 nmdc:mga0qj67_207300_c1 3300050509 Bacteria 1592
899 nmdc:mga0qj67_390648_c1 3300050509 Unclassified 1123
900 nmdc:mga0qj67_74329_c1 3300050509 Bacteria 2716
901 nmdc:mga06r32_102480_c1 3300050510 Bacteria 2810
902 nmdc:mga06r32_11151_c1 3300050510 Bacteria 8094
903 nmdc:mga06r32_42494_c1 3300050510 Bacteria 4322
904 nmdc:mga06r32_456738_c1 3300050510 Bacteria 1257
905 nmdc:mga06r32_558096_c1 3300050510 Bacteria 1119
906 nmdc:mga06r32_648885_c1 3300050510 Bacteria 1024
907 nmdc:mga06r32_92505_c1 3300050510 Unclassified 2957
908 nmdc:mga08y16_12159_c1 3300050511 Bacteria 9048
909 nmdc:mga08y16_148435_c1 3300050511 Unclassified 2437
910 nmdc:mga08y16_1686052_c1 3300050511 Bacteria 589
911 nmdc:mga08y16_207037_c1 3300050511 Bacteria 2032
912 nmdc:mga08y16_232851_c1 3300050511 Bacteria 1905
913 nmdc:mga08y16_244481_c1 3300050511 Unclassified 1854
914 nmdc:mga08y16_31440_c1 3300050511 Bacteria 5583
915 nmdc:mga08y16_503107_c1 3300050511 Bacteria 1231
916 nmdc:mga08y16_670_c1 3300050511 Bacteria 32365
917 nmdc:mga08y16_6941_c1 3300050511 Bacteria 11870
918 nmdc:mga08y16_80156_c1 3300050511 Bacteria 3404
919 nmdc:mga0n895_201838_c1 3300050512 Bacteria 2019
920 nmdc:mga0n895_25280_c1 3300050512 Bacteria 5609
921 nmdc:mga0n895_284128_c1 3300050512 Bacteria 1678
922 nmdc:mga0n895_429_c1 3300050512 Bacteria 28206
923 nmdc:mga0n895_589694_c1 3300050512 Unclassified 1115
924 nmdc:mga0rr50_1117497_c1 3300050513 Unclassified 670
925 nmdc:mga0rr50_210315_c1 3300050513 Bacteria 1602
926 nmdc:mga0rr50_42396_c1 3300050513 Bacteria 3323
927 nmdc:mga0rr50_77440_c1 3300050513 Bacteria 2555
928 nmdc:mga08x19_278354_c1 3300050514 Bacteria 1159
929 nmdc:mga08x19_373327_c1 3300050514 Unclassified 998
930 nmdc:mga0a205_1627_c1 3300050515 Bacteria 19317
931 nmdc:mga0a205_546922_c1 3300050515 Bacteria 1013
932 nmdc:mga0a205_84831_c1 3300050515 Bacteria 3060
933 nmdc:mga0a205_867_c1 3300050515 Bacteria 24788
934 nmdc:mga0a205_8857_c1 3300050515 Bacteria 9169
935 nmdc:mga0a205_928371_c1 3300050515 Unclassified 717
936 Ga0501084_0010418 3300054114 Bacteria 7688
937 Ga0501084_0017927 3300054114 Bacteria 5895
938 Ga0501084_0018490 3300054114 Bacteria 5801
939 Ga0501084_0068690 3300054114 Bacteria 2966
940 Ga0501084_0551773 3300054114 Unclassified 974
941 Ga0501084_0818812 3300054114 Unclassified 784
942 Ga0501082_0002583 3300060353 Bacteria 15835
943 Ga0501082_0012187 3300060353 Bacteria 7387
944 Ga0501082_0049473 3300060353 Bacteria 3625
945 Ga0501082_0137506 3300060353 Unclassified 2120
946 Ga0530510_0000557 3300061734 Bacteria 24044
947 Ga0530510_0075231 3300061734 Unclassified 2452
948 Ga0530510_0128788 3300061734 Archaea 1861
949 Ga0501070_0929913
950 SwRhRL2b_contig_1258267
951 rootH1_10332194
952 Ga0058859_11236937
953 Ga0058859_11334503
954 Ga0058860_12103558
955 Ga0065704_10012427
956 Ga0065704_10017203
957 Ga0065704_10090174
958 Ga0065712_10068024
959 Ga0065712_10114113
960 Ga0065712_10310957
961 Ga0065712_10373566
962 Ga0065715_10000766
963 Ga0065715_10004374
964 Ga0065715_10011502
965 Ga0065715_10113264
966 Ga0065707_10001773
967 Ga0065707_10004206
968 Ga0065707_10088576
969 Ga0065707_10190209
970 Ga0065707_10222241
971 Ga0065707_10421871
972 Ga0065707_10990295
973 Ga0070676_10002130
974 Ga0070676_10008509
975 Ga0070676_10196921
976 Ga0070676_10277113
977 Ga0070676_10448111
978 Ga0070676_10774466
979 Ga0070676_11174988
980 Ga0070690_100006833
981 Ga0070690_100019611
982 Ga0070690_100035456
983 Ga0070670_100006214
984 Ga0070670_100019553
985 Ga0070677_10004228
986 Ga0068869_100004349
987 Ga0068869_100006944
988 Ga0068869_100188677
989 Ga0068869_100369038
990 Ga0068869_100523565
991 Ga0068869_100657405
992 Ga0068869_101189490
993 Ga0068869_101203171
994 Ga0068869_101696026
995 Ga0068869_102054456
996 Ga0070666_10004014
997 Ga0070666_10257807
998 Ga0070666_10940536
999 Ga0070666_11337239
1000 Ga0070680_100266524
1001 Ga0070680_100438756
1002 Ga0070680_100754069
1003 Ga0068868_100122031
1004 Ga0068868_100219482
1005 Ga0070689_100007401
1006 Ga0070689_100009672
1007 Ga0070689_100013527
1008 Ga0070689_100084397
1009 Ga0070689_100179522
1010 Ga0070689_100317711
1011 Ga0070689_100486255
1012 Ga0070689_101751131
1013 Ga0070691_10883709
1014 Ga0070687_100105926
1015 Ga0070687_100204337
1016 Ga0070661_100009957
1017 Ga0070661_101390405
1018 Ga0070692_10016485
1019 Ga0070692_10189938
1020 Ga0070692_10578511
1021 Ga0070668_100045307
1022 Ga0070668_100072618
1023 Ga0070668_100205989
1024 Ga0070668_101509747
1025 Ga0070669_100011599
1026 Ga0070669_100014609
1027 Ga0070669_100046196
1028 Ga0070669_100049163
1029 Ga0070669_100096307
1030 Ga0070669_100468997
1031 Ga0070669_100716712
1032 Ga0070669_101382842
1033 Ga0070675_100002265
1034 Ga0070675_100002427
1035 Ga0070675_100004043
1036 Ga0070675_100006488
1037 Ga0070675_100020169
1038 Ga0070675_100049358
1039 Ga0070675_100098495
1040 Ga0070675_100122555
1041 Ga0070675_100158624
1042 Ga0070675_100168290
1043 Ga0070675_100492599
1044 Ga0070675_100558615
1045 Ga0070675_101138543
1046 Ga0070671_100008742
1047 Ga0070671_100052868
1048 Ga0070671_100059946
1049 Ga0070671_100412497
1050 Ga0070671_101463564
1051 Ga0070674_100008366
1052 Ga0070674_100028325
1053 Ga0070674_100076325
1054 Ga0070674_100208657
1055 Ga0070674_100370335
1056 Ga0070674_100557676
1057 Ga0070674_100912380
1058 Ga0070674_100962441
1059 Ga0070674_101670553
1060 Ga0070673_100013101
1061 Ga0070673_100019662
1062 Ga0070673_100024386
1063 Ga0070673_100072817
1064 Ga0070673_100268772
1065 Ga0070673_100514080
1066 Ga0070673_100663185
1067 Ga0070688_100004251
1068 Ga0070688_100030597
1069 Ga0070688_100284249
1070 Ga0070688_100577600
1071 Ga0070688_101637661
1072 Ga0070659_100821726
1073 Ga0070659_101199680
1074 Ga0070667_100021283
1075 Ga0070709_10697928
1076 Ga0070714_100006277
1077 Ga0070713_100001089
1078 Ga0070710_10409248
1079 Ga0070701_10007994
1080 Ga0070701_10011952
1081 Ga0070701_10052800
1082 Ga0070701_10149205
1083 Ga0070701_11337489
1084 Ga0070711_100030198
1085 Ga0070711_100763122
1086 Ga0070705_100002851
1087 Ga0070705_100011812
1088 Ga0070705_100065077
1089 Ga0070700_100002700
1090 Ga0070700_100008474
1091 Ga0070700_100075791
1092 Ga0070700_100109781
1093 Ga0070700_100572546
1094 Ga0070700_100591406
1095 Ga0070700_101055032
1096 Ga0070694_100001762
1097 Ga0070694_100005154
1098 Ga0070694_100029352
1099 Ga0070694_100221530
1100 Ga0070694_100222347
1101 Ga0070694_100260206
1102 Ga0070694_100281438
1103 Ga0070694_100613499
1104 Ga0070694_100756998
1105 Ga0070708_100059084
1106 Ga0070708_100585494
1107 Ga0070663_100467382
1108 Ga0070663_100602495
1109 Ga0070663_100800391
1110 Ga0070678_100004885
1111 Ga0070678_100094772
1112 Ga0070678_100224186
1113 Ga0070662_100046881
1114 Ga0070662_100061885
1115 Ga0070662_100363014
1116 Ga0070662_100366535
1117 Ga0070681_11464175
1118 Ga0068867_100000229
1119 Ga0068867_100002574
1120 Ga0068867_100100152
1121 Ga0068867_100471483
1122 Ga0068867_101561603
1123 Ga0070685_10004167
1124 Ga0070685_10059731
1125 Ga0070685_10340581
1126 Ga0070685_10443497
1127 Ga0070706_100939545
1128 Ga0070707_100015672
1129 Ga0070707_100071294
1130 Ga0070707_100157196
1131 Ga0070707_100755647
1132 Ga0070707_100782439
1133 Ga0070698_100001553
1134 Ga0070698_100003210
1135 Ga0070698_100144917
1136 Ga0070698_100486693
1137 Ga0070698_100514760
1138 Ga0070698_100518941
1139 Ga0070698_101141623
1140 Ga0070698_101502185
1141 Ga0070699_100000567
1142 Ga0070699_100014400
1143 Ga0070699_100094291
1144 Ga0070699_100946025
1145 Ga0070679_101787458
1146 Ga0070684_100162112
1147 Ga0070697_100072873
1148 Ga0070697_100114816
1149 Ga0070697_100208335
1150 Ga0070697_101925381
1151 Ga0068853_101925889
1152 Ga0068853_102229572
1153 Ga0070672_100002796
1154 Ga0070672_100059499
1155 Ga0070672_100075045
1156 Ga0070672_100184472
1157 Ga0070672_100199416
1158 Ga0070672_100273278
1159 Ga0070672_100314422
1160 Ga0070672_100506553
1161 Ga0070686_100008216
1162 Ga0070686_100019208
1163 Ga0070686_100419797
1164 Ga0070686_100488134
1165 Ga0070695_100000224
1166 Ga0070695_100047411
1167 Ga0070695_100152944
1168 Ga0070695_100530372
1169 Ga0070696_100005480
1170 Ga0070696_100043739
1171 Ga0070696_100073242
1172 Ga0070696_100129190
1173 Ga0070696_100433849
1174 Ga0070696_101495916
1175 Ga0070665_101268475
1176 Ga0070704_100002482
1177 Ga0070704_100010762
1178 Ga0070704_100030713
1179 Ga0070704_100097976
1180 Ga0070704_100173574
1181 Ga0070664_100005747
1182 Ga0070664_100221993
1183 Ga0070664_100228242
1184 Ga0070664_100313440
1185 Ga0068857_100626726
1186 Ga0068857_100759174
1187 Ga0068857_100797550
1188 Ga0068854_100101312
1189 Ga0068854_100368821
1190 Ga0068854_101272929
1191 Ga0070702_100042808
1192 Ga0070702_100068238
1193 Ga0070702_100080722
1194 Ga0070702_100138402
1195 Ga0068852_100115953
1196 Ga0068859_100002873
1197 Ga0068859_100003933
1198 Ga0068859_100022071
1199 Ga0068859_100029033
1200 Ga0068859_100064345
1201 Ga0068859_100134284
1202 Ga0068859_100925841
1203 Ga0068859_101403914
1204 Ga0068864_100029090
1205 Ga0068864_100051552
1206 Ga0068864_100244655
1207 Ga0068864_100262786
1208 Ga0068864_100430938
1209 Ga0068864_100647179
1210 Ga0068864_100921521
1211 Ga0068864_101191076
1212 Ga0068866_10154852
1213 Ga0068861_100005161
1214 Ga0068861_100017323
1215 Ga0068861_100139134
1216 Ga0068861_101167301
1217 Ga0068861_102282927
1218 Ga0068870_10000872
1219 Ga0068870_10004262
1220 Ga0068870_10076281
1221 Ga0068870_10184558
1222 Ga0068870_10244299
1223 Ga0068870_10313683
1224 Ga0068870_10916190
1225 Ga0068863_100002061
1226 Ga0068863_100052741
1227 Ga0068863_100178488
1228 Ga0068863_100333889
1229 Ga0068863_100440924
1230 Ga0068863_100810502
1231 Ga0068863_100875398
1232 Ga0068863_101580293
1233 Ga0068858_100008740
1234 Ga0068858_100026137
1235 Ga0068858_100178835
1236 Ga0068858_100336001
1237 Ga0068858_100643993
1238 Ga0068860_100005513
1239 Ga0068860_100038517
1240 Ga0068860_100152118
1241 Ga0068860_100226513
1242 Ga0068860_100336732
1243 Ga0068862_100003220
1244 Ga0068862_100012749
1245 Ga0068862_100118584
1246 Ga0068862_101054733
1247 Ga0068862_101676820
1248 Ga0081455_10059130
1249 Ga0070717_10008001
1250 Ga0075432_10035274
1251 Ga0070716_100142241
1252 Ga0070716_100257184
1253 Ga0097621_100065519
1254 Ga0097621_100085250
1255 Ga0097621_100231621
1256 Ga0097621_100535913
1257 Ga0097621_100976154
1258 Ga0068871_100079486
1259 Ga0068871_100114530
1260 Ga0068871_100118180
1261 Ga0068871_101238524
1262 Ga0075428_100002730
1263 Ga0075428_100015139
1264 Ga0075428_100018622
1265 Ga0075428_100072319
1266 Ga0075428_100172891
1267 Ga0075428_100379377
1268 Ga0075428_100406631
1269 Ga0075428_100876024
1270 Ga0075428_101640986
1271 Ga0075430_100003769
1272 Ga0075430_100010183
1273 Ga0075430_100035401
1274 Ga0075430_100268119
1275 Ga0075430_100297882
1276 Ga0075430_100342591
1277 Ga0075431_100021013
1278 Ga0075431_100071107
1279 Ga0075431_100114967
1280 Ga0075431_100129847
1281 Ga0075431_100564519
1282 Ga0075431_100776865
1283 Ga0075433_10000616
1284 Ga0075433_10002662
1285 Ga0075433_10051543
1286 Ga0075433_10158910
1287 Ga0075433_10167183
1288 Ga0075433_10387116
1289 Ga0075433_10551605
1290 Ga0075434_100000950
1291 Ga0075434_100007177
1292 Ga0075434_100024688
1293 Ga0075434_100085384
1294 Ga0075434_100086271
1295 Ga0075434_100175032
1296 Ga0075434_100520716
1297 Ga0075434_100935801
1298 Ga0075429_100011117
1299 Ga0075429_100049770
1300 Ga0075429_100050986
1301 Ga0075429_100051448
1302 Ga0075429_100089006
1303 Ga0075429_100123682
1304 Ga0075429_100180591
1305 Ga0075429_100187792
1306 Ga0075429_100277802
1307 Ga0068865_100063384
1308 Ga0068865_100363506
1309 Ga0068865_101404781
1310 Ga0075436_100274172
1311 Ga0097620_100002872
1312 Ga0097620_100003934
1313 Ga0097620_100022068
1314 Ga0097620_100029033
1315 Ga0097620_100064346
1316 Ga0097620_100134279
1317 Ga0097620_100925855
1318 Ga0097620_101403901
1319 Ga0075435_100004577
1320 Ga0075435_100143599
1321 Ga0075435_100471944
1322 Ga0075435_100621010
1323 Ga0075435_100825078
1324 Ga0099794_10029184
1325 Ga0099794_10575416
1326 Ga0111539_10001555
1327 Ga0111539_10013990
1328 Ga0111539_10014413
1329 Ga0111539_10044634
1330 Ga0111539_10097812
1331 Ga0111539_10136151
1332 Ga0111539_10160393
1333 Ga0111539_10175430
1334 Ga0111539_10502944
1335 Ga0105245_10706665
1336 Ga0105247_10183276
1337 Ga0105247_10266704
1338 Ga0105247_11141394
1339 Ga0114129_10003246
1340 Ga0114129_10014347
1341 Ga0114129_10021698
1342 Ga0114129_10043065
1343 Ga0114129_10073691
1344 Ga0114129_10074301
1345 Ga0114129_10260538
1346 Ga0114129_10667655
1347 Ga0114129_10684241
1348 Ga0114129_10931193
1349 Ga0114129_11082329
1350 Ga0114129_11112217
1351 Ga0114129_11674873
1352 Ga0114129_11865571
1353 Ga0114129_12056535
1354 Ga0114129_12411585
1355 Ga0114129_12546883
1356 Ga0105243_10006639
1357 Ga0105243_10014126
1358 Ga0105243_10356263
1359 Ga0105243_10542055
1360 Ga0105243_12158790
1361 Ga0105242_10022994
1362 Ga0105242_10278753
1363 Ga0105248_10188467
1364 Ga0105248_10197798
1365 Ga0105248_10353015
1366 Ga0105248_10666924
1367 Ga0105248_11720186
1368 Ga0105248_12143128
1369 Ga0105238_11571696
1370 Ga0105249_10001517
1371 Ga0105249_10020569
1372 Ga0105249_10271962
1373 Ga0105249_11741905
1374 Ga0099796_10291993
1375 Ga0105246_10006946
1376 Ga0105246_10164281
1377 Ga0105246_11405743
1378 Ga0157339_1012642
1379 Ga0157371_10179565
1380 Ga0157371_10379373
1381 Ga0157374_10151079
1382 Ga0157374_11013834
1383 Ga0157378_10249635
1384 Ga0163162_10007906
1385 Ga0163162_10228874
1386 Ga0163162_10682927
1387 Ga0163162_11331845
1388 Ga0157375_10073966
1389 Ga0157375_10075434
1390 Ga0157375_10101653
1391 Ga0157375_10632570
1392 Ga0157375_10706593
1393 Ga0157375_10881249
1394 Ga0163163_10008085
1395 Ga0163163_10251832
1396 Ga0163163_11826753
1397 Ga0163163_12027724
1398 Ga0163163_12040609
1399 Ga0157380_10012213
1400 Ga0157380_10031871
1401 Ga0157380_10033205
1402 Ga0157380_10035075
1403 Ga0157380_10054889
1404 Ga0157380_10193539
1405 Ga0157380_10318601
1406 Ga0157380_10398774
1407 Ga0157380_10470117
1408 Ga0157380_10565883
1409 Ga0157377_10016086
1410 Ga0157377_10022423
1411 Ga0157377_10140341
1412 Ga0157377_10462394
1413 Ga0157379_10060936
1414 Ga0157379_10095254
1415 Ga0157376_10161608
1416 Ga0157376_10480838
1417 Ga0157376_10573489
1418 Ga0163161_10094497
1419 Ga0163161_10102008
1420 Ga0163161_10222906
1421 Ga0207673_1016061
1422 Ga0207697_10001790
1423 Ga0207653_10070835
1424 Ga0207653_10246993
1425 Ga0207682_10003881
1426 Ga0207682_10054946
1427 Ga0207682_10116478
1428 Ga0207642_10027565
1429 Ga0207642_10194821
1430 Ga0207710_10115735
1431 Ga0207688_10002313
1432 Ga0207688_10136178
1433 Ga0207688_10248161
1434 Ga0207688_11020213
1435 Ga0207680_10148511
1436 Ga0207680_10602821
1437 Ga0207647_10126430
1438 Ga0207647_10209673
1439 Ga0207699_10403318
1440 Ga0207645_10004825
1441 Ga0207645_10012089
1442 Ga0207645_10378167
1443 Ga0207645_10590991
1444 Ga0207645_10936653
1445 Ga0207643_10000719
1446 Ga0207643_10008512
1447 Ga0207643_10009042
1448 Ga0207643_10057012
1449 Ga0207643_10075341
1450 Ga0207643_10180727
1451 Ga0207643_10445792
1452 Ga0207684_10372795
1453 Ga0207684_10677807
1454 Ga0207707_10566181
1455 Ga0207693_10138989
1456 Ga0207663_10101275
1457 Ga0207660_10298477
1458 Ga0207660_10408746
1459 Ga0207660_10495486
1460 Ga0207662_10004573
1461 Ga0207662_10023004
1462 Ga0207662_10055153
1463 Ga0207649_10091822
1464 Ga0207649_10387496
1465 Ga0207649_10914034
1466 Ga0207646_10017561
1467 Ga0207646_10036524
1468 Ga0207646_10236938
1469 Ga0207646_10321953
1470 Ga0207646_10653006
1471 Ga0207681_10094096
1472 Ga0207681_10156446
1473 Ga0207681_10219731
1474 Ga0207681_10259349
1475 Ga0207681_10608425
1476 Ga0207681_10638965
1477 Ga0207681_10661638
1478 Ga0207650_10013492
1479 Ga0207650_10169500
1480 Ga0207650_10598234
1481 Ga0207659_10001109
1482 Ga0207659_10003073
1483 Ga0207659_10007393
1484 Ga0207659_10008078
1485 Ga0207659_10020702
1486 Ga0207659_10061735
1487 Ga0207659_10084112
1488 Ga0207659_10141838
1489 Ga0207659_10277468
1490 Ga0207659_10969471
1491 Ga0207659_11304652
1492 Ga0207700_10003418
1493 Ga0207664_10123930
1494 Ga0207644_10023063
1495 Ga0207644_10102964
1496 Ga0207644_10214290
1497 Ga0207644_10356650
1498 Ga0207644_11080554
1499 Ga0207690_11459947
1500 Ga0207706_10009301
1501 Ga0207706_10028229
1502 Ga0207706_10137157
1503 Ga0207706_10218950
1504 Ga0207706_10234833
1505 Ga0207686_10065287
1506 Ga0207686_10649522
1507 Ga0207709_10006480
1508 Ga0207709_10046532
1509 Ga0207709_10289190
1510 Ga0207709_10372004
1511 Ga0207709_10622979
1512 Ga0207670_10009697
1513 Ga0207670_10080284
1514 Ga0207670_10103355
1515 Ga0207670_10364726
1516 Ga0207670_10408426
1517 Ga0207669_10244386
1518 Ga0207669_10757789
1519 Ga0207669_11017080
1520 Ga0207669_11253302
1521 Ga0207704_10127595
1522 Ga0207704_10319149
1523 Ga0207704_10621973
1524 Ga0207665_10159792
1525 Ga0207691_10043684
1526 Ga0207691_10055697
1527 Ga0207691_10063098
1528 Ga0207691_10063756
1529 Ga0207691_10145578
1530 Ga0207691_10483483
1531 Ga0207691_10489508
1532 Ga0207711_10200732
1533 Ga0207711_10508680
1534 Ga0207711_11041091
1535 Ga0207689_10001069
1536 Ga0207689_10009664
1537 Ga0207689_10195850
1538 Ga0207689_10348301
1539 Ga0207689_11058466
1540 Ga0207689_11323075
1541 Ga0207689_11772148
1542 Ga0207661_10579930
1543 Ga0207679_10021882
1544 Ga0207679_10024068
1545 Ga0207679_10220677
1546 Ga0207651_10012062
1547 Ga0207651_10042607
1548 Ga0207651_10080713
1549 Ga0207651_10100576
1550 Ga0207651_10110987
1551 Ga0207651_10476122
1552 Ga0207651_10632920
1553 Ga0207712_10060348
1554 Ga0207712_10067200
1555 Ga0207712_10594295
1556 Ga0207668_10111199
1557 Ga0207668_10143846
1558 Ga0207668_10938308
1559 Ga0207668_11175777
1560 Ga0207640_10323796
1561 Ga0207640_10618966
1562 Ga0207658_10247569
1563 Ga0207658_10756704
1564 Ga0207658_11029403
1565 Ga0207658_11036730
1566 Ga0207677_10087334
1567 Ga0207677_10464752
1568 Ga0207677_11192386
1569 Ga0207677_11949181
1570 Ga0207703_10018309
1571 Ga0207703_10488712
1572 Ga0207703_10847568
1573 Ga0207703_11007335
1574 Ga0207639_12213150
1575 Ga0207678_10187933
1576 Ga0207678_10566822
1577 Ga0207708_10003724
1578 Ga0207708_10044031
1579 Ga0207708_10069374
1580 Ga0207708_10098955
1581 Ga0207708_10282953
1582 Ga0207641_10026606
1583 Ga0207641_10075679
1584 Ga0207641_10119671
1585 Ga0207641_10309673
1586 Ga0207641_10390122
1587 Ga0207648_10000144
1588 Ga0207648_10004637
1589 Ga0207648_10464668
1590 Ga0207676_10034387
1591 Ga0207676_10040361
1592 Ga0207676_10059474
1593 Ga0207676_10167195
1594 Ga0207676_10685681
1595 Ga0207674_10014747
1596 Ga0207674_10041866
1597 Ga0207674_10208078
1598 Ga0207674_10486169
1599 Ga0207674_10542407
1600 Ga0207674_10773236
1601 Ga0207675_100009291
1602 Ga0207675_100010261
1603 Ga0207675_100017102
1604 Ga0207675_100058080
1605 Ga0207675_100188058
1606 Ga0207675_100434274
1607 Ga0207675_101391273
1608 Ga0207675_101987432
1609 Ga0207683_10009184
1610 Ga0207683_10164565
1611 Ga0207683_10184875
1612 Ga0207683_10571601
1613 Ga0207683_10619596
1614 Ga0207698_10030727
1615 Ga0209969_1054366
1616 Ga0209970_1074382
1617 Ga0209588_1089989
1618 Ga0209998_10026186
1619 Ga0209974_10228929
1620 Ga0207428_10001961
1621 Ga0207428_10002268
1622 Ga0207428_10004387
1623 Ga0207428_10007206
1624 Ga0207428_10139775
1625 Ga0207428_10537066
1626 Ga0207428_11055285
1627 Ga0268266_10015337
1628 Ga0268266_10274382
1629 Ga0268266_11065712
1630 Ga0268265_10001826
1631 Ga0268265_10034431
1632 Ga0268265_10133598
1633 Ga0268265_10263578
1634 Ga0268265_11713865
1635 Ga0268265_11754080
1636 Ga0268264_10005474
1637 Ga0268264_10022129
1638 Ga0268264_10241352
1639 Ga0268264_10314169
1640 Ga0268264_10417955
1641 Ga0268264_10795990
1642 Ga0307412_10323481
1643 Ga0307409_100154617
1644 Ga0307416_100445012
1645 Ga0307416_100544760
1646 Ga0307416_100713528
1647 Ga0307416_100836611
1648 Ga0307416_101341763
1649 Ga0307411_10496295
1650 Ga0373948_0132751
1651 Ga0373950_0097878
1652 Ga0373958_0091664
1653 Ga0373959_0029708
1654 Ga0373926_0014533
1655 Ga0373928_0101492
1656 Ga0373951_0017699
1657 Ga0373932_0003263
1658 Ga0373939_0096588
1659 Ga0373939_0173588
1660 Ga0373941_0229246
1661 Ga0373943_0023444
1662 Ga0373942_0193580
1663 Ga0373962_0034641
1664 Ga0373962_0124364
1665 Ga0373931_0141943
1666 Ga0373931_0232460
1667 Ga0373927_0002388
1668 Ga0373947_0002666
1669 Ga0373947_0140107
1670 Ga0373947_0392198
1671 Ga0373925_0000143
1672 Ga0373925_0345256
1673 Ga0373925_1559459
1674 Ga0242420_039954
1675 Ga0436362_0306081
1676 Ga0436362_1282180
1677 Ga0439453_0035315
1678 Ga0439453_0102205
1679 Ga0451804_0268028
1680 Ga0451853_2251524
1681 Ga0439451_084656
1682 Ga0450923_070569
1683 Ga0439446_0169923
1684 Ga0439434_0188127
1685 Ga0439435_0001066
1686 Ga0439435_0324014
1687 Ga0439459_0081592
1688 Ga0439460_0050049
1689 Ga0439440_0095765
1690 Ga0451576_0015029
1691 Ga0451576_0020117
1692 Ga0451576_0539471
1693 Ga0451576_2651233
1694 Ga0495580_0011821
1695 Ga0495580_0349385
1696 Ga0495605_0365963
1697 Ga0495585_0546136
1698 Ga0495665_0435234
1699 Ga0495586_0077918
1700 Ga0495598_0010836
1701 Ga0495598_0161158
1702 Ga0495598_0461479
1703 Ga0495609_0128037
1704 Ga0495609_0210896
1705 Ga0495621_0003642
1706 Ga0495621_0090163
1707 Ga0495621_0107379
1708 Ga0495656_0191522
1709 Ga0495656_0294992
1710 Ga0495656_0455625
1711 Ga0495659_0003235
1712 Ga0495659_0025672
1713 Ga0495659_0028645
1714 Ga0495659_0162825
1715 Ga0495658_0178801
1716 Ga0495669_0055259
1717 Ga0495669_0083038
1718 Ga0495669_0363686
1719 Ga0495669_0428566
1720 Ga0495636_0050818
1721 Ga0495636_0052349
1722 Ga0495677_0056686
1723 Ga0495677_0260137
1724 Ga0495685_013084
1725 Ga0496102_0735853
1726 Ga0496104_0210665
1727 Ga0496106_0324898
1728 Ga0496109_0304390
1729 Ga0496110_0785149
1730 Ga0496112_0405482
1731 Ga0496113_0085577
1732 Ga0496114_0543142
1733 Ga0501031_0316041
1734 Ga0501033_0135580
1735 Ga0501033_0560909
1736 Ga0501033_0718541
1737 Ga0501034_1284720
1738 Ga0501036_0006517
1739 Ga0501036_0015546
1740 Ga0501036_0043039
1741 Ga0501037_0053504
1742 Ga0501037_0377162
1743 Ga0501038_0415818
1744 Ga0501039_0012801
1745 Ga0501039_0168201
1746 Ga0501039_1217611
1747 Ga0501040_0011449
1748 Ga0501040_0012271
1749 Ga0501040_0012274
1750 Ga0501040_0026883
1751 Ga0501041_0005678
1752 Ga0501041_0005712
1753 Ga0501041_0212142
1754 Ga0501041_0482548
1755 Ga0501042_0001586
1756 Ga0501042_0007901
1757 Ga0501042_0014823
1758 Ga0501042_0048198
1759 Ga0501042_0984645
1760 Ga0501043_0036253
1761 Ga0501043_0165115
1762 Ga0501043_0353426
1763 Ga0501046_0022494
1764 Ga0501046_0034854
1765 Ga0501046_0071352
1766 Ga0501046_0235541
1767 Ga0501048_0013516
1768 Ga0501048_0045174
1769 Ga0501067_0132290
1770 Ga0501068_0022396
1771 Ga0501070_0295328
1772 Ga0501071_0010264
1773 Ga0501071_0016080
1774 Ga0501071_0561499
1775 Ga0501072_0014626
1776 Ga0501072_0029045
1777 Ga0501072_0905690
1778 Ga0501074_0069889
1779 Ga0501074_0192198
1780 Ga0501075_0000268
1781 Ga0501075_0013423
1782 Ga0501075_0077307
1783 Ga0501075_0177902
1784 Ga0501075_0807668
1785 Ga0501075_1114980
1786 Ga0501076_0004709
1787 Ga0501076_0005998
1788 Ga0501076_0256407
1789 Ga0501077_0044953
1790 Ga0501077_0384800
1791 Ga0501077_0482293
1792 Ga0501249_045699
1793 Ga0501245_004579
1794 Ga0501079_0000628
1795 Ga0501079_0002955
1796 Ga0501079_0043815
1797 Ga0501079_0388428
1798 Ga0501079_1550035
1799 Ga0501080_0057691
1800 Ga0501080_0084132
1801 Ga0501080_1061816
1802 Ga0501081_0006126
1803 Ga0501081_0021904
1804 Ga0501081_0023491
1805 Ga0501081_0482947
1806 Ga0501083_0383693
1807 Ga0501083_0488705
1808 Ga0501083_0986879
1809 Ga0501268_031902
1810 Ga0501283_012208
1811 Ga0501045_0013214
1812 Ga0501045_0013639
1813 Ga0501045_0045171
1814 Ga0501045_0113015
1815 nmdc:mga05p37_1039442_c1
1816 nmdc:mga05p37_1081459_c1
1817 nmdc:mga05p37_1098_c1
1818 nmdc:mga05p37_1321194_c1
1819 nmdc:mga05p37_173071_c1
1820 nmdc:mga05p37_1800084_c1
1821 nmdc:mga05p37_182714_c1
1822 nmdc:mga05p37_20113_c1
1823 nmdc:mga05p37_217986_c1
1824 nmdc:mga05p37_263869_c1
1825 nmdc:mga05p37_31490_c2
1826 nmdc:mga05p37_331663_c1
1827 nmdc:mga05p37_339747_c1
1828 nmdc:mga05p37_41099_c1
1829 nmdc:mga05p37_967463_c1
1830 nmdc:mga09592_119986_c1
1831 nmdc:mga09592_223441_c1
1832 nmdc:mga09592_410769_c1
1833 nmdc:mga09592_45067_c1
1834 nmdc:mga09592_47639_c1
1835 nmdc:mga09592_61465_c1
1836 nmdc:mga09592_69703_c1
1837 nmdc:mga09592_717546_c1
1838 nmdc:mga09592_898607_c1
1839 nmdc:mga09592_9774_c1
1840 nmdc:mga0qj67_1031_c1
1841 nmdc:mga0qj67_1147687_c1
1842 nmdc:mga0qj67_119828_c1
1843 nmdc:mga0qj67_127418_c1
1844 nmdc:mga0qj67_165669_c1
1845 nmdc:mga0qj67_199896_c1
1846 nmdc:mga0qj67_207300_c1
1847 nmdc:mga0qj67_390648_c1
1848 nmdc:mga0qj67_74329_c1
1849 nmdc:mga06r32_102480_c1
1850 nmdc:mga06r32_11151_c1
1851 nmdc:mga06r32_42494_c1
1852 nmdc:mga06r32_456738_c1
1853 nmdc:mga06r32_558096_c1
1854 nmdc:mga06r32_648885_c1
1855 nmdc:mga06r32_92505_c1
1856 nmdc:mga08y16_12159_c1
1857 nmdc:mga08y16_148435_c1
1858 nmdc:mga08y16_1686052_c1
1859 nmdc:mga08y16_207037_c1
1860 nmdc:mga08y16_232851_c1
1861 nmdc:mga08y16_244481_c1
1862 nmdc:mga08y16_31440_c1
1863 nmdc:mga08y16_503107_c1
1864 nmdc:mga08y16_670_c1
1865 nmdc:mga08y16_6941_c1
1866 nmdc:mga08y16_80156_c1
1867 nmdc:mga0n895_201838_c1
1868 nmdc:mga0n895_25280_c1
1869 nmdc:mga0n895_284128_c1
1870 nmdc:mga0n895_429_c1
1871 nmdc:mga0n895_589694_c1
1872 nmdc:mga0rr50_1117497_c1
1873 nmdc:mga0rr50_210315_c1
1874 nmdc:mga0rr50_42396_c1
1875 nmdc:mga0rr50_77440_c1
1876 nmdc:mga08x19_278354_c1
1877 nmdc:mga08x19_373327_c1
1878 nmdc:mga0a205_1627_c1
1879 nmdc:mga0a205_546922_c1
1880 nmdc:mga0a205_84831_c1
1881 nmdc:mga0a205_867_c1
1882 nmdc:mga0a205_8857_c1
1883 nmdc:mga0a205_928371_c1
1884 Ga0501084_0010418
1885 Ga0501084_0017927
1886 Ga0501084_0018490
1887 Ga0501084_0068690
1888 Ga0501084_0551773
1889 Ga0501084_0818812
1890 Ga0501082_0002583
1891 Ga0501082_0012187
1892 Ga0501082_0049473
1893 Ga0501082_0137506
1894 Ga0530510_0000557
1895 Ga0530510_0075231
1896 Ga0530510_0128788

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

18

119

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1h9m-assembly1.cif.gz_A two crystal structures of the cytoplasmic molybdate-binding protein modg suggest a novel cooperative binding mechanism and provide insights into ligand-binding specificity. peg-grown form with molybdate bound 0.7768 37 99
2pi2-assembly3.cif.gz_C full-length replication protein a subunits rpa14 and rpa32 0.7497 36 114
4fxd-assembly1.cif.gz_A crystal structure of yeast dna polymerase alpha bound to dna/rna 0.7475 39 72
4fxd-assembly2.cif.gz_B crystal structure of yeast dna polymerase alpha bound to dna/rna 0.744 39 72
6hmf-assembly1.cif.gz_A d-family dna polymerase - dp1 subunit (3'-5' proof-reading exonuclease) h451 proof-reading deficient variant 0.7326 32 117
ID Description Score Start End Superfamily
af_A0A1D8PQ00_161_443_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8318 42 74 2.130.10.10
af_B2RYE5_272_368_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8293 42 70 2.30.29.30
2awoD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8245 37 75 2.40.50.140
af_Q8VC10_106_455_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8161 41 72 3.50.50.60
3rlfA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8 37 97 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A383CUF3-F1-model_v4 OB domain-containing protein 0.9726 31 124
AF-A0A2V8I9N4-F1-model_v4 DUF5666 domain-containing protein 0.9541 39 124
AF-A0A351D019-F1-model_v4 Minor tail protein 0.9532 35 125
AF-A0A2V8LU00-F1-model_v4 OB domain-containing protein 0.9504 37 123
AF-A0A7C2NVP5-F1-model_v4 Uncharacterized protein 0.9501 35 125

Map