F486339
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 941 | 359 | 1882 | 137 |
Family's Representative Sequence
| Representative Sequence | 3300045976|Ga0466967_0844265|Ga0466967_0844265_14_544 |
| Length | 153 |
| Sequence | VSDRRTVESGLDARWQHGGMHSETRSYRTGDREVVLDLTDDCREVVRGRGDGLLHVFVPHATAGIAVIETGSGSDDDLLAALGDLLPADDRWRHAHGSRGHGRSHVLPALVPPYASVPVLGGRLALGTWQSVCLVDLNVDNDEREVRFSFLAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 64 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 65 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 66 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 67 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 98 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 99 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 117 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 119 | 3300024123 | Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 | Metagenome | Unclassified |
| 120 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 121 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 176 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 177 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 178 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 180 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 181 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 182 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 183 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 187 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 188 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 191 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 193 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 194 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 195 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 198 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 199 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 201 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 202 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 203 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 206 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 207 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 208 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 209 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 210 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 211 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 212 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 213 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 214 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 215 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 216 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 217 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 218 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 219 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 220 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 221 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 222 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 223 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 224 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 225 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 226 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 227 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 228 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 278 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 279 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 280 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 281 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 282 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 283 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 286 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 287 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 288 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 289 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 290 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 291 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 292 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 293 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 294 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 322 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 323 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 324 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 325 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 326 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 327 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 328 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 338 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 341 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 342 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 343 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 344 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 345 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 346 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 347 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 348 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 349 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 350 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 351 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 352 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 353 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 354 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 355 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 356 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 357 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 358 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 359 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.77 |
| Metatranscriptomes | 0.32 |
| Isolates | 1.91 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.21 |
| Bulb | 0 |
| Endosphere | 4.99 |
| Nodule | 0.11 |
| Rhizoplane | 4.36 |
| Rhizosphere | 86.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466967_0844265 | 3300045976 | Bacteria | 910 |
| 2 | Ga0070658_10000158 | 3300005327 | Bacteria | 59813 |
| 3 | Ga0070658_10018944 | 3300005327 | Bacteria | 5514 |
| 4 | Ga0070658_10129353 | 3300005327 | Bacteria | 2104 |
| 5 | Ga0070658_10166901 | 3300005327 | Bacteria | 1848 |
| 6 | Ga0070658_10362906 | 3300005327 | Bacteria | 1241 |
| 7 | Ga0070676_10095272 | 3300005328 | Bacteria | 1830 |
| 8 | Ga0070676_10656207 | 3300005328 | Bacteria | 762 |
| 9 | Ga0070683_100151950 | 3300005329 | Bacteria | 2195 |
| 10 | Ga0070683_100285312 | 3300005329 | Bacteria | 1571 |
| 11 | Ga0070690_100128349 | 3300005330 | Bacteria | 1710 |
| 12 | Ga0070690_100293740 | 3300005330 | Bacteria | 1163 |
| 13 | Ga0068869_100479382 | 3300005334 | Bacteria | 1035 |
| 14 | Ga0070666_10360978 | 3300005335 | Bacteria | 1041 |
| 15 | Ga0070680_100008268 | 3300005336 | Bacteria | 7959 |
| 16 | Ga0070680_100079865 | 3300005336 | Bacteria | 2697 |
| 17 | Ga0070680_100104490 | 3300005336 | Bacteria | 2354 |
| 18 | Ga0070682_100829953 | 3300005337 | Bacteria | 753 |
| 19 | Ga0068868_101244795 | 3300005338 | Bacteria | 689 |
| 20 | Ga0070660_100838315 | 3300005339 | Bacteria | 774 |
| 21 | Ga0070660_101667121 | 3300005339 | Bacteria | 543 |
| 22 | Ga0070689_100526223 | 3300005340 | Bacteria | 1016 |
| 23 | Ga0070689_100740875 | 3300005340 | Bacteria | 861 |
| 24 | Ga0070691_10172115 | 3300005341 | Bacteria | 1123 |
| 25 | Ga0070661_101145630 | 3300005344 | Unclassified | 649 |
| 26 | Ga0070675_100403992 | 3300005354 | Bacteria | 1219 |
| 27 | Ga0070675_100749743 | 3300005354 | Bacteria | 891 |
| 28 | Ga0070671_100459621 | 3300005355 | Bacteria | 1092 |
| 29 | Ga0070674_100346211 | 3300005356 | Bacteria | 1199 |
| 30 | Ga0070659_100001258 | 3300005366 | Bacteria | 18400 |
| 31 | Ga0070659_100238961 | 3300005366 | Bacteria | 1502 |
| 32 | Ga0070659_100539305 | 3300005366 | Bacteria | 998 |
| 33 | Ga0070667_100064803 | 3300005367 | Bacteria | 3101 |
| 34 | Ga0070667_100641040 | 3300005367 | Bacteria | 981 |
| 35 | Ga0070667_100665790 | 3300005367 | Bacteria | 962 |
| 36 | Ga0070709_10000169 | 3300005434 | Bacteria | 41293 |
| 37 | Ga0070709_10035138 | 3300005434 | Bacteria | 3044 |
| 38 | Ga0070709_10077460 | 3300005434 | Bacteria | 2161 |
| 39 | Ga0070714_100078175 | 3300005435 | Bacteria | 2875 |
| 40 | Ga0070714_100151874 | 3300005435 | Bacteria | 2088 |
| 41 | Ga0070714_100158543 | 3300005435 | Bacteria | 2045 |
| 42 | Ga0070714_100258574 | 3300005435 | Bacteria | 1612 |
| 43 | Ga0070714_100307219 | 3300005435 | Bacteria | 1480 |
| 44 | Ga0070714_100524714 | 3300005435 | Bacteria | 1131 |
| 45 | Ga0070714_100852132 | 3300005435 | Bacteria | 884 |
| 46 | Ga0070714_100889083 | 3300005435 | Bacteria | 865 |
| 47 | Ga0070713_100086271 | 3300005436 | Bacteria | 2691 |
| 48 | Ga0070713_100096916 | 3300005436 | Bacteria | 2547 |
| 49 | Ga0070713_100211141 | 3300005436 | Bacteria | 1757 |
| 50 | Ga0070713_100396989 | 3300005436 | Bacteria | 1287 |
| 51 | Ga0070713_100609124 | 3300005436 | Bacteria | 1038 |
| 52 | Ga0070713_100910947 | 3300005436 | Bacteria | 846 |
| 53 | Ga0070710_10006479 | 3300005437 | Bacteria | 5625 |
| 54 | Ga0070710_10016835 | 3300005437 | Bacteria | 3729 |
| 55 | Ga0070710_10065623 | 3300005437 | Bacteria | 2079 |
| 56 | Ga0070710_10092288 | 3300005437 | Bacteria | 1788 |
| 57 | Ga0070710_10109305 | 3300005437 | Bacteria | 1658 |
| 58 | Ga0070711_100004460 | 3300005439 | Bacteria | 8263 |
| 59 | Ga0070711_100067694 | 3300005439 | Bacteria | 2506 |
| 60 | Ga0070711_100519900 | 3300005439 | Bacteria | 983 |
| 61 | Ga0070705_100420811 | 3300005440 | Bacteria | 994 |
| 62 | Ga0070700_100907799 | 3300005441 | Bacteria | 718 |
| 63 | Ga0070708_100260347 | 3300005445 | Bacteria | 1631 |
| 64 | Ga0070708_100933041 | 3300005445 | Bacteria | 814 |
| 65 | Ga0070663_100146513 | 3300005455 | Bacteria | 1807 |
| 66 | Ga0070678_100132926 | 3300005456 | Bacteria | 1980 |
| 67 | Ga0070662_100496444 | 3300005457 | Bacteria | 1018 |
| 68 | Ga0070681_10000477 | 3300005458 | Bacteria | 32688 |
| 69 | Ga0070681_10102380 | 3300005458 | Bacteria | 2809 |
| 70 | Ga0070681_10726226 | 3300005458 | Bacteria | 909 |
| 71 | Ga0068867_101536856 | 3300005459 | Bacteria | 620 |
| 72 | Ga0070685_10703614 | 3300005466 | Bacteria | 737 |
| 73 | Ga0070706_100002920 | 3300005467 | Bacteria | 17015 |
| 74 | Ga0070706_100021884 | 3300005467 | Bacteria | 5888 |
| 75 | Ga0070706_100058514 | 3300005467 | Bacteria | 3557 |
| 76 | Ga0070706_100118065 | 3300005467 | Bacteria | 2471 |
| 77 | Ga0070706_100528998 | 3300005467 | Bacteria | 1097 |
| 78 | Ga0070706_100636175 | 3300005467 | Bacteria | 990 |
| 79 | Ga0070706_100669491 | 3300005467 | Bacteria | 963 |
| 80 | Ga0070707_100020822 | 3300005468 | Bacteria | 6191 |
| 81 | Ga0070707_100021782 | 3300005468 | Bacteria | 6057 |
| 82 | Ga0070707_100026241 | 3300005468 | Bacteria | 5530 |
| 83 | Ga0070707_100055420 | 3300005468 | Bacteria | 3801 |
| 84 | Ga0070707_100095956 | 3300005468 | Bacteria | 2872 |
| 85 | Ga0070698_100002175 | 3300005471 | Bacteria | 21736 |
| 86 | Ga0070698_100030449 | 3300005471 | Bacteria | 5594 |
| 87 | Ga0070698_100057473 | 3300005471 | Bacteria | 3937 |
| 88 | Ga0070698_100061172 | 3300005471 | Bacteria | 3799 |
| 89 | Ga0070698_100082007 | 3300005471 | Bacteria | 3218 |
| 90 | Ga0070699_100575577 | 3300005518 | Bacteria | 1026 |
| 91 | Ga0070679_100000521 | 3300005530 | Bacteria | 32688 |
| 92 | Ga0070679_100093697 | 3300005530 | Bacteria | 2991 |
| 93 | Ga0070679_100132171 | 3300005530 | Bacteria | 2477 |
| 94 | Ga0070679_100199108 | 3300005530 | Bacteria | 1970 |
| 95 | Ga0070679_100368868 | 3300005530 | Bacteria | 1383 |
| 96 | Ga0070679_100408693 | 3300005530 | Bacteria | 1303 |
| 97 | Ga0070684_100099739 | 3300005535 | Bacteria | 2592 |
| 98 | Ga0070697_100104197 | 3300005536 | Bacteria | 2359 |
| 99 | Ga0068853_100071753 | 3300005539 | Bacteria | 3016 |
| 100 | Ga0068853_101068616 | 3300005539 | Bacteria | 778 |
| 101 | Ga0070695_100151689 | 3300005545 | Bacteria | 1618 |
| 102 | Ga0070695_100423926 | 3300005545 | Bacteria | 1014 |
| 103 | Ga0070696_100126143 | 3300005546 | Bacteria | 1857 |
| 104 | Ga0070693_100109195 | 3300005547 | Bacteria | 1699 |
| 105 | Ga0068855_102296874 | 3300005563 | Bacteria | 540 |
| 106 | Ga0070664_100797598 | 3300005564 | Bacteria | 883 |
| 107 | Ga0068857_100133729 | 3300005577 | Bacteria | 2239 |
| 108 | Ga0068857_101282088 | 3300005577 | Bacteria | 711 |
| 109 | Ga0068854_100552993 | 3300005578 | Bacteria | 976 |
| 110 | Ga0068856_100025058 | 3300005614 | Bacteria | 5813 |
| 111 | Ga0068856_100741128 | 3300005614 | Bacteria | 1002 |
| 112 | Ga0068856_100860658 | 3300005614 | Bacteria | 926 |
| 113 | Ga0070702_100431408 | 3300005615 | Bacteria | 951 |
| 114 | Ga0068852_100963007 | 3300005616 | Bacteria | 872 |
| 115 | Ga0068859_100035415 | 3300005617 | Bacteria | 5008 |
| 116 | Ga0068859_100353403 | 3300005617 | Bacteria | 1564 |
| 117 | Ga0068864_100065553 | 3300005618 | Bacteria | 3151 |
| 118 | Ga0068864_100516101 | 3300005618 | Bacteria | 1151 |
| 119 | Ga0068861_101236797 | 3300005719 | Bacteria | 723 |
| 120 | Ga0068851_10739310 | 3300005834 | Bacteria | 608 |
| 121 | Ga0068863_100090421 | 3300005841 | Bacteria | 2902 |
| 122 | Ga0068858_100339571 | 3300005842 | Bacteria | 1437 |
| 123 | Ga0068860_100000334 | 3300005843 | Bacteria | 63958 |
| 124 | Ga0068860_100181629 | 3300005843 | Bacteria | 2033 |
| 125 | Ga0068860_100348171 | 3300005843 | Bacteria | 1458 |
| 126 | Ga0068862_100303372 | 3300005844 | Bacteria | 1470 |
| 127 | Ga0081455_10216955 | 3300005937 | Bacteria | 1421 |
| 128 | Ga0081455_10489574 | 3300005937 | Bacteria | 829 |
| 129 | Ga0081455_10511810 | 3300005937 | Bacteria | 803 |
| 130 | Ga0081539_10064214 | 3300005985 | Bacteria | 1999 |
| 131 | Ga0070717_10148387 | 3300006028 | Bacteria | 2027 |
| 132 | Ga0070717_10274187 | 3300006028 | Bacteria | 1494 |
| 133 | Ga0070717_10481647 | 3300006028 | Bacteria | 1120 |
| 134 | Ga0070717_10736106 | 3300006028 | Bacteria | 896 |
| 135 | Ga0070717_10814214 | 3300006028 | Bacteria | 850 |
| 136 | Ga0075365_10012686 | 3300006038 | Bacteria | 5014 |
| 137 | Ga0075365_10020548 | 3300006038 | Bacteria | 4096 |
| 138 | Ga0075365_10103695 | 3300006038 | Bacteria | 1949 |
| 139 | Ga0075365_10106052 | 3300006038 | Bacteria | 1928 |
| 140 | Ga0075365_10113238 | 3300006038 | Bacteria | 1866 |
| 141 | Ga0075365_10126865 | 3300006038 | Bacteria | 1763 |
| 142 | Ga0075365_10146911 | 3300006038 | Bacteria | 1639 |
| 143 | Ga0075365_10571490 | 3300006038 | Bacteria | 800 |
| 144 | Ga0075365_10585480 | 3300006038 | Bacteria | 789 |
| 145 | Ga0075368_10007589 | 3300006042 | Bacteria | 3828 |
| 146 | Ga0075363_100005487 | 3300006048 | Bacteria | 5650 |
| 147 | Ga0075363_100100131 | 3300006048 | Bacteria | 1603 |
| 148 | Ga0075364_10029625 | 3300006051 | Bacteria | 3511 |
| 149 | Ga0075364_10449032 | 3300006051 | Bacteria | 881 |
| 150 | Ga0075364_10518416 | 3300006051 | Bacteria | 815 |
| 151 | Ga0075432_10021839 | 3300006058 | Bacteria | 2188 |
| 152 | Ga0070715_10054925 | 3300006163 | Bacteria | 1727 |
| 153 | Ga0070716_100189873 | 3300006173 | Bacteria | 1356 |
| 154 | Ga0070716_100344512 | 3300006173 | Bacteria | 1052 |
| 155 | Ga0070712_100154336 | 3300006175 | Bacteria | 1766 |
| 156 | Ga0070712_100175425 | 3300006175 | Bacteria | 1666 |
| 157 | Ga0070712_100457548 | 3300006175 | Bacteria | 1064 |
| 158 | Ga0070712_100464811 | 3300006175 | Bacteria | 1055 |
| 159 | Ga0070712_100484076 | 3300006175 | Bacteria | 1035 |
| 160 | Ga0070712_100600133 | 3300006175 | Bacteria | 932 |
| 161 | Ga0070712_100724648 | 3300006175 | Bacteria | 849 |
| 162 | Ga0070712_101319930 | 3300006175 | Bacteria | 629 |
| 163 | Ga0075362_10020031 | 3300006177 | Bacteria | 2791 |
| 164 | Ga0075367_10052247 | 3300006178 | Bacteria | 2418 |
| 165 | Ga0075367_10318112 | 3300006178 | Bacteria | 981 |
| 166 | Ga0075367_10343565 | 3300006178 | Bacteria | 941 |
| 167 | Ga0075367_10392782 | 3300006178 | Bacteria | 877 |
| 168 | Ga0075367_10517510 | 3300006178 | Bacteria | 757 |
| 169 | Ga0097621_100247251 | 3300006237 | Bacteria | 1561 |
| 170 | Ga0097621_100304441 | 3300006237 | Bacteria | 1408 |
| 171 | Ga0075370_10005619 | 3300006353 | Bacteria | 6255 |
| 172 | Ga0068871_100051304 | 3300006358 | Bacteria | 3340 |
| 173 | Ga0068871_100556395 | 3300006358 | Bacteria | 1039 |
| 174 | Ga0075428_100037033 | 3300006844 | Bacteria | 5373 |
| 175 | Ga0075430_100196017 | 3300006846 | Bacteria | 1678 |
| 176 | Ga0075433_10002552 | 3300006852 | Bacteria | 13866 |
| 177 | Ga0075433_10056705 | 3300006852 | Bacteria | 3423 |
| 178 | Ga0075434_100009923 | 3300006871 | Bacteria | 8907 |
| 179 | Ga0075434_100049787 | 3300006871 | Bacteria | 4161 |
| 180 | Ga0075434_100232652 | 3300006871 | Bacteria | 1862 |
| 181 | Ga0075434_100824281 | 3300006871 | Bacteria | 944 |
| 182 | Ga0075434_101479557 | 3300006871 | Bacteria | 688 |
| 183 | Ga0075436_100001677 | 3300006914 | Bacteria | 15144 |
| 184 | Ga0075436_100164768 | 3300006914 | Bacteria | 1563 |
| 185 | Ga0075436_100219894 | 3300006914 | Bacteria | 1348 |
| 186 | Ga0075436_100257596 | 3300006914 | Bacteria | 1244 |
| 187 | Ga0097620_100035416 | 3300006931 | Bacteria | 5008 |
| 188 | Ga0097620_100353400 | 3300006931 | Bacteria | 1564 |
| 189 | Ga0075435_100002810 | 3300007076 | Bacteria | 11643 |
| 190 | Ga0075435_100203110 | 3300007076 | Bacteria | 1679 |
| 191 | Ga0075435_100272660 | 3300007076 | Bacteria | 1443 |
| 192 | Ga0075435_100308200 | 3300007076 | Bacteria | 1355 |
| 193 | Ga0075435_100606485 | 3300007076 | Bacteria | 949 |
| 194 | Ga0105251_10314032 | 3300009011 | Bacteria | 712 |
| 195 | Ga0105250_10132926 | 3300009092 | Bacteria | 1028 |
| 196 | Ga0111539_10003840 | 3300009094 | Bacteria | 19785 |
| 197 | Ga0111539_10082371 | 3300009094 | Bacteria | 3784 |
| 198 | Ga0111539_10348159 | 3300009094 | Bacteria | 1724 |
| 199 | Ga0105245_10161185 | 3300009098 | Bacteria | 2129 |
| 200 | Ga0105245_10603782 | 3300009098 | Bacteria | 1124 |
| 201 | Ga0105245_11140876 | 3300009098 | Bacteria | 826 |
| 202 | Ga0105247_10127806 | 3300009101 | Bacteria | 1653 |
| 203 | Ga0114129_11812613 | 3300009147 | Bacteria | 742 |
| 204 | Ga0105243_10421999 | 3300009148 | Bacteria | 1244 |
| 205 | Ga0105241_10841897 | 3300009174 | Bacteria | 848 |
| 206 | Ga0105241_11259173 | 3300009174 | Bacteria | 703 |
| 207 | Ga0105241_11266065 | 3300009174 | Bacteria | 701 |
| 208 | Ga0105242_10224088 | 3300009176 | Bacteria | 1682 |
| 209 | Ga0105248_10001693 | 3300009177 | Bacteria | 24537 |
| 210 | Ga0105248_10663643 | 3300009177 | Bacteria | 1176 |
| 211 | Ga0105248_11171271 | 3300009177 | Bacteria | 869 |
| 212 | Ga0105237_10049803 | 3300009545 | Bacteria | 4209 |
| 213 | Ga0105237_10271779 | 3300009545 | Bacteria | 1698 |
| 214 | Ga0105237_11723561 | 3300009545 | Bacteria | 634 |
| 215 | Ga0105238_10192905 | 3300009551 | Bacteria | 2013 |
| 216 | Ga0105249_10342165 | 3300009553 | Bacteria | 1513 |
| 217 | Ga0105249_10872220 | 3300009553 | Bacteria | 966 |
| 218 | Ga0105239_10101403 | 3300010375 | Bacteria | 3184 |
| 219 | Ga0105239_10600868 | 3300010375 | Bacteria | 1255 |
| 220 | Ga0157341_1021417 | 3300012494 | Bacteria | 640 |
| 221 | Ga0157342_1018987 | 3300012507 | Bacteria | 783 |
| 222 | Ga0157338_1009839 | 3300012515 | Bacteria | 954 |
| 223 | Ga0157373_10488036 | 3300013100 | Bacteria | 889 |
| 224 | Ga0157371_10054330 | 3300013102 | Bacteria | 2845 |
| 225 | Ga0157370_10196659 | 3300013104 | Bacteria | 1871 |
| 226 | Ga0157370_10467902 | 3300013104 | Bacteria | 1158 |
| 227 | Ga0157370_10807002 | 3300013104 | Bacteria | 854 |
| 228 | Ga0157369_10035314 | 3300013105 | Bacteria | 5483 |
| 229 | Ga0157369_10211251 | 3300013105 | Bacteria | 2034 |
| 230 | Ga0157369_11146767 | 3300013105 | Bacteria | 794 |
| 231 | Ga0157369_12278617 | 3300013105 | Bacteria | 549 |
| 232 | Ga0157374_10051133 | 3300013296 | Bacteria | 3844 |
| 233 | Ga0157374_10797198 | 3300013296 | Bacteria | 960 |
| 234 | Ga0163162_10039395 | 3300013306 | Bacteria | 4722 |
| 235 | Ga0157372_10241084 | 3300013307 | Bacteria | 2098 |
| 236 | Ga0157372_12121283 | 3300013307 | Bacteria | 646 |
| 237 | Ga0157372_13340673 | 3300013307 | Bacteria | 511 |
| 238 | Ga0157375_10072257 | 3300013308 | Bacteria | 3466 |
| 239 | Ga0157375_10734235 | 3300013308 | Bacteria | 1140 |
| 240 | Ga0163163_10007728 | 3300014325 | Bacteria | 9499 |
| 241 | Ga0163163_10045897 | 3300014325 | Bacteria | 4290 |
| 242 | Ga0163163_10109683 | 3300014325 | Bacteria | 2787 |
| 243 | Ga0157380_11096554 | 3300014326 | Bacteria | 835 |
| 244 | Ga0182008_10578847 | 3300014497 | Bacteria | 627 |
| 245 | Ga0157377_10073742 | 3300014745 | Bacteria | 1979 |
| 246 | Ga0157379_10024347 | 3300014968 | Bacteria | 5374 |
| 247 | Ga0157379_10032700 | 3300014968 | Bacteria | 4638 |
| 248 | Ga0157379_10423256 | 3300014968 | Bacteria | 1227 |
| 249 | Ga0157376_10023750 | 3300014969 | Bacteria | 4804 |
| 250 | Ga0206356_10498411 | 3300020070 | Bacteria | 1744 |
| 251 | Ga0206354_10954142 | 3300020081 | Bacteria | 661 |
| 252 | Ga0213875_10051044 | 3300021388 | Bacteria | 1938 |
| 253 | Ga0213875_10189008 | 3300021388 | Bacteria | 968 |
| 254 | Ga0224712_10129158 | 3300022467 | Bacteria | 1102 |
| 255 | Ga0224571_103483 | 3300022734 | Bacteria | 1015 |
| 256 | Ga0228600_1005047 | 3300024123 | Bacteria | 967 |
| 257 | Ga0224572_1045916 | 3300024225 | Bacteria | 818 |
| 258 | Ga0207656_10216480 | 3300025321 | Bacteria | 930 |
| 259 | Ga0207692_10000163 | 3300025898 | Bacteria | 21240 |
| 260 | Ga0207692_10015879 | 3300025898 | Bacteria | 3322 |
| 261 | Ga0207692_10045088 | 3300025898 | Bacteria | 2204 |
| 262 | Ga0207692_10081678 | 3300025898 | Bacteria | 1730 |
| 263 | Ga0207710_10000030 | 3300025900 | Bacteria | 287870 |
| 264 | Ga0207710_10235822 | 3300025900 | Bacteria | 912 |
| 265 | Ga0207688_10164440 | 3300025901 | Bacteria | 1317 |
| 266 | Ga0207647_10118422 | 3300025904 | Bacteria | 1562 |
| 267 | Ga0207647_10228790 | 3300025904 | Bacteria | 1070 |
| 268 | Ga0207685_10050740 | 3300025905 | Bacteria | 1600 |
| 269 | Ga0207685_10145519 | 3300025905 | Unclassified | 1067 |
| 270 | Ga0207685_10189891 | 3300025905 | Bacteria | 958 |
| 271 | Ga0207699_10000201 | 3300025906 | Bacteria | 35645 |
| 272 | Ga0207699_10012599 | 3300025906 | Bacteria | 4306 |
| 273 | Ga0207699_10083278 | 3300025906 | Bacteria | 1989 |
| 274 | Ga0207699_10101419 | 3300025906 | Bacteria | 1827 |
| 275 | Ga0207699_10875627 | 3300025906 | Bacteria | 662 |
| 276 | Ga0207645_10176344 | 3300025907 | Bacteria | 1402 |
| 277 | Ga0207643_10008616 | 3300025908 | Bacteria | 5469 |
| 278 | Ga0207705_10000399 | 3300025909 | Bacteria | 38165 |
| 279 | Ga0207705_10017254 | 3300025909 | Bacteria | 5170 |
| 280 | Ga0207705_10067515 | 3300025909 | Bacteria | 2588 |
| 281 | Ga0207705_10072639 | 3300025909 | Bacteria | 2496 |
| 282 | Ga0207705_10222137 | 3300025909 | Bacteria | 1435 |
| 283 | Ga0207705_10554364 | 3300025909 | Bacteria | 893 |
| 284 | Ga0207705_10656937 | 3300025909 | Bacteria | 815 |
| 285 | Ga0207684_10002079 | 3300025910 | Bacteria | 20578 |
| 286 | Ga0207684_10018950 | 3300025910 | Bacteria | 5887 |
| 287 | Ga0207684_10038962 | 3300025910 | Bacteria | 4033 |
| 288 | Ga0207684_10071650 | 3300025910 | Bacteria | 2944 |
| 289 | Ga0207684_10416581 | 3300025910 | Bacteria | 1154 |
| 290 | Ga0207707_10000720 | 3300025912 | Bacteria | 32689 |
| 291 | Ga0207707_10081666 | 3300025912 | Bacteria | 2822 |
| 292 | Ga0207707_10145519 | 3300025912 | Bacteria | 2072 |
| 293 | Ga0207707_10921660 | 3300025912 | Bacteria | 721 |
| 294 | Ga0207693_10012620 | 3300025915 | Bacteria | 6827 |
| 295 | Ga0207693_10242938 | 3300025915 | Bacteria | 1413 |
| 296 | Ga0207693_10251306 | 3300025915 | Bacteria | 1387 |
| 297 | Ga0207693_10273712 | 3300025915 | Bacteria | 1323 |
| 298 | Ga0207693_10486823 | 3300025915 | Bacteria | 963 |
| 299 | Ga0207663_10001705 | 3300025916 | Bacteria | 10322 |
| 300 | Ga0207663_10012581 | 3300025916 | Bacteria | 4580 |
| 301 | Ga0207663_10076199 | 3300025916 | Bacteria | 2178 |
| 302 | Ga0207663_10353322 | 3300025916 | Bacteria | 1113 |
| 303 | Ga0207663_10501131 | 3300025916 | Bacteria | 943 |
| 304 | Ga0207663_10841080 | 3300025916 | Bacteria | 732 |
| 305 | Ga0207660_10013060 | 3300025917 | Bacteria | 5438 |
| 306 | Ga0207660_10059583 | 3300025917 | Bacteria | 2741 |
| 307 | Ga0207660_10132131 | 3300025917 | Bacteria | 1901 |
| 308 | Ga0207660_10164916 | 3300025917 | Bacteria | 1712 |
| 309 | Ga0207660_10205878 | 3300025917 | Bacteria | 1538 |
| 310 | Ga0207660_10295281 | 3300025917 | Bacteria | 1289 |
| 311 | Ga0207657_10222958 | 3300025919 | Bacteria | 1510 |
| 312 | Ga0207657_10438119 | 3300025919 | Bacteria | 1026 |
| 313 | Ga0207657_10660398 | 3300025919 | Bacteria | 814 |
| 314 | Ga0207657_10686833 | 3300025919 | Bacteria | 795 |
| 315 | Ga0207657_11034745 | 3300025919 | Bacteria | 629 |
| 316 | Ga0207649_10301702 | 3300025920 | Bacteria | 1171 |
| 317 | Ga0207652_10000798 | 3300025921 | Bacteria | 30058 |
| 318 | Ga0207652_10172648 | 3300025921 | Bacteria | 1940 |
| 319 | Ga0207652_10191353 | 3300025921 | Bacteria | 1840 |
| 320 | Ga0207652_10281676 | 3300025921 | Bacteria | 1500 |
| 321 | Ga0207652_10329666 | 3300025921 | Bacteria | 1378 |
| 322 | Ga0207652_10671478 | 3300025921 | Bacteria | 926 |
| 323 | Ga0207646_10000235 | 3300025922 | Bacteria | 76449 |
| 324 | Ga0207646_10006203 | 3300025922 | Bacteria | 12425 |
| 325 | Ga0207646_10011031 | 3300025922 | Bacteria | 8774 |
| 326 | Ga0207646_10019130 | 3300025922 | Bacteria | 6369 |
| 327 | Ga0207646_10783559 | 3300025922 | Bacteria | 850 |
| 328 | Ga0207681_10570279 | 3300025923 | Bacteria | 933 |
| 329 | Ga0207694_10762336 | 3300025924 | Bacteria | 817 |
| 330 | Ga0207694_10772599 | 3300025924 | Bacteria | 811 |
| 331 | Ga0207659_10355051 | 3300025926 | Bacteria | 1217 |
| 332 | Ga0207659_10603195 | 3300025926 | Bacteria | 936 |
| 333 | Ga0207687_10089514 | 3300025927 | Bacteria | 2241 |
| 334 | Ga0207687_10163959 | 3300025927 | Bacteria | 1708 |
| 335 | Ga0207687_10588287 | 3300025927 | Bacteria | 937 |
| 336 | Ga0207700_10003259 | 3300025928 | Bacteria | 9385 |
| 337 | Ga0207700_10003268 | 3300025928 | Bacteria | 9374 |
| 338 | Ga0207700_10073649 | 3300025928 | Bacteria | 2638 |
| 339 | Ga0207700_10204373 | 3300025928 | Bacteria | 1666 |
| 340 | Ga0207700_10245832 | 3300025928 | Bacteria | 1526 |
| 341 | Ga0207700_10270765 | 3300025928 | Bacteria | 1458 |
| 342 | Ga0207664_10007630 | 3300025929 | Bacteria | 7504 |
| 343 | Ga0207664_10009986 | 3300025929 | Bacteria | 6689 |
| 344 | Ga0207664_10017900 | 3300025929 | Bacteria | 5206 |
| 345 | Ga0207664_10035535 | 3300025929 | Bacteria | 3845 |
| 346 | Ga0207664_10068066 | 3300025929 | Bacteria | 2859 |
| 347 | Ga0207664_10073604 | 3300025929 | Bacteria | 2757 |
| 348 | Ga0207664_10213197 | 3300025929 | Bacteria | 1672 |
| 349 | Ga0207664_10639126 | 3300025929 | Bacteria | 956 |
| 350 | Ga0207664_11000415 | 3300025929 | Bacteria | 749 |
| 351 | Ga0207664_11042747 | 3300025929 | Bacteria | 732 |
| 352 | Ga0207664_11150610 | 3300025929 | Bacteria | 693 |
| 353 | Ga0207644_10351262 | 3300025931 | Bacteria | 1197 |
| 354 | Ga0207706_10186689 | 3300025933 | Bacteria | 1820 |
| 355 | Ga0207706_10197840 | 3300025933 | Bacteria | 1763 |
| 356 | Ga0207686_10365522 | 3300025934 | Bacteria | 1090 |
| 357 | Ga0207670_10431106 | 3300025936 | Bacteria | 1060 |
| 358 | Ga0207669_10523020 | 3300025937 | Bacteria | 953 |
| 359 | Ga0207665_10002435 | 3300025939 | Bacteria | 12584 |
| 360 | Ga0207665_10011169 | 3300025939 | Bacteria | 5894 |
| 361 | Ga0207665_10020196 | 3300025939 | Bacteria | 4376 |
| 362 | Ga0207665_10029190 | 3300025939 | Bacteria | 3647 |
| 363 | Ga0207665_10051497 | 3300025939 | Bacteria | 2771 |
| 364 | Ga0207711_10071258 | 3300025941 | Bacteria | 3015 |
| 365 | Ga0207711_10470697 | 3300025941 | Bacteria | 1170 |
| 366 | Ga0207689_10181640 | 3300025942 | Bacteria | 1735 |
| 367 | Ga0207689_10478277 | 3300025942 | Bacteria | 1043 |
| 368 | Ga0207661_10104468 | 3300025944 | Bacteria | 2385 |
| 369 | Ga0207661_10299343 | 3300025944 | Bacteria | 1442 |
| 370 | Ga0207679_10159324 | 3300025945 | Bacteria | 1846 |
| 371 | Ga0207679_10706225 | 3300025945 | Bacteria | 915 |
| 372 | Ga0207667_10838128 | 3300025949 | Bacteria | 914 |
| 373 | Ga0207651_10254972 | 3300025960 | Bacteria | 1437 |
| 374 | Ga0207712_10358586 | 3300025961 | Bacteria | 1214 |
| 375 | Ga0207712_10584034 | 3300025961 | Bacteria | 965 |
| 376 | Ga0207640_10519037 | 3300025981 | Bacteria | 995 |
| 377 | Ga0207658_10045024 | 3300025986 | Bacteria | 3215 |
| 378 | Ga0207658_10481930 | 3300025986 | Bacteria | 1102 |
| 379 | Ga0207658_10827486 | 3300025986 | Bacteria | 841 |
| 380 | Ga0207677_10054423 | 3300026023 | Bacteria | 2731 |
| 381 | Ga0207703_10402393 | 3300026035 | Bacteria | 1270 |
| 382 | Ga0207703_11326446 | 3300026035 | Bacteria | 692 |
| 383 | Ga0207678_10182337 | 3300026067 | Bacteria | 1793 |
| 384 | Ga0207708_10977767 | 3300026075 | Bacteria | 735 |
| 385 | Ga0207702_10088798 | 3300026078 | Bacteria | 2702 |
| 386 | Ga0207702_10532694 | 3300026078 | Bacteria | 1147 |
| 387 | Ga0207648_10190954 | 3300026089 | Bacteria | 1815 |
| 388 | Ga0207676_10049767 | 3300026095 | Bacteria | 3263 |
| 389 | Ga0207674_10154902 | 3300026116 | Bacteria | 2247 |
| 390 | Ga0207683_10008286 | 3300026121 | Bacteria | 8891 |
| 391 | Ga0209813_10231409 | 3300027866 | Bacteria | 696 |
| 392 | Ga0207428_10001176 | 3300027907 | Bacteria | 28190 |
| 393 | Ga0207428_10020592 | 3300027907 | Bacteria | 5601 |
| 394 | Ga0268266_11216696 | 3300028379 | Bacteria | 728 |
| 395 | Ga0268264_10002232 | 3300028381 | Bacteria | 17182 |
| 396 | Ga0268264_10528032 | 3300028381 | Bacteria | 1155 |
| 397 | Ga0265338_10003426 | 3300028800 | Bacteria | 22354 |
| 398 | Ga0307409_100235546 | 3300031995 | Bacteria | 1663 |
| 399 | Ga0316214_1035757 | 3300033545 | Bacteria | 709 |
| 400 | Ga0373948_0029789 | 3300034817 | Bacteria | 1094 |
| 401 | Ga0373950_0092696 | 3300034818 | Bacteria | 643 |
| 402 | Ga0373926_0008108 | 3300035083 | Bacteria | 3498 |
| 403 | Ga0373926_0095935 | 3300035083 | Bacteria | 1106 |
| 404 | Ga0373926_0222153 | 3300035083 | Bacteria | 729 |
| 405 | Ga0373926_0274262 | 3300035083 | Bacteria | 656 |
| 406 | Ga0373929_0011930 | 3300035085 | Bacteria | 1644 |
| 407 | Ga0373934_0000027 | 3300035086 | Bacteria | 46688 |
| 408 | Ga0373934_0002340 | 3300035086 | Bacteria | 6976 |
| 409 | Ga0373934_0017122 | 3300035086 | Bacteria | 2763 |
| 410 | Ga0373934_0019085 | 3300035086 | Bacteria | 2629 |
| 411 | Ga0373934_0167540 | 3300035086 | Bacteria | 902 |
| 412 | Ga0373940_0016961 | 3300035088 | Bacteria | 1811 |
| 413 | Ga0373944_0000323 | 3300035089 | Bacteria | 10714 |
| 414 | Ga0373944_0015922 | 3300035089 | Bacteria | 2114 |
| 415 | Ga0373944_0065359 | 3300035089 | Bacteria | 1175 |
| 416 | Ga0373923_0072476 | 3300035111 | Bacteria | 1481 |
| 417 | Ga0373923_0093929 | 3300035111 | Bacteria | 1315 |
| 418 | Ga0373923_0121724 | 3300035111 | Bacteria | 1166 |
| 419 | Ga0373932_0026941 | 3300035112 | Bacteria | 1568 |
| 420 | Ga0373936_0071408 | 3300035113 | Bacteria | 1431 |
| 421 | Ga0373936_0138399 | 3300035113 | Bacteria | 1050 |
| 422 | Ga0373939_0113443 | 3300035114 | Bacteria | 947 |
| 423 | Ga0373945_0003858 | 3300035116 | Bacteria | 4734 |
| 424 | Ga0373945_0028589 | 3300035116 | Bacteria | 1954 |
| 425 | Ga0373945_0171508 | 3300035116 | Bacteria | 889 |
| 426 | Ga0373953_0000032 | 3300035117 | Bacteria | 37225 |
| 427 | Ga0373953_0009571 | 3300035117 | Bacteria | 3341 |
| 428 | Ga0373953_0010179 | 3300035117 | Bacteria | 3261 |
| 429 | Ga0373953_0071946 | 3300035117 | Bacteria | 1428 |
| 430 | Ga0373953_0096894 | 3300035117 | Bacteria | 1238 |
| 431 | Ga0373953_0124364 | 3300035117 | Bacteria | 1097 |
| 432 | Ga0373953_0352162 | 3300035117 | Bacteria | 645 |
| 433 | Ga0373954_0000342 | 3300035118 | Bacteria | 17080 |
| 434 | Ga0373954_0008936 | 3300035118 | Bacteria | 4409 |
| 435 | Ga0373954_0020321 | 3300035118 | Bacteria | 3003 |
| 436 | Ga0373954_0049616 | 3300035118 | Bacteria | 1968 |
| 437 | Ga0373954_0172158 | 3300035118 | Bacteria | 1060 |
| 438 | Ga0373956_0000561 | 3300035119 | Bacteria | 15245 |
| 439 | Ga0373956_0006481 | 3300035119 | Bacteria | 4691 |
| 440 | Ga0373956_0011840 | 3300035119 | Bacteria | 3603 |
| 441 | Ga0373956_0075064 | 3300035119 | Bacteria | 1546 |
| 442 | Ga0373956_0424904 | 3300035119 | Bacteria | 634 |
| 443 | Ga0373957_0000128 | 3300035120 | Bacteria | 18723 |
| 444 | Ga0373957_0026484 | 3300035120 | Bacteria | 2098 |
| 445 | Ga0373957_0045453 | 3300035120 | Bacteria | 1664 |
| 446 | Ga0373957_0051609 | 3300035120 | Bacteria | 1573 |
| 447 | Ga0373957_0076066 | 3300035120 | Bacteria | 1320 |
| 448 | Ga0373960_0146993 | 3300035121 | Bacteria | 802 |
| 449 | Ga0373943_0088807 | 3300035170 | Bacteria | 1597 |
| 450 | Ga0373943_0118000 | 3300035170 | Bacteria | 1407 |
| 451 | Ga0373943_0128571 | 3300035170 | Bacteria | 1353 |
| 452 | Ga0373943_0537884 | 3300035170 | Bacteria | 685 |
| 453 | Ga0373946_0000324 | 3300035171 | Bacteria | 15464 |
| 454 | Ga0373955_0000361 | 3300035172 | Bacteria | 19116 |
| 455 | Ga0373955_0032622 | 3300035172 | Bacteria | 2735 |
| 456 | Ga0373955_0034558 | 3300035172 | Bacteria | 2671 |
| 457 | Ga0373955_0045505 | 3300035172 | Bacteria | 2368 |
| 458 | Ga0373955_0214047 | 3300035172 | Bacteria | 1149 |
| 459 | Ga0373962_0024594 | 3300035242 | Bacteria | 1612 |
| 460 | Ga0373924_0004004 | 3300035410 | Bacteria | 5117 |
| 461 | Ga0373924_0011107 | 3300035410 | Bacteria | 3337 |
| 462 | Ga0373924_0012923 | 3300035410 | Bacteria | 3128 |
| 463 | Ga0373924_0135037 | 3300035410 | Bacteria | 1074 |
| 464 | Ga0373924_0435359 | 3300035410 | Bacteria | 587 |
| 465 | Ga0373935_0018511 | 3300035692 | Bacteria | 4237 |
| 466 | Ga0373935_0027826 | 3300035692 | Bacteria | 3494 |
| 467 | Ga0373935_0069776 | 3300035692 | Bacteria | 2264 |
| 468 | Ga0373935_0193209 | 3300035692 | Bacteria | 1403 |
| 469 | Ga0373935_0296827 | 3300035692 | Bacteria | 1141 |
| 470 | Ga0373927_0016926 | 3300035695 | Bacteria | 4805 |
| 471 | Ga0373927_0051130 | 3300035695 | Bacteria | 2672 |
| 472 | Ga0373927_0256743 | 3300035695 | Bacteria | 1149 |
| 473 | Ga0373933_0000103 | 3300035724 | Bacteria | 53800 |
| 474 | Ga0373933_0026161 | 3300035724 | Bacteria | 3349 |
| 475 | Ga0373933_0096420 | 3300035724 | Bacteria | 1830 |
| 476 | Ga0373933_0211824 | 3300035724 | Bacteria | 1242 |
| 477 | Ga0373947_0012689 | 3300035725 | Bacteria | 4831 |
| 478 | Ga0373947_0201673 | 3300035725 | Bacteria | 1302 |
| 479 | Ga0373947_0574914 | 3300035725 | Bacteria | 767 |
| 480 | Ga0373947_0610441 | 3300035725 | Bacteria | 743 |
| 481 | Ga0373947_0713360 | 3300035725 | Bacteria | 684 |
| 482 | Ga0373937_0000683 | 3300036401 | Bacteria | 29555 |
| 483 | Ga0373937_0068896 | 3300036401 | Bacteria | 3261 |
| 484 | Ga0373937_0089477 | 3300036401 | Bacteria | 2850 |
| 485 | Ga0373937_0121182 | 3300036401 | Bacteria | 2437 |
| 486 | Ga0373937_0384826 | 3300036401 | Bacteria | 1330 |
| 487 | Ga0373937_0508494 | 3300036401 | Bacteria | 1144 |
| 488 | Ga0373937_0641431 | 3300036401 | Bacteria | 1007 |
| 489 | Ga0373937_0658831 | 3300036401 | Bacteria | 992 |
| 490 | Ga0373925_0011085 | 3300037068 | Bacteria | 6545 |
| 491 | Ga0373925_0044028 | 3300037068 | Bacteria | 3313 |
| 492 | Ga0373925_1030339 | 3300037068 | Bacteria | 677 |
| 493 | Ga0395900_0242198 | 3300037418 | Bacteria | 1809 |
| 494 | Ga0395898_1101945 | 3300037466 | Bacteria | 727 |
| 495 | Ga0395905_0378173 | 3300037471 | Bacteria | 1310 |
| 496 | Ga0436364_0307500 | 3300037853 | Bacteria | 10282 |
| 497 | Ga0436364_0374489 | 3300037853 | Bacteria | 1014 |
| 498 | Ga0436364_0377030 | 3300037853 | Bacteria | 1933 |
| 499 | Ga0436364_1040386 | 3300037853 | Bacteria | 956 |
| 500 | Ga0436364_1044748 | 3300037853 | Bacteria | 506 |
| 501 | Ga0436364_1057201 | 3300037853 | Bacteria | 1226 |
| 502 | Ga0436364_1231352 | 3300037853 | Bacteria | 1916 |
| 503 | Ga0395901_0131036 | 3300038443 | Bacteria | 2635 |
| 504 | Ga0395901_0195467 | 3300038443 | Bacteria | 2121 |
| 505 | Ga0436365_0920719 | 3300039437 | Bacteria | 1813 |
| 506 | Ga0436365_1108856 | 3300039437 | Bacteria | 908 |
| 507 | Ga0436360_0524089 | 3300039438 | Bacteria | 617 |
| 508 | Ga0436361_0139746 | 3300039447 | Bacteria | 1455 |
| 509 | Ga0436361_0585092 | 3300039447 | Bacteria | 729 |
| 510 | Ga0436363_1476138 | 3300039450 | Bacteria | 964 |
| 511 | Ga0436363_1500493 | 3300039450 | Bacteria | 523 |
| 512 | Ga0436362_1225677 | 3300039453 | Bacteria | 727 |
| 513 | Ga0451807_1909869 | 3300041486 | Bacteria | 685 |
| 514 | Ga0466972_0017104 | 3300044658 | Bacteria | 3627 |
| 515 | Ga0466972_0249351 | 3300044658 | Bacteria | 830 |
| 516 | Ga0466965_0011179 | 3300044683 | Bacteria | 4202 |
| 517 | Ga0466965_0033928 | 3300044683 | Bacteria | 2496 |
| 518 | Ga0466965_0041318 | 3300044683 | Bacteria | 2272 |
| 519 | Ga0466965_0154111 | 3300044683 | Bacteria | 1202 |
| 520 | Ga0466965_0439930 | 3300044683 | Bacteria | 725 |
| 521 | Ga0466966_0012584 | 3300044684 | Bacteria | 5607 |
| 522 | Ga0466966_0052358 | 3300044684 | Bacteria | 2593 |
| 523 | Ga0466966_0065950 | 3300044684 | Bacteria | 2276 |
| 524 | Ga0466961_0002144 | 3300044693 | Bacteria | 12265 |
| 525 | Ga0466961_0060207 | 3300044693 | Bacteria | 2414 |
| 526 | Ga0466961_0093991 | 3300044693 | Bacteria | 1892 |
| 527 | Ga0466961_0109719 | 3300044693 | Bacteria | 1737 |
| 528 | Ga0466961_0428348 | 3300044693 | Bacteria | 801 |
| 529 | Ga0466961_0510507 | 3300044693 | Bacteria | 725 |
| 530 | Ga0466963_0046324 | 3300044694 | Bacteria | 2867 |
| 531 | Ga0466964_0024318 | 3300044706 | Bacteria | 2360 |
| 532 | Ga0466971_0055377 | 3300044719 | Bacteria | 1788 |
| 533 | Ga0466970_0002177 | 3300044765 | Bacteria | 9466 |
| 534 | Ga0466970_0091858 | 3300044765 | Bacteria | 1648 |
| 535 | Ga0466970_0148493 | 3300044765 | Bacteria | 1294 |
| 536 | Ga0466970_0334745 | 3300044765 | Bacteria | 857 |
| 537 | Ga0466970_0504391 | 3300044765 | Bacteria | 697 |
| 538 | Ga0466970_0851589 | 3300044765 | Bacteria | 535 |
| 539 | Ga0466957_0011763 | 3300044842 | Bacteria | 5059 |
| 540 | Ga0466957_0030084 | 3300044842 | Bacteria | 3241 |
| 541 | Ga0466957_0122167 | 3300044842 | Bacteria | 1661 |
| 542 | Ga0466960_0002883 | 3300044901 | Bacteria | 6531 |
| 543 | Ga0466960_0012070 | 3300044901 | Bacteria | 3635 |
| 544 | Ga0466960_0066707 | 3300044901 | Bacteria | 1780 |
| 545 | Ga0466960_0692215 | 3300044901 | Bacteria | 611 |
| 546 | Ga0466960_1035102 | 3300044901 | Bacteria | 505 |
| 547 | Ga0466959_0004347 | 3300045049 | Bacteria | 9476 |
| 548 | Ga0466959_0094179 | 3300045049 | Bacteria | 2149 |
| 549 | Ga0466959_1220135 | 3300045049 | Bacteria | 500 |
| 550 | Ga0466958_0014356 | 3300045836 | Bacteria | 4523 |
| 551 | Ga0466967_0036719 | 3300045976 | Bacteria | 4185 |
| 552 | Ga0466967_0495227 | 3300045976 | Bacteria | 1199 |
| 553 | Ga0466967_0543970 | 3300045976 | Bacteria | 1143 |
| 554 | Ga0466967_2106476 | 3300045976 | Bacteria | 560 |
| 555 | Ga0495592_0000184 | 3300046454 | Bacteria | 54898 |
| 556 | Ga0495592_0035394 | 3300046454 | Bacteria | 3762 |
| 557 | Ga0495592_0036036 | 3300046454 | Bacteria | 3726 |
| 558 | Ga0495592_0092614 | 3300046454 | Bacteria | 2165 |
| 559 | Ga0495592_0109952 | 3300046454 | Bacteria | 1951 |
| 560 | Ga0495592_0217229 | 3300046454 | Bacteria | 1280 |
| 561 | Ga0495592_0296180 | 3300046454 | Bacteria | 1053 |
| 562 | Ga0495603_0007694 | 3300046455 | Bacteria | 6490 |
| 563 | Ga0495629_0013497 | 3300046459 | Bacteria | 5892 |
| 564 | Ga0495629_0205390 | 3300046459 | Bacteria | 1361 |
| 565 | Ga0495641_0004733 | 3300046461 | Bacteria | 9480 |
| 566 | Ga0495641_0040864 | 3300046461 | Bacteria | 2155 |
| 567 | Ga0495651_0000131 | 3300046462 | Bacteria | 55705 |
| 568 | Ga0495651_0032558 | 3300046462 | Bacteria | 4065 |
| 569 | Ga0495651_0041587 | 3300046462 | Bacteria | 3569 |
| 570 | Ga0495651_0046202 | 3300046462 | Bacteria | 3370 |
| 571 | Ga0495651_0054599 | 3300046462 | Bacteria | 3071 |
| 572 | Ga0495651_0103080 | 3300046462 | Bacteria | 2120 |
| 573 | Ga0495651_0133537 | 3300046462 | Bacteria | 1809 |
| 574 | Ga0495653_0017840 | 3300046463 | Bacteria | 5770 |
| 575 | Ga0495653_0054434 | 3300046463 | Bacteria | 3057 |
| 576 | Ga0495653_0059598 | 3300046463 | Bacteria | 2896 |
| 577 | Ga0495653_0124216 | 3300046463 | Bacteria | 1835 |
| 578 | Ga0495653_0705547 | 3300046463 | Bacteria | 612 |
| 579 | Ga0495580_0037328 | 3300046472 | Bacteria | 3488 |
| 580 | Ga0495580_0181927 | 3300046472 | Bacteria | 1451 |
| 581 | Ga0495580_0289335 | 3300046472 | Bacteria | 1117 |
| 582 | Ga0495582_0015087 | 3300046473 | Bacteria | 4249 |
| 583 | Ga0495582_0518882 | 3300046473 | Bacteria | 689 |
| 584 | Ga0495639_0001512 | 3300046475 | Bacteria | 10375 |
| 585 | Ga0495639_0161666 | 3300046475 | Bacteria | 1084 |
| 586 | Ga0495662_0002779 | 3300046476 | Bacteria | 8851 |
| 587 | Ga0495662_0067629 | 3300046476 | Bacteria | 1729 |
| 588 | Ga0495662_0078218 | 3300046476 | Bacteria | 1607 |
| 589 | Ga0495662_0373344 | 3300046476 | Bacteria | 701 |
| 590 | Ga0495664_0009440 | 3300046477 | Bacteria | 5458 |
| 591 | Ga0495664_0015506 | 3300046477 | Bacteria | 4332 |
| 592 | Ga0495664_0021197 | 3300046477 | Bacteria | 3753 |
| 593 | Ga0495664_0046686 | 3300046477 | Bacteria | 2570 |
| 594 | Ga0495664_0060513 | 3300046477 | Bacteria | 2254 |
| 595 | Ga0495664_0061523 | 3300046477 | Bacteria | 2235 |
| 596 | Ga0495664_0301314 | 3300046477 | Bacteria | 967 |
| 597 | Ga0495594_0023662 | 3300046499 | Bacteria | 3293 |
| 598 | Ga0495594_0324647 | 3300046499 | Bacteria | 877 |
| 599 | Ga0495608_0000768 | 3300046511 | Bacteria | 22469 |
| 600 | Ga0495608_0007038 | 3300046511 | Bacteria | 7963 |
| 601 | Ga0495608_0013168 | 3300046511 | Bacteria | 5740 |
| 602 | Ga0495608_0035089 | 3300046511 | Bacteria | 3384 |
| 603 | Ga0495608_0055275 | 3300046511 | Bacteria | 2623 |
| 604 | Ga0495608_0061227 | 3300046511 | Bacteria | 2475 |
| 605 | Ga0495618_0088306 | 3300046514 | Bacteria | 1982 |
| 606 | Ga0495618_0175332 | 3300046514 | Bacteria | 1363 |
| 607 | Ga0495628_0000180 | 3300046516 | Bacteria | 55769 |
| 608 | Ga0495628_0094660 | 3300046516 | Bacteria | 2308 |
| 609 | Ga0495628_0097020 | 3300046516 | Bacteria | 2277 |
| 610 | Ga0495628_0128659 | 3300046516 | Bacteria | 1938 |
| 611 | Ga0495628_0186993 | 3300046516 | Bacteria | 1565 |
| 612 | Ga0495628_0401788 | 3300046516 | Bacteria | 1001 |
| 613 | Ga0495628_0738907 | 3300046516 | Bacteria | 692 |
| 614 | Ga0495630_0051873 | 3300046517 | Bacteria | 3070 |
| 615 | Ga0495630_0093518 | 3300046517 | Bacteria | 2272 |
| 616 | Ga0495630_0105463 | 3300046517 | Bacteria | 2134 |
| 617 | Ga0495630_0148136 | 3300046517 | Bacteria | 1785 |
| 618 | Ga0495630_0967375 | 3300046517 | Bacteria | 647 |
| 619 | Ga0495630_1014960 | 3300046517 | Bacteria | 630 |
| 620 | Ga0495630_1085832 | 3300046517 | Bacteria | 607 |
| 621 | Ga0495666_0022116 | 3300046526 | Bacteria | 3149 |
| 622 | Ga0495666_0024178 | 3300046526 | Bacteria | 3002 |
| 623 | Ga0495652_0001434 | 3300046529 | Bacteria | 26398 |
| 624 | Ga0495652_0024252 | 3300046529 | Bacteria | 5371 |
| 625 | Ga0495652_0082674 | 3300046529 | Bacteria | 2645 |
| 626 | Ga0495652_0113027 | 3300046529 | Bacteria | 2180 |
| 627 | Ga0495652_0157731 | 3300046529 | Bacteria | 1765 |
| 628 | Ga0495652_0170963 | 3300046529 | Bacteria | 1677 |
| 629 | Ga0495652_0366278 | 3300046529 | Bacteria | 1028 |
| 630 | Ga0495652_0366411 | 3300046529 | Bacteria | 1028 |
| 631 | Ga0495652_0372268 | 3300046529 | Bacteria | 1018 |
| 632 | Ga0495652_0830437 | 3300046529 | Bacteria | 613 |
| 633 | Ga0495665_0001185 | 3300046531 | Bacteria | 13888 |
| 634 | Ga0495665_0005270 | 3300046531 | Bacteria | 6969 |
| 635 | Ga0495665_0036087 | 3300046531 | Bacteria | 2639 |
| 636 | Ga0495640_0004684 | 3300046533 | Bacteria | 10898 |
| 637 | Ga0495640_0011711 | 3300046533 | Bacteria | 6734 |
| 638 | Ga0495640_0019823 | 3300046533 | Bacteria | 4960 |
| 639 | Ga0495640_0024262 | 3300046533 | Bacteria | 4413 |
| 640 | Ga0495640_0173322 | 3300046533 | Bacteria | 1378 |
| 641 | Ga0495586_0014439 | 3300046535 | Bacteria | 4195 |
| 642 | Ga0495586_0016622 | 3300046535 | Bacteria | 3913 |
| 643 | Ga0495586_0109132 | 3300046535 | Bacteria | 1539 |
| 644 | Ga0495586_0673334 | 3300046535 | Bacteria | 598 |
| 645 | Ga0495587_0000141 | 3300046536 | Bacteria | 53793 |
| 646 | Ga0495587_0002857 | 3300046536 | Bacteria | 11571 |
| 647 | Ga0495587_0015327 | 3300046536 | Bacteria | 4789 |
| 648 | Ga0495587_0017009 | 3300046536 | Bacteria | 4521 |
| 649 | Ga0495587_0069948 | 3300046536 | Bacteria | 2043 |
| 650 | Ga0495587_0330079 | 3300046536 | Bacteria | 851 |
| 651 | Ga0495645_0047134 | 3300046543 | Bacteria | 3140 |
| 652 | Ga0495645_0057412 | 3300046543 | Bacteria | 2825 |
| 653 | Ga0495645_0064711 | 3300046543 | Bacteria | 2645 |
| 654 | Ga0495645_0076700 | 3300046543 | Bacteria | 2404 |
| 655 | Ga0495645_0105403 | 3300046543 | Bacteria | 2000 |
| 656 | Ga0495645_0212532 | 3300046543 | Bacteria | 1305 |
| 657 | Ga0495622_0422911 | 3300046557 | Bacteria | 572 |
| 658 | Ga0495667_0000131 | 3300046559 | Bacteria | 53825 |
| 659 | Ga0495667_0008052 | 3300046559 | Bacteria | 7150 |
| 660 | Ga0495667_0009309 | 3300046559 | Bacteria | 6658 |
| 661 | Ga0495667_0010184 | 3300046559 | Bacteria | 6364 |
| 662 | Ga0495667_0013033 | 3300046559 | Bacteria | 5630 |
| 663 | Ga0495667_0078624 | 3300046559 | Bacteria | 2145 |
| 664 | Ga0495634_0009569 | 3300046642 | Bacteria | 7142 |
| 665 | Ga0495634_0025645 | 3300046642 | Bacteria | 4118 |
| 666 | Ga0495634_0053469 | 3300046642 | Bacteria | 2705 |
| 667 | Ga0495634_0060339 | 3300046642 | Bacteria | 2523 |
| 668 | Ga0495634_0184054 | 3300046642 | Bacteria | 1306 |
| 669 | Ga0495634_0613036 | 3300046642 | Bacteria | 631 |
| 670 | Ga0495635_0136516 | 3300046663 | Bacteria | 1671 |
| 671 | Ga0495635_0202146 | 3300046663 | Bacteria | 1347 |
| 672 | Ga0495635_0228445 | 3300046663 | Bacteria | 1257 |
| 673 | Ga0495635_0284916 | 3300046663 | Bacteria | 1109 |
| 674 | Ga0495588_0040542 | 3300046674 | Bacteria | 2375 |
| 675 | Ga0495588_0047251 | 3300046674 | Bacteria | 2210 |
| 676 | Ga0495657_0000187 | 3300046675 | Bacteria | 55705 |
| 677 | Ga0495657_0030248 | 3300046675 | Bacteria | 3794 |
| 678 | Ga0495657_0044325 | 3300046675 | Bacteria | 3026 |
| 679 | Ga0495657_0089699 | 3300046675 | Bacteria | 1974 |
| 680 | Ga0495657_0105209 | 3300046675 | Bacteria | 1793 |
| 681 | Ga0495657_0109830 | 3300046675 | Bacteria | 1748 |
| 682 | Ga0495599_0000113 | 3300046678 | Bacteria | 53734 |
| 683 | Ga0495599_0006846 | 3300046678 | Bacteria | 6893 |
| 684 | Ga0495599_0007218 | 3300046678 | Bacteria | 6732 |
| 685 | Ga0495599_0028547 | 3300046678 | Bacteria | 3497 |
| 686 | Ga0495599_0059271 | 3300046678 | Bacteria | 2394 |
| 687 | Ga0495599_0116883 | 3300046678 | Bacteria | 1659 |
| 688 | Ga0495599_0166073 | 3300046678 | Bacteria | 1363 |
| 689 | Ga0495599_0610650 | 3300046678 | Bacteria | 634 |
| 690 | Ga0495599_0632034 | 3300046678 | Bacteria | 621 |
| 691 | Ga0495623_0000726 | 3300046679 | Bacteria | 22031 |
| 692 | Ga0495623_0011614 | 3300046679 | Bacteria | 5703 |
| 693 | Ga0495623_0013773 | 3300046679 | Bacteria | 5242 |
| 694 | Ga0495623_0079921 | 3300046679 | Bacteria | 2025 |
| 695 | Ga0495646_0007607 | 3300046680 | Bacteria | 6885 |
| 696 | Ga0495646_0015811 | 3300046680 | Bacteria | 4790 |
| 697 | Ga0495646_0019233 | 3300046680 | Bacteria | 4325 |
| 698 | Ga0495646_0035801 | 3300046680 | Bacteria | 3077 |
| 699 | Ga0495646_0072555 | 3300046680 | Bacteria | 2024 |
| 700 | Ga0495647_0100882 | 3300046681 | Bacteria | 1195 |
| 701 | Ga0495658_0124385 | 3300046683 | Bacteria | 1563 |
| 702 | Ga0495613_0006390 | 3300046689 | Bacteria | 8807 |
| 703 | Ga0495613_0218806 | 3300046689 | Bacteria | 1337 |
| 704 | Ga0495624_0006797 | 3300046690 | Bacteria | 8080 |
| 705 | Ga0495624_0059447 | 3300046690 | Bacteria | 2398 |
| 706 | Ga0495624_0141468 | 3300046690 | Bacteria | 1474 |
| 707 | Ga0495624_0160442 | 3300046690 | Bacteria | 1374 |
| 708 | Ga0495600_0003468 | 3300046809 | Bacteria | 9280 |
| 709 | Ga0495600_0017104 | 3300046809 | Bacteria | 4610 |
| 710 | Ga0495600_0019155 | 3300046809 | Bacteria | 4366 |
| 711 | Ga0495600_0037425 | 3300046809 | Bacteria | 3154 |
| 712 | Ga0495600_0095636 | 3300046809 | Bacteria | 1937 |
| 713 | Ga0495600_0297842 | 3300046809 | Bacteria | 1018 |
| 714 | Ga0495581_0025466 | 3300047315 | Bacteria | 3430 |
| 715 | Ga0495581_0036508 | 3300047315 | Bacteria | 2843 |
| 716 | Ga0495581_0037951 | 3300047315 | Bacteria | 2787 |
| 717 | Ga0495604_0000209 | 3300047317 | Bacteria | 53734 |
| 718 | Ga0495604_0023622 | 3300047317 | Bacteria | 4906 |
| 719 | Ga0495604_0028254 | 3300047317 | Bacteria | 4462 |
| 720 | Ga0495604_0038241 | 3300047317 | Bacteria | 3775 |
| 721 | Ga0495604_0218474 | 3300047317 | Bacteria | 1313 |
| 722 | Ga0495674_0018070 | 3300047319 | Bacteria | 6564 |
| 723 | Ga0495674_0059781 | 3300047319 | Bacteria | 3327 |
| 724 | Ga0495674_0073190 | 3300047319 | Bacteria | 2954 |
| 725 | Ga0495674_0081518 | 3300047319 | Bacteria | 2775 |
| 726 | Ga0495674_0447282 | 3300047319 | Bacteria | 1038 |
| 727 | Ga0495676_0023945 | 3300047321 | Bacteria | 5290 |
| 728 | Ga0495676_0081757 | 3300047321 | Bacteria | 2447 |
| 729 | Ga0495680_0000323 | 3300047322 | Bacteria | 53763 |
| 730 | Ga0495680_0011877 | 3300047322 | Bacteria | 7685 |
| 731 | Ga0495680_0013486 | 3300047322 | Bacteria | 7128 |
| 732 | Ga0495680_0014737 | 3300047322 | Bacteria | 6758 |
| 733 | Ga0495680_0048019 | 3300047322 | Bacteria | 3354 |
| 734 | Ga0495680_0110035 | 3300047322 | Bacteria | 2042 |
| 735 | Ga0495675_0001015 | 3300047444 | Bacteria | 17036 |
| 736 | Ga0495675_0027305 | 3300047444 | Bacteria | 3637 |
| 737 | Ga0495675_0052747 | 3300047444 | Bacteria | 2581 |
| 738 | Ga0495675_0083023 | 3300047444 | Bacteria | 2017 |
| 739 | Ga0495675_0106622 | 3300047444 | Bacteria | 1751 |
| 740 | Ga0495675_0195430 | 3300047444 | Bacteria | 1233 |
| 741 | Ga0495684_0010593 | 3300047471 | Bacteria | 7126 |
| 742 | Ga0495684_0030683 | 3300047471 | Bacteria | 4127 |
| 743 | Ga0495684_0058664 | 3300047471 | Bacteria | 2931 |
| 744 | Ga0495684_0066320 | 3300047471 | Bacteria | 2744 |
| 745 | Ga0495684_0087559 | 3300047471 | Bacteria | 2360 |
| 746 | Ga0495684_0345532 | 3300047471 | Bacteria | 1058 |
| 747 | Ga0495593_0018712 | 3300047673 | Bacteria | 3889 |
| 748 | Ga0495593_0277851 | 3300047673 | Bacteria | 838 |
| 749 | Ga0495602_0000201 | 3300048088 | Bacteria | 55705 |
| 750 | Ga0495602_0062061 | 3300048088 | Bacteria | 3244 |
| 751 | Ga0495602_0139877 | 3300048088 | Bacteria | 1917 |
| 752 | Ga0495602_0139997 | 3300048088 | Bacteria | 1916 |
| 753 | Ga0495602_0227471 | 3300048088 | Bacteria | 1403 |
| 754 | Ga0495602_0259917 | 3300048088 | Bacteria | 1288 |
| 755 | Ga0495614_0034143 | 3300048089 | Bacteria | 2187 |
| 756 | Ga0495614_0129811 | 3300048089 | Bacteria | 1115 |
| 757 | Ga0496100_0386908 | 3300048903 | Bacteria | 1063 |
| 758 | Ga0496100_0732659 | 3300048903 | Bacteria | 772 |
| 759 | Ga0496101_0135489 | 3300048904 | Bacteria | 1873 |
| 760 | Ga0496101_0385910 | 3300048904 | Bacteria | 1102 |
| 761 | Ga0496102_0079539 | 3300048905 | Bacteria | 3019 |
| 762 | Ga0496102_0605768 | 3300048905 | Bacteria | 1018 |
| 763 | Ga0496103_0011000 | 3300048906 | Bacteria | 5354 |
| 764 | Ga0496104_0000961 | 3300048907 | Bacteria | 24771 |
| 765 | Ga0496104_0035449 | 3300048907 | Bacteria | 4658 |
| 766 | Ga0496104_0738546 | 3300048907 | Bacteria | 891 |
| 767 | Ga0496105_0010278 | 3300048908 | Bacteria | 7357 |
| 768 | Ga0496105_0161329 | 3300048908 | Bacteria | 1840 |
| 769 | Ga0496106_0456457 | 3300048909 | Bacteria | 1026 |
| 770 | Ga0496106_0856925 | 3300048909 | Bacteria | 719 |
| 771 | Ga0496107_0261575 | 3300048910 | Bacteria | 1287 |
| 772 | Ga0496107_0345922 | 3300048910 | Bacteria | 1106 |
| 773 | Ga0496108_0003044 | 3300048911 | Bacteria | 13477 |
| 774 | Ga0496108_0118819 | 3300048911 | Bacteria | 2266 |
| 775 | Ga0496108_0196060 | 3300048911 | Bacteria | 1751 |
| 776 | Ga0496108_0281094 | 3300048911 | Bacteria | 1449 |
| 777 | Ga0496108_0626083 | 3300048911 | Bacteria | 936 |
| 778 | Ga0496109_0007325 | 3300048912 | Bacteria | 9330 |
| 779 | Ga0496109_0023704 | 3300048912 | Bacteria | 5448 |
| 780 | Ga0496109_0312503 | 3300048912 | Bacteria | 1482 |
| 781 | Ga0496110_0016527 | 3300048913 | Bacteria | 6161 |
| 782 | Ga0496110_0488896 | 3300048913 | Bacteria | 1121 |
| 783 | Ga0496110_0784962 | 3300048913 | Bacteria | 856 |
| 784 | Ga0496111_0060621 | 3300048914 | Bacteria | 2742 |
| 785 | Ga0496111_1201029 | 3300048914 | Bacteria | 537 |
| 786 | Ga0496112_0015631 | 3300048915 | Bacteria | 7088 |
| 787 | Ga0496112_0164656 | 3300048915 | Bacteria | 2183 |
| 788 | Ga0496112_0535844 | 3300048915 | Bacteria | 1105 |
| 789 | Ga0496113_0021000 | 3300048916 | Bacteria | 4601 |
| 790 | Ga0496113_0026523 | 3300048916 | Bacteria | 4143 |
| 791 | Ga0496113_0677961 | 3300048916 | Bacteria | 823 |
| 792 | Ga0496114_0499987 | 3300048917 | Bacteria | 1075 |
| 793 | Ga0496115_0045544 | 3300048918 | Bacteria | 3502 |
| 794 | Ga0496115_0066577 | 3300048918 | Bacteria | 2911 |
| 795 | Ga0496115_0160288 | 3300048918 | Bacteria | 1859 |
| 796 | Ga0496115_0410765 | 3300048918 | Bacteria | 1097 |
| 797 | Ga0496119_0000290 | 3300048922 | Bacteria | 70278 |
| 798 | Ga0496119_0393623 | 3300048922 | Bacteria | 662 |
| 799 | Ga0496120_0000103 | 3300048923 | Bacteria | 141601 |
| 800 | Ga0496126_0010956 | 3300048929 | Bacteria | 9444 |
| 801 | Ga0496126_0923062 | 3300048929 | Bacteria | 660 |
| 802 | Ga0496126_1064527 | 3300048929 | Bacteria | 603 |
| 803 | Ga0501031_0028296 | 3300049568 | Bacteria | 3653 |
| 804 | Ga0501032_0038427 | 3300049569 | Bacteria | 3260 |
| 805 | Ga0501034_1052079 | 3300049571 | Bacteria | 696 |
| 806 | Ga0501036_0042109 | 3300049572 | Bacteria | 3866 |
| 807 | Ga0501038_0261972 | 3300049574 | Bacteria | 1366 |
| 808 | Ga0501038_1160851 | 3300049574 | Bacteria | 562 |
| 809 | Ga0501039_0036007 | 3300049575 | Bacteria | 3818 |
| 810 | Ga0501039_0048170 | 3300049575 | Bacteria | 3295 |
| 811 | Ga0501039_0509534 | 3300049575 | Bacteria | 945 |
| 812 | Ga0501040_0002169 | 3300049576 | Bacteria | 12667 |
| 813 | Ga0501040_0183974 | 3300049576 | Bacteria | 1482 |
| 814 | Ga0501041_0016935 | 3300049577 | Bacteria | 4336 |
| 815 | Ga0501042_0017357 | 3300049578 | Bacteria | 4963 |
| 816 | Ga0501043_0513872 | 3300049579 | Bacteria | 893 |
| 817 | Ga0501046_0297644 | 3300049580 | Bacteria | 1179 |
| 818 | Ga0501048_0020126 | 3300049582 | Bacteria | 4895 |
| 819 | Ga0501048_1142092 | 3300049582 | Bacteria | 560 |
| 820 | Ga0501067_0040091 | 3300049583 | Bacteria | 2602 |
| 821 | Ga0501067_0392385 | 3300049583 | Bacteria | 774 |
| 822 | Ga0501069_0135230 | 3300049585 | Bacteria | 1413 |
| 823 | Ga0501069_0147852 | 3300049585 | Bacteria | 1349 |
| 824 | Ga0501069_0311600 | 3300049585 | Bacteria | 924 |
| 825 | Ga0501069_0463813 | 3300049585 | Bacteria | 754 |
| 826 | Ga0501069_0780265 | 3300049585 | Unclassified | 579 |
| 827 | Ga0501070_0070615 | 3300049586 | Bacteria | 2892 |
| 828 | Ga0501070_0091317 | 3300049586 | Bacteria | 2520 |
| 829 | Ga0501070_0209423 | 3300049586 | Bacteria | 1600 |
| 830 | Ga0501070_0754402 | 3300049586 | Bacteria | 767 |
| 831 | Ga0501070_0972190 | 3300049586 | Bacteria | 659 |
| 832 | Ga0501071_0031313 | 3300049587 | Bacteria | 3769 |
| 833 | Ga0501071_0076414 | 3300049587 | Bacteria | 2446 |
| 834 | Ga0501071_0967948 | 3300049587 | Bacteria | 657 |
| 835 | Ga0501071_1136735 | 3300049587 | Bacteria | 603 |
| 836 | Ga0501072_0018491 | 3300049588 | Bacteria | 5368 |
| 837 | Ga0501072_0139902 | 3300049588 | Bacteria | 1930 |
| 838 | Ga0501072_0313993 | 3300049588 | Bacteria | 1246 |
| 839 | Ga0501072_0374950 | 3300049588 | Bacteria | 1129 |
| 840 | Ga0501072_0384395 | 3300049588 | Bacteria | 1114 |
| 841 | Ga0501074_0411358 | 3300049590 | Bacteria | 959 |
| 842 | Ga0501075_0017170 | 3300049591 | Bacteria | 5224 |
| 843 | Ga0501075_0165675 | 3300049591 | Bacteria | 1686 |
| 844 | Ga0501076_0006919 | 3300049592 | Bacteria | 8240 |
| 845 | Ga0501076_0091215 | 3300049592 | Bacteria | 2451 |
| 846 | Ga0501076_0183216 | 3300049592 | Bacteria | 1708 |
| 847 | Ga0501077_0283075 | 3300049593 | Bacteria | 1055 |
| 848 | Ga0501079_0003322 | 3300049741 | Bacteria | 11797 |
| 849 | Ga0501079_1619641 | 3300049741 | Bacteria | 509 |
| 850 | Ga0501080_0104937 | 3300049742 | Bacteria | 2621 |
| 851 | Ga0501081_0014169 | 3300049743 | Bacteria | 5255 |
| 852 | Ga0501081_0519097 | 3300049743 | Bacteria | 888 |
| 853 | Ga0501035_0857363 | 3300049822 | Bacteria | 722 |
| 854 | Ga0501035_1284538 | 3300049822 | Bacteria | 565 |
| 855 | Ga0501044_1473629 | 3300049823 | Bacteria | 546 |
| 856 | Ga0501045_0002561 | 3300049824 | Bacteria | 12392 |
| 857 | Ga0501045_0144267 | 3300049824 | Bacteria | 1771 |
| 858 | nmdc:mga03683_52169_c1 | 3300050489 | Bacteria | 1709 |
| 859 | nmdc:mga03n38_456175_c1 | 3300050490 | Bacteria | 712 |
| 860 | nmdc:mga03n38_605093_c1 | 3300050490 | Bacteria | 625 |
| 861 | nmdc:mga00v17_179305_c1 | 3300050491 | Bacteria | 1367 |
| 862 | nmdc:mga00v17_189395_c1 | 3300050491 | Bacteria | 1328 |
| 863 | nmdc:mga00v17_477469_c1 | 3300050491 | Bacteria | 809 |
| 864 | nmdc:mga00v17_531686_c1 | 3300050491 | Bacteria | 761 |
| 865 | nmdc:mga0yw44_1497_c1 | 3300050492 | Bacteria | 9314 |
| 866 | nmdc:mga0yw44_283847_c1 | 3300050492 | Bacteria | 1107 |
| 867 | nmdc:mga0yw44_32008_c1 | 3300050492 | Bacteria | 3062 |
| 868 | nmdc:mga0yw44_451302_c1 | 3300050492 | Bacteria | 871 |
| 869 | nmdc:mga0yw44_62893_c1 | 3300050492 | Bacteria | 2281 |
| 870 | nmdc:mga0yw44_683535_c1 | 3300050492 | Bacteria | 697 |
| 871 | nmdc:mga0yw44_708048_c1 | 3300050492 | Bacteria | 684 |
| 872 | nmdc:mga0yw44_82602_c1 | 3300050492 | Bacteria | 2016 |
| 873 | nmdc:mga06z11_284109_c1 | 3300050494 | Bacteria | 981 |
| 874 | nmdc:mga06z11_356696_c1 | 3300050494 | Bacteria | 876 |
| 875 | nmdc:mga06z11_419735_c1 | 3300050494 | Bacteria | 806 |
| 876 | nmdc:mga06z11_466547_c1 | 3300050494 | Bacteria | 764 |
| 877 | nmdc:mga06z11_471486_c1 | 3300050494 | Bacteria | 760 |
| 878 | nmdc:mga06z11_713443_c1 | 3300050494 | Bacteria | 611 |
| 879 | nmdc:mga04h51_6174_c1 | 3300050495 | Bacteria | 3093 |
| 880 | nmdc:mga07m45_479521_c1 | 3300050496 | Bacteria | 721 |
| 881 | nmdc:mga08y16_32073_c1 | 3300050511 | Bacteria | 5524 |
| 882 | nmdc:mga08y16_6137_c1 | 3300050511 | Bacteria | 12599 |
| 883 | nmdc:mga0n895_115659_c1 | 3300050512 | Bacteria | 2700 |
| 884 | nmdc:mga0n895_1362160_c1 | 3300050512 | Bacteria | 679 |
| 885 | nmdc:mga0n895_277814_c1 | 3300050512 | Bacteria | 1699 |
| 886 | nmdc:mga0n895_50960_c1 | 3300050512 | Bacteria | 4061 |
| 887 | nmdc:mga0rr50_441980_c1 | 3300050513 | Bacteria | 1102 |
| 888 | nmdc:mga0rr50_487829_c1 | 3300050513 | Bacteria | 1047 |
| 889 | nmdc:mga0rr50_57369_c1 | 3300050513 | Bacteria | 2913 |
| 890 | nmdc:mga0rr50_662474_c1 | 3300050513 | Bacteria | 891 |
| 891 | nmdc:mga0rr50_803_c1 | 3300050513 | Bacteria | 16935 |
| 892 | nmdc:mga08x19_15786_c1 | 3300050514 | Bacteria | 4597 |
| 893 | nmdc:mga08x19_617582_c1 | 3300050514 | Bacteria | 768 |
| 894 | nmdc:mga08x19_64773_c1 | 3300050514 | Bacteria | 2373 |
| 895 | nmdc:mga0a205_4611_c1 | 3300050515 | Bacteria | 12358 |
| 896 | Ga0495601_0034844 | 3300053077 | Bacteria | 3140 |
| 897 | Ga0495601_0039047 | 3300053077 | Bacteria | 2971 |
| 898 | Ga0495601_0056331 | 3300053077 | Bacteria | 2489 |
| 899 | Ga0495601_0160864 | 3300053077 | Bacteria | 1467 |
| 900 | Ga0495601_0336616 | 3300053077 | Bacteria | 982 |
| 901 | Ga0495601_0355238 | 3300053077 | Bacteria | 952 |
| 902 | Ga0495612_0000933 | 3300053078 | Bacteria | 11987 |
| 903 | Ga0495612_0028588 | 3300053078 | Bacteria | 2245 |
| 904 | Ga0495612_0030456 | 3300053078 | Bacteria | 2173 |
| 905 | Ga0495612_0030911 | 3300053078 | Bacteria | 2158 |
| 906 | Ga0495612_0121587 | 3300053078 | Bacteria | 1123 |
| 907 | Ga0495595_0002531 | 3300053084 | Bacteria | 7169 |
| 908 | Ga0495595_0010961 | 3300053084 | Bacteria | 3782 |
| 909 | Ga0495595_0024834 | 3300053084 | Bacteria | 2649 |
| 910 | Ga0495595_0108284 | 3300053084 | Bacteria | 1346 |
| 911 | Ga0495619_0015950 | 3300053085 | Bacteria | 4755 |
| 912 | Ga0495619_0232462 | 3300053085 | Bacteria | 1277 |
| 913 | Ga0495619_0659537 | 3300053085 | Bacteria | 713 |
| 914 | Ga0495619_0688642 | 3300053085 | Bacteria | 695 |
| 915 | Ga0500573_0201175 | 3300053140 | Bacteria | 1057 |
| 916 | Ga0501084_0128423 | 3300054114 | Bacteria | 2133 |
| 917 | Ga0501084_0146514 | 3300054114 | Bacteria | 1989 |
| 918 | Ga0501082_0766380 | 3300060353 | Bacteria | 844 |
| 919 | Ga0501082_0863505 | 3300060353 | Bacteria | 792 |
| 920 | Ga0466962_0108384 | 3300061719 | Bacteria | 1336 |
| 921 | Ga0466962_0114873 | 3300061719 | Bacteria | 1297 |
| 922 | Ga0530510_0340676 | 3300061734 | Bacteria | 1125 |
| 923 | Ga0530510_0727008 | 3300061734 | Bacteria | 757 |
| 924 | 2643826461 | 2643221561 | Bacteria | 4984412 |
| 925 | 2644089421 | 2643221615 | Bacteria | 5487866 |
| 926 | 2644319266 | 2643221657 | Bacteria | 5490246 |
| 927 | 2738869479 | 2738541305 | Bacteria | 4910150 |
| 928 | 2808872310 | 2808606365 | Bacteria | 4301966 |
| 929 | 2812333220 | 2811994874 | Bacteria | 5367947 |
| 930 | 2856741982 | 2856741275 | Bacteria | 8096094 |
| 931 | 2873318144 | 2873314349 | Bacteria | 8512634 |
| 932 | 2891396381 | 2891395885 | Bacteria | 9251614 |
| 933 | 2891558361 | 2891554331 | Bacteria | 8812224 |
| 934 | 2891566475 | 2891562705 | Bacteria | 8039471 |
| 935 | 2895436661 | 2895427314 | Bacteria | 13147766 |
| 936 | 2919718195 | 2919713450 | Bacteria | 7431245 |
| 937 | 2984579352 | 2984576629 | Bacteria | 4248407 |
| 938 | 2990256963 | 2990256926 | Bacteria | 4252839 |
| 939 | 3003001319 | 3002998708 | Bacteria | 11715108 |
| 940 | 8053950365 | 8053945823 | Bacteria | 8962862 |
| 941 | 8054611156 | 8054609563 | Bacteria | 5170090 |
| 942 | Ga0466967_0844265 | |||
| 943 | Ga0070658_10000158 | |||
| 944 | Ga0070658_10018944 | |||
| 945 | Ga0070658_10129353 | |||
| 946 | Ga0070658_10166901 | |||
| 947 | Ga0070658_10362906 | |||
| 948 | Ga0070676_10095272 | |||
| 949 | Ga0070676_10656207 | |||
| 950 | Ga0070683_100151950 | |||
| 951 | Ga0070683_100285312 | |||
| 952 | Ga0070690_100128349 | |||
| 953 | Ga0070690_100293740 | |||
| 954 | Ga0068869_100479382 | |||
| 955 | Ga0070666_10360978 | |||
| 956 | Ga0070680_100008268 | |||
| 957 | Ga0070680_100079865 | |||
| 958 | Ga0070680_100104490 | |||
| 959 | Ga0070682_100829953 | |||
| 960 | Ga0068868_101244795 | |||
| 961 | Ga0070660_100838315 | |||
| 962 | Ga0070660_101667121 | |||
| 963 | Ga0070689_100526223 | |||
| 964 | Ga0070689_100740875 | |||
| 965 | Ga0070691_10172115 | |||
| 966 | Ga0070661_101145630 | |||
| 967 | Ga0070675_100403992 | |||
| 968 | Ga0070675_100749743 | |||
| 969 | Ga0070671_100459621 | |||
| 970 | Ga0070674_100346211 | |||
| 971 | Ga0070659_100001258 | |||
| 972 | Ga0070659_100238961 | |||
| 973 | Ga0070659_100539305 | |||
| 974 | Ga0070667_100064803 | |||
| 975 | Ga0070667_100641040 | |||
| 976 | Ga0070667_100665790 | |||
| 977 | Ga0070709_10000169 | |||
| 978 | Ga0070709_10035138 | |||
| 979 | Ga0070709_10077460 | |||
| 980 | Ga0070714_100078175 | |||
| 981 | Ga0070714_100151874 | |||
| 982 | Ga0070714_100158543 | |||
| 983 | Ga0070714_100258574 | |||
| 984 | Ga0070714_100307219 | |||
| 985 | Ga0070714_100524714 | |||
| 986 | Ga0070714_100852132 | |||
| 987 | Ga0070714_100889083 | |||
| 988 | Ga0070713_100086271 | |||
| 989 | Ga0070713_100096916 | |||
| 990 | Ga0070713_100211141 | |||
| 991 | Ga0070713_100396989 | |||
| 992 | Ga0070713_100609124 | |||
| 993 | Ga0070713_100910947 | |||
| 994 | Ga0070710_10006479 | |||
| 995 | Ga0070710_10016835 | |||
| 996 | Ga0070710_10065623 | |||
| 997 | Ga0070710_10092288 | |||
| 998 | Ga0070710_10109305 | |||
| 999 | Ga0070711_100004460 | |||
| 1000 | Ga0070711_100067694 | |||
| 1001 | Ga0070711_100519900 | |||
| 1002 | Ga0070705_100420811 | |||
| 1003 | Ga0070700_100907799 | |||
| 1004 | Ga0070708_100260347 | |||
| 1005 | Ga0070708_100933041 | |||
| 1006 | Ga0070663_100146513 | |||
| 1007 | Ga0070678_100132926 | |||
| 1008 | Ga0070662_100496444 | |||
| 1009 | Ga0070681_10000477 | |||
| 1010 | Ga0070681_10102380 | |||
| 1011 | Ga0070681_10726226 | |||
| 1012 | Ga0068867_101536856 | |||
| 1013 | Ga0070685_10703614 | |||
| 1014 | Ga0070706_100002920 | |||
| 1015 | Ga0070706_100021884 | |||
| 1016 | Ga0070706_100058514 | |||
| 1017 | Ga0070706_100118065 | |||
| 1018 | Ga0070706_100528998 | |||
| 1019 | Ga0070706_100636175 | |||
| 1020 | Ga0070706_100669491 | |||
| 1021 | Ga0070707_100020822 | |||
| 1022 | Ga0070707_100021782 | |||
| 1023 | Ga0070707_100026241 | |||
| 1024 | Ga0070707_100055420 | |||
| 1025 | Ga0070707_100095956 | |||
| 1026 | Ga0070698_100002175 | |||
| 1027 | Ga0070698_100030449 | |||
| 1028 | Ga0070698_100057473 | |||
| 1029 | Ga0070698_100061172 | |||
| 1030 | Ga0070698_100082007 | |||
| 1031 | Ga0070699_100575577 | |||
| 1032 | Ga0070679_100000521 | |||
| 1033 | Ga0070679_100093697 | |||
| 1034 | Ga0070679_100132171 | |||
| 1035 | Ga0070679_100199108 | |||
| 1036 | Ga0070679_100368868 | |||
| 1037 | Ga0070679_100408693 | |||
| 1038 | Ga0070684_100099739 | |||
| 1039 | Ga0070697_100104197 | |||
| 1040 | Ga0068853_100071753 | |||
| 1041 | Ga0068853_101068616 | |||
| 1042 | Ga0070695_100151689 | |||
| 1043 | Ga0070695_100423926 | |||
| 1044 | Ga0070696_100126143 | |||
| 1045 | Ga0070693_100109195 | |||
| 1046 | Ga0068855_102296874 | |||
| 1047 | Ga0070664_100797598 | |||
| 1048 | Ga0068857_100133729 | |||
| 1049 | Ga0068857_101282088 | |||
| 1050 | Ga0068854_100552993 | |||
| 1051 | Ga0068856_100025058 | |||
| 1052 | Ga0068856_100741128 | |||
| 1053 | Ga0068856_100860658 | |||
| 1054 | Ga0070702_100431408 | |||
| 1055 | Ga0068852_100963007 | |||
| 1056 | Ga0068859_100035415 | |||
| 1057 | Ga0068859_100353403 | |||
| 1058 | Ga0068864_100065553 | |||
| 1059 | Ga0068864_100516101 | |||
| 1060 | Ga0068861_101236797 | |||
| 1061 | Ga0068851_10739310 | |||
| 1062 | Ga0068863_100090421 | |||
| 1063 | Ga0068858_100339571 | |||
| 1064 | Ga0068860_100000334 | |||
| 1065 | Ga0068860_100181629 | |||
| 1066 | Ga0068860_100348171 | |||
| 1067 | Ga0068862_100303372 | |||
| 1068 | Ga0081455_10216955 | |||
| 1069 | Ga0081455_10489574 | |||
| 1070 | Ga0081455_10511810 | |||
| 1071 | Ga0081539_10064214 | |||
| 1072 | Ga0070717_10148387 | |||
| 1073 | Ga0070717_10274187 | |||
| 1074 | Ga0070717_10481647 | |||
| 1075 | Ga0070717_10736106 | |||
| 1076 | Ga0070717_10814214 | |||
| 1077 | Ga0075365_10012686 | |||
| 1078 | Ga0075365_10020548 | |||
| 1079 | Ga0075365_10103695 | |||
| 1080 | Ga0075365_10106052 | |||
| 1081 | Ga0075365_10113238 | |||
| 1082 | Ga0075365_10126865 | |||
| 1083 | Ga0075365_10146911 | |||
| 1084 | Ga0075365_10571490 | |||
| 1085 | Ga0075365_10585480 | |||
| 1086 | Ga0075368_10007589 | |||
| 1087 | Ga0075363_100005487 | |||
| 1088 | Ga0075363_100100131 | |||
| 1089 | Ga0075364_10029625 | |||
| 1090 | Ga0075364_10449032 | |||
| 1091 | Ga0075364_10518416 | |||
| 1092 | Ga0075432_10021839 | |||
| 1093 | Ga0070715_10054925 | |||
| 1094 | Ga0070716_100189873 | |||
| 1095 | Ga0070716_100344512 | |||
| 1096 | Ga0070712_100154336 | |||
| 1097 | Ga0070712_100175425 | |||
| 1098 | Ga0070712_100457548 | |||
| 1099 | Ga0070712_100464811 | |||
| 1100 | Ga0070712_100484076 | |||
| 1101 | Ga0070712_100600133 | |||
| 1102 | Ga0070712_100724648 | |||
| 1103 | Ga0070712_101319930 | |||
| 1104 | Ga0075362_10020031 | |||
| 1105 | Ga0075367_10052247 | |||
| 1106 | Ga0075367_10318112 | |||
| 1107 | Ga0075367_10343565 | |||
| 1108 | Ga0075367_10392782 | |||
| 1109 | Ga0075367_10517510 | |||
| 1110 | Ga0097621_100247251 | |||
| 1111 | Ga0097621_100304441 | |||
| 1112 | Ga0075370_10005619 | |||
| 1113 | Ga0068871_100051304 | |||
| 1114 | Ga0068871_100556395 | |||
| 1115 | Ga0075428_100037033 | |||
| 1116 | Ga0075430_100196017 | |||
| 1117 | Ga0075433_10002552 | |||
| 1118 | Ga0075433_10056705 | |||
| 1119 | Ga0075434_100009923 | |||
| 1120 | Ga0075434_100049787 | |||
| 1121 | Ga0075434_100232652 | |||
| 1122 | Ga0075434_100824281 | |||
| 1123 | Ga0075434_101479557 | |||
| 1124 | Ga0075436_100001677 | |||
| 1125 | Ga0075436_100164768 | |||
| 1126 | Ga0075436_100219894 | |||
| 1127 | Ga0075436_100257596 | |||
| 1128 | Ga0097620_100035416 | |||
| 1129 | Ga0097620_100353400 | |||
| 1130 | Ga0075435_100002810 | |||
| 1131 | Ga0075435_100203110 | |||
| 1132 | Ga0075435_100272660 | |||
| 1133 | Ga0075435_100308200 | |||
| 1134 | Ga0075435_100606485 | |||
| 1135 | Ga0105251_10314032 | |||
| 1136 | Ga0105250_10132926 | |||
| 1137 | Ga0111539_10003840 | |||
| 1138 | Ga0111539_10082371 | |||
| 1139 | Ga0111539_10348159 | |||
| 1140 | Ga0105245_10161185 | |||
| 1141 | Ga0105245_10603782 | |||
| 1142 | Ga0105245_11140876 | |||
| 1143 | Ga0105247_10127806 | |||
| 1144 | Ga0114129_11812613 | |||
| 1145 | Ga0105243_10421999 | |||
| 1146 | Ga0105241_10841897 | |||
| 1147 | Ga0105241_11259173 | |||
| 1148 | Ga0105241_11266065 | |||
| 1149 | Ga0105242_10224088 | |||
| 1150 | Ga0105248_10001693 | |||
| 1151 | Ga0105248_10663643 | |||
| 1152 | Ga0105248_11171271 | |||
| 1153 | Ga0105237_10049803 | |||
| 1154 | Ga0105237_10271779 | |||
| 1155 | Ga0105237_11723561 | |||
| 1156 | Ga0105238_10192905 | |||
| 1157 | Ga0105249_10342165 | |||
| 1158 | Ga0105249_10872220 | |||
| 1159 | Ga0105239_10101403 | |||
| 1160 | Ga0105239_10600868 | |||
| 1161 | Ga0157341_1021417 | |||
| 1162 | Ga0157342_1018987 | |||
| 1163 | Ga0157338_1009839 | |||
| 1164 | Ga0157373_10488036 | |||
| 1165 | Ga0157371_10054330 | |||
| 1166 | Ga0157370_10196659 | |||
| 1167 | Ga0157370_10467902 | |||
| 1168 | Ga0157370_10807002 | |||
| 1169 | Ga0157369_10035314 | |||
| 1170 | Ga0157369_10211251 | |||
| 1171 | Ga0157369_11146767 | |||
| 1172 | Ga0157369_12278617 | |||
| 1173 | Ga0157374_10051133 | |||
| 1174 | Ga0157374_10797198 | |||
| 1175 | Ga0163162_10039395 | |||
| 1176 | Ga0157372_10241084 | |||
| 1177 | Ga0157372_12121283 | |||
| 1178 | Ga0157372_13340673 | |||
| 1179 | Ga0157375_10072257 | |||
| 1180 | Ga0157375_10734235 | |||
| 1181 | Ga0163163_10007728 | |||
| 1182 | Ga0163163_10045897 | |||
| 1183 | Ga0163163_10109683 | |||
| 1184 | Ga0157380_11096554 | |||
| 1185 | Ga0182008_10578847 | |||
| 1186 | Ga0157377_10073742 | |||
| 1187 | Ga0157379_10024347 | |||
| 1188 | Ga0157379_10032700 | |||
| 1189 | Ga0157379_10423256 | |||
| 1190 | Ga0157376_10023750 | |||
| 1191 | Ga0206356_10498411 | |||
| 1192 | Ga0206354_10954142 | |||
| 1193 | Ga0213875_10051044 | |||
| 1194 | Ga0213875_10189008 | |||
| 1195 | Ga0224712_10129158 | |||
| 1196 | Ga0224571_103483 | |||
| 1197 | Ga0228600_1005047 | |||
| 1198 | Ga0224572_1045916 | |||
| 1199 | Ga0207656_10216480 | |||
| 1200 | Ga0207692_10000163 | |||
| 1201 | Ga0207692_10015879 | |||
| 1202 | Ga0207692_10045088 | |||
| 1203 | Ga0207692_10081678 | |||
| 1204 | Ga0207710_10000030 | |||
| 1205 | Ga0207710_10235822 | |||
| 1206 | Ga0207688_10164440 | |||
| 1207 | Ga0207647_10118422 | |||
| 1208 | Ga0207647_10228790 | |||
| 1209 | Ga0207685_10050740 | |||
| 1210 | Ga0207685_10145519 | |||
| 1211 | Ga0207685_10189891 | |||
| 1212 | Ga0207699_10000201 | |||
| 1213 | Ga0207699_10012599 | |||
| 1214 | Ga0207699_10083278 | |||
| 1215 | Ga0207699_10101419 | |||
| 1216 | Ga0207699_10875627 | |||
| 1217 | Ga0207645_10176344 | |||
| 1218 | Ga0207643_10008616 | |||
| 1219 | Ga0207705_10000399 | |||
| 1220 | Ga0207705_10017254 | |||
| 1221 | Ga0207705_10067515 | |||
| 1222 | Ga0207705_10072639 | |||
| 1223 | Ga0207705_10222137 | |||
| 1224 | Ga0207705_10554364 | |||
| 1225 | Ga0207705_10656937 | |||
| 1226 | Ga0207684_10002079 | |||
| 1227 | Ga0207684_10018950 | |||
| 1228 | Ga0207684_10038962 | |||
| 1229 | Ga0207684_10071650 | |||
| 1230 | Ga0207684_10416581 | |||
| 1231 | Ga0207707_10000720 | |||
| 1232 | Ga0207707_10081666 | |||
| 1233 | Ga0207707_10145519 | |||
| 1234 | Ga0207707_10921660 | |||
| 1235 | Ga0207693_10012620 | |||
| 1236 | Ga0207693_10242938 | |||
| 1237 | Ga0207693_10251306 | |||
| 1238 | Ga0207693_10273712 | |||
| 1239 | Ga0207693_10486823 | |||
| 1240 | Ga0207663_10001705 | |||
| 1241 | Ga0207663_10012581 | |||
| 1242 | Ga0207663_10076199 | |||
| 1243 | Ga0207663_10353322 | |||
| 1244 | Ga0207663_10501131 | |||
| 1245 | Ga0207663_10841080 | |||
| 1246 | Ga0207660_10013060 | |||
| 1247 | Ga0207660_10059583 | |||
| 1248 | Ga0207660_10132131 | |||
| 1249 | Ga0207660_10164916 | |||
| 1250 | Ga0207660_10205878 | |||
| 1251 | Ga0207660_10295281 | |||
| 1252 | Ga0207657_10222958 | |||
| 1253 | Ga0207657_10438119 | |||
| 1254 | Ga0207657_10660398 | |||
| 1255 | Ga0207657_10686833 | |||
| 1256 | Ga0207657_11034745 | |||
| 1257 | Ga0207649_10301702 | |||
| 1258 | Ga0207652_10000798 | |||
| 1259 | Ga0207652_10172648 | |||
| 1260 | Ga0207652_10191353 | |||
| 1261 | Ga0207652_10281676 | |||
| 1262 | Ga0207652_10329666 | |||
| 1263 | Ga0207652_10671478 | |||
| 1264 | Ga0207646_10000235 | |||
| 1265 | Ga0207646_10006203 | |||
| 1266 | Ga0207646_10011031 | |||
| 1267 | Ga0207646_10019130 | |||
| 1268 | Ga0207646_10783559 | |||
| 1269 | Ga0207681_10570279 | |||
| 1270 | Ga0207694_10762336 | |||
| 1271 | Ga0207694_10772599 | |||
| 1272 | Ga0207659_10355051 | |||
| 1273 | Ga0207659_10603195 | |||
| 1274 | Ga0207687_10089514 | |||
| 1275 | Ga0207687_10163959 | |||
| 1276 | Ga0207687_10588287 | |||
| 1277 | Ga0207700_10003259 | |||
| 1278 | Ga0207700_10003268 | |||
| 1279 | Ga0207700_10073649 | |||
| 1280 | Ga0207700_10204373 | |||
| 1281 | Ga0207700_10245832 | |||
| 1282 | Ga0207700_10270765 | |||
| 1283 | Ga0207664_10007630 | |||
| 1284 | Ga0207664_10009986 | |||
| 1285 | Ga0207664_10017900 | |||
| 1286 | Ga0207664_10035535 | |||
| 1287 | Ga0207664_10068066 | |||
| 1288 | Ga0207664_10073604 | |||
| 1289 | Ga0207664_10213197 | |||
| 1290 | Ga0207664_10639126 | |||
| 1291 | Ga0207664_11000415 | |||
| 1292 | Ga0207664_11042747 | |||
| 1293 | Ga0207664_11150610 | |||
| 1294 | Ga0207644_10351262 | |||
| 1295 | Ga0207706_10186689 | |||
| 1296 | Ga0207706_10197840 | |||
| 1297 | Ga0207686_10365522 | |||
| 1298 | Ga0207670_10431106 | |||
| 1299 | Ga0207669_10523020 | |||
| 1300 | Ga0207665_10002435 | |||
| 1301 | Ga0207665_10011169 | |||
| 1302 | Ga0207665_10020196 | |||
| 1303 | Ga0207665_10029190 | |||
| 1304 | Ga0207665_10051497 | |||
| 1305 | Ga0207711_10071258 | |||
| 1306 | Ga0207711_10470697 | |||
| 1307 | Ga0207689_10181640 | |||
| 1308 | Ga0207689_10478277 | |||
| 1309 | Ga0207661_10104468 | |||
| 1310 | Ga0207661_10299343 | |||
| 1311 | Ga0207679_10159324 | |||
| 1312 | Ga0207679_10706225 | |||
| 1313 | Ga0207667_10838128 | |||
| 1314 | Ga0207651_10254972 | |||
| 1315 | Ga0207712_10358586 | |||
| 1316 | Ga0207712_10584034 | |||
| 1317 | Ga0207640_10519037 | |||
| 1318 | Ga0207658_10045024 | |||
| 1319 | Ga0207658_10481930 | |||
| 1320 | Ga0207658_10827486 | |||
| 1321 | Ga0207677_10054423 | |||
| 1322 | Ga0207703_10402393 | |||
| 1323 | Ga0207703_11326446 | |||
| 1324 | Ga0207678_10182337 | |||
| 1325 | Ga0207708_10977767 | |||
| 1326 | Ga0207702_10088798 | |||
| 1327 | Ga0207702_10532694 | |||
| 1328 | Ga0207648_10190954 | |||
| 1329 | Ga0207676_10049767 | |||
| 1330 | Ga0207674_10154902 | |||
| 1331 | Ga0207683_10008286 | |||
| 1332 | Ga0209813_10231409 | |||
| 1333 | Ga0207428_10001176 | |||
| 1334 | Ga0207428_10020592 | |||
| 1335 | Ga0268266_11216696 | |||
| 1336 | Ga0268264_10002232 | |||
| 1337 | Ga0268264_10528032 | |||
| 1338 | Ga0265338_10003426 | |||
| 1339 | Ga0307409_100235546 | |||
| 1340 | Ga0316214_1035757 | |||
| 1341 | Ga0373948_0029789 | |||
| 1342 | Ga0373950_0092696 | |||
| 1343 | Ga0373926_0008108 | |||
| 1344 | Ga0373926_0095935 | |||
| 1345 | Ga0373926_0222153 | |||
| 1346 | Ga0373926_0274262 | |||
| 1347 | Ga0373929_0011930 | |||
| 1348 | Ga0373934_0000027 | |||
| 1349 | Ga0373934_0002340 | |||
| 1350 | Ga0373934_0017122 | |||
| 1351 | Ga0373934_0019085 | |||
| 1352 | Ga0373934_0167540 | |||
| 1353 | Ga0373940_0016961 | |||
| 1354 | Ga0373944_0000323 | |||
| 1355 | Ga0373944_0015922 | |||
| 1356 | Ga0373944_0065359 | |||
| 1357 | Ga0373923_0072476 | |||
| 1358 | Ga0373923_0093929 | |||
| 1359 | Ga0373923_0121724 | |||
| 1360 | Ga0373932_0026941 | |||
| 1361 | Ga0373936_0071408 | |||
| 1362 | Ga0373936_0138399 | |||
| 1363 | Ga0373939_0113443 | |||
| 1364 | Ga0373945_0003858 | |||
| 1365 | Ga0373945_0028589 | |||
| 1366 | Ga0373945_0171508 | |||
| 1367 | Ga0373953_0000032 | |||
| 1368 | Ga0373953_0009571 | |||
| 1369 | Ga0373953_0010179 | |||
| 1370 | Ga0373953_0071946 | |||
| 1371 | Ga0373953_0096894 | |||
| 1372 | Ga0373953_0124364 | |||
| 1373 | Ga0373953_0352162 | |||
| 1374 | Ga0373954_0000342 | |||
| 1375 | Ga0373954_0008936 | |||
| 1376 | Ga0373954_0020321 | |||
| 1377 | Ga0373954_0049616 | |||
| 1378 | Ga0373954_0172158 | |||
| 1379 | Ga0373956_0000561 | |||
| 1380 | Ga0373956_0006481 | |||
| 1381 | Ga0373956_0011840 | |||
| 1382 | Ga0373956_0075064 | |||
| 1383 | Ga0373956_0424904 | |||
| 1384 | Ga0373957_0000128 | |||
| 1385 | Ga0373957_0026484 | |||
| 1386 | Ga0373957_0045453 | |||
| 1387 | Ga0373957_0051609 | |||
| 1388 | Ga0373957_0076066 | |||
| 1389 | Ga0373960_0146993 | |||
| 1390 | Ga0373943_0088807 | |||
| 1391 | Ga0373943_0118000 | |||
| 1392 | Ga0373943_0128571 | |||
| 1393 | Ga0373943_0537884 | |||
| 1394 | Ga0373946_0000324 | |||
| 1395 | Ga0373955_0000361 | |||
| 1396 | Ga0373955_0032622 | |||
| 1397 | Ga0373955_0034558 | |||
| 1398 | Ga0373955_0045505 | |||
| 1399 | Ga0373955_0214047 | |||
| 1400 | Ga0373962_0024594 | |||
| 1401 | Ga0373924_0004004 | |||
| 1402 | Ga0373924_0011107 | |||
| 1403 | Ga0373924_0012923 | |||
| 1404 | Ga0373924_0135037 | |||
| 1405 | Ga0373924_0435359 | |||
| 1406 | Ga0373935_0018511 | |||
| 1407 | Ga0373935_0027826 | |||
| 1408 | Ga0373935_0069776 | |||
| 1409 | Ga0373935_0193209 | |||
| 1410 | Ga0373935_0296827 | |||
| 1411 | Ga0373927_0016926 | |||
| 1412 | Ga0373927_0051130 | |||
| 1413 | Ga0373927_0256743 | |||
| 1414 | Ga0373933_0000103 | |||
| 1415 | Ga0373933_0026161 | |||
| 1416 | Ga0373933_0096420 | |||
| 1417 | Ga0373933_0211824 | |||
| 1418 | Ga0373947_0012689 | |||
| 1419 | Ga0373947_0201673 | |||
| 1420 | Ga0373947_0574914 | |||
| 1421 | Ga0373947_0610441 | |||
| 1422 | Ga0373947_0713360 | |||
| 1423 | Ga0373937_0000683 | |||
| 1424 | Ga0373937_0068896 | |||
| 1425 | Ga0373937_0089477 | |||
| 1426 | Ga0373937_0121182 | |||
| 1427 | Ga0373937_0384826 | |||
| 1428 | Ga0373937_0508494 | |||
| 1429 | Ga0373937_0641431 | |||
| 1430 | Ga0373937_0658831 | |||
| 1431 | Ga0373925_0011085 | |||
| 1432 | Ga0373925_0044028 | |||
| 1433 | Ga0373925_1030339 | |||
| 1434 | Ga0395900_0242198 | |||
| 1435 | Ga0395898_1101945 | |||
| 1436 | Ga0395905_0378173 | |||
| 1437 | Ga0436364_0307500 | |||
| 1438 | Ga0436364_0374489 | |||
| 1439 | Ga0436364_0377030 | |||
| 1440 | Ga0436364_1040386 | |||
| 1441 | Ga0436364_1044748 | |||
| 1442 | Ga0436364_1057201 | |||
| 1443 | Ga0436364_1231352 | |||
| 1444 | Ga0395901_0131036 | |||
| 1445 | Ga0395901_0195467 | |||
| 1446 | Ga0436365_0920719 | |||
| 1447 | Ga0436365_1108856 | |||
| 1448 | Ga0436360_0524089 | |||
| 1449 | Ga0436361_0139746 | |||
| 1450 | Ga0436361_0585092 | |||
| 1451 | Ga0436363_1476138 | |||
| 1452 | Ga0436363_1500493 | |||
| 1453 | Ga0436362_1225677 | |||
| 1454 | Ga0451807_1909869 | |||
| 1455 | Ga0466972_0017104 | |||
| 1456 | Ga0466972_0249351 | |||
| 1457 | Ga0466965_0011179 | |||
| 1458 | Ga0466965_0033928 | |||
| 1459 | Ga0466965_0041318 | |||
| 1460 | Ga0466965_0154111 | |||
| 1461 | Ga0466965_0439930 | |||
| 1462 | Ga0466966_0012584 | |||
| 1463 | Ga0466966_0052358 | |||
| 1464 | Ga0466966_0065950 | |||
| 1465 | Ga0466961_0002144 | |||
| 1466 | Ga0466961_0060207 | |||
| 1467 | Ga0466961_0093991 | |||
| 1468 | Ga0466961_0109719 | |||
| 1469 | Ga0466961_0428348 | |||
| 1470 | Ga0466961_0510507 | |||
| 1471 | Ga0466963_0046324 | |||
| 1472 | Ga0466964_0024318 | |||
| 1473 | Ga0466971_0055377 | |||
| 1474 | Ga0466970_0002177 | |||
| 1475 | Ga0466970_0091858 | |||
| 1476 | Ga0466970_0148493 | |||
| 1477 | Ga0466970_0334745 | |||
| 1478 | Ga0466970_0504391 | |||
| 1479 | Ga0466970_0851589 | |||
| 1480 | Ga0466957_0011763 | |||
| 1481 | Ga0466957_0030084 | |||
| 1482 | Ga0466957_0122167 | |||
| 1483 | Ga0466960_0002883 | |||
| 1484 | Ga0466960_0012070 | |||
| 1485 | Ga0466960_0066707 | |||
| 1486 | Ga0466960_0692215 | |||
| 1487 | Ga0466960_1035102 | |||
| 1488 | Ga0466959_0004347 | |||
| 1489 | Ga0466959_0094179 | |||
| 1490 | Ga0466959_1220135 | |||
| 1491 | Ga0466958_0014356 | |||
| 1492 | Ga0466967_0036719 | |||
| 1493 | Ga0466967_0495227 | |||
| 1494 | Ga0466967_0543970 | |||
| 1495 | Ga0466967_2106476 | |||
| 1496 | Ga0495592_0000184 | |||
| 1497 | Ga0495592_0035394 | |||
| 1498 | Ga0495592_0036036 | |||
| 1499 | Ga0495592_0092614 | |||
| 1500 | Ga0495592_0109952 | |||
| 1501 | Ga0495592_0217229 | |||
| 1502 | Ga0495592_0296180 | |||
| 1503 | Ga0495603_0007694 | |||
| 1504 | Ga0495629_0013497 | |||
| 1505 | Ga0495629_0205390 | |||
| 1506 | Ga0495641_0004733 | |||
| 1507 | Ga0495641_0040864 | |||
| 1508 | Ga0495651_0000131 | |||
| 1509 | Ga0495651_0032558 | |||
| 1510 | Ga0495651_0041587 | |||
| 1511 | Ga0495651_0046202 | |||
| 1512 | Ga0495651_0054599 | |||
| 1513 | Ga0495651_0103080 | |||
| 1514 | Ga0495651_0133537 | |||
| 1515 | Ga0495653_0017840 | |||
| 1516 | Ga0495653_0054434 | |||
| 1517 | Ga0495653_0059598 | |||
| 1518 | Ga0495653_0124216 | |||
| 1519 | Ga0495653_0705547 | |||
| 1520 | Ga0495580_0037328 | |||
| 1521 | Ga0495580_0181927 | |||
| 1522 | Ga0495580_0289335 | |||
| 1523 | Ga0495582_0015087 | |||
| 1524 | Ga0495582_0518882 | |||
| 1525 | Ga0495639_0001512 | |||
| 1526 | Ga0495639_0161666 | |||
| 1527 | Ga0495662_0002779 | |||
| 1528 | Ga0495662_0067629 | |||
| 1529 | Ga0495662_0078218 | |||
| 1530 | Ga0495662_0373344 | |||
| 1531 | Ga0495664_0009440 | |||
| 1532 | Ga0495664_0015506 | |||
| 1533 | Ga0495664_0021197 | |||
| 1534 | Ga0495664_0046686 | |||
| 1535 | Ga0495664_0060513 | |||
| 1536 | Ga0495664_0061523 | |||
| 1537 | Ga0495664_0301314 | |||
| 1538 | Ga0495594_0023662 | |||
| 1539 | Ga0495594_0324647 | |||
| 1540 | Ga0495608_0000768 | |||
| 1541 | Ga0495608_0007038 | |||
| 1542 | Ga0495608_0013168 | |||
| 1543 | Ga0495608_0035089 | |||
| 1544 | Ga0495608_0055275 | |||
| 1545 | Ga0495608_0061227 | |||
| 1546 | Ga0495618_0088306 | |||
| 1547 | Ga0495618_0175332 | |||
| 1548 | Ga0495628_0000180 | |||
| 1549 | Ga0495628_0094660 | |||
| 1550 | Ga0495628_0097020 | |||
| 1551 | Ga0495628_0128659 | |||
| 1552 | Ga0495628_0186993 | |||
| 1553 | Ga0495628_0401788 | |||
| 1554 | Ga0495628_0738907 | |||
| 1555 | Ga0495630_0051873 | |||
| 1556 | Ga0495630_0093518 | |||
| 1557 | Ga0495630_0105463 | |||
| 1558 | Ga0495630_0148136 | |||
| 1559 | Ga0495630_0967375 | |||
| 1560 | Ga0495630_1014960 | |||
| 1561 | Ga0495630_1085832 | |||
| 1562 | Ga0495666_0022116 | |||
| 1563 | Ga0495666_0024178 | |||
| 1564 | Ga0495652_0001434 | |||
| 1565 | Ga0495652_0024252 | |||
| 1566 | Ga0495652_0082674 | |||
| 1567 | Ga0495652_0113027 | |||
| 1568 | Ga0495652_0157731 | |||
| 1569 | Ga0495652_0170963 | |||
| 1570 | Ga0495652_0366278 | |||
| 1571 | Ga0495652_0366411 | |||
| 1572 | Ga0495652_0372268 | |||
| 1573 | Ga0495652_0830437 | |||
| 1574 | Ga0495665_0001185 | |||
| 1575 | Ga0495665_0005270 | |||
| 1576 | Ga0495665_0036087 | |||
| 1577 | Ga0495640_0004684 | |||
| 1578 | Ga0495640_0011711 | |||
| 1579 | Ga0495640_0019823 | |||
| 1580 | Ga0495640_0024262 | |||
| 1581 | Ga0495640_0173322 | |||
| 1582 | Ga0495586_0014439 | |||
| 1583 | Ga0495586_0016622 | |||
| 1584 | Ga0495586_0109132 | |||
| 1585 | Ga0495586_0673334 | |||
| 1586 | Ga0495587_0000141 | |||
| 1587 | Ga0495587_0002857 | |||
| 1588 | Ga0495587_0015327 | |||
| 1589 | Ga0495587_0017009 | |||
| 1590 | Ga0495587_0069948 | |||
| 1591 | Ga0495587_0330079 | |||
| 1592 | Ga0495645_0047134 | |||
| 1593 | Ga0495645_0057412 | |||
| 1594 | Ga0495645_0064711 | |||
| 1595 | Ga0495645_0076700 | |||
| 1596 | Ga0495645_0105403 | |||
| 1597 | Ga0495645_0212532 | |||
| 1598 | Ga0495622_0422911 | |||
| 1599 | Ga0495667_0000131 | |||
| 1600 | Ga0495667_0008052 | |||
| 1601 | Ga0495667_0009309 | |||
| 1602 | Ga0495667_0010184 | |||
| 1603 | Ga0495667_0013033 | |||
| 1604 | Ga0495667_0078624 | |||
| 1605 | Ga0495634_0009569 | |||
| 1606 | Ga0495634_0025645 | |||
| 1607 | Ga0495634_0053469 | |||
| 1608 | Ga0495634_0060339 | |||
| 1609 | Ga0495634_0184054 | |||
| 1610 | Ga0495634_0613036 | |||
| 1611 | Ga0495635_0136516 | |||
| 1612 | Ga0495635_0202146 | |||
| 1613 | Ga0495635_0228445 | |||
| 1614 | Ga0495635_0284916 | |||
| 1615 | Ga0495588_0040542 | |||
| 1616 | Ga0495588_0047251 | |||
| 1617 | Ga0495657_0000187 | |||
| 1618 | Ga0495657_0030248 | |||
| 1619 | Ga0495657_0044325 | |||
| 1620 | Ga0495657_0089699 | |||
| 1621 | Ga0495657_0105209 | |||
| 1622 | Ga0495657_0109830 | |||
| 1623 | Ga0495599_0000113 | |||
| 1624 | Ga0495599_0006846 | |||
| 1625 | Ga0495599_0007218 | |||
| 1626 | Ga0495599_0028547 | |||
| 1627 | Ga0495599_0059271 | |||
| 1628 | Ga0495599_0116883 | |||
| 1629 | Ga0495599_0166073 | |||
| 1630 | Ga0495599_0610650 | |||
| 1631 | Ga0495599_0632034 | |||
| 1632 | Ga0495623_0000726 | |||
| 1633 | Ga0495623_0011614 | |||
| 1634 | Ga0495623_0013773 | |||
| 1635 | Ga0495623_0079921 | |||
| 1636 | Ga0495646_0007607 | |||
| 1637 | Ga0495646_0015811 | |||
| 1638 | Ga0495646_0019233 | |||
| 1639 | Ga0495646_0035801 | |||
| 1640 | Ga0495646_0072555 | |||
| 1641 | Ga0495647_0100882 | |||
| 1642 | Ga0495658_0124385 | |||
| 1643 | Ga0495613_0006390 | |||
| 1644 | Ga0495613_0218806 | |||
| 1645 | Ga0495624_0006797 | |||
| 1646 | Ga0495624_0059447 | |||
| 1647 | Ga0495624_0141468 | |||
| 1648 | Ga0495624_0160442 | |||
| 1649 | Ga0495600_0003468 | |||
| 1650 | Ga0495600_0017104 | |||
| 1651 | Ga0495600_0019155 | |||
| 1652 | Ga0495600_0037425 | |||
| 1653 | Ga0495600_0095636 | |||
| 1654 | Ga0495600_0297842 | |||
| 1655 | Ga0495581_0025466 | |||
| 1656 | Ga0495581_0036508 | |||
| 1657 | Ga0495581_0037951 | |||
| 1658 | Ga0495604_0000209 | |||
| 1659 | Ga0495604_0023622 | |||
| 1660 | Ga0495604_0028254 | |||
| 1661 | Ga0495604_0038241 | |||
| 1662 | Ga0495604_0218474 | |||
| 1663 | Ga0495674_0018070 | |||
| 1664 | Ga0495674_0059781 | |||
| 1665 | Ga0495674_0073190 | |||
| 1666 | Ga0495674_0081518 | |||
| 1667 | Ga0495674_0447282 | |||
| 1668 | Ga0495676_0023945 | |||
| 1669 | Ga0495676_0081757 | |||
| 1670 | Ga0495680_0000323 | |||
| 1671 | Ga0495680_0011877 | |||
| 1672 | Ga0495680_0013486 | |||
| 1673 | Ga0495680_0014737 | |||
| 1674 | Ga0495680_0048019 | |||
| 1675 | Ga0495680_0110035 | |||
| 1676 | Ga0495675_0001015 | |||
| 1677 | Ga0495675_0027305 | |||
| 1678 | Ga0495675_0052747 | |||
| 1679 | Ga0495675_0083023 | |||
| 1680 | Ga0495675_0106622 | |||
| 1681 | Ga0495675_0195430 | |||
| 1682 | Ga0495684_0010593 | |||
| 1683 | Ga0495684_0030683 | |||
| 1684 | Ga0495684_0058664 | |||
| 1685 | Ga0495684_0066320 | |||
| 1686 | Ga0495684_0087559 | |||
| 1687 | Ga0495684_0345532 | |||
| 1688 | Ga0495593_0018712 | |||
| 1689 | Ga0495593_0277851 | |||
| 1690 | Ga0495602_0000201 | |||
| 1691 | Ga0495602_0062061 | |||
| 1692 | Ga0495602_0139877 | |||
| 1693 | Ga0495602_0139997 | |||
| 1694 | Ga0495602_0227471 | |||
| 1695 | Ga0495602_0259917 | |||
| 1696 | Ga0495614_0034143 | |||
| 1697 | Ga0495614_0129811 | |||
| 1698 | Ga0496100_0386908 | |||
| 1699 | Ga0496100_0732659 | |||
| 1700 | Ga0496101_0135489 | |||
| 1701 | Ga0496101_0385910 | |||
| 1702 | Ga0496102_0079539 | |||
| 1703 | Ga0496102_0605768 | |||
| 1704 | Ga0496103_0011000 | |||
| 1705 | Ga0496104_0000961 | |||
| 1706 | Ga0496104_0035449 | |||
| 1707 | Ga0496104_0738546 | |||
| 1708 | Ga0496105_0010278 | |||
| 1709 | Ga0496105_0161329 | |||
| 1710 | Ga0496106_0456457 | |||
| 1711 | Ga0496106_0856925 | |||
| 1712 | Ga0496107_0261575 | |||
| 1713 | Ga0496107_0345922 | |||
| 1714 | Ga0496108_0003044 | |||
| 1715 | Ga0496108_0118819 | |||
| 1716 | Ga0496108_0196060 | |||
| 1717 | Ga0496108_0281094 | |||
| 1718 | Ga0496108_0626083 | |||
| 1719 | Ga0496109_0007325 | |||
| 1720 | Ga0496109_0023704 | |||
| 1721 | Ga0496109_0312503 | |||
| 1722 | Ga0496110_0016527 | |||
| 1723 | Ga0496110_0488896 | |||
| 1724 | Ga0496110_0784962 | |||
| 1725 | Ga0496111_0060621 | |||
| 1726 | Ga0496111_1201029 | |||
| 1727 | Ga0496112_0015631 | |||
| 1728 | Ga0496112_0164656 | |||
| 1729 | Ga0496112_0535844 | |||
| 1730 | Ga0496113_0021000 | |||
| 1731 | Ga0496113_0026523 | |||
| 1732 | Ga0496113_0677961 | |||
| 1733 | Ga0496114_0499987 | |||
| 1734 | Ga0496115_0045544 | |||
| 1735 | Ga0496115_0066577 | |||
| 1736 | Ga0496115_0160288 | |||
| 1737 | Ga0496115_0410765 | |||
| 1738 | Ga0496119_0000290 | |||
| 1739 | Ga0496119_0393623 | |||
| 1740 | Ga0496120_0000103 | |||
| 1741 | Ga0496126_0010956 | |||
| 1742 | Ga0496126_0923062 | |||
| 1743 | Ga0496126_1064527 | |||
| 1744 | Ga0501031_0028296 | |||
| 1745 | Ga0501032_0038427 | |||
| 1746 | Ga0501034_1052079 | |||
| 1747 | Ga0501036_0042109 | |||
| 1748 | Ga0501038_0261972 | |||
| 1749 | Ga0501038_1160851 | |||
| 1750 | Ga0501039_0036007 | |||
| 1751 | Ga0501039_0048170 | |||
| 1752 | Ga0501039_0509534 | |||
| 1753 | Ga0501040_0002169 | |||
| 1754 | Ga0501040_0183974 | |||
| 1755 | Ga0501041_0016935 | |||
| 1756 | Ga0501042_0017357 | |||
| 1757 | Ga0501043_0513872 | |||
| 1758 | Ga0501046_0297644 | |||
| 1759 | Ga0501048_0020126 | |||
| 1760 | Ga0501048_1142092 | |||
| 1761 | Ga0501067_0040091 | |||
| 1762 | Ga0501067_0392385 | |||
| 1763 | Ga0501069_0135230 | |||
| 1764 | Ga0501069_0147852 | |||
| 1765 | Ga0501069_0311600 | |||
| 1766 | Ga0501069_0463813 | |||
| 1767 | Ga0501069_0780265 | |||
| 1768 | Ga0501070_0070615 | |||
| 1769 | Ga0501070_0091317 | |||
| 1770 | Ga0501070_0209423 | |||
| 1771 | Ga0501070_0754402 | |||
| 1772 | Ga0501070_0972190 | |||
| 1773 | Ga0501071_0031313 | |||
| 1774 | Ga0501071_0076414 | |||
| 1775 | Ga0501071_0967948 | |||
| 1776 | Ga0501071_1136735 | |||
| 1777 | Ga0501072_0018491 | |||
| 1778 | Ga0501072_0139902 | |||
| 1779 | Ga0501072_0313993 | |||
| 1780 | Ga0501072_0374950 | |||
| 1781 | Ga0501072_0384395 | |||
| 1782 | Ga0501074_0411358 | |||
| 1783 | Ga0501075_0017170 | |||
| 1784 | Ga0501075_0165675 | |||
| 1785 | Ga0501076_0006919 | |||
| 1786 | Ga0501076_0091215 | |||
| 1787 | Ga0501076_0183216 | |||
| 1788 | Ga0501077_0283075 | |||
| 1789 | Ga0501079_0003322 | |||
| 1790 | Ga0501079_1619641 | |||
| 1791 | Ga0501080_0104937 | |||
| 1792 | Ga0501081_0014169 | |||
| 1793 | Ga0501081_0519097 | |||
| 1794 | Ga0501035_0857363 | |||
| 1795 | Ga0501035_1284538 | |||
| 1796 | Ga0501044_1473629 | |||
| 1797 | Ga0501045_0002561 | |||
| 1798 | Ga0501045_0144267 | |||
| 1799 | nmdc:mga03683_52169_c1 | |||
| 1800 | nmdc:mga03n38_456175_c1 | |||
| 1801 | nmdc:mga03n38_605093_c1 | |||
| 1802 | nmdc:mga00v17_179305_c1 | |||
| 1803 | nmdc:mga00v17_189395_c1 | |||
| 1804 | nmdc:mga00v17_477469_c1 | |||
| 1805 | nmdc:mga00v17_531686_c1 | |||
| 1806 | nmdc:mga0yw44_1497_c1 | |||
| 1807 | nmdc:mga0yw44_283847_c1 | |||
| 1808 | nmdc:mga0yw44_32008_c1 | |||
| 1809 | nmdc:mga0yw44_451302_c1 | |||
| 1810 | nmdc:mga0yw44_62893_c1 | |||
| 1811 | nmdc:mga0yw44_683535_c1 | |||
| 1812 | nmdc:mga0yw44_708048_c1 | |||
| 1813 | nmdc:mga0yw44_82602_c1 | |||
| 1814 | nmdc:mga06z11_284109_c1 | |||
| 1815 | nmdc:mga06z11_356696_c1 | |||
| 1816 | nmdc:mga06z11_419735_c1 | |||
| 1817 | nmdc:mga06z11_466547_c1 | |||
| 1818 | nmdc:mga06z11_471486_c1 | |||
| 1819 | nmdc:mga06z11_713443_c1 | |||
| 1820 | nmdc:mga04h51_6174_c1 | |||
| 1821 | nmdc:mga07m45_479521_c1 | |||
| 1822 | nmdc:mga08y16_32073_c1 | |||
| 1823 | nmdc:mga08y16_6137_c1 | |||
| 1824 | nmdc:mga0n895_115659_c1 | |||
| 1825 | nmdc:mga0n895_1362160_c1 | |||
| 1826 | nmdc:mga0n895_277814_c1 | |||
| 1827 | nmdc:mga0n895_50960_c1 | |||
| 1828 | nmdc:mga0rr50_441980_c1 | |||
| 1829 | nmdc:mga0rr50_487829_c1 | |||
| 1830 | nmdc:mga0rr50_57369_c1 | |||
| 1831 | nmdc:mga0rr50_662474_c1 | |||
| 1832 | nmdc:mga0rr50_803_c1 | |||
| 1833 | nmdc:mga08x19_15786_c1 | |||
| 1834 | nmdc:mga08x19_617582_c1 | |||
| 1835 | nmdc:mga08x19_64773_c1 | |||
| 1836 | nmdc:mga0a205_4611_c1 | |||
| 1837 | Ga0495601_0034844 | |||
| 1838 | Ga0495601_0039047 | |||
| 1839 | Ga0495601_0056331 | |||
| 1840 | Ga0495601_0160864 | |||
| 1841 | Ga0495601_0336616 | |||
| 1842 | Ga0495601_0355238 | |||
| 1843 | Ga0495612_0000933 | |||
| 1844 | Ga0495612_0028588 | |||
| 1845 | Ga0495612_0030456 | |||
| 1846 | Ga0495612_0030911 | |||
| 1847 | Ga0495612_0121587 | |||
| 1848 | Ga0495595_0002531 | |||
| 1849 | Ga0495595_0010961 | |||
| 1850 | Ga0495595_0024834 | |||
| 1851 | Ga0495595_0108284 | |||
| 1852 | Ga0495619_0015950 | |||
| 1853 | Ga0495619_0232462 | |||
| 1854 | Ga0495619_0659537 | |||
| 1855 | Ga0495619_0688642 | |||
| 1856 | Ga0500573_0201175 | |||
| 1857 | Ga0501084_0128423 | |||
| 1858 | Ga0501084_0146514 | |||
| 1859 | Ga0501082_0766380 | |||
| 1860 | Ga0501082_0863505 | |||
| 1861 | Ga0466962_0108384 | |||
| 1862 | Ga0466962_0114873 | |||
| 1863 | Ga0530510_0340676 | |||
| 1864 | Ga0530510_0727008 | |||
| 1865 | 2643826461 | |||
| 1866 | 2644089421 | |||
| 1867 | 2644319266 | |||
| 1868 | 2738869479 | |||
| 1869 | 2808872310 | |||
| 1870 | 2812333220 | |||
| 1871 | 2856741982 | |||
| 1872 | 2873318144 | |||
| 1873 | 2891396381 | |||
| 1874 | 2891558361 | |||
| 1875 | 2891566475 | |||
| 1876 | 2895436661 | |||
| 1877 | 2919718195 | |||
| 1878 | 2984579352 | |||
| 1879 | 2990256963 | |||
| 1880 | 3003001319 | |||
| 1881 | 8053950365 | |||
| 1882 | 8054611156 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xbf-assembly1.cif.gz_C | x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum | 0.9056 | 2 | 133 |
| 1ve0-assembly1.cif.gz_A | crystal structure of uncharacterized protein st2072 from sulfolobus tokodaii | 0.8984 | 3 | 135 |
| 2p6c-assembly1.cif.gz_A | crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. | 0.8932 | 3 | 135 |
| 1vph-assembly2.cif.gz_E | crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution | 0.8921 | 2 | 135 |
| 1xbf-assembly1.cif.gz_C | x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum | 0.8914 | 2 | 133 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WFP9_1_132_2.60.120.460 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.927 | 1 | 134 | 2.60.120.460 |
| af_P9WFP9_1_132_2.60.120.460 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.9202 | 1 | 134 | 2.60.120.460 |
| 1ve0A00 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.8964 | 3 | 130 | 2.60.120.460 |
| 2p6cB00 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.8928 | 3 | 135 | 2.60.120.460 |
| 1vphC00 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.8912 | 3 | 135 | 2.60.120.460 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2H0P403-F1-model_v4 | Secondary thiamine-phosphate synthase enzyme | 0.9475 | 2 | 135 |
|
| AF-A0A5C8JLL2-F1-model_v4 | YjbQ family protein | 0.9374 | 1 | 135 |
|
| AF-A0A840PCT9-F1-model_v4 | Secondary thiamine-phosphate synthase enzyme | 0.9352 | 1 | 135 |
|
| AF-A0A2H0P403-F1-model_v4 | Secondary thiamine-phosphate synthase enzyme | 0.9341 | 2 | 135 |
|
| AF-A0A7J9ZLL6-F1-model_v4 | YjbQ family protein | 0.9338 | 1 | 135 |
|