F486339

General Info

Members Datasets Scaffolds Average Seq Length
941 359 1882 137

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0844265|Ga0466967_0844265_14_544
Length 153
Sequence VSDRRTVESGLDARWQHGGMHSETRSYRTGDREVVLDLTDDCREVVRGRGDGLLHVFVPHATAGIAVIETGSGSDDDLLAALGDLLPADDRWRHAHGSRGHGRSHVLPALVPPYASVPVLGGRLALGTWQSVCLVDLNVDNDEREVRFSFLAG

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
98 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
99 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
117 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
119 3300024123 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 Metagenome Unclassified
120 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
177 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
178 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
179 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
180 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
181 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
182 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
183 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
184 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
186 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
188 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
189 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
190 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
191 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
192 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
193 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
194 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
195 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
198 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
211 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
212 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
213 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
214 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
215 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
216 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
217 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
218 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
219 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
220 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
221 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
222 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
223 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
224 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
225 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
226 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
227 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
228 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
229 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
230 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
231 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
234 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
235 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
236 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
237 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
238 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
239 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
240 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
241 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
242 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
243 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
244 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
245 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
246 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
247 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
248 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
249 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
250 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
251 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
252 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
253 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
254 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
255 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
256 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
257 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
258 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
259 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
260 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
261 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
262 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
263 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
264 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
265 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
266 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
267 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
268 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
269 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
270 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
271 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
272 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
273 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
274 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
279 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
280 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
281 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
282 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
283 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
284 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
285 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
286 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
289 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
290 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
291 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
292 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
293 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
294 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
307 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
308 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
309 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
310 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
311 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
312 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
313 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
314 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
315 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
316 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
317 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
318 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
321 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
322 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
323 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
324 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
325 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
326 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
327 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
328 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
329 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
330 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
331 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
332 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
333 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
334 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
335 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
336 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
337 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
338 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
339 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
340 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
341 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
342 2643221561 Nocardioides sp. Root151 Isolate Unclassified
343 2643221615 Nocardioides sp. Root224 Isolate Unclassified
344 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
345 2738541305 Nocardioides sp. CF167 Isolate Unclassified
346 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
347 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
348 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
349 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
350 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
351 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
352 2891562705 Microbispora tritici MT50 Isolate Unclassified
353 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
354 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
355 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
356 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
357 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
358 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
359 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.77
Metatranscriptomes 0.32
Isolates 1.91

Biome Distribution

Category Percentage (%)
Aerial Root 0.21
Bulb 0
Endosphere 4.99
Nodule 0.11
Rhizoplane 4.36
Rhizosphere 86.82
Stem 0
Stem Tuber 0
Unclassified 0.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0844265 3300045976 Bacteria 910
2 Ga0070658_10000158 3300005327 Bacteria 59813
3 Ga0070658_10018944 3300005327 Bacteria 5514
4 Ga0070658_10129353 3300005327 Bacteria 2104
5 Ga0070658_10166901 3300005327 Bacteria 1848
6 Ga0070658_10362906 3300005327 Bacteria 1241
7 Ga0070676_10095272 3300005328 Bacteria 1830
8 Ga0070676_10656207 3300005328 Bacteria 762
9 Ga0070683_100151950 3300005329 Bacteria 2195
10 Ga0070683_100285312 3300005329 Bacteria 1571
11 Ga0070690_100128349 3300005330 Bacteria 1710
12 Ga0070690_100293740 3300005330 Bacteria 1163
13 Ga0068869_100479382 3300005334 Bacteria 1035
14 Ga0070666_10360978 3300005335 Bacteria 1041
15 Ga0070680_100008268 3300005336 Bacteria 7959
16 Ga0070680_100079865 3300005336 Bacteria 2697
17 Ga0070680_100104490 3300005336 Bacteria 2354
18 Ga0070682_100829953 3300005337 Bacteria 753
19 Ga0068868_101244795 3300005338 Bacteria 689
20 Ga0070660_100838315 3300005339 Bacteria 774
21 Ga0070660_101667121 3300005339 Bacteria 543
22 Ga0070689_100526223 3300005340 Bacteria 1016
23 Ga0070689_100740875 3300005340 Bacteria 861
24 Ga0070691_10172115 3300005341 Bacteria 1123
25 Ga0070661_101145630 3300005344 Unclassified 649
26 Ga0070675_100403992 3300005354 Bacteria 1219
27 Ga0070675_100749743 3300005354 Bacteria 891
28 Ga0070671_100459621 3300005355 Bacteria 1092
29 Ga0070674_100346211 3300005356 Bacteria 1199
30 Ga0070659_100001258 3300005366 Bacteria 18400
31 Ga0070659_100238961 3300005366 Bacteria 1502
32 Ga0070659_100539305 3300005366 Bacteria 998
33 Ga0070667_100064803 3300005367 Bacteria 3101
34 Ga0070667_100641040 3300005367 Bacteria 981
35 Ga0070667_100665790 3300005367 Bacteria 962
36 Ga0070709_10000169 3300005434 Bacteria 41293
37 Ga0070709_10035138 3300005434 Bacteria 3044
38 Ga0070709_10077460 3300005434 Bacteria 2161
39 Ga0070714_100078175 3300005435 Bacteria 2875
40 Ga0070714_100151874 3300005435 Bacteria 2088
41 Ga0070714_100158543 3300005435 Bacteria 2045
42 Ga0070714_100258574 3300005435 Bacteria 1612
43 Ga0070714_100307219 3300005435 Bacteria 1480
44 Ga0070714_100524714 3300005435 Bacteria 1131
45 Ga0070714_100852132 3300005435 Bacteria 884
46 Ga0070714_100889083 3300005435 Bacteria 865
47 Ga0070713_100086271 3300005436 Bacteria 2691
48 Ga0070713_100096916 3300005436 Bacteria 2547
49 Ga0070713_100211141 3300005436 Bacteria 1757
50 Ga0070713_100396989 3300005436 Bacteria 1287
51 Ga0070713_100609124 3300005436 Bacteria 1038
52 Ga0070713_100910947 3300005436 Bacteria 846
53 Ga0070710_10006479 3300005437 Bacteria 5625
54 Ga0070710_10016835 3300005437 Bacteria 3729
55 Ga0070710_10065623 3300005437 Bacteria 2079
56 Ga0070710_10092288 3300005437 Bacteria 1788
57 Ga0070710_10109305 3300005437 Bacteria 1658
58 Ga0070711_100004460 3300005439 Bacteria 8263
59 Ga0070711_100067694 3300005439 Bacteria 2506
60 Ga0070711_100519900 3300005439 Bacteria 983
61 Ga0070705_100420811 3300005440 Bacteria 994
62 Ga0070700_100907799 3300005441 Bacteria 718
63 Ga0070708_100260347 3300005445 Bacteria 1631
64 Ga0070708_100933041 3300005445 Bacteria 814
65 Ga0070663_100146513 3300005455 Bacteria 1807
66 Ga0070678_100132926 3300005456 Bacteria 1980
67 Ga0070662_100496444 3300005457 Bacteria 1018
68 Ga0070681_10000477 3300005458 Bacteria 32688
69 Ga0070681_10102380 3300005458 Bacteria 2809
70 Ga0070681_10726226 3300005458 Bacteria 909
71 Ga0068867_101536856 3300005459 Bacteria 620
72 Ga0070685_10703614 3300005466 Bacteria 737
73 Ga0070706_100002920 3300005467 Bacteria 17015
74 Ga0070706_100021884 3300005467 Bacteria 5888
75 Ga0070706_100058514 3300005467 Bacteria 3557
76 Ga0070706_100118065 3300005467 Bacteria 2471
77 Ga0070706_100528998 3300005467 Bacteria 1097
78 Ga0070706_100636175 3300005467 Bacteria 990
79 Ga0070706_100669491 3300005467 Bacteria 963
80 Ga0070707_100020822 3300005468 Bacteria 6191
81 Ga0070707_100021782 3300005468 Bacteria 6057
82 Ga0070707_100026241 3300005468 Bacteria 5530
83 Ga0070707_100055420 3300005468 Bacteria 3801
84 Ga0070707_100095956 3300005468 Bacteria 2872
85 Ga0070698_100002175 3300005471 Bacteria 21736
86 Ga0070698_100030449 3300005471 Bacteria 5594
87 Ga0070698_100057473 3300005471 Bacteria 3937
88 Ga0070698_100061172 3300005471 Bacteria 3799
89 Ga0070698_100082007 3300005471 Bacteria 3218
90 Ga0070699_100575577 3300005518 Bacteria 1026
91 Ga0070679_100000521 3300005530 Bacteria 32688
92 Ga0070679_100093697 3300005530 Bacteria 2991
93 Ga0070679_100132171 3300005530 Bacteria 2477
94 Ga0070679_100199108 3300005530 Bacteria 1970
95 Ga0070679_100368868 3300005530 Bacteria 1383
96 Ga0070679_100408693 3300005530 Bacteria 1303
97 Ga0070684_100099739 3300005535 Bacteria 2592
98 Ga0070697_100104197 3300005536 Bacteria 2359
99 Ga0068853_100071753 3300005539 Bacteria 3016
100 Ga0068853_101068616 3300005539 Bacteria 778
101 Ga0070695_100151689 3300005545 Bacteria 1618
102 Ga0070695_100423926 3300005545 Bacteria 1014
103 Ga0070696_100126143 3300005546 Bacteria 1857
104 Ga0070693_100109195 3300005547 Bacteria 1699
105 Ga0068855_102296874 3300005563 Bacteria 540
106 Ga0070664_100797598 3300005564 Bacteria 883
107 Ga0068857_100133729 3300005577 Bacteria 2239
108 Ga0068857_101282088 3300005577 Bacteria 711
109 Ga0068854_100552993 3300005578 Bacteria 976
110 Ga0068856_100025058 3300005614 Bacteria 5813
111 Ga0068856_100741128 3300005614 Bacteria 1002
112 Ga0068856_100860658 3300005614 Bacteria 926
113 Ga0070702_100431408 3300005615 Bacteria 951
114 Ga0068852_100963007 3300005616 Bacteria 872
115 Ga0068859_100035415 3300005617 Bacteria 5008
116 Ga0068859_100353403 3300005617 Bacteria 1564
117 Ga0068864_100065553 3300005618 Bacteria 3151
118 Ga0068864_100516101 3300005618 Bacteria 1151
119 Ga0068861_101236797 3300005719 Bacteria 723
120 Ga0068851_10739310 3300005834 Bacteria 608
121 Ga0068863_100090421 3300005841 Bacteria 2902
122 Ga0068858_100339571 3300005842 Bacteria 1437
123 Ga0068860_100000334 3300005843 Bacteria 63958
124 Ga0068860_100181629 3300005843 Bacteria 2033
125 Ga0068860_100348171 3300005843 Bacteria 1458
126 Ga0068862_100303372 3300005844 Bacteria 1470
127 Ga0081455_10216955 3300005937 Bacteria 1421
128 Ga0081455_10489574 3300005937 Bacteria 829
129 Ga0081455_10511810 3300005937 Bacteria 803
130 Ga0081539_10064214 3300005985 Bacteria 1999
131 Ga0070717_10148387 3300006028 Bacteria 2027
132 Ga0070717_10274187 3300006028 Bacteria 1494
133 Ga0070717_10481647 3300006028 Bacteria 1120
134 Ga0070717_10736106 3300006028 Bacteria 896
135 Ga0070717_10814214 3300006028 Bacteria 850
136 Ga0075365_10012686 3300006038 Bacteria 5014
137 Ga0075365_10020548 3300006038 Bacteria 4096
138 Ga0075365_10103695 3300006038 Bacteria 1949
139 Ga0075365_10106052 3300006038 Bacteria 1928
140 Ga0075365_10113238 3300006038 Bacteria 1866
141 Ga0075365_10126865 3300006038 Bacteria 1763
142 Ga0075365_10146911 3300006038 Bacteria 1639
143 Ga0075365_10571490 3300006038 Bacteria 800
144 Ga0075365_10585480 3300006038 Bacteria 789
145 Ga0075368_10007589 3300006042 Bacteria 3828
146 Ga0075363_100005487 3300006048 Bacteria 5650
147 Ga0075363_100100131 3300006048 Bacteria 1603
148 Ga0075364_10029625 3300006051 Bacteria 3511
149 Ga0075364_10449032 3300006051 Bacteria 881
150 Ga0075364_10518416 3300006051 Bacteria 815
151 Ga0075432_10021839 3300006058 Bacteria 2188
152 Ga0070715_10054925 3300006163 Bacteria 1727
153 Ga0070716_100189873 3300006173 Bacteria 1356
154 Ga0070716_100344512 3300006173 Bacteria 1052
155 Ga0070712_100154336 3300006175 Bacteria 1766
156 Ga0070712_100175425 3300006175 Bacteria 1666
157 Ga0070712_100457548 3300006175 Bacteria 1064
158 Ga0070712_100464811 3300006175 Bacteria 1055
159 Ga0070712_100484076 3300006175 Bacteria 1035
160 Ga0070712_100600133 3300006175 Bacteria 932
161 Ga0070712_100724648 3300006175 Bacteria 849
162 Ga0070712_101319930 3300006175 Bacteria 629
163 Ga0075362_10020031 3300006177 Bacteria 2791
164 Ga0075367_10052247 3300006178 Bacteria 2418
165 Ga0075367_10318112 3300006178 Bacteria 981
166 Ga0075367_10343565 3300006178 Bacteria 941
167 Ga0075367_10392782 3300006178 Bacteria 877
168 Ga0075367_10517510 3300006178 Bacteria 757
169 Ga0097621_100247251 3300006237 Bacteria 1561
170 Ga0097621_100304441 3300006237 Bacteria 1408
171 Ga0075370_10005619 3300006353 Bacteria 6255
172 Ga0068871_100051304 3300006358 Bacteria 3340
173 Ga0068871_100556395 3300006358 Bacteria 1039
174 Ga0075428_100037033 3300006844 Bacteria 5373
175 Ga0075430_100196017 3300006846 Bacteria 1678
176 Ga0075433_10002552 3300006852 Bacteria 13866
177 Ga0075433_10056705 3300006852 Bacteria 3423
178 Ga0075434_100009923 3300006871 Bacteria 8907
179 Ga0075434_100049787 3300006871 Bacteria 4161
180 Ga0075434_100232652 3300006871 Bacteria 1862
181 Ga0075434_100824281 3300006871 Bacteria 944
182 Ga0075434_101479557 3300006871 Bacteria 688
183 Ga0075436_100001677 3300006914 Bacteria 15144
184 Ga0075436_100164768 3300006914 Bacteria 1563
185 Ga0075436_100219894 3300006914 Bacteria 1348
186 Ga0075436_100257596 3300006914 Bacteria 1244
187 Ga0097620_100035416 3300006931 Bacteria 5008
188 Ga0097620_100353400 3300006931 Bacteria 1564
189 Ga0075435_100002810 3300007076 Bacteria 11643
190 Ga0075435_100203110 3300007076 Bacteria 1679
191 Ga0075435_100272660 3300007076 Bacteria 1443
192 Ga0075435_100308200 3300007076 Bacteria 1355
193 Ga0075435_100606485 3300007076 Bacteria 949
194 Ga0105251_10314032 3300009011 Bacteria 712
195 Ga0105250_10132926 3300009092 Bacteria 1028
196 Ga0111539_10003840 3300009094 Bacteria 19785
197 Ga0111539_10082371 3300009094 Bacteria 3784
198 Ga0111539_10348159 3300009094 Bacteria 1724
199 Ga0105245_10161185 3300009098 Bacteria 2129
200 Ga0105245_10603782 3300009098 Bacteria 1124
201 Ga0105245_11140876 3300009098 Bacteria 826
202 Ga0105247_10127806 3300009101 Bacteria 1653
203 Ga0114129_11812613 3300009147 Bacteria 742
204 Ga0105243_10421999 3300009148 Bacteria 1244
205 Ga0105241_10841897 3300009174 Bacteria 848
206 Ga0105241_11259173 3300009174 Bacteria 703
207 Ga0105241_11266065 3300009174 Bacteria 701
208 Ga0105242_10224088 3300009176 Bacteria 1682
209 Ga0105248_10001693 3300009177 Bacteria 24537
210 Ga0105248_10663643 3300009177 Bacteria 1176
211 Ga0105248_11171271 3300009177 Bacteria 869
212 Ga0105237_10049803 3300009545 Bacteria 4209
213 Ga0105237_10271779 3300009545 Bacteria 1698
214 Ga0105237_11723561 3300009545 Bacteria 634
215 Ga0105238_10192905 3300009551 Bacteria 2013
216 Ga0105249_10342165 3300009553 Bacteria 1513
217 Ga0105249_10872220 3300009553 Bacteria 966
218 Ga0105239_10101403 3300010375 Bacteria 3184
219 Ga0105239_10600868 3300010375 Bacteria 1255
220 Ga0157341_1021417 3300012494 Bacteria 640
221 Ga0157342_1018987 3300012507 Bacteria 783
222 Ga0157338_1009839 3300012515 Bacteria 954
223 Ga0157373_10488036 3300013100 Bacteria 889
224 Ga0157371_10054330 3300013102 Bacteria 2845
225 Ga0157370_10196659 3300013104 Bacteria 1871
226 Ga0157370_10467902 3300013104 Bacteria 1158
227 Ga0157370_10807002 3300013104 Bacteria 854
228 Ga0157369_10035314 3300013105 Bacteria 5483
229 Ga0157369_10211251 3300013105 Bacteria 2034
230 Ga0157369_11146767 3300013105 Bacteria 794
231 Ga0157369_12278617 3300013105 Bacteria 549
232 Ga0157374_10051133 3300013296 Bacteria 3844
233 Ga0157374_10797198 3300013296 Bacteria 960
234 Ga0163162_10039395 3300013306 Bacteria 4722
235 Ga0157372_10241084 3300013307 Bacteria 2098
236 Ga0157372_12121283 3300013307 Bacteria 646
237 Ga0157372_13340673 3300013307 Bacteria 511
238 Ga0157375_10072257 3300013308 Bacteria 3466
239 Ga0157375_10734235 3300013308 Bacteria 1140
240 Ga0163163_10007728 3300014325 Bacteria 9499
241 Ga0163163_10045897 3300014325 Bacteria 4290
242 Ga0163163_10109683 3300014325 Bacteria 2787
243 Ga0157380_11096554 3300014326 Bacteria 835
244 Ga0182008_10578847 3300014497 Bacteria 627
245 Ga0157377_10073742 3300014745 Bacteria 1979
246 Ga0157379_10024347 3300014968 Bacteria 5374
247 Ga0157379_10032700 3300014968 Bacteria 4638
248 Ga0157379_10423256 3300014968 Bacteria 1227
249 Ga0157376_10023750 3300014969 Bacteria 4804
250 Ga0206356_10498411 3300020070 Bacteria 1744
251 Ga0206354_10954142 3300020081 Bacteria 661
252 Ga0213875_10051044 3300021388 Bacteria 1938
253 Ga0213875_10189008 3300021388 Bacteria 968
254 Ga0224712_10129158 3300022467 Bacteria 1102
255 Ga0224571_103483 3300022734 Bacteria 1015
256 Ga0228600_1005047 3300024123 Bacteria 967
257 Ga0224572_1045916 3300024225 Bacteria 818
258 Ga0207656_10216480 3300025321 Bacteria 930
259 Ga0207692_10000163 3300025898 Bacteria 21240
260 Ga0207692_10015879 3300025898 Bacteria 3322
261 Ga0207692_10045088 3300025898 Bacteria 2204
262 Ga0207692_10081678 3300025898 Bacteria 1730
263 Ga0207710_10000030 3300025900 Bacteria 287870
264 Ga0207710_10235822 3300025900 Bacteria 912
265 Ga0207688_10164440 3300025901 Bacteria 1317
266 Ga0207647_10118422 3300025904 Bacteria 1562
267 Ga0207647_10228790 3300025904 Bacteria 1070
268 Ga0207685_10050740 3300025905 Bacteria 1600
269 Ga0207685_10145519 3300025905 Unclassified 1067
270 Ga0207685_10189891 3300025905 Bacteria 958
271 Ga0207699_10000201 3300025906 Bacteria 35645
272 Ga0207699_10012599 3300025906 Bacteria 4306
273 Ga0207699_10083278 3300025906 Bacteria 1989
274 Ga0207699_10101419 3300025906 Bacteria 1827
275 Ga0207699_10875627 3300025906 Bacteria 662
276 Ga0207645_10176344 3300025907 Bacteria 1402
277 Ga0207643_10008616 3300025908 Bacteria 5469
278 Ga0207705_10000399 3300025909 Bacteria 38165
279 Ga0207705_10017254 3300025909 Bacteria 5170
280 Ga0207705_10067515 3300025909 Bacteria 2588
281 Ga0207705_10072639 3300025909 Bacteria 2496
282 Ga0207705_10222137 3300025909 Bacteria 1435
283 Ga0207705_10554364 3300025909 Bacteria 893
284 Ga0207705_10656937 3300025909 Bacteria 815
285 Ga0207684_10002079 3300025910 Bacteria 20578
286 Ga0207684_10018950 3300025910 Bacteria 5887
287 Ga0207684_10038962 3300025910 Bacteria 4033
288 Ga0207684_10071650 3300025910 Bacteria 2944
289 Ga0207684_10416581 3300025910 Bacteria 1154
290 Ga0207707_10000720 3300025912 Bacteria 32689
291 Ga0207707_10081666 3300025912 Bacteria 2822
292 Ga0207707_10145519 3300025912 Bacteria 2072
293 Ga0207707_10921660 3300025912 Bacteria 721
294 Ga0207693_10012620 3300025915 Bacteria 6827
295 Ga0207693_10242938 3300025915 Bacteria 1413
296 Ga0207693_10251306 3300025915 Bacteria 1387
297 Ga0207693_10273712 3300025915 Bacteria 1323
298 Ga0207693_10486823 3300025915 Bacteria 963
299 Ga0207663_10001705 3300025916 Bacteria 10322
300 Ga0207663_10012581 3300025916 Bacteria 4580
301 Ga0207663_10076199 3300025916 Bacteria 2178
302 Ga0207663_10353322 3300025916 Bacteria 1113
303 Ga0207663_10501131 3300025916 Bacteria 943
304 Ga0207663_10841080 3300025916 Bacteria 732
305 Ga0207660_10013060 3300025917 Bacteria 5438
306 Ga0207660_10059583 3300025917 Bacteria 2741
307 Ga0207660_10132131 3300025917 Bacteria 1901
308 Ga0207660_10164916 3300025917 Bacteria 1712
309 Ga0207660_10205878 3300025917 Bacteria 1538
310 Ga0207660_10295281 3300025917 Bacteria 1289
311 Ga0207657_10222958 3300025919 Bacteria 1510
312 Ga0207657_10438119 3300025919 Bacteria 1026
313 Ga0207657_10660398 3300025919 Bacteria 814
314 Ga0207657_10686833 3300025919 Bacteria 795
315 Ga0207657_11034745 3300025919 Bacteria 629
316 Ga0207649_10301702 3300025920 Bacteria 1171
317 Ga0207652_10000798 3300025921 Bacteria 30058
318 Ga0207652_10172648 3300025921 Bacteria 1940
319 Ga0207652_10191353 3300025921 Bacteria 1840
320 Ga0207652_10281676 3300025921 Bacteria 1500
321 Ga0207652_10329666 3300025921 Bacteria 1378
322 Ga0207652_10671478 3300025921 Bacteria 926
323 Ga0207646_10000235 3300025922 Bacteria 76449
324 Ga0207646_10006203 3300025922 Bacteria 12425
325 Ga0207646_10011031 3300025922 Bacteria 8774
326 Ga0207646_10019130 3300025922 Bacteria 6369
327 Ga0207646_10783559 3300025922 Bacteria 850
328 Ga0207681_10570279 3300025923 Bacteria 933
329 Ga0207694_10762336 3300025924 Bacteria 817
330 Ga0207694_10772599 3300025924 Bacteria 811
331 Ga0207659_10355051 3300025926 Bacteria 1217
332 Ga0207659_10603195 3300025926 Bacteria 936
333 Ga0207687_10089514 3300025927 Bacteria 2241
334 Ga0207687_10163959 3300025927 Bacteria 1708
335 Ga0207687_10588287 3300025927 Bacteria 937
336 Ga0207700_10003259 3300025928 Bacteria 9385
337 Ga0207700_10003268 3300025928 Bacteria 9374
338 Ga0207700_10073649 3300025928 Bacteria 2638
339 Ga0207700_10204373 3300025928 Bacteria 1666
340 Ga0207700_10245832 3300025928 Bacteria 1526
341 Ga0207700_10270765 3300025928 Bacteria 1458
342 Ga0207664_10007630 3300025929 Bacteria 7504
343 Ga0207664_10009986 3300025929 Bacteria 6689
344 Ga0207664_10017900 3300025929 Bacteria 5206
345 Ga0207664_10035535 3300025929 Bacteria 3845
346 Ga0207664_10068066 3300025929 Bacteria 2859
347 Ga0207664_10073604 3300025929 Bacteria 2757
348 Ga0207664_10213197 3300025929 Bacteria 1672
349 Ga0207664_10639126 3300025929 Bacteria 956
350 Ga0207664_11000415 3300025929 Bacteria 749
351 Ga0207664_11042747 3300025929 Bacteria 732
352 Ga0207664_11150610 3300025929 Bacteria 693
353 Ga0207644_10351262 3300025931 Bacteria 1197
354 Ga0207706_10186689 3300025933 Bacteria 1820
355 Ga0207706_10197840 3300025933 Bacteria 1763
356 Ga0207686_10365522 3300025934 Bacteria 1090
357 Ga0207670_10431106 3300025936 Bacteria 1060
358 Ga0207669_10523020 3300025937 Bacteria 953
359 Ga0207665_10002435 3300025939 Bacteria 12584
360 Ga0207665_10011169 3300025939 Bacteria 5894
361 Ga0207665_10020196 3300025939 Bacteria 4376
362 Ga0207665_10029190 3300025939 Bacteria 3647
363 Ga0207665_10051497 3300025939 Bacteria 2771
364 Ga0207711_10071258 3300025941 Bacteria 3015
365 Ga0207711_10470697 3300025941 Bacteria 1170
366 Ga0207689_10181640 3300025942 Bacteria 1735
367 Ga0207689_10478277 3300025942 Bacteria 1043
368 Ga0207661_10104468 3300025944 Bacteria 2385
369 Ga0207661_10299343 3300025944 Bacteria 1442
370 Ga0207679_10159324 3300025945 Bacteria 1846
371 Ga0207679_10706225 3300025945 Bacteria 915
372 Ga0207667_10838128 3300025949 Bacteria 914
373 Ga0207651_10254972 3300025960 Bacteria 1437
374 Ga0207712_10358586 3300025961 Bacteria 1214
375 Ga0207712_10584034 3300025961 Bacteria 965
376 Ga0207640_10519037 3300025981 Bacteria 995
377 Ga0207658_10045024 3300025986 Bacteria 3215
378 Ga0207658_10481930 3300025986 Bacteria 1102
379 Ga0207658_10827486 3300025986 Bacteria 841
380 Ga0207677_10054423 3300026023 Bacteria 2731
381 Ga0207703_10402393 3300026035 Bacteria 1270
382 Ga0207703_11326446 3300026035 Bacteria 692
383 Ga0207678_10182337 3300026067 Bacteria 1793
384 Ga0207708_10977767 3300026075 Bacteria 735
385 Ga0207702_10088798 3300026078 Bacteria 2702
386 Ga0207702_10532694 3300026078 Bacteria 1147
387 Ga0207648_10190954 3300026089 Bacteria 1815
388 Ga0207676_10049767 3300026095 Bacteria 3263
389 Ga0207674_10154902 3300026116 Bacteria 2247
390 Ga0207683_10008286 3300026121 Bacteria 8891
391 Ga0209813_10231409 3300027866 Bacteria 696
392 Ga0207428_10001176 3300027907 Bacteria 28190
393 Ga0207428_10020592 3300027907 Bacteria 5601
394 Ga0268266_11216696 3300028379 Bacteria 728
395 Ga0268264_10002232 3300028381 Bacteria 17182
396 Ga0268264_10528032 3300028381 Bacteria 1155
397 Ga0265338_10003426 3300028800 Bacteria 22354
398 Ga0307409_100235546 3300031995 Bacteria 1663
399 Ga0316214_1035757 3300033545 Bacteria 709
400 Ga0373948_0029789 3300034817 Bacteria 1094
401 Ga0373950_0092696 3300034818 Bacteria 643
402 Ga0373926_0008108 3300035083 Bacteria 3498
403 Ga0373926_0095935 3300035083 Bacteria 1106
404 Ga0373926_0222153 3300035083 Bacteria 729
405 Ga0373926_0274262 3300035083 Bacteria 656
406 Ga0373929_0011930 3300035085 Bacteria 1644
407 Ga0373934_0000027 3300035086 Bacteria 46688
408 Ga0373934_0002340 3300035086 Bacteria 6976
409 Ga0373934_0017122 3300035086 Bacteria 2763
410 Ga0373934_0019085 3300035086 Bacteria 2629
411 Ga0373934_0167540 3300035086 Bacteria 902
412 Ga0373940_0016961 3300035088 Bacteria 1811
413 Ga0373944_0000323 3300035089 Bacteria 10714
414 Ga0373944_0015922 3300035089 Bacteria 2114
415 Ga0373944_0065359 3300035089 Bacteria 1175
416 Ga0373923_0072476 3300035111 Bacteria 1481
417 Ga0373923_0093929 3300035111 Bacteria 1315
418 Ga0373923_0121724 3300035111 Bacteria 1166
419 Ga0373932_0026941 3300035112 Bacteria 1568
420 Ga0373936_0071408 3300035113 Bacteria 1431
421 Ga0373936_0138399 3300035113 Bacteria 1050
422 Ga0373939_0113443 3300035114 Bacteria 947
423 Ga0373945_0003858 3300035116 Bacteria 4734
424 Ga0373945_0028589 3300035116 Bacteria 1954
425 Ga0373945_0171508 3300035116 Bacteria 889
426 Ga0373953_0000032 3300035117 Bacteria 37225
427 Ga0373953_0009571 3300035117 Bacteria 3341
428 Ga0373953_0010179 3300035117 Bacteria 3261
429 Ga0373953_0071946 3300035117 Bacteria 1428
430 Ga0373953_0096894 3300035117 Bacteria 1238
431 Ga0373953_0124364 3300035117 Bacteria 1097
432 Ga0373953_0352162 3300035117 Bacteria 645
433 Ga0373954_0000342 3300035118 Bacteria 17080
434 Ga0373954_0008936 3300035118 Bacteria 4409
435 Ga0373954_0020321 3300035118 Bacteria 3003
436 Ga0373954_0049616 3300035118 Bacteria 1968
437 Ga0373954_0172158 3300035118 Bacteria 1060
438 Ga0373956_0000561 3300035119 Bacteria 15245
439 Ga0373956_0006481 3300035119 Bacteria 4691
440 Ga0373956_0011840 3300035119 Bacteria 3603
441 Ga0373956_0075064 3300035119 Bacteria 1546
442 Ga0373956_0424904 3300035119 Bacteria 634
443 Ga0373957_0000128 3300035120 Bacteria 18723
444 Ga0373957_0026484 3300035120 Bacteria 2098
445 Ga0373957_0045453 3300035120 Bacteria 1664
446 Ga0373957_0051609 3300035120 Bacteria 1573
447 Ga0373957_0076066 3300035120 Bacteria 1320
448 Ga0373960_0146993 3300035121 Bacteria 802
449 Ga0373943_0088807 3300035170 Bacteria 1597
450 Ga0373943_0118000 3300035170 Bacteria 1407
451 Ga0373943_0128571 3300035170 Bacteria 1353
452 Ga0373943_0537884 3300035170 Bacteria 685
453 Ga0373946_0000324 3300035171 Bacteria 15464
454 Ga0373955_0000361 3300035172 Bacteria 19116
455 Ga0373955_0032622 3300035172 Bacteria 2735
456 Ga0373955_0034558 3300035172 Bacteria 2671
457 Ga0373955_0045505 3300035172 Bacteria 2368
458 Ga0373955_0214047 3300035172 Bacteria 1149
459 Ga0373962_0024594 3300035242 Bacteria 1612
460 Ga0373924_0004004 3300035410 Bacteria 5117
461 Ga0373924_0011107 3300035410 Bacteria 3337
462 Ga0373924_0012923 3300035410 Bacteria 3128
463 Ga0373924_0135037 3300035410 Bacteria 1074
464 Ga0373924_0435359 3300035410 Bacteria 587
465 Ga0373935_0018511 3300035692 Bacteria 4237
466 Ga0373935_0027826 3300035692 Bacteria 3494
467 Ga0373935_0069776 3300035692 Bacteria 2264
468 Ga0373935_0193209 3300035692 Bacteria 1403
469 Ga0373935_0296827 3300035692 Bacteria 1141
470 Ga0373927_0016926 3300035695 Bacteria 4805
471 Ga0373927_0051130 3300035695 Bacteria 2672
472 Ga0373927_0256743 3300035695 Bacteria 1149
473 Ga0373933_0000103 3300035724 Bacteria 53800
474 Ga0373933_0026161 3300035724 Bacteria 3349
475 Ga0373933_0096420 3300035724 Bacteria 1830
476 Ga0373933_0211824 3300035724 Bacteria 1242
477 Ga0373947_0012689 3300035725 Bacteria 4831
478 Ga0373947_0201673 3300035725 Bacteria 1302
479 Ga0373947_0574914 3300035725 Bacteria 767
480 Ga0373947_0610441 3300035725 Bacteria 743
481 Ga0373947_0713360 3300035725 Bacteria 684
482 Ga0373937_0000683 3300036401 Bacteria 29555
483 Ga0373937_0068896 3300036401 Bacteria 3261
484 Ga0373937_0089477 3300036401 Bacteria 2850
485 Ga0373937_0121182 3300036401 Bacteria 2437
486 Ga0373937_0384826 3300036401 Bacteria 1330
487 Ga0373937_0508494 3300036401 Bacteria 1144
488 Ga0373937_0641431 3300036401 Bacteria 1007
489 Ga0373937_0658831 3300036401 Bacteria 992
490 Ga0373925_0011085 3300037068 Bacteria 6545
491 Ga0373925_0044028 3300037068 Bacteria 3313
492 Ga0373925_1030339 3300037068 Bacteria 677
493 Ga0395900_0242198 3300037418 Bacteria 1809
494 Ga0395898_1101945 3300037466 Bacteria 727
495 Ga0395905_0378173 3300037471 Bacteria 1310
496 Ga0436364_0307500 3300037853 Bacteria 10282
497 Ga0436364_0374489 3300037853 Bacteria 1014
498 Ga0436364_0377030 3300037853 Bacteria 1933
499 Ga0436364_1040386 3300037853 Bacteria 956
500 Ga0436364_1044748 3300037853 Bacteria 506
501 Ga0436364_1057201 3300037853 Bacteria 1226
502 Ga0436364_1231352 3300037853 Bacteria 1916
503 Ga0395901_0131036 3300038443 Bacteria 2635
504 Ga0395901_0195467 3300038443 Bacteria 2121
505 Ga0436365_0920719 3300039437 Bacteria 1813
506 Ga0436365_1108856 3300039437 Bacteria 908
507 Ga0436360_0524089 3300039438 Bacteria 617
508 Ga0436361_0139746 3300039447 Bacteria 1455
509 Ga0436361_0585092 3300039447 Bacteria 729
510 Ga0436363_1476138 3300039450 Bacteria 964
511 Ga0436363_1500493 3300039450 Bacteria 523
512 Ga0436362_1225677 3300039453 Bacteria 727
513 Ga0451807_1909869 3300041486 Bacteria 685
514 Ga0466972_0017104 3300044658 Bacteria 3627
515 Ga0466972_0249351 3300044658 Bacteria 830
516 Ga0466965_0011179 3300044683 Bacteria 4202
517 Ga0466965_0033928 3300044683 Bacteria 2496
518 Ga0466965_0041318 3300044683 Bacteria 2272
519 Ga0466965_0154111 3300044683 Bacteria 1202
520 Ga0466965_0439930 3300044683 Bacteria 725
521 Ga0466966_0012584 3300044684 Bacteria 5607
522 Ga0466966_0052358 3300044684 Bacteria 2593
523 Ga0466966_0065950 3300044684 Bacteria 2276
524 Ga0466961_0002144 3300044693 Bacteria 12265
525 Ga0466961_0060207 3300044693 Bacteria 2414
526 Ga0466961_0093991 3300044693 Bacteria 1892
527 Ga0466961_0109719 3300044693 Bacteria 1737
528 Ga0466961_0428348 3300044693 Bacteria 801
529 Ga0466961_0510507 3300044693 Bacteria 725
530 Ga0466963_0046324 3300044694 Bacteria 2867
531 Ga0466964_0024318 3300044706 Bacteria 2360
532 Ga0466971_0055377 3300044719 Bacteria 1788
533 Ga0466970_0002177 3300044765 Bacteria 9466
534 Ga0466970_0091858 3300044765 Bacteria 1648
535 Ga0466970_0148493 3300044765 Bacteria 1294
536 Ga0466970_0334745 3300044765 Bacteria 857
537 Ga0466970_0504391 3300044765 Bacteria 697
538 Ga0466970_0851589 3300044765 Bacteria 535
539 Ga0466957_0011763 3300044842 Bacteria 5059
540 Ga0466957_0030084 3300044842 Bacteria 3241
541 Ga0466957_0122167 3300044842 Bacteria 1661
542 Ga0466960_0002883 3300044901 Bacteria 6531
543 Ga0466960_0012070 3300044901 Bacteria 3635
544 Ga0466960_0066707 3300044901 Bacteria 1780
545 Ga0466960_0692215 3300044901 Bacteria 611
546 Ga0466960_1035102 3300044901 Bacteria 505
547 Ga0466959_0004347 3300045049 Bacteria 9476
548 Ga0466959_0094179 3300045049 Bacteria 2149
549 Ga0466959_1220135 3300045049 Bacteria 500
550 Ga0466958_0014356 3300045836 Bacteria 4523
551 Ga0466967_0036719 3300045976 Bacteria 4185
552 Ga0466967_0495227 3300045976 Bacteria 1199
553 Ga0466967_0543970 3300045976 Bacteria 1143
554 Ga0466967_2106476 3300045976 Bacteria 560
555 Ga0495592_0000184 3300046454 Bacteria 54898
556 Ga0495592_0035394 3300046454 Bacteria 3762
557 Ga0495592_0036036 3300046454 Bacteria 3726
558 Ga0495592_0092614 3300046454 Bacteria 2165
559 Ga0495592_0109952 3300046454 Bacteria 1951
560 Ga0495592_0217229 3300046454 Bacteria 1280
561 Ga0495592_0296180 3300046454 Bacteria 1053
562 Ga0495603_0007694 3300046455 Bacteria 6490
563 Ga0495629_0013497 3300046459 Bacteria 5892
564 Ga0495629_0205390 3300046459 Bacteria 1361
565 Ga0495641_0004733 3300046461 Bacteria 9480
566 Ga0495641_0040864 3300046461 Bacteria 2155
567 Ga0495651_0000131 3300046462 Bacteria 55705
568 Ga0495651_0032558 3300046462 Bacteria 4065
569 Ga0495651_0041587 3300046462 Bacteria 3569
570 Ga0495651_0046202 3300046462 Bacteria 3370
571 Ga0495651_0054599 3300046462 Bacteria 3071
572 Ga0495651_0103080 3300046462 Bacteria 2120
573 Ga0495651_0133537 3300046462 Bacteria 1809
574 Ga0495653_0017840 3300046463 Bacteria 5770
575 Ga0495653_0054434 3300046463 Bacteria 3057
576 Ga0495653_0059598 3300046463 Bacteria 2896
577 Ga0495653_0124216 3300046463 Bacteria 1835
578 Ga0495653_0705547 3300046463 Bacteria 612
579 Ga0495580_0037328 3300046472 Bacteria 3488
580 Ga0495580_0181927 3300046472 Bacteria 1451
581 Ga0495580_0289335 3300046472 Bacteria 1117
582 Ga0495582_0015087 3300046473 Bacteria 4249
583 Ga0495582_0518882 3300046473 Bacteria 689
584 Ga0495639_0001512 3300046475 Bacteria 10375
585 Ga0495639_0161666 3300046475 Bacteria 1084
586 Ga0495662_0002779 3300046476 Bacteria 8851
587 Ga0495662_0067629 3300046476 Bacteria 1729
588 Ga0495662_0078218 3300046476 Bacteria 1607
589 Ga0495662_0373344 3300046476 Bacteria 701
590 Ga0495664_0009440 3300046477 Bacteria 5458
591 Ga0495664_0015506 3300046477 Bacteria 4332
592 Ga0495664_0021197 3300046477 Bacteria 3753
593 Ga0495664_0046686 3300046477 Bacteria 2570
594 Ga0495664_0060513 3300046477 Bacteria 2254
595 Ga0495664_0061523 3300046477 Bacteria 2235
596 Ga0495664_0301314 3300046477 Bacteria 967
597 Ga0495594_0023662 3300046499 Bacteria 3293
598 Ga0495594_0324647 3300046499 Bacteria 877
599 Ga0495608_0000768 3300046511 Bacteria 22469
600 Ga0495608_0007038 3300046511 Bacteria 7963
601 Ga0495608_0013168 3300046511 Bacteria 5740
602 Ga0495608_0035089 3300046511 Bacteria 3384
603 Ga0495608_0055275 3300046511 Bacteria 2623
604 Ga0495608_0061227 3300046511 Bacteria 2475
605 Ga0495618_0088306 3300046514 Bacteria 1982
606 Ga0495618_0175332 3300046514 Bacteria 1363
607 Ga0495628_0000180 3300046516 Bacteria 55769
608 Ga0495628_0094660 3300046516 Bacteria 2308
609 Ga0495628_0097020 3300046516 Bacteria 2277
610 Ga0495628_0128659 3300046516 Bacteria 1938
611 Ga0495628_0186993 3300046516 Bacteria 1565
612 Ga0495628_0401788 3300046516 Bacteria 1001
613 Ga0495628_0738907 3300046516 Bacteria 692
614 Ga0495630_0051873 3300046517 Bacteria 3070
615 Ga0495630_0093518 3300046517 Bacteria 2272
616 Ga0495630_0105463 3300046517 Bacteria 2134
617 Ga0495630_0148136 3300046517 Bacteria 1785
618 Ga0495630_0967375 3300046517 Bacteria 647
619 Ga0495630_1014960 3300046517 Bacteria 630
620 Ga0495630_1085832 3300046517 Bacteria 607
621 Ga0495666_0022116 3300046526 Bacteria 3149
622 Ga0495666_0024178 3300046526 Bacteria 3002
623 Ga0495652_0001434 3300046529 Bacteria 26398
624 Ga0495652_0024252 3300046529 Bacteria 5371
625 Ga0495652_0082674 3300046529 Bacteria 2645
626 Ga0495652_0113027 3300046529 Bacteria 2180
627 Ga0495652_0157731 3300046529 Bacteria 1765
628 Ga0495652_0170963 3300046529 Bacteria 1677
629 Ga0495652_0366278 3300046529 Bacteria 1028
630 Ga0495652_0366411 3300046529 Bacteria 1028
631 Ga0495652_0372268 3300046529 Bacteria 1018
632 Ga0495652_0830437 3300046529 Bacteria 613
633 Ga0495665_0001185 3300046531 Bacteria 13888
634 Ga0495665_0005270 3300046531 Bacteria 6969
635 Ga0495665_0036087 3300046531 Bacteria 2639
636 Ga0495640_0004684 3300046533 Bacteria 10898
637 Ga0495640_0011711 3300046533 Bacteria 6734
638 Ga0495640_0019823 3300046533 Bacteria 4960
639 Ga0495640_0024262 3300046533 Bacteria 4413
640 Ga0495640_0173322 3300046533 Bacteria 1378
641 Ga0495586_0014439 3300046535 Bacteria 4195
642 Ga0495586_0016622 3300046535 Bacteria 3913
643 Ga0495586_0109132 3300046535 Bacteria 1539
644 Ga0495586_0673334 3300046535 Bacteria 598
645 Ga0495587_0000141 3300046536 Bacteria 53793
646 Ga0495587_0002857 3300046536 Bacteria 11571
647 Ga0495587_0015327 3300046536 Bacteria 4789
648 Ga0495587_0017009 3300046536 Bacteria 4521
649 Ga0495587_0069948 3300046536 Bacteria 2043
650 Ga0495587_0330079 3300046536 Bacteria 851
651 Ga0495645_0047134 3300046543 Bacteria 3140
652 Ga0495645_0057412 3300046543 Bacteria 2825
653 Ga0495645_0064711 3300046543 Bacteria 2645
654 Ga0495645_0076700 3300046543 Bacteria 2404
655 Ga0495645_0105403 3300046543 Bacteria 2000
656 Ga0495645_0212532 3300046543 Bacteria 1305
657 Ga0495622_0422911 3300046557 Bacteria 572
658 Ga0495667_0000131 3300046559 Bacteria 53825
659 Ga0495667_0008052 3300046559 Bacteria 7150
660 Ga0495667_0009309 3300046559 Bacteria 6658
661 Ga0495667_0010184 3300046559 Bacteria 6364
662 Ga0495667_0013033 3300046559 Bacteria 5630
663 Ga0495667_0078624 3300046559 Bacteria 2145
664 Ga0495634_0009569 3300046642 Bacteria 7142
665 Ga0495634_0025645 3300046642 Bacteria 4118
666 Ga0495634_0053469 3300046642 Bacteria 2705
667 Ga0495634_0060339 3300046642 Bacteria 2523
668 Ga0495634_0184054 3300046642 Bacteria 1306
669 Ga0495634_0613036 3300046642 Bacteria 631
670 Ga0495635_0136516 3300046663 Bacteria 1671
671 Ga0495635_0202146 3300046663 Bacteria 1347
672 Ga0495635_0228445 3300046663 Bacteria 1257
673 Ga0495635_0284916 3300046663 Bacteria 1109
674 Ga0495588_0040542 3300046674 Bacteria 2375
675 Ga0495588_0047251 3300046674 Bacteria 2210
676 Ga0495657_0000187 3300046675 Bacteria 55705
677 Ga0495657_0030248 3300046675 Bacteria 3794
678 Ga0495657_0044325 3300046675 Bacteria 3026
679 Ga0495657_0089699 3300046675 Bacteria 1974
680 Ga0495657_0105209 3300046675 Bacteria 1793
681 Ga0495657_0109830 3300046675 Bacteria 1748
682 Ga0495599_0000113 3300046678 Bacteria 53734
683 Ga0495599_0006846 3300046678 Bacteria 6893
684 Ga0495599_0007218 3300046678 Bacteria 6732
685 Ga0495599_0028547 3300046678 Bacteria 3497
686 Ga0495599_0059271 3300046678 Bacteria 2394
687 Ga0495599_0116883 3300046678 Bacteria 1659
688 Ga0495599_0166073 3300046678 Bacteria 1363
689 Ga0495599_0610650 3300046678 Bacteria 634
690 Ga0495599_0632034 3300046678 Bacteria 621
691 Ga0495623_0000726 3300046679 Bacteria 22031
692 Ga0495623_0011614 3300046679 Bacteria 5703
693 Ga0495623_0013773 3300046679 Bacteria 5242
694 Ga0495623_0079921 3300046679 Bacteria 2025
695 Ga0495646_0007607 3300046680 Bacteria 6885
696 Ga0495646_0015811 3300046680 Bacteria 4790
697 Ga0495646_0019233 3300046680 Bacteria 4325
698 Ga0495646_0035801 3300046680 Bacteria 3077
699 Ga0495646_0072555 3300046680 Bacteria 2024
700 Ga0495647_0100882 3300046681 Bacteria 1195
701 Ga0495658_0124385 3300046683 Bacteria 1563
702 Ga0495613_0006390 3300046689 Bacteria 8807
703 Ga0495613_0218806 3300046689 Bacteria 1337
704 Ga0495624_0006797 3300046690 Bacteria 8080
705 Ga0495624_0059447 3300046690 Bacteria 2398
706 Ga0495624_0141468 3300046690 Bacteria 1474
707 Ga0495624_0160442 3300046690 Bacteria 1374
708 Ga0495600_0003468 3300046809 Bacteria 9280
709 Ga0495600_0017104 3300046809 Bacteria 4610
710 Ga0495600_0019155 3300046809 Bacteria 4366
711 Ga0495600_0037425 3300046809 Bacteria 3154
712 Ga0495600_0095636 3300046809 Bacteria 1937
713 Ga0495600_0297842 3300046809 Bacteria 1018
714 Ga0495581_0025466 3300047315 Bacteria 3430
715 Ga0495581_0036508 3300047315 Bacteria 2843
716 Ga0495581_0037951 3300047315 Bacteria 2787
717 Ga0495604_0000209 3300047317 Bacteria 53734
718 Ga0495604_0023622 3300047317 Bacteria 4906
719 Ga0495604_0028254 3300047317 Bacteria 4462
720 Ga0495604_0038241 3300047317 Bacteria 3775
721 Ga0495604_0218474 3300047317 Bacteria 1313
722 Ga0495674_0018070 3300047319 Bacteria 6564
723 Ga0495674_0059781 3300047319 Bacteria 3327
724 Ga0495674_0073190 3300047319 Bacteria 2954
725 Ga0495674_0081518 3300047319 Bacteria 2775
726 Ga0495674_0447282 3300047319 Bacteria 1038
727 Ga0495676_0023945 3300047321 Bacteria 5290
728 Ga0495676_0081757 3300047321 Bacteria 2447
729 Ga0495680_0000323 3300047322 Bacteria 53763
730 Ga0495680_0011877 3300047322 Bacteria 7685
731 Ga0495680_0013486 3300047322 Bacteria 7128
732 Ga0495680_0014737 3300047322 Bacteria 6758
733 Ga0495680_0048019 3300047322 Bacteria 3354
734 Ga0495680_0110035 3300047322 Bacteria 2042
735 Ga0495675_0001015 3300047444 Bacteria 17036
736 Ga0495675_0027305 3300047444 Bacteria 3637
737 Ga0495675_0052747 3300047444 Bacteria 2581
738 Ga0495675_0083023 3300047444 Bacteria 2017
739 Ga0495675_0106622 3300047444 Bacteria 1751
740 Ga0495675_0195430 3300047444 Bacteria 1233
741 Ga0495684_0010593 3300047471 Bacteria 7126
742 Ga0495684_0030683 3300047471 Bacteria 4127
743 Ga0495684_0058664 3300047471 Bacteria 2931
744 Ga0495684_0066320 3300047471 Bacteria 2744
745 Ga0495684_0087559 3300047471 Bacteria 2360
746 Ga0495684_0345532 3300047471 Bacteria 1058
747 Ga0495593_0018712 3300047673 Bacteria 3889
748 Ga0495593_0277851 3300047673 Bacteria 838
749 Ga0495602_0000201 3300048088 Bacteria 55705
750 Ga0495602_0062061 3300048088 Bacteria 3244
751 Ga0495602_0139877 3300048088 Bacteria 1917
752 Ga0495602_0139997 3300048088 Bacteria 1916
753 Ga0495602_0227471 3300048088 Bacteria 1403
754 Ga0495602_0259917 3300048088 Bacteria 1288
755 Ga0495614_0034143 3300048089 Bacteria 2187
756 Ga0495614_0129811 3300048089 Bacteria 1115
757 Ga0496100_0386908 3300048903 Bacteria 1063
758 Ga0496100_0732659 3300048903 Bacteria 772
759 Ga0496101_0135489 3300048904 Bacteria 1873
760 Ga0496101_0385910 3300048904 Bacteria 1102
761 Ga0496102_0079539 3300048905 Bacteria 3019
762 Ga0496102_0605768 3300048905 Bacteria 1018
763 Ga0496103_0011000 3300048906 Bacteria 5354
764 Ga0496104_0000961 3300048907 Bacteria 24771
765 Ga0496104_0035449 3300048907 Bacteria 4658
766 Ga0496104_0738546 3300048907 Bacteria 891
767 Ga0496105_0010278 3300048908 Bacteria 7357
768 Ga0496105_0161329 3300048908 Bacteria 1840
769 Ga0496106_0456457 3300048909 Bacteria 1026
770 Ga0496106_0856925 3300048909 Bacteria 719
771 Ga0496107_0261575 3300048910 Bacteria 1287
772 Ga0496107_0345922 3300048910 Bacteria 1106
773 Ga0496108_0003044 3300048911 Bacteria 13477
774 Ga0496108_0118819 3300048911 Bacteria 2266
775 Ga0496108_0196060 3300048911 Bacteria 1751
776 Ga0496108_0281094 3300048911 Bacteria 1449
777 Ga0496108_0626083 3300048911 Bacteria 936
778 Ga0496109_0007325 3300048912 Bacteria 9330
779 Ga0496109_0023704 3300048912 Bacteria 5448
780 Ga0496109_0312503 3300048912 Bacteria 1482
781 Ga0496110_0016527 3300048913 Bacteria 6161
782 Ga0496110_0488896 3300048913 Bacteria 1121
783 Ga0496110_0784962 3300048913 Bacteria 856
784 Ga0496111_0060621 3300048914 Bacteria 2742
785 Ga0496111_1201029 3300048914 Bacteria 537
786 Ga0496112_0015631 3300048915 Bacteria 7088
787 Ga0496112_0164656 3300048915 Bacteria 2183
788 Ga0496112_0535844 3300048915 Bacteria 1105
789 Ga0496113_0021000 3300048916 Bacteria 4601
790 Ga0496113_0026523 3300048916 Bacteria 4143
791 Ga0496113_0677961 3300048916 Bacteria 823
792 Ga0496114_0499987 3300048917 Bacteria 1075
793 Ga0496115_0045544 3300048918 Bacteria 3502
794 Ga0496115_0066577 3300048918 Bacteria 2911
795 Ga0496115_0160288 3300048918 Bacteria 1859
796 Ga0496115_0410765 3300048918 Bacteria 1097
797 Ga0496119_0000290 3300048922 Bacteria 70278
798 Ga0496119_0393623 3300048922 Bacteria 662
799 Ga0496120_0000103 3300048923 Bacteria 141601
800 Ga0496126_0010956 3300048929 Bacteria 9444
801 Ga0496126_0923062 3300048929 Bacteria 660
802 Ga0496126_1064527 3300048929 Bacteria 603
803 Ga0501031_0028296 3300049568 Bacteria 3653
804 Ga0501032_0038427 3300049569 Bacteria 3260
805 Ga0501034_1052079 3300049571 Bacteria 696
806 Ga0501036_0042109 3300049572 Bacteria 3866
807 Ga0501038_0261972 3300049574 Bacteria 1366
808 Ga0501038_1160851 3300049574 Bacteria 562
809 Ga0501039_0036007 3300049575 Bacteria 3818
810 Ga0501039_0048170 3300049575 Bacteria 3295
811 Ga0501039_0509534 3300049575 Bacteria 945
812 Ga0501040_0002169 3300049576 Bacteria 12667
813 Ga0501040_0183974 3300049576 Bacteria 1482
814 Ga0501041_0016935 3300049577 Bacteria 4336
815 Ga0501042_0017357 3300049578 Bacteria 4963
816 Ga0501043_0513872 3300049579 Bacteria 893
817 Ga0501046_0297644 3300049580 Bacteria 1179
818 Ga0501048_0020126 3300049582 Bacteria 4895
819 Ga0501048_1142092 3300049582 Bacteria 560
820 Ga0501067_0040091 3300049583 Bacteria 2602
821 Ga0501067_0392385 3300049583 Bacteria 774
822 Ga0501069_0135230 3300049585 Bacteria 1413
823 Ga0501069_0147852 3300049585 Bacteria 1349
824 Ga0501069_0311600 3300049585 Bacteria 924
825 Ga0501069_0463813 3300049585 Bacteria 754
826 Ga0501069_0780265 3300049585 Unclassified 579
827 Ga0501070_0070615 3300049586 Bacteria 2892
828 Ga0501070_0091317 3300049586 Bacteria 2520
829 Ga0501070_0209423 3300049586 Bacteria 1600
830 Ga0501070_0754402 3300049586 Bacteria 767
831 Ga0501070_0972190 3300049586 Bacteria 659
832 Ga0501071_0031313 3300049587 Bacteria 3769
833 Ga0501071_0076414 3300049587 Bacteria 2446
834 Ga0501071_0967948 3300049587 Bacteria 657
835 Ga0501071_1136735 3300049587 Bacteria 603
836 Ga0501072_0018491 3300049588 Bacteria 5368
837 Ga0501072_0139902 3300049588 Bacteria 1930
838 Ga0501072_0313993 3300049588 Bacteria 1246
839 Ga0501072_0374950 3300049588 Bacteria 1129
840 Ga0501072_0384395 3300049588 Bacteria 1114
841 Ga0501074_0411358 3300049590 Bacteria 959
842 Ga0501075_0017170 3300049591 Bacteria 5224
843 Ga0501075_0165675 3300049591 Bacteria 1686
844 Ga0501076_0006919 3300049592 Bacteria 8240
845 Ga0501076_0091215 3300049592 Bacteria 2451
846 Ga0501076_0183216 3300049592 Bacteria 1708
847 Ga0501077_0283075 3300049593 Bacteria 1055
848 Ga0501079_0003322 3300049741 Bacteria 11797
849 Ga0501079_1619641 3300049741 Bacteria 509
850 Ga0501080_0104937 3300049742 Bacteria 2621
851 Ga0501081_0014169 3300049743 Bacteria 5255
852 Ga0501081_0519097 3300049743 Bacteria 888
853 Ga0501035_0857363 3300049822 Bacteria 722
854 Ga0501035_1284538 3300049822 Bacteria 565
855 Ga0501044_1473629 3300049823 Bacteria 546
856 Ga0501045_0002561 3300049824 Bacteria 12392
857 Ga0501045_0144267 3300049824 Bacteria 1771
858 nmdc:mga03683_52169_c1 3300050489 Bacteria 1709
859 nmdc:mga03n38_456175_c1 3300050490 Bacteria 712
860 nmdc:mga03n38_605093_c1 3300050490 Bacteria 625
861 nmdc:mga00v17_179305_c1 3300050491 Bacteria 1367
862 nmdc:mga00v17_189395_c1 3300050491 Bacteria 1328
863 nmdc:mga00v17_477469_c1 3300050491 Bacteria 809
864 nmdc:mga00v17_531686_c1 3300050491 Bacteria 761
865 nmdc:mga0yw44_1497_c1 3300050492 Bacteria 9314
866 nmdc:mga0yw44_283847_c1 3300050492 Bacteria 1107
867 nmdc:mga0yw44_32008_c1 3300050492 Bacteria 3062
868 nmdc:mga0yw44_451302_c1 3300050492 Bacteria 871
869 nmdc:mga0yw44_62893_c1 3300050492 Bacteria 2281
870 nmdc:mga0yw44_683535_c1 3300050492 Bacteria 697
871 nmdc:mga0yw44_708048_c1 3300050492 Bacteria 684
872 nmdc:mga0yw44_82602_c1 3300050492 Bacteria 2016
873 nmdc:mga06z11_284109_c1 3300050494 Bacteria 981
874 nmdc:mga06z11_356696_c1 3300050494 Bacteria 876
875 nmdc:mga06z11_419735_c1 3300050494 Bacteria 806
876 nmdc:mga06z11_466547_c1 3300050494 Bacteria 764
877 nmdc:mga06z11_471486_c1 3300050494 Bacteria 760
878 nmdc:mga06z11_713443_c1 3300050494 Bacteria 611
879 nmdc:mga04h51_6174_c1 3300050495 Bacteria 3093
880 nmdc:mga07m45_479521_c1 3300050496 Bacteria 721
881 nmdc:mga08y16_32073_c1 3300050511 Bacteria 5524
882 nmdc:mga08y16_6137_c1 3300050511 Bacteria 12599
883 nmdc:mga0n895_115659_c1 3300050512 Bacteria 2700
884 nmdc:mga0n895_1362160_c1 3300050512 Bacteria 679
885 nmdc:mga0n895_277814_c1 3300050512 Bacteria 1699
886 nmdc:mga0n895_50960_c1 3300050512 Bacteria 4061
887 nmdc:mga0rr50_441980_c1 3300050513 Bacteria 1102
888 nmdc:mga0rr50_487829_c1 3300050513 Bacteria 1047
889 nmdc:mga0rr50_57369_c1 3300050513 Bacteria 2913
890 nmdc:mga0rr50_662474_c1 3300050513 Bacteria 891
891 nmdc:mga0rr50_803_c1 3300050513 Bacteria 16935
892 nmdc:mga08x19_15786_c1 3300050514 Bacteria 4597
893 nmdc:mga08x19_617582_c1 3300050514 Bacteria 768
894 nmdc:mga08x19_64773_c1 3300050514 Bacteria 2373
895 nmdc:mga0a205_4611_c1 3300050515 Bacteria 12358
896 Ga0495601_0034844 3300053077 Bacteria 3140
897 Ga0495601_0039047 3300053077 Bacteria 2971
898 Ga0495601_0056331 3300053077 Bacteria 2489
899 Ga0495601_0160864 3300053077 Bacteria 1467
900 Ga0495601_0336616 3300053077 Bacteria 982
901 Ga0495601_0355238 3300053077 Bacteria 952
902 Ga0495612_0000933 3300053078 Bacteria 11987
903 Ga0495612_0028588 3300053078 Bacteria 2245
904 Ga0495612_0030456 3300053078 Bacteria 2173
905 Ga0495612_0030911 3300053078 Bacteria 2158
906 Ga0495612_0121587 3300053078 Bacteria 1123
907 Ga0495595_0002531 3300053084 Bacteria 7169
908 Ga0495595_0010961 3300053084 Bacteria 3782
909 Ga0495595_0024834 3300053084 Bacteria 2649
910 Ga0495595_0108284 3300053084 Bacteria 1346
911 Ga0495619_0015950 3300053085 Bacteria 4755
912 Ga0495619_0232462 3300053085 Bacteria 1277
913 Ga0495619_0659537 3300053085 Bacteria 713
914 Ga0495619_0688642 3300053085 Bacteria 695
915 Ga0500573_0201175 3300053140 Bacteria 1057
916 Ga0501084_0128423 3300054114 Bacteria 2133
917 Ga0501084_0146514 3300054114 Bacteria 1989
918 Ga0501082_0766380 3300060353 Bacteria 844
919 Ga0501082_0863505 3300060353 Bacteria 792
920 Ga0466962_0108384 3300061719 Bacteria 1336
921 Ga0466962_0114873 3300061719 Bacteria 1297
922 Ga0530510_0340676 3300061734 Bacteria 1125
923 Ga0530510_0727008 3300061734 Bacteria 757
924 2643826461 2643221561 Bacteria 4984412
925 2644089421 2643221615 Bacteria 5487866
926 2644319266 2643221657 Bacteria 5490246
927 2738869479 2738541305 Bacteria 4910150
928 2808872310 2808606365 Bacteria 4301966
929 2812333220 2811994874 Bacteria 5367947
930 2856741982 2856741275 Bacteria 8096094
931 2873318144 2873314349 Bacteria 8512634
932 2891396381 2891395885 Bacteria 9251614
933 2891558361 2891554331 Bacteria 8812224
934 2891566475 2891562705 Bacteria 8039471
935 2895436661 2895427314 Bacteria 13147766
936 2919718195 2919713450 Bacteria 7431245
937 2984579352 2984576629 Bacteria 4248407
938 2990256963 2990256926 Bacteria 4252839
939 3003001319 3002998708 Bacteria 11715108
940 8053950365 8053945823 Bacteria 8962862
941 8054611156 8054609563 Bacteria 5170090
942 Ga0466967_0844265
943 Ga0070658_10000158
944 Ga0070658_10018944
945 Ga0070658_10129353
946 Ga0070658_10166901
947 Ga0070658_10362906
948 Ga0070676_10095272
949 Ga0070676_10656207
950 Ga0070683_100151950
951 Ga0070683_100285312
952 Ga0070690_100128349
953 Ga0070690_100293740
954 Ga0068869_100479382
955 Ga0070666_10360978
956 Ga0070680_100008268
957 Ga0070680_100079865
958 Ga0070680_100104490
959 Ga0070682_100829953
960 Ga0068868_101244795
961 Ga0070660_100838315
962 Ga0070660_101667121
963 Ga0070689_100526223
964 Ga0070689_100740875
965 Ga0070691_10172115
966 Ga0070661_101145630
967 Ga0070675_100403992
968 Ga0070675_100749743
969 Ga0070671_100459621
970 Ga0070674_100346211
971 Ga0070659_100001258
972 Ga0070659_100238961
973 Ga0070659_100539305
974 Ga0070667_100064803
975 Ga0070667_100641040
976 Ga0070667_100665790
977 Ga0070709_10000169
978 Ga0070709_10035138
979 Ga0070709_10077460
980 Ga0070714_100078175
981 Ga0070714_100151874
982 Ga0070714_100158543
983 Ga0070714_100258574
984 Ga0070714_100307219
985 Ga0070714_100524714
986 Ga0070714_100852132
987 Ga0070714_100889083
988 Ga0070713_100086271
989 Ga0070713_100096916
990 Ga0070713_100211141
991 Ga0070713_100396989
992 Ga0070713_100609124
993 Ga0070713_100910947
994 Ga0070710_10006479
995 Ga0070710_10016835
996 Ga0070710_10065623
997 Ga0070710_10092288
998 Ga0070710_10109305
999 Ga0070711_100004460
1000 Ga0070711_100067694
1001 Ga0070711_100519900
1002 Ga0070705_100420811
1003 Ga0070700_100907799
1004 Ga0070708_100260347
1005 Ga0070708_100933041
1006 Ga0070663_100146513
1007 Ga0070678_100132926
1008 Ga0070662_100496444
1009 Ga0070681_10000477
1010 Ga0070681_10102380
1011 Ga0070681_10726226
1012 Ga0068867_101536856
1013 Ga0070685_10703614
1014 Ga0070706_100002920
1015 Ga0070706_100021884
1016 Ga0070706_100058514
1017 Ga0070706_100118065
1018 Ga0070706_100528998
1019 Ga0070706_100636175
1020 Ga0070706_100669491
1021 Ga0070707_100020822
1022 Ga0070707_100021782
1023 Ga0070707_100026241
1024 Ga0070707_100055420
1025 Ga0070707_100095956
1026 Ga0070698_100002175
1027 Ga0070698_100030449
1028 Ga0070698_100057473
1029 Ga0070698_100061172
1030 Ga0070698_100082007
1031 Ga0070699_100575577
1032 Ga0070679_100000521
1033 Ga0070679_100093697
1034 Ga0070679_100132171
1035 Ga0070679_100199108
1036 Ga0070679_100368868
1037 Ga0070679_100408693
1038 Ga0070684_100099739
1039 Ga0070697_100104197
1040 Ga0068853_100071753
1041 Ga0068853_101068616
1042 Ga0070695_100151689
1043 Ga0070695_100423926
1044 Ga0070696_100126143
1045 Ga0070693_100109195
1046 Ga0068855_102296874
1047 Ga0070664_100797598
1048 Ga0068857_100133729
1049 Ga0068857_101282088
1050 Ga0068854_100552993
1051 Ga0068856_100025058
1052 Ga0068856_100741128
1053 Ga0068856_100860658
1054 Ga0070702_100431408
1055 Ga0068852_100963007
1056 Ga0068859_100035415
1057 Ga0068859_100353403
1058 Ga0068864_100065553
1059 Ga0068864_100516101
1060 Ga0068861_101236797
1061 Ga0068851_10739310
1062 Ga0068863_100090421
1063 Ga0068858_100339571
1064 Ga0068860_100000334
1065 Ga0068860_100181629
1066 Ga0068860_100348171
1067 Ga0068862_100303372
1068 Ga0081455_10216955
1069 Ga0081455_10489574
1070 Ga0081455_10511810
1071 Ga0081539_10064214
1072 Ga0070717_10148387
1073 Ga0070717_10274187
1074 Ga0070717_10481647
1075 Ga0070717_10736106
1076 Ga0070717_10814214
1077 Ga0075365_10012686
1078 Ga0075365_10020548
1079 Ga0075365_10103695
1080 Ga0075365_10106052
1081 Ga0075365_10113238
1082 Ga0075365_10126865
1083 Ga0075365_10146911
1084 Ga0075365_10571490
1085 Ga0075365_10585480
1086 Ga0075368_10007589
1087 Ga0075363_100005487
1088 Ga0075363_100100131
1089 Ga0075364_10029625
1090 Ga0075364_10449032
1091 Ga0075364_10518416
1092 Ga0075432_10021839
1093 Ga0070715_10054925
1094 Ga0070716_100189873
1095 Ga0070716_100344512
1096 Ga0070712_100154336
1097 Ga0070712_100175425
1098 Ga0070712_100457548
1099 Ga0070712_100464811
1100 Ga0070712_100484076
1101 Ga0070712_100600133
1102 Ga0070712_100724648
1103 Ga0070712_101319930
1104 Ga0075362_10020031
1105 Ga0075367_10052247
1106 Ga0075367_10318112
1107 Ga0075367_10343565
1108 Ga0075367_10392782
1109 Ga0075367_10517510
1110 Ga0097621_100247251
1111 Ga0097621_100304441
1112 Ga0075370_10005619
1113 Ga0068871_100051304
1114 Ga0068871_100556395
1115 Ga0075428_100037033
1116 Ga0075430_100196017
1117 Ga0075433_10002552
1118 Ga0075433_10056705
1119 Ga0075434_100009923
1120 Ga0075434_100049787
1121 Ga0075434_100232652
1122 Ga0075434_100824281
1123 Ga0075434_101479557
1124 Ga0075436_100001677
1125 Ga0075436_100164768
1126 Ga0075436_100219894
1127 Ga0075436_100257596
1128 Ga0097620_100035416
1129 Ga0097620_100353400
1130 Ga0075435_100002810
1131 Ga0075435_100203110
1132 Ga0075435_100272660
1133 Ga0075435_100308200
1134 Ga0075435_100606485
1135 Ga0105251_10314032
1136 Ga0105250_10132926
1137 Ga0111539_10003840
1138 Ga0111539_10082371
1139 Ga0111539_10348159
1140 Ga0105245_10161185
1141 Ga0105245_10603782
1142 Ga0105245_11140876
1143 Ga0105247_10127806
1144 Ga0114129_11812613
1145 Ga0105243_10421999
1146 Ga0105241_10841897
1147 Ga0105241_11259173
1148 Ga0105241_11266065
1149 Ga0105242_10224088
1150 Ga0105248_10001693
1151 Ga0105248_10663643
1152 Ga0105248_11171271
1153 Ga0105237_10049803
1154 Ga0105237_10271779
1155 Ga0105237_11723561
1156 Ga0105238_10192905
1157 Ga0105249_10342165
1158 Ga0105249_10872220
1159 Ga0105239_10101403
1160 Ga0105239_10600868
1161 Ga0157341_1021417
1162 Ga0157342_1018987
1163 Ga0157338_1009839
1164 Ga0157373_10488036
1165 Ga0157371_10054330
1166 Ga0157370_10196659
1167 Ga0157370_10467902
1168 Ga0157370_10807002
1169 Ga0157369_10035314
1170 Ga0157369_10211251
1171 Ga0157369_11146767
1172 Ga0157369_12278617
1173 Ga0157374_10051133
1174 Ga0157374_10797198
1175 Ga0163162_10039395
1176 Ga0157372_10241084
1177 Ga0157372_12121283
1178 Ga0157372_13340673
1179 Ga0157375_10072257
1180 Ga0157375_10734235
1181 Ga0163163_10007728
1182 Ga0163163_10045897
1183 Ga0163163_10109683
1184 Ga0157380_11096554
1185 Ga0182008_10578847
1186 Ga0157377_10073742
1187 Ga0157379_10024347
1188 Ga0157379_10032700
1189 Ga0157379_10423256
1190 Ga0157376_10023750
1191 Ga0206356_10498411
1192 Ga0206354_10954142
1193 Ga0213875_10051044
1194 Ga0213875_10189008
1195 Ga0224712_10129158
1196 Ga0224571_103483
1197 Ga0228600_1005047
1198 Ga0224572_1045916
1199 Ga0207656_10216480
1200 Ga0207692_10000163
1201 Ga0207692_10015879
1202 Ga0207692_10045088
1203 Ga0207692_10081678
1204 Ga0207710_10000030
1205 Ga0207710_10235822
1206 Ga0207688_10164440
1207 Ga0207647_10118422
1208 Ga0207647_10228790
1209 Ga0207685_10050740
1210 Ga0207685_10145519
1211 Ga0207685_10189891
1212 Ga0207699_10000201
1213 Ga0207699_10012599
1214 Ga0207699_10083278
1215 Ga0207699_10101419
1216 Ga0207699_10875627
1217 Ga0207645_10176344
1218 Ga0207643_10008616
1219 Ga0207705_10000399
1220 Ga0207705_10017254
1221 Ga0207705_10067515
1222 Ga0207705_10072639
1223 Ga0207705_10222137
1224 Ga0207705_10554364
1225 Ga0207705_10656937
1226 Ga0207684_10002079
1227 Ga0207684_10018950
1228 Ga0207684_10038962
1229 Ga0207684_10071650
1230 Ga0207684_10416581
1231 Ga0207707_10000720
1232 Ga0207707_10081666
1233 Ga0207707_10145519
1234 Ga0207707_10921660
1235 Ga0207693_10012620
1236 Ga0207693_10242938
1237 Ga0207693_10251306
1238 Ga0207693_10273712
1239 Ga0207693_10486823
1240 Ga0207663_10001705
1241 Ga0207663_10012581
1242 Ga0207663_10076199
1243 Ga0207663_10353322
1244 Ga0207663_10501131
1245 Ga0207663_10841080
1246 Ga0207660_10013060
1247 Ga0207660_10059583
1248 Ga0207660_10132131
1249 Ga0207660_10164916
1250 Ga0207660_10205878
1251 Ga0207660_10295281
1252 Ga0207657_10222958
1253 Ga0207657_10438119
1254 Ga0207657_10660398
1255 Ga0207657_10686833
1256 Ga0207657_11034745
1257 Ga0207649_10301702
1258 Ga0207652_10000798
1259 Ga0207652_10172648
1260 Ga0207652_10191353
1261 Ga0207652_10281676
1262 Ga0207652_10329666
1263 Ga0207652_10671478
1264 Ga0207646_10000235
1265 Ga0207646_10006203
1266 Ga0207646_10011031
1267 Ga0207646_10019130
1268 Ga0207646_10783559
1269 Ga0207681_10570279
1270 Ga0207694_10762336
1271 Ga0207694_10772599
1272 Ga0207659_10355051
1273 Ga0207659_10603195
1274 Ga0207687_10089514
1275 Ga0207687_10163959
1276 Ga0207687_10588287
1277 Ga0207700_10003259
1278 Ga0207700_10003268
1279 Ga0207700_10073649
1280 Ga0207700_10204373
1281 Ga0207700_10245832
1282 Ga0207700_10270765
1283 Ga0207664_10007630
1284 Ga0207664_10009986
1285 Ga0207664_10017900
1286 Ga0207664_10035535
1287 Ga0207664_10068066
1288 Ga0207664_10073604
1289 Ga0207664_10213197
1290 Ga0207664_10639126
1291 Ga0207664_11000415
1292 Ga0207664_11042747
1293 Ga0207664_11150610
1294 Ga0207644_10351262
1295 Ga0207706_10186689
1296 Ga0207706_10197840
1297 Ga0207686_10365522
1298 Ga0207670_10431106
1299 Ga0207669_10523020
1300 Ga0207665_10002435
1301 Ga0207665_10011169
1302 Ga0207665_10020196
1303 Ga0207665_10029190
1304 Ga0207665_10051497
1305 Ga0207711_10071258
1306 Ga0207711_10470697
1307 Ga0207689_10181640
1308 Ga0207689_10478277
1309 Ga0207661_10104468
1310 Ga0207661_10299343
1311 Ga0207679_10159324
1312 Ga0207679_10706225
1313 Ga0207667_10838128
1314 Ga0207651_10254972
1315 Ga0207712_10358586
1316 Ga0207712_10584034
1317 Ga0207640_10519037
1318 Ga0207658_10045024
1319 Ga0207658_10481930
1320 Ga0207658_10827486
1321 Ga0207677_10054423
1322 Ga0207703_10402393
1323 Ga0207703_11326446
1324 Ga0207678_10182337
1325 Ga0207708_10977767
1326 Ga0207702_10088798
1327 Ga0207702_10532694
1328 Ga0207648_10190954
1329 Ga0207676_10049767
1330 Ga0207674_10154902
1331 Ga0207683_10008286
1332 Ga0209813_10231409
1333 Ga0207428_10001176
1334 Ga0207428_10020592
1335 Ga0268266_11216696
1336 Ga0268264_10002232
1337 Ga0268264_10528032
1338 Ga0265338_10003426
1339 Ga0307409_100235546
1340 Ga0316214_1035757
1341 Ga0373948_0029789
1342 Ga0373950_0092696
1343 Ga0373926_0008108
1344 Ga0373926_0095935
1345 Ga0373926_0222153
1346 Ga0373926_0274262
1347 Ga0373929_0011930
1348 Ga0373934_0000027
1349 Ga0373934_0002340
1350 Ga0373934_0017122
1351 Ga0373934_0019085
1352 Ga0373934_0167540
1353 Ga0373940_0016961
1354 Ga0373944_0000323
1355 Ga0373944_0015922
1356 Ga0373944_0065359
1357 Ga0373923_0072476
1358 Ga0373923_0093929
1359 Ga0373923_0121724
1360 Ga0373932_0026941
1361 Ga0373936_0071408
1362 Ga0373936_0138399
1363 Ga0373939_0113443
1364 Ga0373945_0003858
1365 Ga0373945_0028589
1366 Ga0373945_0171508
1367 Ga0373953_0000032
1368 Ga0373953_0009571
1369 Ga0373953_0010179
1370 Ga0373953_0071946
1371 Ga0373953_0096894
1372 Ga0373953_0124364
1373 Ga0373953_0352162
1374 Ga0373954_0000342
1375 Ga0373954_0008936
1376 Ga0373954_0020321
1377 Ga0373954_0049616
1378 Ga0373954_0172158
1379 Ga0373956_0000561
1380 Ga0373956_0006481
1381 Ga0373956_0011840
1382 Ga0373956_0075064
1383 Ga0373956_0424904
1384 Ga0373957_0000128
1385 Ga0373957_0026484
1386 Ga0373957_0045453
1387 Ga0373957_0051609
1388 Ga0373957_0076066
1389 Ga0373960_0146993
1390 Ga0373943_0088807
1391 Ga0373943_0118000
1392 Ga0373943_0128571
1393 Ga0373943_0537884
1394 Ga0373946_0000324
1395 Ga0373955_0000361
1396 Ga0373955_0032622
1397 Ga0373955_0034558
1398 Ga0373955_0045505
1399 Ga0373955_0214047
1400 Ga0373962_0024594
1401 Ga0373924_0004004
1402 Ga0373924_0011107
1403 Ga0373924_0012923
1404 Ga0373924_0135037
1405 Ga0373924_0435359
1406 Ga0373935_0018511
1407 Ga0373935_0027826
1408 Ga0373935_0069776
1409 Ga0373935_0193209
1410 Ga0373935_0296827
1411 Ga0373927_0016926
1412 Ga0373927_0051130
1413 Ga0373927_0256743
1414 Ga0373933_0000103
1415 Ga0373933_0026161
1416 Ga0373933_0096420
1417 Ga0373933_0211824
1418 Ga0373947_0012689
1419 Ga0373947_0201673
1420 Ga0373947_0574914
1421 Ga0373947_0610441
1422 Ga0373947_0713360
1423 Ga0373937_0000683
1424 Ga0373937_0068896
1425 Ga0373937_0089477
1426 Ga0373937_0121182
1427 Ga0373937_0384826
1428 Ga0373937_0508494
1429 Ga0373937_0641431
1430 Ga0373937_0658831
1431 Ga0373925_0011085
1432 Ga0373925_0044028
1433 Ga0373925_1030339
1434 Ga0395900_0242198
1435 Ga0395898_1101945
1436 Ga0395905_0378173
1437 Ga0436364_0307500
1438 Ga0436364_0374489
1439 Ga0436364_0377030
1440 Ga0436364_1040386
1441 Ga0436364_1044748
1442 Ga0436364_1057201
1443 Ga0436364_1231352
1444 Ga0395901_0131036
1445 Ga0395901_0195467
1446 Ga0436365_0920719
1447 Ga0436365_1108856
1448 Ga0436360_0524089
1449 Ga0436361_0139746
1450 Ga0436361_0585092
1451 Ga0436363_1476138
1452 Ga0436363_1500493
1453 Ga0436362_1225677
1454 Ga0451807_1909869
1455 Ga0466972_0017104
1456 Ga0466972_0249351
1457 Ga0466965_0011179
1458 Ga0466965_0033928
1459 Ga0466965_0041318
1460 Ga0466965_0154111
1461 Ga0466965_0439930
1462 Ga0466966_0012584
1463 Ga0466966_0052358
1464 Ga0466966_0065950
1465 Ga0466961_0002144
1466 Ga0466961_0060207
1467 Ga0466961_0093991
1468 Ga0466961_0109719
1469 Ga0466961_0428348
1470 Ga0466961_0510507
1471 Ga0466963_0046324
1472 Ga0466964_0024318
1473 Ga0466971_0055377
1474 Ga0466970_0002177
1475 Ga0466970_0091858
1476 Ga0466970_0148493
1477 Ga0466970_0334745
1478 Ga0466970_0504391
1479 Ga0466970_0851589
1480 Ga0466957_0011763
1481 Ga0466957_0030084
1482 Ga0466957_0122167
1483 Ga0466960_0002883
1484 Ga0466960_0012070
1485 Ga0466960_0066707
1486 Ga0466960_0692215
1487 Ga0466960_1035102
1488 Ga0466959_0004347
1489 Ga0466959_0094179
1490 Ga0466959_1220135
1491 Ga0466958_0014356
1492 Ga0466967_0036719
1493 Ga0466967_0495227
1494 Ga0466967_0543970
1495 Ga0466967_2106476
1496 Ga0495592_0000184
1497 Ga0495592_0035394
1498 Ga0495592_0036036
1499 Ga0495592_0092614
1500 Ga0495592_0109952
1501 Ga0495592_0217229
1502 Ga0495592_0296180
1503 Ga0495603_0007694
1504 Ga0495629_0013497
1505 Ga0495629_0205390
1506 Ga0495641_0004733
1507 Ga0495641_0040864
1508 Ga0495651_0000131
1509 Ga0495651_0032558
1510 Ga0495651_0041587
1511 Ga0495651_0046202
1512 Ga0495651_0054599
1513 Ga0495651_0103080
1514 Ga0495651_0133537
1515 Ga0495653_0017840
1516 Ga0495653_0054434
1517 Ga0495653_0059598
1518 Ga0495653_0124216
1519 Ga0495653_0705547
1520 Ga0495580_0037328
1521 Ga0495580_0181927
1522 Ga0495580_0289335
1523 Ga0495582_0015087
1524 Ga0495582_0518882
1525 Ga0495639_0001512
1526 Ga0495639_0161666
1527 Ga0495662_0002779
1528 Ga0495662_0067629
1529 Ga0495662_0078218
1530 Ga0495662_0373344
1531 Ga0495664_0009440
1532 Ga0495664_0015506
1533 Ga0495664_0021197
1534 Ga0495664_0046686
1535 Ga0495664_0060513
1536 Ga0495664_0061523
1537 Ga0495664_0301314
1538 Ga0495594_0023662
1539 Ga0495594_0324647
1540 Ga0495608_0000768
1541 Ga0495608_0007038
1542 Ga0495608_0013168
1543 Ga0495608_0035089
1544 Ga0495608_0055275
1545 Ga0495608_0061227
1546 Ga0495618_0088306
1547 Ga0495618_0175332
1548 Ga0495628_0000180
1549 Ga0495628_0094660
1550 Ga0495628_0097020
1551 Ga0495628_0128659
1552 Ga0495628_0186993
1553 Ga0495628_0401788
1554 Ga0495628_0738907
1555 Ga0495630_0051873
1556 Ga0495630_0093518
1557 Ga0495630_0105463
1558 Ga0495630_0148136
1559 Ga0495630_0967375
1560 Ga0495630_1014960
1561 Ga0495630_1085832
1562 Ga0495666_0022116
1563 Ga0495666_0024178
1564 Ga0495652_0001434
1565 Ga0495652_0024252
1566 Ga0495652_0082674
1567 Ga0495652_0113027
1568 Ga0495652_0157731
1569 Ga0495652_0170963
1570 Ga0495652_0366278
1571 Ga0495652_0366411
1572 Ga0495652_0372268
1573 Ga0495652_0830437
1574 Ga0495665_0001185
1575 Ga0495665_0005270
1576 Ga0495665_0036087
1577 Ga0495640_0004684
1578 Ga0495640_0011711
1579 Ga0495640_0019823
1580 Ga0495640_0024262
1581 Ga0495640_0173322
1582 Ga0495586_0014439
1583 Ga0495586_0016622
1584 Ga0495586_0109132
1585 Ga0495586_0673334
1586 Ga0495587_0000141
1587 Ga0495587_0002857
1588 Ga0495587_0015327
1589 Ga0495587_0017009
1590 Ga0495587_0069948
1591 Ga0495587_0330079
1592 Ga0495645_0047134
1593 Ga0495645_0057412
1594 Ga0495645_0064711
1595 Ga0495645_0076700
1596 Ga0495645_0105403
1597 Ga0495645_0212532
1598 Ga0495622_0422911
1599 Ga0495667_0000131
1600 Ga0495667_0008052
1601 Ga0495667_0009309
1602 Ga0495667_0010184
1603 Ga0495667_0013033
1604 Ga0495667_0078624
1605 Ga0495634_0009569
1606 Ga0495634_0025645
1607 Ga0495634_0053469
1608 Ga0495634_0060339
1609 Ga0495634_0184054
1610 Ga0495634_0613036
1611 Ga0495635_0136516
1612 Ga0495635_0202146
1613 Ga0495635_0228445
1614 Ga0495635_0284916
1615 Ga0495588_0040542
1616 Ga0495588_0047251
1617 Ga0495657_0000187
1618 Ga0495657_0030248
1619 Ga0495657_0044325
1620 Ga0495657_0089699
1621 Ga0495657_0105209
1622 Ga0495657_0109830
1623 Ga0495599_0000113
1624 Ga0495599_0006846
1625 Ga0495599_0007218
1626 Ga0495599_0028547
1627 Ga0495599_0059271
1628 Ga0495599_0116883
1629 Ga0495599_0166073
1630 Ga0495599_0610650
1631 Ga0495599_0632034
1632 Ga0495623_0000726
1633 Ga0495623_0011614
1634 Ga0495623_0013773
1635 Ga0495623_0079921
1636 Ga0495646_0007607
1637 Ga0495646_0015811
1638 Ga0495646_0019233
1639 Ga0495646_0035801
1640 Ga0495646_0072555
1641 Ga0495647_0100882
1642 Ga0495658_0124385
1643 Ga0495613_0006390
1644 Ga0495613_0218806
1645 Ga0495624_0006797
1646 Ga0495624_0059447
1647 Ga0495624_0141468
1648 Ga0495624_0160442
1649 Ga0495600_0003468
1650 Ga0495600_0017104
1651 Ga0495600_0019155
1652 Ga0495600_0037425
1653 Ga0495600_0095636
1654 Ga0495600_0297842
1655 Ga0495581_0025466
1656 Ga0495581_0036508
1657 Ga0495581_0037951
1658 Ga0495604_0000209
1659 Ga0495604_0023622
1660 Ga0495604_0028254
1661 Ga0495604_0038241
1662 Ga0495604_0218474
1663 Ga0495674_0018070
1664 Ga0495674_0059781
1665 Ga0495674_0073190
1666 Ga0495674_0081518
1667 Ga0495674_0447282
1668 Ga0495676_0023945
1669 Ga0495676_0081757
1670 Ga0495680_0000323
1671 Ga0495680_0011877
1672 Ga0495680_0013486
1673 Ga0495680_0014737
1674 Ga0495680_0048019
1675 Ga0495680_0110035
1676 Ga0495675_0001015
1677 Ga0495675_0027305
1678 Ga0495675_0052747
1679 Ga0495675_0083023
1680 Ga0495675_0106622
1681 Ga0495675_0195430
1682 Ga0495684_0010593
1683 Ga0495684_0030683
1684 Ga0495684_0058664
1685 Ga0495684_0066320
1686 Ga0495684_0087559
1687 Ga0495684_0345532
1688 Ga0495593_0018712
1689 Ga0495593_0277851
1690 Ga0495602_0000201
1691 Ga0495602_0062061
1692 Ga0495602_0139877
1693 Ga0495602_0139997
1694 Ga0495602_0227471
1695 Ga0495602_0259917
1696 Ga0495614_0034143
1697 Ga0495614_0129811
1698 Ga0496100_0386908
1699 Ga0496100_0732659
1700 Ga0496101_0135489
1701 Ga0496101_0385910
1702 Ga0496102_0079539
1703 Ga0496102_0605768
1704 Ga0496103_0011000
1705 Ga0496104_0000961
1706 Ga0496104_0035449
1707 Ga0496104_0738546
1708 Ga0496105_0010278
1709 Ga0496105_0161329
1710 Ga0496106_0456457
1711 Ga0496106_0856925
1712 Ga0496107_0261575
1713 Ga0496107_0345922
1714 Ga0496108_0003044
1715 Ga0496108_0118819
1716 Ga0496108_0196060
1717 Ga0496108_0281094
1718 Ga0496108_0626083
1719 Ga0496109_0007325
1720 Ga0496109_0023704
1721 Ga0496109_0312503
1722 Ga0496110_0016527
1723 Ga0496110_0488896
1724 Ga0496110_0784962
1725 Ga0496111_0060621
1726 Ga0496111_1201029
1727 Ga0496112_0015631
1728 Ga0496112_0164656
1729 Ga0496112_0535844
1730 Ga0496113_0021000
1731 Ga0496113_0026523
1732 Ga0496113_0677961
1733 Ga0496114_0499987
1734 Ga0496115_0045544
1735 Ga0496115_0066577
1736 Ga0496115_0160288
1737 Ga0496115_0410765
1738 Ga0496119_0000290
1739 Ga0496119_0393623
1740 Ga0496120_0000103
1741 Ga0496126_0010956
1742 Ga0496126_0923062
1743 Ga0496126_1064527
1744 Ga0501031_0028296
1745 Ga0501032_0038427
1746 Ga0501034_1052079
1747 Ga0501036_0042109
1748 Ga0501038_0261972
1749 Ga0501038_1160851
1750 Ga0501039_0036007
1751 Ga0501039_0048170
1752 Ga0501039_0509534
1753 Ga0501040_0002169
1754 Ga0501040_0183974
1755 Ga0501041_0016935
1756 Ga0501042_0017357
1757 Ga0501043_0513872
1758 Ga0501046_0297644
1759 Ga0501048_0020126
1760 Ga0501048_1142092
1761 Ga0501067_0040091
1762 Ga0501067_0392385
1763 Ga0501069_0135230
1764 Ga0501069_0147852
1765 Ga0501069_0311600
1766 Ga0501069_0463813
1767 Ga0501069_0780265
1768 Ga0501070_0070615
1769 Ga0501070_0091317
1770 Ga0501070_0209423
1771 Ga0501070_0754402
1772 Ga0501070_0972190
1773 Ga0501071_0031313
1774 Ga0501071_0076414
1775 Ga0501071_0967948
1776 Ga0501071_1136735
1777 Ga0501072_0018491
1778 Ga0501072_0139902
1779 Ga0501072_0313993
1780 Ga0501072_0374950
1781 Ga0501072_0384395
1782 Ga0501074_0411358
1783 Ga0501075_0017170
1784 Ga0501075_0165675
1785 Ga0501076_0006919
1786 Ga0501076_0091215
1787 Ga0501076_0183216
1788 Ga0501077_0283075
1789 Ga0501079_0003322
1790 Ga0501079_1619641
1791 Ga0501080_0104937
1792 Ga0501081_0014169
1793 Ga0501081_0519097
1794 Ga0501035_0857363
1795 Ga0501035_1284538
1796 Ga0501044_1473629
1797 Ga0501045_0002561
1798 Ga0501045_0144267
1799 nmdc:mga03683_52169_c1
1800 nmdc:mga03n38_456175_c1
1801 nmdc:mga03n38_605093_c1
1802 nmdc:mga00v17_179305_c1
1803 nmdc:mga00v17_189395_c1
1804 nmdc:mga00v17_477469_c1
1805 nmdc:mga00v17_531686_c1
1806 nmdc:mga0yw44_1497_c1
1807 nmdc:mga0yw44_283847_c1
1808 nmdc:mga0yw44_32008_c1
1809 nmdc:mga0yw44_451302_c1
1810 nmdc:mga0yw44_62893_c1
1811 nmdc:mga0yw44_683535_c1
1812 nmdc:mga0yw44_708048_c1
1813 nmdc:mga0yw44_82602_c1
1814 nmdc:mga06z11_284109_c1
1815 nmdc:mga06z11_356696_c1
1816 nmdc:mga06z11_419735_c1
1817 nmdc:mga06z11_466547_c1
1818 nmdc:mga06z11_471486_c1
1819 nmdc:mga06z11_713443_c1
1820 nmdc:mga04h51_6174_c1
1821 nmdc:mga07m45_479521_c1
1822 nmdc:mga08y16_32073_c1
1823 nmdc:mga08y16_6137_c1
1824 nmdc:mga0n895_115659_c1
1825 nmdc:mga0n895_1362160_c1
1826 nmdc:mga0n895_277814_c1
1827 nmdc:mga0n895_50960_c1
1828 nmdc:mga0rr50_441980_c1
1829 nmdc:mga0rr50_487829_c1
1830 nmdc:mga0rr50_57369_c1
1831 nmdc:mga0rr50_662474_c1
1832 nmdc:mga0rr50_803_c1
1833 nmdc:mga08x19_15786_c1
1834 nmdc:mga08x19_617582_c1
1835 nmdc:mga08x19_64773_c1
1836 nmdc:mga0a205_4611_c1
1837 Ga0495601_0034844
1838 Ga0495601_0039047
1839 Ga0495601_0056331
1840 Ga0495601_0160864
1841 Ga0495601_0336616
1842 Ga0495601_0355238
1843 Ga0495612_0000933
1844 Ga0495612_0028588
1845 Ga0495612_0030456
1846 Ga0495612_0030911
1847 Ga0495612_0121587
1848 Ga0495595_0002531
1849 Ga0495595_0010961
1850 Ga0495595_0024834
1851 Ga0495595_0108284
1852 Ga0495619_0015950
1853 Ga0495619_0232462
1854 Ga0495619_0659537
1855 Ga0495619_0688642
1856 Ga0500573_0201175
1857 Ga0501084_0128423
1858 Ga0501084_0146514
1859 Ga0501082_0766380
1860 Ga0501082_0863505
1861 Ga0466962_0108384
1862 Ga0466962_0114873
1863 Ga0530510_0340676
1864 Ga0530510_0727008
1865 2643826461
1866 2644089421
1867 2644319266
1868 2738869479
1869 2808872310
1870 2812333220
1871 2856741982
1872 2873318144
1873 2891396381
1874 2891558361
1875 2891566475
1876 2895436661
1877 2919718195
1878 2984579352
1879 2990256963
1880 3003001319
1881 8053950365
1882 8054611156

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

37

150

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.9056 2 133
1ve0-assembly1.cif.gz_A crystal structure of uncharacterized protein st2072 from sulfolobus tokodaii 0.8984 3 135
2p6c-assembly1.cif.gz_A crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. 0.8932 3 135
1vph-assembly2.cif.gz_E crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution 0.8921 2 135
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.8914 2 133
ID Description Score Start End Superfamily
af_P9WFP9_1_132_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.927 1 134 2.60.120.460
af_P9WFP9_1_132_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9202 1 134 2.60.120.460
1ve0A00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8964 3 130 2.60.120.460
2p6cB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8928 3 135 2.60.120.460
1vphC00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8912 3 135 2.60.120.460
ID Description Score Start End GO Terms
AF-A0A2H0P403-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9475 2 135
AF-A0A5C8JLL2-F1-model_v4 YjbQ family protein 0.9374 1 135
AF-A0A840PCT9-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9352 1 135
AF-A0A2H0P403-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9341 2 135
AF-A0A7J9ZLL6-F1-model_v4 YjbQ family protein 0.9338 1 135

Map