F486334
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 941 | 612 | 666 | 287 |
Family's Representative Sequence
| Representative Sequence | 3300035725|Ga0373947_0018767|Ga0373947_0018767_706_1647 |
| Length | 313 |
| Sequence | VSHLWLSALVTSSGYTGARRTALHEAAMNILSIQSWVAYGHVGNASAVFPLQRLGAEVWSINTVQFSNHTGYGHWTGQVYTGDAVRDLVDGIAARDVLRHCDAVLSGYMGDAGIGEAILHAVTRVREENPRAIYCCDPVIGDTEEGVYVREGIEEFLRDHALPQADIATPNRFELERLTGLDCGTLTGAKDAVERLAATMRPDGLRCVLLTSLETELTPGDHMDLLVGEGGSFHLLRTPRLPVSVNGAGDAVAALFLFHRLDTGSAVKAMEAAGSAVHGLLRRTAEAGSREILTVAAQDEFVAPATRFVAHPC |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 3 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 4 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 5 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 6 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 7 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 8 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 9 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 10 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 11 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 12 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 13 | 2524614857 | Deinococcus ficus DSM 19119 | Isolate | Rhizosphere |
| 14 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 15 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 16 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 17 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 18 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 19 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 20 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 21 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 22 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 23 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 24 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 25 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 26 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 27 | 2739367875 | Deinococcus ficus CC-FR2-10 | Isolate | Unclassified |
| 28 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 29 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 30 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 31 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 32 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 33 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 34 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 35 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 36 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 37 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 38 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 39 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 40 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 41 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 42 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 43 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 44 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 45 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 46 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 47 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 48 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 49 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 50 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 51 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 52 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 53 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 54 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 55 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 56 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 57 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 58 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 59 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 60 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 61 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 62 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 63 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 64 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 65 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 66 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 67 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 68 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 69 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 70 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 71 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 72 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 73 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 74 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 75 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 76 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 77 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 78 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 79 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 80 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 81 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 82 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 83 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 84 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 85 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 86 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 87 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 88 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 89 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 90 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 91 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 92 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 93 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 94 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 95 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 96 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 97 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 98 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 99 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 100 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 101 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 102 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 103 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 104 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 105 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 106 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 107 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 108 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 109 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 110 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 111 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 112 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 113 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 114 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 115 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 116 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 117 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 118 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 119 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 120 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 121 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 122 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 123 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 124 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 125 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 126 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 127 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 128 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 129 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 130 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 131 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 132 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 133 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 134 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 135 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 136 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 137 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 138 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 139 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 140 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 141 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 142 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 143 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 144 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 145 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 146 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 147 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 148 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 149 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 150 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 151 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 152 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 153 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 154 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 155 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 156 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 157 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 158 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 159 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 160 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 161 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 162 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 163 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 164 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 165 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 166 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 167 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 168 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 169 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 170 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 171 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 172 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 173 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 174 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 175 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 176 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 177 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 178 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 179 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 180 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 181 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 182 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 183 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 184 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 185 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 186 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 187 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 188 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 189 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 190 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 191 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 192 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 193 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 194 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 195 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 196 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 197 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 198 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 199 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 200 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 201 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 202 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 203 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 204 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 205 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 206 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 207 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 208 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 209 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 210 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 211 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 212 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 213 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 214 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 215 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 216 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 217 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 218 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 219 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 220 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 221 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 222 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 223 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 224 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 225 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 226 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 227 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 228 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 229 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 230 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 231 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 232 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 233 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 234 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 235 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 236 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 237 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 238 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 239 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 240 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 241 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 242 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 243 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 244 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 245 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 246 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 247 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 248 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 249 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 250 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 251 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 252 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 253 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 254 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 255 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 256 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 257 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 258 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 259 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 260 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 261 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 262 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 263 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 264 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 265 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 266 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 267 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 268 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 269 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 270 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 271 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 272 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 273 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 274 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 275 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 276 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 277 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 278 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 279 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 280 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 281 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 282 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 283 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 284 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 285 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 286 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 287 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 288 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 289 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 290 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 291 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 292 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 293 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 294 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 295 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 296 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 297 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 298 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 299 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 300 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 301 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 302 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 303 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 304 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 305 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 306 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 307 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 308 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 309 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 310 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 311 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 312 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 313 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 314 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 315 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 316 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 317 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 318 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 319 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 320 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 321 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 323 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 324 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 325 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 326 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 327 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 328 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 329 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 331 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 332 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 333 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 335 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 336 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 338 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 339 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 340 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 341 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 342 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 343 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 344 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 345 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 346 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 347 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 348 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 349 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 350 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 351 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 352 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 353 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 354 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 355 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 356 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 357 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 358 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 359 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 360 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 361 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 362 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 363 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 364 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 365 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 366 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 414 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 416 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 417 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 418 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 419 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 420 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 421 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 422 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 423 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 424 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 425 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 426 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 427 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 428 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 429 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 430 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 431 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 432 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 433 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 434 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 435 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 436 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 437 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 438 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 439 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 440 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 441 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 442 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 443 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 444 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 445 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 446 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 447 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 448 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 449 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 450 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 451 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 452 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 453 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 454 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 455 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 456 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 457 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 458 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 459 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 460 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 461 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 462 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 463 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 464 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 465 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 466 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 467 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 468 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 469 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 470 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 471 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 472 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 473 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 474 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 475 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 476 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 477 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 478 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 479 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 480 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 481 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 522 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 523 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 524 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 525 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 526 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 527 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 528 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 529 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 530 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 531 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 532 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 533 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 534 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 535 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 536 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 537 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 538 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 539 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 540 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 541 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 542 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 543 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 544 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 545 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 546 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 547 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 548 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 549 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 550 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 551 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 552 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 553 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 554 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 555 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 556 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 557 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 558 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 559 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 560 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 561 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 562 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 563 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 564 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 565 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 566 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 567 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 568 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 569 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 570 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 571 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 572 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 573 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 574 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 575 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 576 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 577 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 578 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 579 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 580 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 581 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 582 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 587 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 588 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 589 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 590 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 591 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 592 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 593 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 594 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 595 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 596 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 597 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 598 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 599 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 600 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 601 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 602 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 603 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 604 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 605 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 606 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 607 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 608 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 609 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 610 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 611 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 612 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 70.46 |
| Metatranscriptomes | 0.32 |
| Isolates | 29.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.14 |
| Nodule | 24.44 |
| Rhizoplane | 5.31 |
| Rhizosphere | 59.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000109 | 3300003203 | Bacteria | 36339 |
| 2 | JGI25404J52841_10000082 | 3300003659 | Bacteria | 8763 |
| 3 | Ga0070658_10056505 | 3300005327 | Bacteria | 3190 |
| 4 | Ga0070683_100069233 | 3300005329 | Bacteria | 3289 |
| 5 | Ga0070683_100163430 | 3300005329 | Bacteria | 2112 |
| 6 | Ga0070683_100182341 | 3300005329 | Bacteria | 1993 |
| 7 | Ga0070690_100036374 | 3300005330 | Bacteria | 3094 |
| 8 | Ga0070670_100050719 | 3300005331 | Bacteria | 3565 |
| 9 | Ga0070666_10006286 | 3300005335 | Bacteria | 7304 |
| 10 | Ga0070666_10014730 | 3300005335 | Bacteria | 4981 |
| 11 | Ga0070680_100159738 | 3300005336 | Bacteria | 1894 |
| 12 | Ga0070680_100365256 | 3300005336 | Bacteria | 1228 |
| 13 | Ga0070682_100263438 | 3300005337 | Bacteria | 1248 |
| 14 | Ga0068868_100013509 | 3300005338 | Bacteria | 5988 |
| 15 | Ga0070660_100213575 | 3300005339 | Bacteria | 1567 |
| 16 | Ga0070687_100085215 | 3300005343 | Bacteria | 1734 |
| 17 | Ga0070661_100022274 | 3300005344 | Bacteria | 4536 |
| 18 | Ga0070692_10257612 | 3300005345 | Bacteria | 1047 |
| 19 | Ga0070668_100200150 | 3300005347 | Bacteria | 1639 |
| 20 | Ga0070668_100325935 | 3300005347 | Bacteria | 1294 |
| 21 | Ga0070669_100164922 | 3300005353 | Bacteria | 1724 |
| 22 | Ga0070675_100278038 | 3300005354 | Bacteria | 1470 |
| 23 | Ga0070671_100097885 | 3300005355 | Bacteria | 2460 |
| 24 | Ga0070673_100041471 | 3300005364 | Bacteria | 3540 |
| 25 | Ga0070688_100007241 | 3300005365 | Bacteria | 5976 |
| 26 | Ga0070659_100086396 | 3300005366 | Bacteria | 2510 |
| 27 | Ga0070667_100032087 | 3300005367 | Bacteria | 4380 |
| 28 | Ga0070667_100060010 | 3300005367 | Bacteria | 3219 |
| 29 | Ga0070709_10010315 | 3300005434 | Bacteria | 5168 |
| 30 | Ga0070709_10021445 | 3300005434 | Bacteria | 3762 |
| 31 | Ga0070714_100085603 | 3300005435 | Bacteria | 2753 |
| 32 | Ga0070714_100445834 | 3300005435 | Bacteria | 1229 |
| 33 | Ga0070714_100687792 | 3300005435 | Bacteria | 986 |
| 34 | Ga0070713_100016764 | 3300005436 | Bacteria | 5516 |
| 35 | Ga0070713_100022844 | 3300005436 | Bacteria | 4841 |
| 36 | Ga0070713_100119143 | 3300005436 | Bacteria | 2312 |
| 37 | Ga0070710_10002270 | 3300005437 | Bacteria | 9092 |
| 38 | Ga0070710_10009019 | 3300005437 | Bacteria | 4875 |
| 39 | Ga0070710_10067927 | 3300005437 | Bacteria | 2047 |
| 40 | Ga0070701_10113335 | 3300005438 | Bacteria | 1518 |
| 41 | Ga0070701_10127453 | 3300005438 | Bacteria | 1442 |
| 42 | Ga0070711_100016805 | 3300005439 | Bacteria | 4651 |
| 43 | Ga0070711_100047333 | 3300005439 | Bacteria | 2935 |
| 44 | Ga0070663_100624251 | 3300005455 | Bacteria | 909 |
| 45 | Ga0070678_100004557 | 3300005456 | Bacteria | 7865 |
| 46 | Ga0070678_100033282 | 3300005456 | Bacteria | 3577 |
| 47 | Ga0070662_100313836 | 3300005457 | Bacteria | 1277 |
| 48 | Ga0070681_10058748 | 3300005458 | Bacteria | 3826 |
| 49 | Ga0070685_10006589 | 3300005466 | Bacteria | 5924 |
| 50 | Ga0070679_100002598 | 3300005530 | Bacteria | 16417 |
| 51 | Ga0070679_100079164 | 3300005530 | Bacteria | 3276 |
| 52 | Ga0070679_100163069 | 3300005530 | Bacteria | 2203 |
| 53 | Ga0070679_100510759 | 3300005530 | Bacteria | 1146 |
| 54 | Ga0070684_100529592 | 3300005535 | Bacteria | 1092 |
| 55 | Ga0070672_100376566 | 3300005543 | Bacteria | 1214 |
| 56 | Ga0070672_100389092 | 3300005543 | Bacteria | 1194 |
| 57 | Ga0070686_100003427 | 3300005544 | Bacteria | 8705 |
| 58 | Ga0070695_100099238 | 3300005545 | Bacteria | 1958 |
| 59 | Ga0070693_100006523 | 3300005547 | Bacteria | 5659 |
| 60 | Ga0070665_100014656 | 3300005548 | Bacteria | 7868 |
| 61 | Ga0070665_100065860 | 3300005548 | Bacteria | 3634 |
| 62 | Ga0070665_100189359 | 3300005548 | Bacteria | 2058 |
| 63 | Ga0068855_100099540 | 3300005563 | Bacteria | 3348 |
| 64 | Ga0070664_100221706 | 3300005564 | Bacteria | 1692 |
| 65 | Ga0068857_100454614 | 3300005577 | Bacteria | 1198 |
| 66 | Ga0068856_100201818 | 3300005614 | Bacteria | 2003 |
| 67 | Ga0068852_100335647 | 3300005616 | Bacteria | 1472 |
| 68 | Ga0068859_100080273 | 3300005617 | Bacteria | 3303 |
| 69 | Ga0068864_100009012 | 3300005618 | Bacteria | 8227 |
| 70 | Ga0068866_10011785 | 3300005718 | Bacteria | 3793 |
| 71 | Ga0068866_10091414 | 3300005718 | Bacteria | 1658 |
| 72 | Ga0068861_100185416 | 3300005719 | Bacteria | 1735 |
| 73 | Ga0068863_100078487 | 3300005841 | Bacteria | 3126 |
| 74 | Ga0068858_100033296 | 3300005842 | Bacteria | 4784 |
| 75 | Ga0068858_100271812 | 3300005842 | Bacteria | 1613 |
| 76 | Ga0081455_10002387 | 3300005937 | Bacteria | 22423 |
| 77 | Ga0081455_10002827 | 3300005937 | Bacteria | 20442 |
| 78 | Ga0081455_10051220 | 3300005937 | Bacteria | 3542 |
| 79 | Ga0081538_10059592 | 3300005981 | Bacteria | 2203 |
| 80 | Ga0081540_1015854 | 3300005983 | Bacteria | 4749 |
| 81 | Ga0081540_1087122 | 3300005983 | Bacteria | 1385 |
| 82 | Ga0081539_10001010 | 3300005985 | Bacteria | 51943 |
| 83 | Ga0081539_10001777 | 3300005985 | Bacteria | 34287 |
| 84 | Ga0070717_10000870 | 3300006028 | Bacteria | 19960 |
| 85 | Ga0070717_10291515 | 3300006028 | Bacteria | 1449 |
| 86 | Ga0075365_10006435 | 3300006038 | Bacteria | 6464 |
| 87 | Ga0075365_10092287 | 3300006038 | Bacteria | 2064 |
| 88 | Ga0075365_10160544 | 3300006038 | Bacteria | 1566 |
| 89 | Ga0075368_10039114 | 3300006042 | Bacteria | 1858 |
| 90 | Ga0075363_100005578 | 3300006048 | Bacteria | 5615 |
| 91 | Ga0075363_100013754 | 3300006048 | Bacteria | 3936 |
| 92 | Ga0075363_100117986 | 3300006048 | Bacteria | 1480 |
| 93 | Ga0075364_10005368 | 3300006051 | Bacteria | 7443 |
| 94 | Ga0075364_10043125 | 3300006051 | Bacteria | 2932 |
| 95 | Ga0070715_10004329 | 3300006163 | Bacteria | 4640 |
| 96 | Ga0070716_100000405 | 3300006173 | Bacteria | 17764 |
| 97 | Ga0070712_100006107 | 3300006175 | Bacteria | 7457 |
| 98 | Ga0070712_100054743 | 3300006175 | Bacteria | 2790 |
| 99 | Ga0070712_100323869 | 3300006175 | Bacteria | 1254 |
| 100 | Ga0070712_100453504 | 3300006175 | Bacteria | 1068 |
| 101 | Ga0075362_10017365 | 3300006177 | Bacteria | 2964 |
| 102 | Ga0075362_10089358 | 3300006177 | Bacteria | 1428 |
| 103 | Ga0075367_10002138 | 3300006178 | Bacteria | 8895 |
| 104 | Ga0075367_10023750 | 3300006178 | Bacteria | 3453 |
| 105 | Ga0075369_10016092 | 3300006186 | Bacteria | 3011 |
| 106 | Ga0075369_10120529 | 3300006186 | Bacteria | 1187 |
| 107 | Ga0097621_100012752 | 3300006237 | Bacteria | 6245 |
| 108 | Ga0075370_10041958 | 3300006353 | Bacteria | 2583 |
| 109 | Ga0068871_100005825 | 3300006358 | Bacteria | 8660 |
| 110 | Ga0075428_100174181 | 3300006844 | Bacteria | 2331 |
| 111 | Ga0075428_100289642 | 3300006844 | Bacteria | 1761 |
| 112 | Ga0075431_100241413 | 3300006847 | Bacteria | 1838 |
| 113 | Ga0075433_10054160 | 3300006852 | Bacteria | 3499 |
| 114 | Ga0075433_10065447 | 3300006852 | Bacteria | 3188 |
| 115 | Ga0075434_100065236 | 3300006871 | Bacteria | 3626 |
| 116 | Ga0075436_100008760 | 3300006914 | Bacteria | 6918 |
| 117 | Ga0075436_100049534 | 3300006914 | Bacteria | 2899 |
| 118 | Ga0097620_100080265 | 3300006931 | Bacteria | 3303 |
| 119 | Ga0075435_100101881 | 3300007076 | Bacteria | 2379 |
| 120 | Ga0105251_10025457 | 3300009011 | Bacteria | 3026 |
| 121 | Ga0105240_10026513 | 3300009093 | Bacteria | 7604 |
| 122 | Ga0105240_10041350 | 3300009093 | Bacteria | 5884 |
| 123 | Ga0111539_10351140 | 3300009094 | Bacteria | 1716 |
| 124 | Ga0105245_10030429 | 3300009098 | Bacteria | 4773 |
| 125 | Ga0105245_10070476 | 3300009098 | Bacteria | 3172 |
| 126 | Ga0105245_10185072 | 3300009098 | Bacteria | 1992 |
| 127 | Ga0105245_10759657 | 3300009098 | Bacteria | 1006 |
| 128 | Ga0105247_10066254 | 3300009101 | Bacteria | 2248 |
| 129 | Ga0114129_10604466 | 3300009147 | Bacteria | 1420 |
| 130 | Ga0105243_10030161 | 3300009148 | Bacteria | 4174 |
| 131 | Ga0105241_10005705 | 3300009174 | Bacteria | 9189 |
| 132 | Ga0105241_10079582 | 3300009174 | Bacteria | 2563 |
| 133 | Ga0105242_10061684 | 3300009176 | Bacteria | 3084 |
| 134 | Ga0105248_10134950 | 3300009177 | Bacteria | 2784 |
| 135 | Ga0105237_10068044 | 3300009545 | Bacteria | 3555 |
| 136 | Ga0105237_10112538 | 3300009545 | Bacteria | 2714 |
| 137 | Ga0105238_10005562 | 3300009551 | Bacteria | 12449 |
| 138 | Ga0105238_10015166 | 3300009551 | Bacteria | 7802 |
| 139 | Ga0105249_10154668 | 3300009553 | Bacteria | 2211 |
| 140 | Ga0105249_10236978 | 3300009553 | Bacteria | 1802 |
| 141 | Ga0105239_10022803 | 3300010375 | Bacteria | 6901 |
| 142 | Ga0105239_10030197 | 3300010375 | Bacteria | 5959 |
| 143 | Ga0105239_10061573 | 3300010375 | Bacteria | 4119 |
| 144 | Ga0105239_10201567 | 3300010375 | Bacteria | 2229 |
| 145 | Ga0105239_10246944 | 3300010375 | Bacteria | 2004 |
| 146 | Ga0105246_10006169 | 3300011119 | Bacteria | 7315 |
| 147 | Ga0105246_10164679 | 3300011119 | Bacteria | 1692 |
| 148 | Ga0105246_10218187 | 3300011119 | Bacteria | 1493 |
| 149 | Ga0157316_1003708 | 3300012510 | Bacteria | 1118 |
| 150 | Ga0157370_10012471 | 3300013104 | Bacteria | 8809 |
| 151 | Ga0157369_10087271 | 3300013105 | Bacteria | 3331 |
| 152 | Ga0157374_10045210 | 3300013296 | Bacteria | 4075 |
| 153 | Ga0163162_10089104 | 3300013306 | Bacteria | 3166 |
| 154 | Ga0163162_10443199 | 3300013306 | Bacteria | 1431 |
| 155 | Ga0157372_10263811 | 3300013307 | Bacteria | 2000 |
| 156 | Ga0157372_10754354 | 3300013307 | Bacteria | 1131 |
| 157 | Ga0157375_10177508 | 3300013308 | Bacteria | 2280 |
| 158 | Ga0163163_10030377 | 3300014325 | Bacteria | 5206 |
| 159 | Ga0163163_10066561 | 3300014325 | Bacteria | 3579 |
| 160 | Ga0163163_10078997 | 3300014325 | Bacteria | 3288 |
| 161 | Ga0182008_10072215 | 3300014497 | Bacteria | 1698 |
| 162 | Ga0157377_10109951 | 3300014745 | Bacteria | 1655 |
| 163 | Ga0157379_10124798 | 3300014968 | Bacteria | 2316 |
| 164 | Ga0157376_10104693 | 3300014969 | Bacteria | 2480 |
| 165 | Ga0182006_1027380 | 3300015261 | Bacteria | 2327 |
| 166 | Ga0206356_11202692 | 3300020070 | Bacteria | 1320 |
| 167 | Ga0206353_10492257 | 3300020082 | Bacteria | 2718 |
| 168 | Ga0206353_11116635 | 3300020082 | Bacteria | 2996 |
| 169 | Ga0213875_10001607 | 3300021388 | Bacteria | 14297 |
| 170 | Ga0213875_10012138 | 3300021388 | Bacteria | 4261 |
| 171 | Ga0213875_10079050 | 3300021388 | Bacteria | 1534 |
| 172 | Ga0213871_10026807 | 3300021441 | Bacteria | 1477 |
| 173 | Ga0209026_1000032 | 3300025250 | Bacteria | 322378 |
| 174 | Ga0209759_1000142 | 3300025256 | Bacteria | 124090 |
| 175 | Ga0209233_1000030 | 3300025261 | Bacteria | 636702 |
| 176 | Ga0209233_1009633 | 3300025261 | Bacteria | 2933 |
| 177 | Ga0207713_1014372 | 3300025735 | Bacteria | 4118 |
| 178 | Ga0207692_10005119 | 3300025898 | Bacteria | 5231 |
| 179 | Ga0207692_10007113 | 3300025898 | Bacteria | 4573 |
| 180 | Ga0207692_10010180 | 3300025898 | Bacteria | 3955 |
| 181 | Ga0207692_10053560 | 3300025898 | Bacteria | 2056 |
| 182 | Ga0207710_10001149 | 3300025900 | Bacteria | 13486 |
| 183 | Ga0207647_10005873 | 3300025904 | Bacteria | 8946 |
| 184 | Ga0207685_10004995 | 3300025905 | Bacteria | 3446 |
| 185 | Ga0207699_10001920 | 3300025906 | Bacteria | 9798 |
| 186 | Ga0207699_10374379 | 3300025906 | Bacteria | 1009 |
| 187 | Ga0207645_10037731 | 3300025907 | Bacteria | 3100 |
| 188 | Ga0207705_10018366 | 3300025909 | Bacteria | 5001 |
| 189 | Ga0207654_10077909 | 3300025911 | Bacteria | 1988 |
| 190 | Ga0207707_10094608 | 3300025912 | Bacteria | 2611 |
| 191 | Ga0207707_10413448 | 3300025912 | Bacteria | 1157 |
| 192 | Ga0207695_10026753 | 3300025913 | Bacteria | 6433 |
| 193 | Ga0207671_10288687 | 3300025914 | Bacteria | 1295 |
| 194 | Ga0207693_10004498 | 3300025915 | Bacteria | 11795 |
| 195 | Ga0207693_10006034 | 3300025915 | Bacteria | 10045 |
| 196 | Ga0207693_10009769 | 3300025915 | Bacteria | 7810 |
| 197 | Ga0207663_10026882 | 3300025916 | Bacteria | 3345 |
| 198 | Ga0207663_10228336 | 3300025916 | Bacteria | 1358 |
| 199 | Ga0207660_10129825 | 3300025917 | Bacteria | 1917 |
| 200 | Ga0207662_10149627 | 3300025918 | Bacteria | 1484 |
| 201 | Ga0207657_10034662 | 3300025919 | Bacteria | 4536 |
| 202 | Ga0207657_10054719 | 3300025919 | Bacteria | 3449 |
| 203 | Ga0207694_10008304 | 3300025924 | Bacteria | 7849 |
| 204 | Ga0207650_10004278 | 3300025925 | Bacteria | 9744 |
| 205 | Ga0207687_10008663 | 3300025927 | Bacteria | 6648 |
| 206 | Ga0207700_10000884 | 3300025928 | Bacteria | 17256 |
| 207 | Ga0207700_10063123 | 3300025928 | Bacteria | 2816 |
| 208 | Ga0207664_10028839 | 3300025929 | Bacteria | 4221 |
| 209 | Ga0207664_10396407 | 3300025929 | Bacteria | 1227 |
| 210 | Ga0207644_10011873 | 3300025931 | Bacteria | 5772 |
| 211 | Ga0207644_10056747 | 3300025931 | Bacteria | 2826 |
| 212 | Ga0207706_10043327 | 3300025933 | Bacteria | 3988 |
| 213 | Ga0207706_10054929 | 3300025933 | Bacteria | 3514 |
| 214 | Ga0207709_10025546 | 3300025935 | Bacteria | 3383 |
| 215 | Ga0207670_10006927 | 3300025936 | Bacteria | 6309 |
| 216 | Ga0207669_10025973 | 3300025937 | Bacteria | 3177 |
| 217 | Ga0207704_10092321 | 3300025938 | Bacteria | 1992 |
| 218 | Ga0207665_10000996 | 3300025939 | Bacteria | 19123 |
| 219 | Ga0207691_10475398 | 3300025940 | Bacteria | 1062 |
| 220 | Ga0207711_10027773 | 3300025941 | Bacteria | 4756 |
| 221 | Ga0207667_10063594 | 3300025949 | Bacteria | 3856 |
| 222 | Ga0207651_10020536 | 3300025960 | Bacteria | 3989 |
| 223 | Ga0207712_10049036 | 3300025961 | Bacteria | 2940 |
| 224 | Ga0207712_10309000 | 3300025961 | Bacteria | 1300 |
| 225 | Ga0207658_10009968 | 3300025986 | Bacteria | 6457 |
| 226 | Ga0207703_10079032 | 3300026035 | Bacteria | 2735 |
| 227 | Ga0207639_10282780 | 3300026041 | Bacteria | 1460 |
| 228 | Ga0207678_10016681 | 3300026067 | Bacteria | 6450 |
| 229 | Ga0207678_10112700 | 3300026067 | Bacteria | 2320 |
| 230 | Ga0207678_10413604 | 3300026067 | Bacteria | 1169 |
| 231 | Ga0207702_10220404 | 3300026078 | Bacteria | 1768 |
| 232 | Ga0207702_10268115 | 3300026078 | Bacteria | 1610 |
| 233 | Ga0207641_10012369 | 3300026088 | Bacteria | 7001 |
| 234 | Ga0207648_10483688 | 3300026089 | Bacteria | 1131 |
| 235 | Ga0207676_10008443 | 3300026095 | Bacteria | 7323 |
| 236 | Ga0207674_10275389 | 3300026116 | Bacteria | 1631 |
| 237 | Ga0207675_100016232 | 3300026118 | Bacteria | 6951 |
| 238 | Ga0207675_100177464 | 3300026118 | Bacteria | 2038 |
| 239 | Ga0207675_100235960 | 3300026118 | Bacteria | 1766 |
| 240 | Ga0207683_10003153 | 3300026121 | Bacteria | 14397 |
| 241 | Ga0207683_10056939 | 3300026121 | Bacteria | 3430 |
| 242 | Ga0207698_10058439 | 3300026142 | Bacteria | 2989 |
| 243 | Ga0207698_10090301 | 3300026142 | Bacteria | 2505 |
| 244 | Ga0268266_10003978 | 3300028379 | Bacteria | 14334 |
| 245 | Ga0268266_10019048 | 3300028379 | Bacteria | 5846 |
| 246 | Ga0268266_10131554 | 3300028379 | Bacteria | 2238 |
| 247 | Ga0268266_10152584 | 3300028379 | Bacteria | 2084 |
| 248 | Ga0268265_10035234 | 3300028380 | Bacteria | 3655 |
| 249 | Ga0268265_10586000 | 3300028380 | Bacteria | 1064 |
| 250 | Ga0268264_10016368 | 3300028381 | Bacteria | 6071 |
| 251 | Ga0265337_1001512 | 3300028556 | Bacteria | 11408 |
| 252 | Ga0265338_10018836 | 3300028800 | Bacteria | 7363 |
| 253 | Ga0265338_10030205 | 3300028800 | Bacteria | 5347 |
| 254 | Ga0265313_10007874 | 3300031595 | Bacteria | 7182 |
| 255 | Ga0307508_10085557 | 3300031616 | Bacteria | 2736 |
| 256 | Ga0316579_10024534 | 3300031691 | Bacteria | 2716 |
| 257 | Ga0265314_10071571 | 3300031711 | Bacteria | 2319 |
| 258 | Ga0265314_10108940 | 3300031711 | Bacteria | 1764 |
| 259 | Ga0307413_10013520 | 3300031824 | Bacteria | 4108 |
| 260 | Ga0307410_10379299 | 3300031852 | Bacteria | 1137 |
| 261 | Ga0307410_10396523 | 3300031852 | Bacteria | 1114 |
| 262 | Ga0307407_10304197 | 3300031903 | Bacteria | 1113 |
| 263 | Ga0307407_10427340 | 3300031903 | Bacteria | 956 |
| 264 | Ga0307412_10052877 | 3300031911 | Bacteria | 2691 |
| 265 | Ga0307409_100124461 | 3300031995 | Bacteria | 2190 |
| 266 | Ga0307409_100128668 | 3300031995 | Bacteria | 2159 |
| 267 | Ga0307409_100203465 | 3300031995 | Bacteria | 1773 |
| 268 | Ga0307416_100220795 | 3300032002 | Bacteria | 1817 |
| 269 | Ga0307416_101126389 | 3300032002 | Bacteria | 890 |
| 270 | Ga0307415_100094346 | 3300032126 | Bacteria | 2175 |
| 271 | Ga0307415_100096430 | 3300032126 | Bacteria | 2155 |
| 272 | Ga0307510_10113650 | 3300033180 | Bacteria | 2440 |
| 273 | Ga0373930_0009127 | 3300034816 | Bacteria | 1749 |
| 274 | Ga0373930_0021193 | 3300034816 | Bacteria | 1274 |
| 275 | Ga0373948_0022159 | 3300034817 | Bacteria | 1223 |
| 276 | Ga0373959_0025617 | 3300034820 | Bacteria | 1160 |
| 277 | Ga0373938_0029931 | 3300034957 | Bacteria | 1159 |
| 278 | Ga0373926_0071044 | 3300035083 | Bacteria | 1279 |
| 279 | Ga0373926_0133000 | 3300035083 | Bacteria | 942 |
| 280 | Ga0373928_0032971 | 3300035084 | Bacteria | 1157 |
| 281 | Ga0373940_0062743 | 3300035088 | Bacteria | 1067 |
| 282 | Ga0373944_0013917 | 3300035089 | Bacteria | 2239 |
| 283 | Ga0373944_0036829 | 3300035089 | Bacteria | 1496 |
| 284 | Ga0373949_0019193 | 3300035090 | Bacteria | 1555 |
| 285 | Ga0373951_0013595 | 3300035091 | Bacteria | 1829 |
| 286 | Ga0373952_0022384 | 3300035092 | Bacteria | 1342 |
| 287 | Ga0373923_0072157 | 3300035111 | Bacteria | 1484 |
| 288 | Ga0373932_0008124 | 3300035112 | Bacteria | 2505 |
| 289 | Ga0373936_0128024 | 3300035113 | Bacteria | 1089 |
| 290 | Ga0373939_0000595 | 3300035114 | Bacteria | 9020 |
| 291 | Ga0373939_0008360 | 3300035114 | Bacteria | 2536 |
| 292 | Ga0373941_0024519 | 3300035115 | Bacteria | 1733 |
| 293 | Ga0373954_0005645 | 3300035118 | Bacteria | 5420 |
| 294 | Ga0373954_0009134 | 3300035118 | Bacteria | 4362 |
| 295 | Ga0373954_0035220 | 3300035118 | Bacteria | 2321 |
| 296 | Ga0373956_0017690 | 3300035119 | Bacteria | 3010 |
| 297 | Ga0373957_0072477 | 3300035120 | Unclassified | 1349 |
| 298 | Ga0373957_0075762 | 3300035120 | Bacteria | 1322 |
| 299 | Ga0373943_0014695 | 3300035170 | Bacteria | 3550 |
| 300 | Ga0373943_0058322 | 3300035170 | Bacteria | 1921 |
| 301 | Ga0373943_0164217 | 3300035170 | Bacteria | 1211 |
| 302 | Ga0373955_0003027 | 3300035172 | Bacteria | 7369 |
| 303 | Ga0373955_0007627 | 3300035172 | Bacteria | 4985 |
| 304 | Ga0373955_0007756 | 3300035172 | Bacteria | 4946 |
| 305 | Ga0373924_0005315 | 3300035410 | Bacteria | 4554 |
| 306 | Ga0373924_0080189 | 3300035410 | Bacteria | 1387 |
| 307 | Ga0373931_0052368 | 3300035691 | Bacteria | 2176 |
| 308 | Ga0373931_0167389 | 3300035691 | Bacteria | 1292 |
| 309 | Ga0373935_0016511 | 3300035692 | Bacteria | 4466 |
| 310 | Ga0373935_0035975 | 3300035692 | Bacteria | 3093 |
| 311 | Ga0373935_0077427 | 3300035692 | Bacteria | 2155 |
| 312 | Ga0373935_0175544 | 3300035692 | Bacteria | 1468 |
| 313 | Ga0373935_0204050 | 3300035692 | Bacteria | 1367 |
| 314 | Ga0373927_0020566 | 3300035695 | Bacteria | 4328 |
| 315 | Ga0373927_0067623 | 3300035695 | Bacteria | 2312 |
| 316 | Ga0373933_0007683 | 3300035724 | Bacteria | 5888 |
| 317 | Ga0373933_0008207 | 3300035724 | Bacteria | 5701 |
| 318 | Ga0373933_0034906 | 3300035724 | Bacteria | 2934 |
| 319 | Ga0373933_0042484 | 3300035724 | Bacteria | 2687 |
| 320 | Ga0373933_0087061 | 3300035724 | Bacteria | 1923 |
| 321 | Ga0373947_0018767 | 3300035725 | Bacteria | 3983 |
| 322 | Ga0373947_0045098 | 3300035725 | Bacteria | 2638 |
| 323 | Ga0373947_0046308 | 3300035725 | Bacteria | 2604 |
| 324 | Ga0373937_0000824 | 3300036401 | Bacteria | 26565 |
| 325 | Ga0373937_0003327 | 3300036401 | Bacteria | 13492 |
| 326 | Ga0373937_0005428 | 3300036401 | Bacteria | 10911 |
| 327 | Ga0373937_0020693 | 3300036401 | Bacteria | 5901 |
| 328 | Ga0373937_0035947 | 3300036401 | Bacteria | 4512 |
| 329 | Ga0373937_0043962 | 3300036401 | Bacteria | 4079 |
| 330 | Ga0373937_0206769 | 3300036401 | Bacteria | 1846 |
| 331 | Ga0373937_0406378 | 3300036401 | Bacteria | 1292 |
| 332 | Ga0373937_0636318 | 3300036401 | Unclassified | 1012 |
| 333 | Ga0373925_0009860 | 3300037068 | Bacteria | 6939 |
| 334 | Ga0373925_0020221 | 3300037068 | Bacteria | 4844 |
| 335 | Ga0373925_0046337 | 3300037068 | Bacteria | 3233 |
| 336 | Ga0373925_0121310 | 3300037068 | Bacteria | 2029 |
| 337 | Ga0373925_0203128 | 3300037068 | Bacteria | 1576 |
| 338 | Ga0373925_0546680 | 3300037068 | Bacteria | 952 |
| 339 | Ga0395899_0000058 | 3300037312 | Bacteria | 213049 |
| 340 | Ga0395899_0002233 | 3300037312 | Bacteria | 15864 |
| 341 | Ga0395899_0078551 | 3300037312 | Bacteria | 2405 |
| 342 | Ga0395900_0001351 | 3300037418 | Bacteria | 29638 |
| 343 | Ga0395900_0043962 | 3300037418 | Bacteria | 4604 |
| 344 | Ga0395900_0144680 | 3300037418 | Bacteria | 2432 |
| 345 | Ga0395900_0228201 | 3300037418 | Bacteria | 1874 |
| 346 | Ga0395900_0258646 | 3300037418 | Bacteria | 1739 |
| 347 | Ga0395898_0014184 | 3300037466 | Bacteria | 8194 |
| 348 | Ga0395898_0016934 | 3300037466 | Bacteria | 7441 |
| 349 | Ga0395898_0021905 | 3300037466 | Bacteria | 6473 |
| 350 | Ga0395898_0038675 | 3300037466 | Bacteria | 4727 |
| 351 | Ga0395905_0263078 | 3300037471 | Bacteria | 1610 |
| 352 | Ga0395905_0459597 | 3300037471 | Bacteria | 1171 |
| 353 | Ga0436364_0127534 | 3300037853 | Bacteria | 4097 |
| 354 | Ga0436364_0335466 | 3300037853 | Bacteria | 1895 |
| 355 | Ga0436364_0341381 | 3300037853 | Bacteria | 15601 |
| 356 | Ga0436364_0534960 | 3300037853 | Bacteria | 1060 |
| 357 | Ga0436364_0716978 | 3300037853 | Bacteria | 4965 |
| 358 | Ga0436364_1095010 | 3300037853 | Bacteria | 1263 |
| 359 | Ga0436364_1179675 | 3300037853 | Bacteria | 7860 |
| 360 | Ga0436364_1505086 | 3300037853 | Bacteria | 23518 |
| 361 | Ga0436364_1513145 | 3300037853 | Bacteria | 16116 |
| 362 | Ga0395901_0013773 | 3300038443 | Bacteria | 8221 |
| 363 | Ga0395901_0015782 | 3300038443 | Bacteria | 7696 |
| 364 | Ga0395901_0044071 | 3300038443 | Bacteria | 4627 |
| 365 | Ga0395901_0131108 | 3300038443 | Bacteria | 2634 |
| 366 | Ga0436365_0209418 | 3300039437 | Bacteria | 1799 |
| 367 | Ga0436365_0686558 | 3300039437 | Bacteria | 2799 |
| 368 | Ga0436365_0696682 | 3300039437 | Bacteria | 2067 |
| 369 | Ga0436365_1151479 | 3300039437 | Bacteria | 9186 |
| 370 | Ga0436365_1658787 | 3300039437 | Bacteria | 3409 |
| 371 | Ga0436360_0023402 | 3300039438 | Bacteria | 3422 |
| 372 | Ga0436360_0314979 | 3300039438 | Bacteria | 1486 |
| 373 | Ga0436360_0394148 | 3300039438 | Bacteria | 6296 |
| 374 | Ga0436360_1044519 | 3300039438 | Bacteria | 2578 |
| 375 | Ga0436361_0582741 | 3300039447 | Bacteria | 1535 |
| 376 | Ga0436363_0329936 | 3300039450 | Bacteria | 1735 |
| 377 | Ga0436363_0678607 | 3300039450 | Bacteria | 1648 |
| 378 | Ga0436363_1347707 | 3300039450 | Bacteria | 1307 |
| 379 | Ga0436362_0749915 | 3300039453 | Bacteria | 1522 |
| 380 | Ga0436362_1078251 | 3300039453 | Bacteria | 3010 |
| 381 | Ga0466972_0030800 | 3300044658 | Bacteria | 2641 |
| 382 | Ga0466965_0112551 | 3300044683 | Bacteria | 1400 |
| 383 | Ga0466965_0133181 | 3300044683 | Bacteria | 1290 |
| 384 | Ga0466966_0048885 | 3300044684 | Bacteria | 2694 |
| 385 | Ga0466961_0069813 | 3300044693 | Bacteria | 2230 |
| 386 | Ga0466961_0177552 | 3300044693 | Bacteria | 1323 |
| 387 | Ga0466963_0151206 | 3300044694 | Bacteria | 1612 |
| 388 | Ga0466963_0232437 | 3300044694 | Bacteria | 1292 |
| 389 | Ga0466963_0272778 | 3300044694 | Bacteria | 1188 |
| 390 | Ga0466963_0319368 | 3300044694 | Bacteria | 1093 |
| 391 | Ga0466971_0052565 | 3300044719 | Bacteria | 1835 |
| 392 | Ga0466968_0042004 | 3300044735 | Bacteria | 1932 |
| 393 | Ga0466970_0211593 | 3300044765 | Bacteria | 1080 |
| 394 | Ga0466957_0301227 | 3300044842 | Bacteria | 1077 |
| 395 | Ga0466960_0065737 | 3300044901 | Bacteria | 1792 |
| 396 | Ga0466960_0066169 | 3300044901 | Bacteria | 1786 |
| 397 | Ga0466960_0067827 | 3300044901 | Bacteria | 1768 |
| 398 | Ga0466960_0302647 | 3300044901 | Bacteria | 901 |
| 399 | Ga0466959_0093137 | 3300045049 | Bacteria | 2162 |
| 400 | Ga0466959_0103152 | 3300045049 | Bacteria | 2041 |
| 401 | Ga0466959_0106141 | 3300045049 | Bacteria | 2008 |
| 402 | Ga0466967_0038125 | 3300045976 | Bacteria | 4119 |
| 403 | Ga0466967_0091230 | 3300045976 | Bacteria | 2768 |
| 404 | Ga0466967_0211600 | 3300045976 | Bacteria | 1839 |
| 405 | Ga0466967_0673365 | 3300045976 | Bacteria | 1024 |
| 406 | Ga0495592_0016974 | 3300046454 | Bacteria | 5526 |
| 407 | Ga0495592_0019964 | 3300046454 | Bacteria | 5094 |
| 408 | Ga0495592_0176742 | 3300046454 | Unclassified | 1457 |
| 409 | Ga0495592_0234065 | 3300046454 | Bacteria | 1222 |
| 410 | Ga0495603_0046352 | 3300046455 | Bacteria | 2591 |
| 411 | Ga0495629_0006816 | 3300046459 | Bacteria | 8445 |
| 412 | Ga0495638_0021151 | 3300046460 | Bacteria | 4291 |
| 413 | Ga0495641_0118462 | 3300046461 | Bacteria | 1181 |
| 414 | Ga0495651_0010286 | 3300046462 | Bacteria | 7188 |
| 415 | Ga0495651_0051025 | 3300046462 | Bacteria | 3191 |
| 416 | Ga0495651_0088366 | 3300046462 | Bacteria | 2329 |
| 417 | Ga0495653_0064776 | 3300046463 | Bacteria | 2753 |
| 418 | Ga0495653_0128709 | 3300046463 | Bacteria | 1795 |
| 419 | Ga0495580_0083844 | 3300046472 | Bacteria | 2220 |
| 420 | Ga0495639_0109221 | 3300046475 | Bacteria | 1311 |
| 421 | Ga0495664_0005387 | 3300046477 | Bacteria | 7023 |
| 422 | Ga0495664_0151921 | 3300046477 | Bacteria | 1404 |
| 423 | Ga0495664_0194775 | 3300046477 | Bacteria | 1228 |
| 424 | Ga0495594_0065426 | 3300046499 | Bacteria | 2016 |
| 425 | Ga0495606_0213347 | 3300046507 | Bacteria | 1092 |
| 426 | Ga0495608_0133658 | 3300046511 | Bacteria | 1586 |
| 427 | Ga0495608_0143047 | 3300046511 | Bacteria | 1526 |
| 428 | Ga0495608_0230235 | 3300046511 | Bacteria | 1160 |
| 429 | Ga0495628_0002495 | 3300046516 | Bacteria | 16570 |
| 430 | Ga0495628_0189170 | 3300046516 | Bacteria | 1555 |
| 431 | Ga0495643_0020016 | 3300046522 | Bacteria | 3865 |
| 432 | Ga0495640_0054279 | 3300046533 | Bacteria | 2745 |
| 433 | Ga0495640_0126671 | 3300046533 | Bacteria | 1656 |
| 434 | Ga0495587_0015685 | 3300046536 | Bacteria | 4726 |
| 435 | Ga0495587_0025425 | 3300046536 | Bacteria | 3618 |
| 436 | Ga0495587_0050288 | 3300046536 | Bacteria | 2466 |
| 437 | Ga0495645_0039395 | 3300046543 | Bacteria | 3446 |
| 438 | Ga0495667_0005423 | 3300046559 | Bacteria | 8621 |
| 439 | Ga0495667_0007799 | 3300046559 | Bacteria | 7249 |
| 440 | Ga0495667_0029059 | 3300046559 | Bacteria | 3721 |
| 441 | Ga0495667_0063057 | 3300046559 | Bacteria | 2427 |
| 442 | Ga0495667_0123470 | 3300046559 | Bacteria | 1671 |
| 443 | Ga0495667_0329835 | 3300046559 | Bacteria | 965 |
| 444 | Ga0495634_0055785 | 3300046642 | Bacteria | 2641 |
| 445 | Ga0495635_0013367 | 3300046663 | Bacteria | 5745 |
| 446 | Ga0495635_0014990 | 3300046663 | Bacteria | 5422 |
| 447 | Ga0495635_0117174 | 3300046663 | Bacteria | 1817 |
| 448 | Ga0495588_0301765 | 3300046674 | Bacteria | 843 |
| 449 | Ga0495657_0007004 | 3300046675 | Bacteria | 8746 |
| 450 | Ga0495657_0117051 | 3300046675 | Bacteria | 1682 |
| 451 | Ga0495657_0121432 | 3300046675 | Bacteria | 1645 |
| 452 | Ga0495599_0015899 | 3300046678 | Bacteria | 4670 |
| 453 | Ga0495599_0071204 | 3300046678 | Bacteria | 2170 |
| 454 | Ga0495623_0339024 | 3300046679 | Bacteria | 821 |
| 455 | Ga0495646_0007579 | 3300046680 | Bacteria | 6898 |
| 456 | Ga0495646_0205501 | 3300046680 | Bacteria | 1071 |
| 457 | Ga0495658_0000857 | 3300046683 | Bacteria | 16367 |
| 458 | Ga0495658_0182417 | 3300046683 | Bacteria | 1303 |
| 459 | Ga0495613_0005530 | 3300046689 | Bacteria | 9485 |
| 460 | Ga0495613_0199293 | 3300046689 | Bacteria | 1412 |
| 461 | Ga0495604_0007736 | 3300047317 | Bacteria | 8512 |
| 462 | Ga0495604_0029158 | 3300047317 | Bacteria | 4390 |
| 463 | Ga0495604_0052727 | 3300047317 | Bacteria | 3148 |
| 464 | Ga0495604_0064971 | 3300047317 | Bacteria | 2779 |
| 465 | Ga0495604_0196319 | 3300047317 | Bacteria | 1403 |
| 466 | Ga0495674_0042794 | 3300047319 | Bacteria | 4037 |
| 467 | Ga0495674_0116521 | 3300047319 | Bacteria | 2260 |
| 468 | Ga0495676_0062701 | 3300047321 | Bacteria | 2901 |
| 469 | Ga0495676_0082339 | 3300047321 | Bacteria | 2436 |
| 470 | Ga0495680_0007406 | 3300047322 | Bacteria | 10066 |
| 471 | Ga0495680_0019787 | 3300047322 | Bacteria | 5676 |
| 472 | Ga0495680_0155661 | 3300047322 | Bacteria | 1663 |
| 473 | Ga0495680_0164646 | 3300047322 | Bacteria | 1608 |
| 474 | Ga0495687_033246 | 3300047443 | Bacteria | 2342 |
| 475 | Ga0495675_0008439 | 3300047444 | Bacteria | 6383 |
| 476 | Ga0495679_094254 | 3300047446 | Bacteria | 837 |
| 477 | Ga0495684_0072882 | 3300047471 | Bacteria | 2609 |
| 478 | Ga0495684_0147958 | 3300047471 | Bacteria | 1758 |
| 479 | Ga0495684_0249205 | 3300047471 | Bacteria | 1293 |
| 480 | Ga0495684_0266262 | 3300047471 | Bacteria | 1241 |
| 481 | Ga0495593_0073081 | 3300047673 | Bacteria | 1779 |
| 482 | Ga0495602_0007703 | 3300048088 | Bacteria | 11258 |
| 483 | Ga0495602_0008247 | 3300048088 | Bacteria | 10879 |
| 484 | Ga0495602_0040749 | 3300048088 | Bacteria | 4253 |
| 485 | Ga0495602_0056229 | 3300048088 | Bacteria | 3461 |
| 486 | Ga0495614_0227468 | 3300048089 | Bacteria | 849 |
| 487 | Ga0495626_0146227 | 3300048091 | Bacteria | 999 |
| 488 | Ga0496100_0010727 | 3300048903 | Bacteria | 5195 |
| 489 | Ga0496100_0016956 | 3300048903 | Bacteria | 4287 |
| 490 | Ga0496101_0030950 | 3300048904 | Bacteria | 3757 |
| 491 | Ga0496102_0004469 | 3300048905 | Bacteria | 11799 |
| 492 | Ga0496102_0054690 | 3300048905 | Bacteria | 3640 |
| 493 | Ga0496102_0093976 | 3300048905 | Bacteria | 2778 |
| 494 | Ga0496102_0144634 | 3300048905 | Bacteria | 2231 |
| 495 | Ga0496102_0183389 | 3300048905 | Bacteria | 1972 |
| 496 | Ga0496102_0229204 | 3300048905 | Bacteria | 1751 |
| 497 | Ga0496102_0283571 | 3300048905 | Bacteria | 1561 |
| 498 | Ga0496102_0300223 | 3300048905 | Bacteria | 1513 |
| 499 | Ga0496103_0007284 | 3300048906 | Bacteria | 6593 |
| 500 | Ga0496103_0116220 | 3300048906 | Bacteria | 1702 |
| 501 | Ga0496104_0000055 | 3300048907 | Bacteria | 124267 |
| 502 | Ga0496104_0003540 | 3300048907 | Bacteria | 13466 |
| 503 | Ga0496104_0008257 | 3300048907 | Bacteria | 9245 |
| 504 | Ga0496104_0435682 | 3300048907 | Bacteria | 1223 |
| 505 | Ga0496105_0000797 | 3300048908 | Bacteria | 21298 |
| 506 | Ga0496105_0012262 | 3300048908 | Bacteria | 6786 |
| 507 | Ga0496105_0020421 | 3300048908 | Bacteria | 5352 |
| 508 | Ga0496105_0115646 | 3300048908 | Bacteria | 2212 |
| 509 | Ga0496107_0015062 | 3300048910 | Bacteria | 5417 |
| 510 | Ga0496107_0024577 | 3300048910 | Bacteria | 4262 |
| 511 | Ga0496108_0002024 | 3300048911 | Bacteria | 16234 |
| 512 | Ga0496108_0004408 | 3300048911 | Bacteria | 11325 |
| 513 | Ga0496108_0121897 | 3300048911 | Bacteria | 2237 |
| 514 | Ga0496109_0001887 | 3300048912 | Bacteria | 17391 |
| 515 | Ga0496109_0017110 | 3300048912 | Bacteria | 6346 |
| 516 | Ga0496109_0050361 | 3300048912 | Bacteria | 3793 |
| 517 | Ga0496109_0075889 | 3300048912 | Bacteria | 3090 |
| 518 | Ga0496110_0004828 | 3300048913 | Bacteria | 10504 |
| 519 | Ga0496110_0303778 | 3300048913 | Bacteria | 1453 |
| 520 | Ga0496110_0311797 | 3300048913 | Bacteria | 1433 |
| 521 | Ga0496111_0001458 | 3300048914 | Bacteria | 13525 |
| 522 | Ga0496111_0082817 | 3300048914 | Bacteria | 2343 |
| 523 | Ga0496111_0138127 | 3300048914 | Bacteria | 1806 |
| 524 | Ga0496112_0008278 | 3300048915 | Bacteria | 9305 |
| 525 | Ga0496112_0026418 | 3300048915 | Bacteria | 5586 |
| 526 | Ga0496112_0152710 | 3300048915 | Bacteria | 2276 |
| 527 | Ga0496113_0008064 | 3300048916 | Bacteria | 6834 |
| 528 | Ga0496113_0011316 | 3300048916 | Bacteria | 5946 |
| 529 | Ga0496113_0020314 | 3300048916 | Bacteria | 4667 |
| 530 | Ga0496113_0080341 | 3300048916 | Bacteria | 2498 |
| 531 | Ga0496114_0078664 | 3300048917 | Bacteria | 2782 |
| 532 | Ga0496114_0211875 | 3300048917 | Bacteria | 1699 |
| 533 | Ga0496115_0039056 | 3300048918 | Bacteria | 3769 |
| 534 | Ga0496115_0071180 | 3300048918 | Bacteria | 2820 |
| 535 | Ga0496115_0077469 | 3300048918 | Bacteria | 2703 |
| 536 | Ga0496115_0293493 | 3300048918 | Bacteria | 1333 |
| 537 | Ga0496117_0053718 | 3300048920 | Bacteria | 2829 |
| 538 | Ga0496119_0000344 | 3300048922 | Bacteria | 65097 |
| 539 | Ga0496119_0002572 | 3300048922 | Bacteria | 19717 |
| 540 | Ga0496121_0166975 | 3300048924 | Bacteria | 1603 |
| 541 | Ga0496122_0011879 | 3300048925 | Bacteria | 8749 |
| 542 | Ga0496123_0005458 | 3300048926 | Bacteria | 12799 |
| 543 | Ga0496124_0158266 | 3300048927 | Bacteria | 1769 |
| 544 | Ga0501031_0000166 | 3300049568 | Bacteria | 37199 |
| 545 | Ga0501031_0025653 | 3300049568 | Bacteria | 3844 |
| 546 | Ga0501031_0130464 | 3300049568 | Bacteria | 1642 |
| 547 | Ga0501031_0156460 | 3300049568 | Bacteria | 1490 |
| 548 | Ga0501032_0000384 | 3300049569 | Bacteria | 36492 |
| 549 | Ga0501032_0005222 | 3300049569 | Bacteria | 9665 |
| 550 | Ga0501033_0000511 | 3300049570 | Bacteria | 36490 |
| 551 | Ga0501033_0034340 | 3300049570 | Bacteria | 3806 |
| 552 | Ga0501033_0036461 | 3300049570 | Bacteria | 3685 |
| 553 | Ga0501033_0072778 | 3300049570 | Bacteria | 2523 |
| 554 | Ga0501033_0073043 | 3300049570 | Bacteria | 2518 |
| 555 | Ga0501034_0001159 | 3300049571 | Bacteria | 36532 |
| 556 | Ga0501034_0001769 | 3300049571 | Bacteria | 27612 |
| 557 | Ga0501034_0041858 | 3300049571 | Bacteria | 4635 |
| 558 | Ga0501034_0278589 | 3300049571 | Bacteria | 1612 |
| 559 | Ga0501034_0471844 | 3300049571 | Bacteria | 1171 |
| 560 | Ga0501036_0000248 | 3300049572 | Bacteria | 36490 |
| 561 | Ga0501037_0000389 | 3300049573 | Bacteria | 36523 |
| 562 | Ga0501037_0020819 | 3300049573 | Bacteria | 4842 |
| 563 | Ga0501037_0045208 | 3300049573 | Bacteria | 3232 |
| 564 | Ga0501037_0045725 | 3300049573 | Bacteria | 3213 |
| 565 | Ga0501038_0000433 | 3300049574 | Bacteria | 36490 |
| 566 | Ga0501038_0060799 | 3300049574 | Bacteria | 3232 |
| 567 | Ga0501038_0099584 | 3300049574 | Bacteria | 2423 |
| 568 | Ga0501039_0000279 | 3300049575 | Bacteria | 36490 |
| 569 | Ga0501039_0175451 | 3300049575 | Bacteria | 1685 |
| 570 | Ga0501040_0015093 | 3300049576 | Bacteria | 5104 |
| 571 | Ga0501042_0108850 | 3300049578 | Bacteria | 1995 |
| 572 | Ga0501043_0000452 | 3300049579 | Bacteria | 36530 |
| 573 | Ga0501043_0057397 | 3300049579 | Bacteria | 3057 |
| 574 | Ga0501043_0174320 | 3300049579 | Bacteria | 1677 |
| 575 | Ga0501047_0000677 | 3300049581 | Bacteria | 35497 |
| 576 | Ga0501047_0074907 | 3300049581 | Bacteria | 3258 |
| 577 | Ga0501047_0128563 | 3300049581 | Bacteria | 2413 |
| 578 | Ga0501047_0182779 | 3300049581 | Bacteria | 1963 |
| 579 | Ga0501047_0827165 | 3300049581 | Bacteria | 740 |
| 580 | Ga0501048_0004698 | 3300049582 | Bacteria | 10399 |
| 581 | Ga0501067_0009463 | 3300049583 | Bacteria | 5399 |
| 582 | Ga0501067_0018832 | 3300049583 | Bacteria | 3821 |
| 583 | Ga0501068_0003218 | 3300049584 | Bacteria | 8747 |
| 584 | Ga0501069_0135635 | 3300049585 | Bacteria | 1411 |
| 585 | Ga0501069_0241699 | 3300049585 | Bacteria | 1052 |
| 586 | Ga0501070_0032726 | 3300049586 | Bacteria | 4350 |
| 587 | Ga0501070_0043124 | 3300049586 | Bacteria | 3755 |
| 588 | Ga0501070_0154614 | 3300049586 | Bacteria | 1892 |
| 589 | Ga0501071_0069902 | 3300049587 | Bacteria | 2557 |
| 590 | Ga0501071_0170165 | 3300049587 | Bacteria | 1631 |
| 591 | Ga0501072_0004195 | 3300049588 | Bacteria | 10925 |
| 592 | Ga0501073_0025687 | 3300049589 | Bacteria | 4221 |
| 593 | Ga0501073_0038639 | 3300049589 | Bacteria | 3384 |
| 594 | Ga0501073_0066587 | 3300049589 | Bacteria | 2511 |
| 595 | Ga0501074_0044730 | 3300049590 | Bacteria | 3204 |
| 596 | Ga0501074_0093956 | 3300049590 | Bacteria | 2148 |
| 597 | Ga0501074_0130257 | 3300049590 | Bacteria | 1800 |
| 598 | Ga0501080_0044678 | 3300049742 | Bacteria | 4124 |
| 599 | Ga0501080_0485492 | 3300049742 | Bacteria | 1105 |
| 600 | Ga0501080_0698425 | 3300049742 | Bacteria | 895 |
| 601 | Ga0501083_0046096 | 3300049744 | Bacteria | 2948 |
| 602 | Ga0501083_0067811 | 3300049744 | Bacteria | 2374 |
| 603 | Ga0501083_0086999 | 3300049744 | Bacteria | 2067 |
| 604 | Ga0501083_0309078 | 3300049744 | Bacteria | 1028 |
| 605 | Ga0501035_0000651 | 3300049822 | Bacteria | 38225 |
| 606 | Ga0501035_0064636 | 3300049822 | Bacteria | 3251 |
| 607 | Ga0501044_0000862 | 3300049823 | Bacteria | 36490 |
| 608 | Ga0501044_0019854 | 3300049823 | Bacteria | 7177 |
| 609 | Ga0501044_0025214 | 3300049823 | Bacteria | 6305 |
| 610 | Ga0501044_0056088 | 3300049823 | Bacteria | 4045 |
| 611 | Ga0501044_0211761 | 3300049823 | Bacteria | 1892 |
| 612 | Ga0501044_0278927 | 3300049823 | Bacteria | 1605 |
| 613 | Ga0501045_0018395 | 3300049824 | Bacteria | 4970 |
| 614 | nmdc:mga03683_47570_c1 | 3300050489 | Bacteria | 1780 |
| 615 | nmdc:mga03n38_16303_c1 | 3300050490 | Bacteria | 2888 |
| 616 | nmdc:mga00v17_114749_c1 | 3300050491 | Bacteria | 1711 |
| 617 | nmdc:mga00v17_16996_c1 | 3300050491 | Bacteria | 4109 |
| 618 | nmdc:mga00v17_37745_c1 | 3300050491 | Bacteria | 2886 |
| 619 | nmdc:mga0yw44_153322_c1 | 3300050492 | Bacteria | 1504 |
| 620 | nmdc:mga0yw44_20790_c1 | 3300050492 | Bacteria | 3649 |
| 621 | nmdc:mga0yw44_8593_c1 | 3300050492 | Bacteria | 5099 |
| 622 | nmdc:mga0yw44_99598_c1 | 3300050492 | Bacteria | 1849 |
| 623 | nmdc:mga0k408_28578_c1 | 3300050493 | Bacteria | 3171 |
| 624 | nmdc:mga06z11_38624_c1 | 3300050494 | Bacteria | 2372 |
| 625 | nmdc:mga06z11_659_c1 | 3300050494 | Bacteria | 11138 |
| 626 | nmdc:mga07m45_267935_c1 | 3300050496 | Bacteria | 994 |
| 627 | nmdc:mga05p37_4816_c1 | 3300050507 | Bacteria | 15790 |
| 628 | nmdc:mga06r32_209654_c1 | 3300050510 | Bacteria | 1936 |
| 629 | nmdc:mga06r32_99192_c1 | 3300050510 | Bacteria | 2856 |
| 630 | nmdc:mga0n895_103856_c1 | 3300050512 | Bacteria | 2854 |
| 631 | nmdc:mga0n895_42236_c1 | 3300050512 | Bacteria | 4436 |
| 632 | nmdc:mga0rr50_205118_c1 | 3300050513 | Bacteria | 1622 |
| 633 | nmdc:mga0rr50_24524_c1 | 3300050513 | Bacteria | 4178 |
| 634 | nmdc:mga08x19_9716_c1 | 3300050514 | Bacteria | 5760 |
| 635 | nmdc:mga0a205_86288_c1 | 3300050515 | Bacteria | 3031 |
| 636 | nmdc:mga0sz30_16451_c1 | 3300050516 | Bacteria | 2938 |
| 637 | nmdc:mga0sz30_76197_c1 | 3300050516 | Bacteria | 1448 |
| 638 | Ga0495601_0004059 | 3300053077 | Bacteria | 8442 |
| 639 | Ga0495601_0005636 | 3300053077 | Bacteria | 7300 |
| 640 | Ga0495601_0016725 | 3300053077 | Bacteria | 4447 |
| 641 | Ga0495612_0001521 | 3300053078 | Bacteria | 9544 |
| 642 | Ga0495612_0002491 | 3300053078 | Bacteria | 7590 |
| 643 | Ga0495612_0015912 | 3300053078 | Bacteria | 3014 |
| 644 | Ga0495612_0030188 | 3300053078 | Bacteria | 2184 |
| 645 | Ga0495612_0046200 | 3300053078 | Bacteria | 1783 |
| 646 | Ga0495595_0000380 | 3300053084 | Bacteria | 16825 |
| 647 | Ga0495595_0007849 | 3300053084 | Bacteria | 4371 |
| 648 | Ga0495619_0000085 | 3300053085 | Bacteria | 70073 |
| 649 | Ga0495619_0000442 | 3300053085 | Bacteria | 27859 |
| 650 | Ga0495619_0000536 | 3300053085 | Bacteria | 25079 |
| 651 | Ga0495619_0011298 | 3300053085 | Bacteria | 5618 |
| 652 | Ga0495619_0020082 | 3300053085 | Bacteria | 4251 |
| 653 | Ga0495619_0061326 | 3300053085 | Bacteria | 2502 |
| 654 | Ga0500556_0000122 | 3300053104 | Bacteria | 67150 |
| 655 | Ga0500593_000036 | 3300053117 | Bacteria | 47889 |
| 656 | Ga0500568_0000002 | 3300053139 | Bacteria | 880601 |
| 657 | Ga0500568_0000104 | 3300053139 | Bacteria | 78075 |
| 658 | Ga0500604_0079305 | 3300053151 | Bacteria | 1058 |
| 659 | Ga0500620_021403 | 3300053155 | Bacteria | 1932 |
| 660 | Ga0501084_0037737 | 3300054114 | Bacteria | 4038 |
| 661 | Ga0501084_0054562 | 3300054114 | Bacteria | 3343 |
| 662 | Ga0501084_0282195 | 3300054114 | Bacteria | 1402 |
| 663 | Ga0501082_0000032 | 3300060353 | Bacteria | 99261 |
| 664 | Ga0466962_0032763 | 3300061719 | Bacteria | 2487 |
| 665 | Ga0466962_0050053 | 3300061719 | Bacteria | 1997 |
| 666 | Ga0466962_0050886 | 3300061719 | Bacteria | 1981 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300036401 | Ga0373937_0636318 | Ga0373937_0636318_45_731 | 214 |
| 2 | 3300047446 | Ga0495679_094254 | Ga0495679_094254_29_715 | 214 |
| 3 | 3300053151 | Ga0500604_0079305 | Ga0500604_0079305_290_1033 | 218 |
| 4 | 3300048089 | Ga0495614_0227468 | Ga0495614_0227468_24_719 | 219 |
| 5 | 3300049581 | Ga0501047_0827165 | Ga0501047_0827165_19_723 | 219 |
| 6 | 3300037418 | Ga0395900_0144680 | Ga0395900_0144680_767_1453 | 228 |
| 7 | 3300037466 | Ga0395898_0038675 | Ga0395898_0038675_131_817 | 228 |
| 8 | 3300005530 | Ga0070679_100510759 | Ga0070679_1005107591 | 233 |
| 9 | 3300034817 | Ga0373948_0022159 | Ga0373948_0022159_405_1178 | 244 |
| 10 | 3300035115 | Ga0373941_0024519 | Ga0373941_0024519_950_1723 | 244 |
| 11 | 3300035691 | Ga0373931_0167389 | Ga0373931_0167389_508_1281 | 244 |
| 12 | 3300046674 | Ga0495588_0301765 | Ga0495588_0301765_53_832 | 244 |
| 13 | 3300046679 | Ga0495623_0339024 | Ga0495623_0339024_32_808 | 244 |
| 14 | 3300049571 | Ga0501034_0278589 | Ga0501034_0278589_818_1594 | 244 |
| 15 | iso_pu_bacteria | 2919450847 | 2919454906 | 246 |
| 16 | iso_pu_bacteria | 8001845381 | 8001849347 | 246 |
| 17 | 3300035170 | Ga0373943_0164217 | Ga0373943_0164217_19_798 | 247 |
| 18 | 3300005718 | Ga0068866_10091414 | Ga0068866_100914142 | 249 |
| 19 | 3300037853 | Ga0436364_1505086 | Ga0436364_1505086_15470_16267 | 249 |
| 20 | 3300009098 | Ga0105245_10759657 | Ga0105245_107596571 | 250 |
| 21 | 3300044683 | Ga0466965_0133181 | Ga0466965_0133181_133_1023 | 251 |
| 22 | iso_pu_bacteria | 2965032056 | 2965032098 | 251 |
| 23 | 3300026118 | Ga0207675_100016232 | Ga0207675_1000162325 | 252 |
| 24 | 3300049583 | Ga0501067_0009463 | Ga0501067_0009463_3489_4322 | 252 |
| 25 | 3300049583 | Ga0501067_0018832 | Ga0501067_0018832_292_1128 | 252 |
| 26 | 3300049589 | Ga0501073_0066587 | Ga0501073_0066587_884_1717 | 252 |
| 27 | 3300049744 | Ga0501083_0086999 | Ga0501083_0086999_105_938 | 252 |
| 28 | 3300054114 | Ga0501084_0054562 | Ga0501084_0054562_661_1494 | 252 |
| 29 | 3300054114 | Ga0501084_0037737 | Ga0501084_0037737_1610_2452 | 253 |
| 30 | iso_pu_bacteria | 2917554339 | 2917554934 | 253 |
| 31 | 3300005985 | Ga0081539_10001777 | Ga0081539_100017779 | 254 |
| 32 | 3300044694 | Ga0466963_0319368 | Ga0466963_0319368_162_1013 | 254 |
| 33 | 3300045049 | Ga0466959_0103152 | Ga0466959_0103152_30_881 | 254 |
| 34 | 3300046460 | Ga0495638_0021151 | Ga0495638_0021151_813_1691 | 254 |
| 35 | 3300048907 | Ga0496104_0435682 | Ga0496104_0435682_357_1208 | 254 |
| 36 | 3300050492 | nmdc:mga0yw44_153322_c1 | nmdc:mga0yw44_153322_c1_474_1352 | 254 |
| 37 | iso_pu_bacteria | 2503198000 | 2503199165 | 254 |
| 38 | iso_pu_bacteria | 2508501123 | 2509116541 | 254 |
| 39 | iso_pu_bacteria | 2508501127 | 2509144290 | 254 |
| 40 | iso_pu_bacteria | 2509276018 | 2509372515 | 254 |
| 41 | iso_pu_bacteria | 2509276022 | 2509394105 | 254 |
| 42 | iso_pu_bacteria | 2512875016 | 2512933440 | 254 |
| 43 | iso_pu_bacteria | 2512875024 | 2512961556 | 254 |
| 44 | iso_pu_bacteria | 2513237090 | 2513613342 | 254 |
| 45 | iso_pu_bacteria | 2513237164 | 2514036841 | 254 |
| 46 | iso_pu_bacteria | 2513237305 | 2514418131 | 254 |
| 47 | iso_pu_bacteria | 2513237351 | 2514586908 | 254 |
| 48 | iso_pu_bacteria | 2588253730 | 2588519511 | 254 |
| 49 | iso_pu_bacteria | 2597489875 | 2597811787 | 254 |
| 50 | iso_pu_bacteria | 2599185301 | 2599937050 | 254 |
| 51 | iso_pu_bacteria | 2643221551 | 2643777471 | 254 |
| 52 | iso_pu_bacteria | 2643221555 | 2643795919 | 254 |
| 53 | iso_pu_bacteria | 2687453392 | 2688596450 | 254 |
| 54 | iso_pu_bacteria | 2693429783 | 2694630130 | 254 |
| 55 | iso_pu_bacteria | 2721755686 | 2723573540 | 254 |
| 56 | iso_pu_bacteria | 2738543024 | 2739306137 | 254 |
| 57 | iso_pu_bacteria | 2837678835 | 2837682524 | 254 |
| 58 | iso_pu_bacteria | 2841734538 | 2841736871 | 254 |
| 59 | iso_pu_bacteria | 2844009547 | 2844011276 | 254 |
| 60 | iso_pu_bacteria | 2847670302 | 2847673855 | 254 |
| 61 | iso_pu_bacteria | 2847686936 | 2847690350 | 254 |
| 62 | iso_pu_bacteria | 2856314179 | 2856320494 | 254 |
| 63 | iso_pu_bacteria | 2856320880 | 2856327308 | 254 |
| 64 | iso_pu_bacteria | 2856328259 | 2856328405 | 254 |
| 65 | iso_pu_bacteria | 2856334872 | 2856338593 | 254 |
| 66 | iso_pu_bacteria | 2856342000 | 2856344591 | 254 |
| 67 | iso_pu_bacteria | 2856349417 | 2856350841 | 254 |
| 68 | iso_pu_bacteria | 2856356410 | 2856356739 | 254 |
| 69 | iso_pu_bacteria | 2856364286 | 2856364963 | 254 |
| 70 | iso_pu_bacteria | 2857349434 | 2857353347 | 254 |
| 71 | iso_pu_bacteria | 2857367948 | 2857373407 | 254 |
| 72 | iso_pu_bacteria | 2869169390 | 2869174427 | 254 |
| 73 | iso_pu_bacteria | 2869234852 | 2869235963 | 254 |
| 74 | iso_pu_bacteria | 2869242130 | 2869244428 | 254 |
| 75 | iso_pu_bacteria | 2869249662 | 2869254069 | 254 |
| 76 | iso_pu_bacteria | 2869256925 | 2869257182 | 254 |
| 77 | iso_pu_bacteria | 2869264136 | 2869266410 | 254 |
| 78 | iso_pu_bacteria | 2869271264 | 2869273102 | 254 |
| 79 | iso_pu_bacteria | 2869278585 | 2869279465 | 254 |
| 80 | iso_pu_bacteria | 2869285874 | 2869286412 | 254 |
| 81 | iso_pu_bacteria | 2871429161 | 2871430381 | 254 |
| 82 | iso_pu_bacteria | 2871435913 | 2871440122 | 254 |
| 83 | iso_pu_bacteria | 2871444079 | 2871450556 | 254 |
| 84 | iso_pu_bacteria | 2871451962 | 2871452074 | 254 |
| 85 | iso_pu_bacteria | 2871474448 | 2871477133 | 254 |
| 86 | iso_pu_bacteria | 2871481445 | 2871483774 | 254 |
| 87 | iso_pu_bacteria | 2871488783 | 2871494809 | 254 |
| 88 | iso_pu_bacteria | 2874102143 | 2874102889 | 254 |
| 89 | iso_pu_bacteria | 2874109183 | 2874116329 | 254 |
| 90 | iso_pu_bacteria | 2874116593 | 2874119661 | 254 |
| 91 | iso_pu_bacteria | 2874123672 | 2874130188 | 254 |
| 92 | iso_pu_bacteria | 2874131515 | 2874135960 | 254 |
| 93 | iso_pu_bacteria | 2874139085 | 2874139544 | 254 |
| 94 | iso_pu_bacteria | 2874146452 | 2874146799 | 254 |
| 95 | iso_pu_bacteria | 2874155637 | 2874155872 | 254 |
| 96 | iso_pu_bacteria | 2874162495 | 2874165497 | 254 |
| 97 | iso_pu_bacteria | 2874168670 | 2874176710 | 254 |
| 98 | iso_pu_bacteria | 2876363079 | 2876364306 | 254 |
| 99 | iso_pu_bacteria | 2876369609 | 2876377607 | 254 |
| 100 | iso_pu_bacteria | 2876377896 | 2876385159 | 254 |
| 101 | iso_pu_bacteria | 2876386047 | 2876386370 | 254 |
| 102 | iso_pu_bacteria | 2876399893 | 2876402245 | 254 |
| 103 | iso_pu_bacteria | 2876413966 | 2876414201 | 254 |
| 104 | iso_pu_bacteria | 2876420981 | 2876421331 | 254 |
| 105 | iso_pu_bacteria | 2878035449 | 2878038909 | 254 |
| 106 | iso_pu_bacteria | 2878730984 | 2878737036 | 254 |
| 107 | iso_pu_bacteria | 2878738818 | 2878741991 | 254 |
| 108 | iso_pu_bacteria | 2878745973 | 2878746577 | 254 |
| 109 | iso_pu_bacteria | 2878753008 | 2878759942 | 254 |
| 110 | iso_pu_bacteria | 2878760144 | 2878765079 | 254 |
| 111 | iso_pu_bacteria | 2878767105 | 2878772251 | 254 |
| 112 | iso_pu_bacteria | 2878774303 | 2878776494 | 254 |
| 113 | iso_pu_bacteria | 2878781027 | 2878785775 | 254 |
| 114 | iso_pu_bacteria | 2881147464 | 2881148651 | 254 |
| 115 | iso_pu_bacteria | 2881155292 | 2881159730 | 254 |
| 116 | iso_pu_bacteria | 2881161766 | 2881165432 | 254 |
| 117 | iso_pu_bacteria | 2881845957 | 2881851216 | 254 |
| 118 | iso_pu_bacteria | 2881861095 | 2881866955 | 254 |
| 119 | iso_pu_bacteria | 2882632389 | 2882640253 | 254 |
| 120 | iso_pu_bacteria | 2882912400 | 2882914155 | 254 |
| 121 | iso_pu_bacteria | 2885305155 | 2885307287 | 254 |
| 122 | iso_pu_bacteria | 2885312484 | 2885313673 | 254 |
| 123 | iso_pu_bacteria | 2885318864 | 2885322822 | 254 |
| 124 | iso_pu_bacteria | 2885326080 | 2885329056 | 254 |
| 125 | iso_pu_bacteria | 2885334103 | 2885339364 | 254 |
| 126 | iso_pu_bacteria | 2885342637 | 2885343615 | 254 |
| 127 | iso_pu_bacteria | 2885350715 | 2885352456 | 254 |
| 128 | iso_pu_bacteria | 2888337043 | 2888337126 | 254 |
| 129 | iso_pu_bacteria | 2888343758 | 2888344838 | 254 |
| 130 | iso_pu_bacteria | 2888350351 | 2888353607 | 254 |
| 131 | iso_pu_bacteria | 2889010040 | 2889015327 | 254 |
| 132 | iso_pu_bacteria | 2889016732 | 2889019599 | 254 |
| 133 | iso_pu_bacteria | 2891048133 | 2891048767 | 254 |
| 134 | iso_pu_bacteria | 2903448605 | 2903455170 | 254 |
| 135 | iso_pu_bacteria | 2903492973 | 2903494167 | 254 |
| 136 | iso_pu_bacteria | 2903492973 | 2903499767 | 254 |
| 137 | iso_pu_bacteria | 2903521522 | 2903523927 | 254 |
| 138 | iso_pu_bacteria | 2903528002 | 2903530426 | 254 |
| 139 | iso_pu_bacteria | 2903540706 | 2903545881 | 254 |
| 140 | iso_pu_bacteria | 2906308376 | 2906308979 | 254 |
| 141 | iso_pu_bacteria | 2906321335 | 2906322259 | 254 |
| 142 | iso_pu_bacteria | 2906328253 | 2906333788 | 254 |
| 143 | iso_pu_bacteria | 2906363423 | 2906367577 | 254 |
| 144 | iso_pu_bacteria | 2906370794 | 2906373810 | 254 |
| 145 | iso_pu_bacteria | 2906386501 | 2906390269 | 254 |
| 146 | iso_pu_bacteria | 2906393657 | 2906398157 | 254 |
| 147 | iso_pu_bacteria | 2906401398 | 2906402686 | 254 |
| 148 | iso_pu_bacteria | 2906408224 | 2906409972 | 254 |
| 149 | iso_pu_bacteria | 2906414383 | 2906421273 | 254 |
| 150 | iso_pu_bacteria | 2922130491 | 2922136709 | 254 |
| 151 | iso_pu_bacteria | 2922151315 | 2922157601 | 254 |
| 152 | iso_pu_bacteria | 2922158528 | 2922161308 | 254 |
| 153 | iso_pu_bacteria | 2922172374 | 2922173562 | 254 |
| 154 | iso_pu_bacteria | 2922178524 | 2922183708 | 254 |
| 155 | iso_pu_bacteria | 2922185730 | 2922193556 | 254 |
| 156 | iso_pu_bacteria | 2924710171 | 2924714556 | 254 |
| 157 | iso_pu_bacteria | 2924718760 | 2924725504 | 254 |
| 158 | iso_pu_bacteria | 2924726620 | 2924730450 | 254 |
| 159 | iso_pu_bacteria | 2924733363 | 2924734412 | 254 |
| 160 | iso_pu_bacteria | 2924741084 | 2924744531 | 254 |
| 161 | iso_pu_bacteria | 2924748358 | 2924751012 | 254 |
| 162 | iso_pu_bacteria | 2924754689 | 2924759883 | 254 |
| 163 | iso_pu_bacteria | 2924762789 | 2924765404 | 254 |
| 164 | iso_pu_bacteria | 2924776078 | 2924779675 | 254 |
| 165 | iso_pu_bacteria | 2924784321 | 2924790747 | 254 |
| 166 | iso_pu_bacteria | 2937813078 | 2937822319 | 254 |
| 167 | iso_pu_bacteria | 2937822353 | 2937826890 | 254 |
| 168 | iso_pu_bacteria | 2937836603 | 2937841280 | 254 |
| 169 | iso_pu_bacteria | 2937861824 | 2937866204 | 254 |
| 170 | iso_pu_bacteria | 2937868953 | 2937873903 | 254 |
| 171 | iso_pu_bacteria | 2937877337 | 2937878169 | 254 |
| 172 | iso_pu_bacteria | 2937891427 | 2937896331 | 254 |
| 173 | iso_pu_bacteria | 2937972304 | 2937972924 | 254 |
| 174 | iso_pu_bacteria | 2937980651 | 2937982799 | 254 |
| 175 | iso_pu_bacteria | 2937994558 | 2937999735 | 254 |
| 176 | iso_pu_bacteria | 2938014810 | 2938022276 | 254 |
| 177 | iso_pu_bacteria | 2958034702 | 2958035043 | 254 |
| 178 | iso_pu_bacteria | 2958041894 | 2958044074 | 254 |
| 179 | iso_pu_bacteria | 2958041894 | 2958057330 | 254 |
| 180 | iso_pu_bacteria | 2958064165 | 2958068544 | 254 |
| 181 | iso_pu_bacteria | 2958071322 | 2958073147 | 254 |
| 182 | iso_pu_bacteria | 2958084443 | 2958085283 | 254 |
| 183 | iso_pu_bacteria | 2958092219 | 2958098747 | 254 |
| 184 | iso_pu_bacteria | 2958100919 | 2958107667 | 254 |
| 185 | iso_pu_bacteria | 2958108152 | 2958110765 | 254 |
| 186 | iso_pu_bacteria | 2958115193 | 2958120523 | 254 |
| 187 | iso_pu_bacteria | 2958122699 | 2958122947 | 254 |
| 188 | iso_pu_bacteria | 2958130278 | 2958130813 | 254 |
| 189 | iso_pu_bacteria | 2958137437 | 2958143015 | 254 |
| 190 | iso_pu_bacteria | 2958158011 | 2958164045 | 254 |
| 191 | iso_pu_bacteria | 2958165035 | 2958170203 | 254 |
| 192 | iso_pu_bacteria | 2958172287 | 2958173573 | 254 |
| 193 | iso_pu_bacteria | 2958179912 | 2958180151 | 254 |
| 194 | iso_pu_bacteria | 2961077736 | 2961077978 | 254 |
| 195 | iso_pu_bacteria | 2961127735 | 2961130543 | 254 |
| 196 | iso_pu_bacteria | 2961136820 | 2961136925 | 254 |
| 197 | iso_pu_bacteria | 2961163497 | 2961168654 | 254 |
| 198 | iso_pu_bacteria | 2961170736 | 2961177214 | 254 |
| 199 | iso_pu_bacteria | 2961183825 | 2961185207 | 254 |
| 200 | iso_pu_bacteria | 2963644680 | 2963645764 | 254 |
| 201 | iso_pu_bacteria | 2965018300 | 2965023466 | 254 |
| 202 | iso_pu_bacteria | 2965025482 | 2965030939 | 254 |
| 203 | iso_pu_bacteria | 2965040258 | 2965041782 | 254 |
| 204 | iso_pu_bacteria | 2965047637 | 2965052175 | 254 |
| 205 | iso_pu_bacteria | 2965062239 | 2965062261 | 254 |
| 206 | iso_pu_bacteria | 2965089291 | 2965094418 | 254 |
| 207 | iso_pu_bacteria | 2965102966 | 2965106301 | 254 |
| 208 | iso_pu_bacteria | 2965119406 | 2965125894 | 254 |
| 209 | iso_pu_bacteria | 2967996073 | 2968002305 | 254 |
| 210 | iso_pu_bacteria | 2968003550 | 2968009539 | 254 |
| 211 | iso_pu_bacteria | 2968016561 | 2968023463 | 254 |
| 212 | iso_pu_bacteria | 2968083720 | 2968089272 | 254 |
| 213 | iso_pu_bacteria | 2968097103 | 2968101939 | 254 |
| 214 | iso_pu_bacteria | 2968117919 | 2968122255 | 254 |
| 215 | iso_pu_bacteria | 2968128360 | 2968133209 | 254 |
| 216 | iso_pu_bacteria | 2968138860 | 2968143041 | 254 |
| 217 | iso_pu_bacteria | 2968171901 | 2968177066 | 254 |
| 218 | iso_pu_bacteria | 2970469710 | 2970476045 | 254 |
| 219 | iso_pu_bacteria | 2970489779 | 2970493732 | 254 |
| 220 | iso_pu_bacteria | 2970503327 | 2970509888 | 254 |
| 221 | iso_pu_bacteria | 2970510686 | 2970512591 | 254 |
| 222 | iso_pu_bacteria | 2970524798 | 2970526563 | 254 |
| 223 | iso_pu_bacteria | 2970532167 | 2970537167 | 254 |
| 224 | iso_pu_bacteria | 2970540015 | 2970540042 | 254 |
| 225 | iso_pu_bacteria | 2970547951 | 2970552343 | 254 |
| 226 | iso_pu_bacteria | 2970554993 | 2970559926 | 254 |
| 227 | iso_pu_bacteria | 2970593180 | 2970594065 | 254 |
| 228 | iso_pu_bacteria | 2970627176 | 2970627209 | 254 |
| 229 | iso_pu_bacteria | 2977821940 | 2977828464 | 254 |
| 230 | iso_pu_bacteria | 2977828996 | 2977836485 | 254 |
| 231 | iso_pu_bacteria | 2977843712 | 2977844185 | 254 |
| 232 | iso_pu_bacteria | 2977851361 | 2977857658 | 254 |
| 233 | iso_pu_bacteria | 2977858184 | 2977864907 | 254 |
| 234 | iso_pu_bacteria | 2977864932 | 2977869779 | 254 |
| 235 | iso_pu_bacteria | 2977872689 | 2977878376 | 254 |
| 236 | iso_pu_bacteria | 2977898635 | 2977906273 | 254 |
| 237 | iso_pu_bacteria | 2977907340 | 2977914183 | 254 |
| 238 | iso_pu_bacteria | 2977915119 | 2977922566 | 254 |
| 239 | iso_pu_bacteria | 2977935797 | 2977941791 | 254 |
| 240 | iso_pu_bacteria | 2977942078 | 2977942319 | 254 |
| 241 | iso_pu_bacteria | 2977950692 | 2977954456 | 254 |
| 242 | iso_pu_bacteria | 2977957713 | 2977962686 | 254 |
| 243 | iso_pu_bacteria | 2977971508 | 2977975117 | 254 |
| 244 | iso_pu_bacteria | 2977986579 | 2977991227 | 254 |
| 245 | iso_pu_bacteria | 2979710463 | 2979710835 | 254 |
| 246 | iso_pu_bacteria | 2979742915 | 2979745545 | 254 |
| 247 | iso_pu_bacteria | 2979764755 | 2979770811 | 254 |
| 248 | iso_pu_bacteria | 2979772303 | 2979776811 | 254 |
| 249 | iso_pu_bacteria | 2979779861 | 2979782398 | 254 |
| 250 | iso_pu_bacteria | 2979793036 | 2979794832 | 254 |
| 251 | iso_pu_bacteria | 2979808191 | 2979814764 | 254 |
| 252 | iso_pu_bacteria | 2987636660 | 2987641940 | 254 |
| 253 | iso_pu_bacteria | 2987645492 | 2987646318 | 254 |
| 254 | iso_pu_bacteria | 2987652177 | 2987655314 | 254 |
| 255 | iso_pu_bacteria | 2987659509 | 2987664683 | 254 |
| 256 | iso_pu_bacteria | 2987666974 | 2987669748 | 254 |
| 257 | iso_pu_bacteria | 2987673487 | 2987680773 | 254 |
| 258 | iso_pu_bacteria | 2996310559 | 2996315310 | 254 |
| 259 | iso_pu_bacteria | 2996341866 | 2996346716 | 254 |
| 260 | iso_pu_bacteria | 2996348954 | 2996354626 | 254 |
| 261 | iso_pu_bacteria | 2996386984 | 2996389558 | 254 |
| 262 | iso_pu_bacteria | 3000135777 | 3000137841 | 254 |
| 263 | iso_pu_bacteria | 3004188549 | 3004193738 | 254 |
| 264 | iso_pu_bacteria | 3004195979 | 3004202666 | 254 |
| 265 | iso_pu_bacteria | 3004203850 | 3004209249 | 254 |
| 266 | iso_pu_bacteria | 3004232784 | 3004237783 | 254 |
| 267 | iso_pu_bacteria | 3004239961 | 3004243251 | 254 |
| 268 | iso_pu_bacteria | 3004248173 | 3004251952 | 254 |
| 269 | iso_pu_bacteria | 3004268573 | 3004269094 | 254 |
| 270 | iso_pu_bacteria | 3004275668 | 3004281274 | 254 |
| 271 | iso_pu_bacteria | 3004334049 | 3004336704 | 254 |
| 272 | iso_pu_bacteria | 637000159 | 637076541 | 254 |
| 273 | iso_pu_bacteria | 649633066 | 649871001 | 254 |
| 274 | iso_pu_bacteria | 8002285264 | 8002290697 | 254 |
| 275 | iso_pu_bacteria | 8004300914 | 8004306830 | 254 |
| 276 | iso_pu_bacteria | 8004361976 | 8004363709 | 254 |
| 277 | iso_pu_bacteria | 8004374579 | 8004381441 | 254 |
| 278 | iso_pu_bacteria | 8004387939 | 8004388614 | 254 |
| 279 | iso_pu_bacteria | 8004445564 | 8004452218 | 254 |
| 280 | iso_pu_bacteria | 8004633249 | 8004635437 | 254 |
| 281 | iso_pu_bacteria | 8004640170 | 8004646414 | 254 |
| 282 | iso_pu_bacteria | 8004695233 | 8004700419 | 254 |
| 283 | iso_pu_bacteria | 8004703790 | 8004706319 | 254 |
| 284 | iso_pu_bacteria | 8004714634 | 8004715235 | 254 |
| 285 | iso_pu_bacteria | 8004727605 | 8004728998 | 254 |
| 286 | iso_pu_bacteria | 8055617313 | 8055618392 | 254 |
| 287 | 3300044842 | Ga0466957_0301227 | Ga0466957_0301227_184_1032 | 255 |
| 288 | 3300061719 | Ga0466962_0032763 | Ga0466962_0032763_91_939 | 255 |
| 289 | 3300005353 | Ga0070669_100164922 | Ga0070669_1001649222 | 256 |
| 290 | 3300005548 | Ga0070665_100065860 | Ga0070665_1000658604 | 256 |
| 291 | 3300006038 | Ga0075365_10092287 | Ga0075365_100922873 | 256 |
| 292 | 3300006042 | Ga0075368_10039114 | Ga0075368_100391143 | 256 |
| 293 | 3300006048 | Ga0075363_100117986 | Ga0075363_1001179863 | 256 |
| 294 | 3300006177 | Ga0075362_10089358 | Ga0075362_100893582 | 256 |
| 295 | 3300006186 | Ga0075369_10120529 | Ga0075369_101205292 | 256 |
| 296 | 3300009093 | Ga0105240_10041350 | Ga0105240_100413505 | 256 |
| 297 | 3300009148 | Ga0105243_10030161 | Ga0105243_100301615 | 256 |
| 298 | 3300009545 | Ga0105237_10068044 | Ga0105237_100680444 | 256 |
| 299 | 3300009551 | Ga0105238_10005562 | Ga0105238_100055628 | 256 |
| 300 | 3300010375 | Ga0105239_10022803 | Ga0105239_100228033 | 256 |
| 301 | 3300010375 | Ga0105239_10030197 | Ga0105239_100301973 | 256 |
| 302 | 3300010375 | Ga0105239_10201567 | Ga0105239_102015672 | 256 |
| 303 | 3300015261 | Ga0182006_1027380 | Ga0182006_10273802 | 256 |
| 304 | 3300025250 | Ga0209026_1000032 | Ga0209026_1000032166 | 256 |
| 305 | 3300025256 | Ga0209759_1000142 | Ga0209759_100014231 | 256 |
| 306 | 3300025261 | Ga0209233_1000030 | Ga0209233_100003037 | 256 |
| 307 | 3300025261 | Ga0209233_1009633 | Ga0209233_10096333 | 256 |
| 308 | 3300025904 | Ga0207647_10005873 | Ga0207647_1000587310 | 256 |
| 309 | 3300025924 | Ga0207694_10008304 | Ga0207694_100083044 | 256 |
| 310 | 3300026067 | Ga0207678_10413604 | Ga0207678_104136041 | 256 |
| 311 | 3300026089 | Ga0207648_10483688 | Ga0207648_104836881 | 256 |
| 312 | 3300026142 | Ga0207698_10058439 | Ga0207698_100584394 | 256 |
| 313 | 3300028379 | Ga0268266_10019048 | Ga0268266_100190485 | 256 |
| 314 | 3300028379 | Ga0268266_10131554 | Ga0268266_101315544 | 256 |
| 315 | 3300037312 | Ga0395899_0000058 | Ga0395899_0000058_159212_160078 | 256 |
| 316 | 3300037418 | Ga0395900_0043962 | Ga0395900_0043962_587_1471 | 256 |
| 317 | 3300037418 | Ga0395900_0228201 | Ga0395900_0228201_298_1182 | 256 |
| 318 | 3300037471 | Ga0395905_0263078 | Ga0395905_0263078_273_1157 | 256 |
| 319 | 3300037471 | Ga0395905_0459597 | Ga0395905_0459597_155_1039 | 256 |
| 320 | 3300038443 | Ga0395901_0044071 | Ga0395901_0044071_2354_3211 | 256 |
| 321 | 3300038443 | Ga0395901_0131108 | Ga0395901_0131108_895_1779 | 256 |
| 322 | 3300044683 | Ga0466965_0112551 | Ga0466965_0112551_305_1189 | 256 |
| 323 | 3300044901 | Ga0466960_0065737 | Ga0466960_0065737_168_1052 | 256 |
| 324 | 3300046507 | Ga0495606_0213347 | Ga0495606_0213347_106_990 | 256 |
| 325 | 3300046522 | Ga0495643_0020016 | Ga0495643_0020016_2737_3621 | 256 |
| 326 | 3300047443 | Ga0495687_033246 | Ga0495687_033246_611_1495 | 256 |
| 327 | 3300048091 | Ga0495626_0146227 | Ga0495626_0146227_73_957 | 256 |
| 328 | 3300048905 | Ga0496102_0283571 | Ga0496102_0283571_625_1509 | 256 |
| 329 | 3300048915 | Ga0496112_0026418 | Ga0496112_0026418_1201_2085 | 256 |
| 330 | 3300048920 | Ga0496117_0053718 | Ga0496117_0053718_1551_2435 | 256 |
| 331 | 3300048924 | Ga0496121_0166975 | Ga0496121_0166975_221_1105 | 256 |
| 332 | 3300048927 | Ga0496124_0158266 | Ga0496124_0158266_604_1488 | 256 |
| 333 | 3300049568 | Ga0501031_0000166 | Ga0501031_0000166_24526_25410 | 256 |
| 334 | 3300049568 | Ga0501031_0025653 | Ga0501031_0025653_1960_2844 | 256 |
| 335 | 3300049569 | Ga0501032_0000384 | Ga0501032_0000384_24528_25412 | 256 |
| 336 | 3300049569 | Ga0501032_0005222 | Ga0501032_0005222_6664_7548 | 256 |
| 337 | 3300049570 | Ga0501033_0000511 | Ga0501033_0000511_24526_25410 | 256 |
| 338 | 3300049570 | Ga0501033_0073043 | Ga0501033_0073043_1238_2125 | 256 |
| 339 | 3300049571 | Ga0501034_0001159 | Ga0501034_0001159_24526_25410 | 256 |
| 340 | 3300049571 | Ga0501034_0001769 | Ga0501034_0001769_19233_20126 | 256 |
| 341 | 3300049572 | Ga0501036_0000248 | Ga0501036_0000248_24526_25410 | 256 |
| 342 | 3300049573 | Ga0501037_0000389 | Ga0501037_0000389_11114_11998 | 256 |
| 343 | 3300049573 | Ga0501037_0045208 | Ga0501037_0045208_1512_2396 | 256 |
| 344 | 3300049574 | Ga0501038_0000433 | Ga0501038_0000433_24526_25410 | 256 |
| 345 | 3300049574 | Ga0501038_0060799 | Ga0501038_0060799_837_1721 | 256 |
| 346 | 3300049575 | Ga0501039_0000279 | Ga0501039_0000279_24526_25410 | 256 |
| 347 | 3300049575 | Ga0501039_0175451 | Ga0501039_0175451_110_994 | 256 |
| 348 | 3300049576 | Ga0501040_0015093 | Ga0501040_0015093_1998_2882 | 256 |
| 349 | 3300049578 | Ga0501042_0108850 | Ga0501042_0108850_239_1123 | 256 |
| 350 | 3300049579 | Ga0501043_0000452 | Ga0501043_0000452_11122_12006 | 256 |
| 351 | 3300049579 | Ga0501043_0174320 | Ga0501043_0174320_527_1414 | 256 |
| 352 | 3300049581 | Ga0501047_0000677 | Ga0501047_0000677_17831_18715 | 256 |
| 353 | 3300049581 | Ga0501047_0074907 | Ga0501047_0074907_719_1609 | 256 |
| 354 | 3300049581 | Ga0501047_0128563 | Ga0501047_0128563_692_1576 | 256 |
| 355 | 3300049582 | Ga0501048_0004698 | Ga0501048_0004698_7718_8602 | 256 |
| 356 | 3300049584 | Ga0501068_0003218 | Ga0501068_0003218_6808_7692 | 256 |
| 357 | 3300049585 | Ga0501069_0135635 | Ga0501069_0135635_472_1356 | 256 |
| 358 | 3300049586 | Ga0501070_0032726 | Ga0501070_0032726_2262_3146 | 256 |
| 359 | 3300049586 | Ga0501070_0043124 | Ga0501070_0043124_1513_2397 | 256 |
| 360 | 3300049587 | Ga0501071_0069902 | Ga0501071_0069902_297_1181 | 256 |
| 361 | 3300049589 | Ga0501073_0038639 | Ga0501073_0038639_525_1409 | 256 |
| 362 | 3300049590 | Ga0501074_0044730 | Ga0501074_0044730_169_1053 | 256 |
| 363 | 3300049742 | Ga0501080_0044678 | Ga0501080_0044678_1266_2150 | 256 |
| 364 | 3300049744 | Ga0501083_0309078 | Ga0501083_0309078_16_900 | 256 |
| 365 | 3300049822 | Ga0501035_0000651 | Ga0501035_0000651_25253_26137 | 256 |
| 366 | 3300049822 | Ga0501035_0064636 | Ga0501035_0064636_451_1338 | 256 |
| 367 | 3300049823 | Ga0501044_0000862 | Ga0501044_0000862_11081_11965 | 256 |
| 368 | 3300049823 | Ga0501044_0019854 | Ga0501044_0019854_5457_6341 | 256 |
| 369 | 3300049823 | Ga0501044_0278927 | Ga0501044_0278927_337_1224 | 256 |
| 370 | 3300049824 | Ga0501045_0018395 | Ga0501045_0018395_2118_3002 | 256 |
| 371 | 3300050491 | nmdc:mga00v17_114749_c1 | nmdc:mga00v17_114749_c1_73_957 | 256 |
| 372 | 3300050492 | nmdc:mga0yw44_99598_c1 | nmdc:mga0yw44_99598_c1_366_1250 | 256 |
| 373 | 3300050496 | nmdc:mga07m45_267935_c1 | nmdc:mga07m45_267935_c1_78_962 | 256 |
| 374 | 3300050516 | nmdc:mga0sz30_76197_c1 | nmdc:mga0sz30_76197_c1_546_1430 | 256 |
| 375 | 3300053139 | Ga0500568_0000104 | Ga0500568_0000104_10857_11741 | 256 |
| 376 | 3300053155 | Ga0500620_021403 | Ga0500620_021403_775_1659 | 256 |
| 377 | 3300006051 | Ga0075364_10043125 | Ga0075364_100431253 | 257 |
| 378 | 3300021388 | Ga0213875_10012138 | Ga0213875_100121382 | 257 |
| 379 | 3300037853 | Ga0436364_0127534 | Ga0436364_0127534_2907_3767 | 257 |
| 380 | 3300050491 | nmdc:mga00v17_37745_c1 | nmdc:mga00v17_37745_c1_921_1832 | 257 |
| 381 | 3300028800 | Ga0265338_10030205 | Ga0265338_100302051 | 259 |
| 382 | 3300039447 | Ga0436361_0582741 | Ga0436361_0582741_663_1505 | 259 |
| 383 | 3300048922 | Ga0496119_0002572 | Ga0496119_0002572_12930_13790 | 259 |
| 384 | 3300049570 | Ga0501033_0072778 | Ga0501033_0072778_1579_2439 | 259 |
| 385 | 3300049573 | Ga0501037_0020819 | Ga0501037_0020819_1963_2823 | 259 |
| 386 | 3300050510 | nmdc:mga06r32_99192_c1 | nmdc:mga06r32_99192_c1_1067_1888 | 261 |
| 387 | 3300049571 | Ga0501034_0471844 | Ga0501034_0471844_200_1069 | 262 |
| 388 | 3300048088 | Ga0495602_0040749 | Ga0495602_0040749_1112_1972 | 263 |
| 389 | 3300061719 | Ga0466962_0050886 | Ga0466962_0050886_689_1537 | 265 |
| 390 | iso_pu_bacteria | 2523231067 | 2523467409 | 266 |
| 391 | iso_pu_bacteria | 2545555834 | 2545675643 | 266 |
| 392 | iso_pu_bacteria | 2595698237 | 2596375007 | 266 |
| 393 | iso_pu_bacteria | 2738543031 | 2739347852 | 266 |
| 394 | iso_pu_bacteria | 2842698319 | 2842702458 | 266 |
| 395 | iso_pu_bacteria | 2842775625 | 2842777744 | 266 |
| 396 | iso_pu_bacteria | 2883577096 | 2883578302 | 266 |
| 397 | iso_pu_bacteria | 2884298095 | 2884299575 | 266 |
| 398 | iso_pu_bacteria | 2902405164 | 2902411364 | 266 |
| 399 | iso_pu_bacteria | 2909042592 | 2909044198 | 266 |
| 400 | iso_pu_bacteria | 2928125067 | 2928129930 | 266 |
| 401 | iso_pu_bacteria | 641522639 | 641641709 | 266 |
| 402 | 3300031852 | Ga0307410_10379299 | Ga0307410_103792992 | 267 |
| 403 | iso_pu_bacteria | 2622736605 | 2623500983 | 267 |
| 404 | iso_pu_bacteria | 2828305725 | 2828308722 | 267 |
| 405 | iso_pu_bacteria | 2842333319 | 2842336437 | 267 |
| 406 | iso_pu_bacteria | 2894772417 | 2894775621 | 267 |
| 407 | iso_pu_bacteria | 8057160832 | 8057163766 | 267 |
| 408 | 3300035113 | Ga0373936_0128024 | Ga0373936_0128024_21_866 | 268 |
| 409 | 3300046477 | Ga0495664_0151921 | Ga0495664_0151921_14_883 | 268 |
| 410 | 3300046511 | Ga0495608_0143047 | Ga0495608_0143047_534_1403 | 268 |
| 411 | 3300046683 | Ga0495658_0182417 | Ga0495658_0182417_139_1008 | 268 |
| 412 | 3300048905 | Ga0496102_0004469 | Ga0496102_0004469_2252_3121 | 268 |
| 413 | 3300048905 | Ga0496102_0144634 | Ga0496102_0144634_952_1821 | 268 |
| 414 | 3300048905 | Ga0496102_0183389 | Ga0496102_0183389_482_1351 | 268 |
| 415 | 3300048906 | Ga0496103_0116220 | Ga0496103_0116220_620_1489 | 268 |
| 416 | 3300048907 | Ga0496104_0008257 | Ga0496104_0008257_7202_8071 | 268 |
| 417 | 3300048908 | Ga0496105_0020421 | Ga0496105_0020421_1174_2043 | 268 |
| 418 | 3300048911 | Ga0496108_0004408 | Ga0496108_0004408_104_973 | 268 |
| 419 | 3300048912 | Ga0496109_0017110 | Ga0496109_0017110_2005_2874 | 268 |
| 420 | 3300048913 | Ga0496110_0004828 | Ga0496110_0004828_7559_8428 | 268 |
| 421 | 3300048913 | Ga0496110_0311797 | Ga0496110_0311797_76_1098 | 268 |
| 422 | 3300048914 | Ga0496111_0001458 | Ga0496111_0001458_7789_8658 | 268 |
| 423 | 3300048916 | Ga0496113_0011316 | Ga0496113_0011316_2672_3541 | 268 |
| 424 | 3300048917 | Ga0496114_0078664 | Ga0496114_0078664_1845_2714 | 268 |
| 425 | 3300048918 | Ga0496115_0293493 | Ga0496115_0293493_108_977 | 268 |
| 426 | 3300049744 | Ga0501083_0046096 | Ga0501083_0046096_1302_2147 | 268 |
| 427 | iso_pu_bacteria | 2929199973 | 2929204148 | 268 |
| 428 | iso_pu_bacteria | 8055909800 | 8055911324 | 268 |
| 429 | 3300005438 | Ga0070701_10127453 | Ga0070701_101274531 | 269 |
| 430 | 3300006914 | Ga0075436_100008760 | Ga0075436_1000087606 | 269 |
| 431 | 3300021388 | Ga0213875_10001607 | Ga0213875_1000160710 | 269 |
| 432 | 3300039437 | Ga0436365_0696682 | Ga0436365_0696682_659_1516 | 269 |
| 433 | 3300050514 | nmdc:mga08x19_9716_c1 | nmdc:mga08x19_9716_c1_2856_3701 | 269 |
| 434 | 3300003203 | JGI25406J46586_10000109 | JGI25406J46586_1000010929 | 270 |
| 435 | 3300003659 | JGI25404J52841_10000082 | JGI25404J52841_100000828 | 270 |
| 436 | 3300005327 | Ga0070658_10056505 | Ga0070658_100565052 | 270 |
| 437 | 3300005329 | Ga0070683_100069233 | Ga0070683_1000692333 | 270 |
| 438 | 3300005329 | Ga0070683_100163430 | Ga0070683_1001634302 | 270 |
| 439 | 3300005329 | Ga0070683_100182341 | Ga0070683_1001823412 | 270 |
| 440 | 3300005330 | Ga0070690_100036374 | Ga0070690_1000363742 | 270 |
| 441 | 3300005331 | Ga0070670_100050719 | Ga0070670_1000507193 | 270 |
| 442 | 3300005335 | Ga0070666_10006286 | Ga0070666_100062864 | 270 |
| 443 | 3300005335 | Ga0070666_10014730 | Ga0070666_100147302 | 270 |
| 444 | 3300005336 | Ga0070680_100159738 | Ga0070680_1001597381 | 270 |
| 445 | 3300005336 | Ga0070680_100365256 | Ga0070680_1003652561 | 270 |
| 446 | 3300005337 | Ga0070682_100263438 | Ga0070682_1002634382 | 270 |
| 447 | 3300005338 | Ga0068868_100013509 | Ga0068868_1000135092 | 270 |
| 448 | 3300005339 | Ga0070660_100213575 | Ga0070660_1002135752 | 270 |
| 449 | 3300005343 | Ga0070687_100085215 | Ga0070687_1000852152 | 270 |
| 450 | 3300005344 | Ga0070661_100022274 | Ga0070661_1000222743 | 270 |
| 451 | 3300005345 | Ga0070692_10257612 | Ga0070692_102576121 | 270 |
| 452 | 3300005347 | Ga0070668_100200150 | Ga0070668_1002001502 | 270 |
| 453 | 3300005347 | Ga0070668_100325935 | Ga0070668_1003259352 | 270 |
| 454 | 3300005354 | Ga0070675_100278038 | Ga0070675_1002780382 | 270 |
| 455 | 3300005355 | Ga0070671_100097885 | Ga0070671_1000978852 | 270 |
| 456 | 3300005364 | Ga0070673_100041471 | Ga0070673_1000414714 | 270 |
| 457 | 3300005365 | Ga0070688_100007241 | Ga0070688_1000072412 | 270 |
| 458 | 3300005366 | Ga0070659_100086396 | Ga0070659_1000863963 | 270 |
| 459 | 3300005367 | Ga0070667_100032087 | Ga0070667_1000320873 | 270 |
| 460 | 3300005367 | Ga0070667_100060010 | Ga0070667_1000600103 | 270 |
| 461 | 3300005434 | Ga0070709_10010315 | Ga0070709_100103153 | 270 |
| 462 | 3300005434 | Ga0070709_10021445 | Ga0070709_100214451 | 270 |
| 463 | 3300005435 | Ga0070714_100085603 | Ga0070714_1000856032 | 270 |
| 464 | 3300005435 | Ga0070714_100445834 | Ga0070714_1004458341 | 270 |
| 465 | 3300005435 | Ga0070714_100687792 | Ga0070714_1006877921 | 270 |
| 466 | 3300005436 | Ga0070713_100016764 | Ga0070713_1000167645 | 270 |
| 467 | 3300005436 | Ga0070713_100022844 | Ga0070713_1000228442 | 270 |
| 468 | 3300005436 | Ga0070713_100119143 | Ga0070713_1001191433 | 270 |
| 469 | 3300005437 | Ga0070710_10002270 | Ga0070710_100022704 | 270 |
| 470 | 3300005437 | Ga0070710_10009019 | Ga0070710_100090196 | 270 |
| 471 | 3300005437 | Ga0070710_10067927 | Ga0070710_100679271 | 270 |
| 472 | 3300005438 | Ga0070701_10113335 | Ga0070701_101133352 | 270 |
| 473 | 3300005439 | Ga0070711_100016805 | Ga0070711_1000168055 | 270 |
| 474 | 3300005439 | Ga0070711_100047333 | Ga0070711_1000473332 | 270 |
| 475 | 3300005455 | Ga0070663_100624251 | Ga0070663_1006242511 | 270 |
| 476 | 3300005456 | Ga0070678_100004557 | Ga0070678_1000045573 | 270 |
| 477 | 3300005456 | Ga0070678_100033282 | Ga0070678_1000332823 | 270 |
| 478 | 3300005457 | Ga0070662_100313836 | Ga0070662_1003138361 | 270 |
| 479 | 3300005458 | Ga0070681_10058748 | Ga0070681_100587484 | 270 |
| 480 | 3300005466 | Ga0070685_10006589 | Ga0070685_100065896 | 270 |
| 481 | 3300005530 | Ga0070679_100002598 | Ga0070679_1000025985 | 270 |
| 482 | 3300005530 | Ga0070679_100079164 | Ga0070679_1000791642 | 270 |
| 483 | 3300005530 | Ga0070679_100163069 | Ga0070679_1001630692 | 270 |
| 484 | 3300005535 | Ga0070684_100529592 | Ga0070684_1005295921 | 270 |
| 485 | 3300005543 | Ga0070672_100376566 | Ga0070672_1003765662 | 270 |
| 486 | 3300005543 | Ga0070672_100389092 | Ga0070672_1003890922 | 270 |
| 487 | 3300005544 | Ga0070686_100003427 | Ga0070686_1000034273 | 270 |
| 488 | 3300005545 | Ga0070695_100099238 | Ga0070695_1000992382 | 270 |
| 489 | 3300005547 | Ga0070693_100006523 | Ga0070693_1000065232 | 270 |
| 490 | 3300005548 | Ga0070665_100014656 | Ga0070665_1000146567 | 270 |
| 491 | 3300005548 | Ga0070665_100189359 | Ga0070665_1001893593 | 270 |
| 492 | 3300005563 | Ga0068855_100099540 | Ga0068855_1000995402 | 270 |
| 493 | 3300005564 | Ga0070664_100221706 | Ga0070664_1002217062 | 270 |
| 494 | 3300005577 | Ga0068857_100454614 | Ga0068857_1004546142 | 270 |
| 495 | 3300005614 | Ga0068856_100201818 | Ga0068856_1002018182 | 270 |
| 496 | 3300005616 | Ga0068852_100335647 | Ga0068852_1003356472 | 270 |
| 497 | 3300005617 | Ga0068859_100080273 | Ga0068859_1000802732 | 270 |
| 498 | 3300005618 | Ga0068864_100009012 | Ga0068864_1000090123 | 270 |
| 499 | 3300005718 | Ga0068866_10011785 | Ga0068866_100117852 | 270 |
| 500 | 3300005719 | Ga0068861_100185416 | Ga0068861_1001854163 | 270 |
| 501 | 3300005841 | Ga0068863_100078487 | Ga0068863_1000784872 | 270 |
| 502 | 3300005842 | Ga0068858_100033296 | Ga0068858_1000332964 | 270 |
| 503 | 3300005842 | Ga0068858_100271812 | Ga0068858_1002718122 | 270 |
| 504 | 3300005937 | Ga0081455_10002387 | Ga0081455_1000238712 | 270 |
| 505 | 3300005937 | Ga0081455_10002827 | Ga0081455_1000282720 | 270 |
| 506 | 3300005937 | Ga0081455_10051220 | Ga0081455_100512204 | 270 |
| 507 | 3300005981 | Ga0081538_10059592 | Ga0081538_100595923 | 270 |
| 508 | 3300005983 | Ga0081540_1015854 | Ga0081540_10158543 | 270 |
| 509 | 3300005983 | Ga0081540_1087122 | Ga0081540_10871222 | 270 |
| 510 | 3300005985 | Ga0081539_10001010 | Ga0081539_1000101048 | 270 |
| 511 | 3300006028 | Ga0070717_10000870 | Ga0070717_100008704 | 270 |
| 512 | 3300006028 | Ga0070717_10291515 | Ga0070717_102915152 | 270 |
| 513 | 3300006038 | Ga0075365_10006435 | Ga0075365_100064352 | 270 |
| 514 | 3300006038 | Ga0075365_10160544 | Ga0075365_101605442 | 270 |
| 515 | 3300006048 | Ga0075363_100005578 | Ga0075363_1000055782 | 270 |
| 516 | 3300006048 | Ga0075363_100013754 | Ga0075363_1000137543 | 270 |
| 517 | 3300006051 | Ga0075364_10005368 | Ga0075364_100053686 | 270 |
| 518 | 3300006163 | Ga0070715_10004329 | Ga0070715_100043292 | 270 |
| 519 | 3300006173 | Ga0070716_100000405 | Ga0070716_1000004058 | 270 |
| 520 | 3300006175 | Ga0070712_100006107 | Ga0070712_1000061074 | 270 |
| 521 | 3300006175 | Ga0070712_100054743 | Ga0070712_1000547432 | 270 |
| 522 | 3300006175 | Ga0070712_100323869 | Ga0070712_1003238692 | 270 |
| 523 | 3300006175 | Ga0070712_100453504 | Ga0070712_1004535041 | 270 |
| 524 | 3300006177 | Ga0075362_10017365 | Ga0075362_100173652 | 270 |
| 525 | 3300006178 | Ga0075367_10002138 | Ga0075367_100021384 | 270 |
| 526 | 3300006178 | Ga0075367_10023750 | Ga0075367_100237502 | 270 |
| 527 | 3300006186 | Ga0075369_10016092 | Ga0075369_100160924 | 270 |
| 528 | 3300006237 | Ga0097621_100012752 | Ga0097621_1000127526 | 270 |
| 529 | 3300006353 | Ga0075370_10041958 | Ga0075370_100419582 | 270 |
| 530 | 3300006358 | Ga0068871_100005825 | Ga0068871_1000058258 | 270 |
| 531 | 3300006844 | Ga0075428_100174181 | Ga0075428_1001741812 | 270 |
| 532 | 3300006844 | Ga0075428_100289642 | Ga0075428_1002896422 | 270 |
| 533 | 3300006847 | Ga0075431_100241413 | Ga0075431_1002414133 | 270 |
| 534 | 3300006852 | Ga0075433_10054160 | Ga0075433_100541603 | 270 |
| 535 | 3300006852 | Ga0075433_10065447 | Ga0075433_100654475 | 270 |
| 536 | 3300006871 | Ga0075434_100065236 | Ga0075434_1000652362 | 270 |
| 537 | 3300006914 | Ga0075436_100049534 | Ga0075436_1000495341 | 270 |
| 538 | 3300006931 | Ga0097620_100080265 | Ga0097620_1000802652 | 270 |
| 539 | 3300007076 | Ga0075435_100101881 | Ga0075435_1001018814 | 270 |
| 540 | 3300009011 | Ga0105251_10025457 | Ga0105251_100254574 | 270 |
| 541 | 3300009093 | Ga0105240_10026513 | Ga0105240_100265133 | 270 |
| 542 | 3300009094 | Ga0111539_10351140 | Ga0111539_103511402 | 270 |
| 543 | 3300009098 | Ga0105245_10030429 | Ga0105245_100304295 | 270 |
| 544 | 3300009098 | Ga0105245_10070476 | Ga0105245_100704762 | 270 |
| 545 | 3300009098 | Ga0105245_10185072 | Ga0105245_101850722 | 270 |
| 546 | 3300009101 | Ga0105247_10066254 | Ga0105247_100662542 | 270 |
| 547 | 3300009147 | Ga0114129_10604466 | Ga0114129_106044662 | 270 |
| 548 | 3300009174 | Ga0105241_10005705 | Ga0105241_100057057 | 270 |
| 549 | 3300009174 | Ga0105241_10079582 | Ga0105241_100795823 | 270 |
| 550 | 3300009176 | Ga0105242_10061684 | Ga0105242_100616841 | 270 |
| 551 | 3300009177 | Ga0105248_10134950 | Ga0105248_101349502 | 270 |
| 552 | 3300009545 | Ga0105237_10112538 | Ga0105237_101125383 | 270 |
| 553 | 3300009551 | Ga0105238_10015166 | Ga0105238_100151666 | 270 |
| 554 | 3300009553 | Ga0105249_10154668 | Ga0105249_101546682 | 270 |
| 555 | 3300009553 | Ga0105249_10236978 | Ga0105249_102369782 | 270 |
| 556 | 3300010375 | Ga0105239_10061573 | Ga0105239_100615734 | 270 |
| 557 | 3300010375 | Ga0105239_10246944 | Ga0105239_102469443 | 270 |
| 558 | 3300011119 | Ga0105246_10006169 | Ga0105246_100061693 | 270 |
| 559 | 3300011119 | Ga0105246_10164679 | Ga0105246_101646792 | 270 |
| 560 | 3300011119 | Ga0105246_10218187 | Ga0105246_102181872 | 270 |
| 561 | 3300012510 | Ga0157316_1003708 | Ga0157316_10037081 | 270 |
| 562 | 3300013104 | Ga0157370_10012471 | Ga0157370_100124716 | 270 |
| 563 | 3300013105 | Ga0157369_10087271 | Ga0157369_100872714 | 270 |
| 564 | 3300013296 | Ga0157374_10045210 | Ga0157374_100452104 | 270 |
| 565 | 3300013306 | Ga0163162_10089104 | Ga0163162_100891042 | 270 |
| 566 | 3300013306 | Ga0163162_10443199 | Ga0163162_104431991 | 270 |
| 567 | 3300013307 | Ga0157372_10263811 | Ga0157372_102638112 | 270 |
| 568 | 3300013307 | Ga0157372_10754354 | Ga0157372_107543542 | 270 |
| 569 | 3300013308 | Ga0157375_10177508 | Ga0157375_101775083 | 270 |
| 570 | 3300014325 | Ga0163163_10030377 | Ga0163163_100303774 | 270 |
| 571 | 3300014325 | Ga0163163_10066561 | Ga0163163_100665613 | 270 |
| 572 | 3300014325 | Ga0163163_10078997 | Ga0163163_100789973 | 270 |
| 573 | 3300014497 | Ga0182008_10072215 | Ga0182008_100722152 | 270 |
| 574 | 3300014745 | Ga0157377_10109951 | Ga0157377_101099512 | 270 |
| 575 | 3300014968 | Ga0157379_10124798 | Ga0157379_101247983 | 270 |
| 576 | 3300014969 | Ga0157376_10104693 | Ga0157376_101046932 | 270 |
| 577 | 3300020070 | Ga0206356_11202692 | Ga0206356_112026921 | 270 |
| 578 | 3300020082 | Ga0206353_10492257 | Ga0206353_104922571 | 270 |
| 579 | 3300020082 | Ga0206353_11116635 | Ga0206353_111166351 | 270 |
| 580 | 3300021388 | Ga0213875_10079050 | Ga0213875_100790502 | 270 |
| 581 | 3300021441 | Ga0213871_10026807 | Ga0213871_100268072 | 270 |
| 582 | 3300025735 | Ga0207713_1014372 | Ga0207713_10143723 | 270 |
| 583 | 3300025898 | Ga0207692_10005119 | Ga0207692_100051196 | 270 |
| 584 | 3300025898 | Ga0207692_10007113 | Ga0207692_100071132 | 270 |
| 585 | 3300025898 | Ga0207692_10010180 | Ga0207692_100101803 | 270 |
| 586 | 3300025898 | Ga0207692_10053560 | Ga0207692_100535602 | 270 |
| 587 | 3300025900 | Ga0207710_10001149 | Ga0207710_1000114910 | 270 |
| 588 | 3300025905 | Ga0207685_10004995 | Ga0207685_100049952 | 270 |
| 589 | 3300025906 | Ga0207699_10001920 | Ga0207699_100019206 | 270 |
| 590 | 3300025906 | Ga0207699_10374379 | Ga0207699_103743791 | 270 |
| 591 | 3300025907 | Ga0207645_10037731 | Ga0207645_100377314 | 270 |
| 592 | 3300025909 | Ga0207705_10018366 | Ga0207705_100183665 | 270 |
| 593 | 3300025911 | Ga0207654_10077909 | Ga0207654_100779091 | 270 |
| 594 | 3300025912 | Ga0207707_10094608 | Ga0207707_100946083 | 270 |
| 595 | 3300025912 | Ga0207707_10413448 | Ga0207707_104134481 | 270 |
| 596 | 3300025913 | Ga0207695_10026753 | Ga0207695_100267535 | 270 |
| 597 | 3300025914 | Ga0207671_10288687 | Ga0207671_102886872 | 270 |
| 598 | 3300025915 | Ga0207693_10004498 | Ga0207693_100044984 | 270 |
| 599 | 3300025915 | Ga0207693_10006034 | Ga0207693_100060343 | 270 |
| 600 | 3300025915 | Ga0207693_10009769 | Ga0207693_100097697 | 270 |
| 601 | 3300025916 | Ga0207663_10026882 | Ga0207663_100268822 | 270 |
| 602 | 3300025916 | Ga0207663_10228336 | Ga0207663_102283362 | 270 |
| 603 | 3300025917 | Ga0207660_10129825 | Ga0207660_101298251 | 270 |
| 604 | 3300025918 | Ga0207662_10149627 | Ga0207662_101496272 | 270 |
| 605 | 3300025919 | Ga0207657_10034662 | Ga0207657_100346625 | 270 |
| 606 | 3300025919 | Ga0207657_10054719 | Ga0207657_100547194 | 270 |
| 607 | 3300025925 | Ga0207650_10004278 | Ga0207650_100042785 | 270 |
| 608 | 3300025927 | Ga0207687_10008663 | Ga0207687_100086634 | 270 |
| 609 | 3300025928 | Ga0207700_10000884 | Ga0207700_1000088412 | 270 |
| 610 | 3300025928 | Ga0207700_10063123 | Ga0207700_100631233 | 270 |
| 611 | 3300025929 | Ga0207664_10028839 | Ga0207664_100288395 | 270 |
| 612 | 3300025929 | Ga0207664_10396407 | Ga0207664_103964072 | 270 |
| 613 | 3300025931 | Ga0207644_10011873 | Ga0207644_100118733 | 270 |
| 614 | 3300025931 | Ga0207644_10056747 | Ga0207644_100567472 | 270 |
| 615 | 3300025933 | Ga0207706_10043327 | Ga0207706_100433275 | 270 |
| 616 | 3300025933 | Ga0207706_10054929 | Ga0207706_100549294 | 270 |
| 617 | 3300025935 | Ga0207709_10025546 | Ga0207709_100255463 | 270 |
| 618 | 3300025936 | Ga0207670_10006927 | Ga0207670_100069276 | 270 |
| 619 | 3300025937 | Ga0207669_10025973 | Ga0207669_100259733 | 270 |
| 620 | 3300025938 | Ga0207704_10092321 | Ga0207704_100923212 | 270 |
| 621 | 3300025939 | Ga0207665_10000996 | Ga0207665_1000099610 | 270 |
| 622 | 3300025940 | Ga0207691_10475398 | Ga0207691_104753982 | 270 |
| 623 | 3300025941 | Ga0207711_10027773 | Ga0207711_100277732 | 270 |
| 624 | 3300025949 | Ga0207667_10063594 | Ga0207667_100635942 | 270 |
| 625 | 3300025960 | Ga0207651_10020536 | Ga0207651_100205364 | 270 |
| 626 | 3300025961 | Ga0207712_10049036 | Ga0207712_100490363 | 270 |
| 627 | 3300025961 | Ga0207712_10309000 | Ga0207712_103090001 | 270 |
| 628 | 3300025986 | Ga0207658_10009968 | Ga0207658_100099686 | 270 |
| 629 | 3300026035 | Ga0207703_10079032 | Ga0207703_100790322 | 270 |
| 630 | 3300026041 | Ga0207639_10282780 | Ga0207639_102827802 | 270 |
| 631 | 3300026067 | Ga0207678_10016681 | Ga0207678_100166816 | 270 |
| 632 | 3300026067 | Ga0207678_10112700 | Ga0207678_101127003 | 270 |
| 633 | 3300026078 | Ga0207702_10220404 | Ga0207702_102204042 | 270 |
| 634 | 3300026078 | Ga0207702_10268115 | Ga0207702_102681152 | 270 |
| 635 | 3300026088 | Ga0207641_10012369 | Ga0207641_100123693 | 270 |
| 636 | 3300026095 | Ga0207676_10008443 | Ga0207676_100084436 | 270 |
| 637 | 3300026116 | Ga0207674_10275389 | Ga0207674_102753892 | 270 |
| 638 | 3300026118 | Ga0207675_100177464 | Ga0207675_1001774642 | 270 |
| 639 | 3300026118 | Ga0207675_100235960 | Ga0207675_1002359601 | 270 |
| 640 | 3300026121 | Ga0207683_10003153 | Ga0207683_1000315310 | 270 |
| 641 | 3300026121 | Ga0207683_10056939 | Ga0207683_100569393 | 270 |
| 642 | 3300026142 | Ga0207698_10090301 | Ga0207698_100903013 | 270 |
| 643 | 3300028379 | Ga0268266_10003978 | Ga0268266_1000397810 | 270 |
| 644 | 3300028379 | Ga0268266_10152584 | Ga0268266_101525842 | 270 |
| 645 | 3300028380 | Ga0268265_10035234 | Ga0268265_100352342 | 270 |
| 646 | 3300028380 | Ga0268265_10586000 | Ga0268265_105860002 | 270 |
| 647 | 3300028381 | Ga0268264_10016368 | Ga0268264_100163684 | 270 |
| 648 | 3300028556 | Ga0265337_1001512 | Ga0265337_10015126 | 270 |
| 649 | 3300028800 | Ga0265338_10018836 | Ga0265338_100188362 | 270 |
| 650 | 3300031595 | Ga0265313_10007874 | Ga0265313_100078744 | 270 |
| 651 | 3300031616 | Ga0307508_10085557 | Ga0307508_100855573 | 270 |
| 652 | 3300031691 | Ga0316579_10024534 | Ga0316579_100245342 | 270 |
| 653 | 3300031711 | Ga0265314_10071571 | Ga0265314_100715712 | 270 |
| 654 | 3300031711 | Ga0265314_10108940 | Ga0265314_101089402 | 270 |
| 655 | 3300031824 | Ga0307413_10013520 | Ga0307413_100135204 | 270 |
| 656 | 3300031852 | Ga0307410_10396523 | Ga0307410_103965232 | 270 |
| 657 | 3300031903 | Ga0307407_10304197 | Ga0307407_103041971 | 270 |
| 658 | 3300031903 | Ga0307407_10427340 | Ga0307407_104273401 | 270 |
| 659 | 3300031911 | Ga0307412_10052877 | Ga0307412_100528775 | 270 |
| 660 | 3300031995 | Ga0307409_100124461 | Ga0307409_1001244613 | 270 |
| 661 | 3300031995 | Ga0307409_100128668 | Ga0307409_1001286681 | 270 |
| 662 | 3300031995 | Ga0307409_100203465 | Ga0307409_1002034653 | 270 |
| 663 | 3300032002 | Ga0307416_100220795 | Ga0307416_1002207953 | 270 |
| 664 | 3300032002 | Ga0307416_101126389 | Ga0307416_1011263891 | 270 |
| 665 | 3300032126 | Ga0307415_100094346 | Ga0307415_1000943463 | 270 |
| 666 | 3300032126 | Ga0307415_100096430 | Ga0307415_1000964301 | 270 |
| 667 | 3300033180 | Ga0307510_10113650 | Ga0307510_101136501 | 270 |
| 668 | 3300034816 | Ga0373930_0009127 | Ga0373930_0009127_768_1619 | 270 |
| 669 | 3300034816 | Ga0373930_0021193 | Ga0373930_0021193_287_1195 | 270 |
| 670 | 3300034820 | Ga0373959_0025617 | Ga0373959_0025617_47_898 | 270 |
| 671 | 3300034957 | Ga0373938_0029931 | Ga0373938_0029931_144_995 | 270 |
| 672 | 3300035083 | Ga0373926_0071044 | Ga0373926_0071044_289_1149 | 270 |
| 673 | 3300035083 | Ga0373926_0133000 | Ga0373926_0133000_17_922 | 270 |
| 674 | 3300035084 | Ga0373928_0032971 | Ga0373928_0032971_227_1078 | 270 |
| 675 | 3300035088 | Ga0373940_0062743 | Ga0373940_0062743_76_927 | 270 |
| 676 | 3300035089 | Ga0373944_0013917 | Ga0373944_0013917_31_891 | 270 |
| 677 | 3300035089 | Ga0373944_0036829 | Ga0373944_0036829_257_1114 | 270 |
| 678 | 3300035090 | Ga0373949_0019193 | Ga0373949_0019193_178_1029 | 270 |
| 679 | 3300035091 | Ga0373951_0013595 | Ga0373951_0013595_562_1413 | 270 |
| 680 | 3300035092 | Ga0373952_0022384 | Ga0373952_0022384_128_1036 | 270 |
| 681 | 3300035111 | Ga0373923_0072157 | Ga0373923_0072157_274_1134 | 270 |
| 682 | 3300035112 | Ga0373932_0008124 | Ga0373932_0008124_1511_2362 | 270 |
| 683 | 3300035114 | Ga0373939_0000595 | Ga0373939_0000595_5727_6581 | 270 |
| 684 | 3300035114 | Ga0373939_0008360 | Ga0373939_0008360_256_1107 | 270 |
| 685 | 3300035118 | Ga0373954_0005645 | Ga0373954_0005645_2589_3497 | 270 |
| 686 | 3300035118 | Ga0373954_0009134 | Ga0373954_0009134_566_1426 | 270 |
| 687 | 3300035118 | Ga0373954_0035220 | Ga0373954_0035220_242_1096 | 270 |
| 688 | 3300035119 | Ga0373956_0017690 | Ga0373956_0017690_979_1827 | 270 |
| 689 | 3300035120 | Ga0373957_0072477 | Ga0373957_0072477_118_972 | 270 |
| 690 | 3300035120 | Ga0373957_0075762 | Ga0373957_0075762_124_984 | 270 |
| 691 | 3300035170 | Ga0373943_0014695 | Ga0373943_0014695_184_1038 | 270 |
| 692 | 3300035170 | Ga0373943_0058322 | Ga0373943_0058322_296_1153 | 270 |
| 693 | 3300035172 | Ga0373955_0003027 | Ga0373955_0003027_6124_6972 | 270 |
| 694 | 3300035172 | Ga0373955_0007627 | Ga0373955_0007627_3999_4859 | 270 |
| 695 | 3300035172 | Ga0373955_0007756 | Ga0373955_0007756_589_1443 | 270 |
| 696 | 3300035410 | Ga0373924_0005315 | Ga0373924_0005315_2794_3702 | 270 |
| 697 | 3300035410 | Ga0373924_0080189 | Ga0373924_0080189_82_942 | 270 |
| 698 | 3300035691 | Ga0373931_0052368 | Ga0373931_0052368_588_1442 | 270 |
| 699 | 3300035692 | Ga0373935_0016511 | Ga0373935_0016511_3320_4180 | 270 |
| 700 | 3300035692 | Ga0373935_0035975 | Ga0373935_0035975_553_1407 | 270 |
| 701 | 3300035692 | Ga0373935_0077427 | Ga0373935_0077427_150_1055 | 270 |
| 702 | 3300035692 | Ga0373935_0175544 | Ga0373935_0175544_320_1180 | 270 |
| 703 | 3300035692 | Ga0373935_0204050 | Ga0373935_0204050_130_990 | 270 |
| 704 | 3300035695 | Ga0373927_0020566 | Ga0373927_0020566_289_1149 | 270 |
| 705 | 3300035695 | Ga0373927_0067623 | Ga0373927_0067623_114_974 | 270 |
| 706 | 3300035724 | Ga0373933_0007683 | Ga0373933_0007683_3774_4628 | 270 |
| 707 | 3300035724 | Ga0373933_0008207 | Ga0373933_0008207_4829_5689 | 270 |
| 708 | 3300035724 | Ga0373933_0034906 | Ga0373933_0034906_364_1272 | 270 |
| 709 | 3300035724 | Ga0373933_0042484 | Ga0373933_0042484_1344_2192 | 270 |
| 710 | 3300035724 | Ga0373933_0087061 | Ga0373933_0087061_582_1442 | 270 |
| 711 | 3300035725 | Ga0373947_0018767 | Ga0373947_0018767_706_1647 | 270 |
| 712 | 3300035725 | Ga0373947_0045098 | Ga0373947_0045098_1602_2462 | 270 |
| 713 | 3300035725 | Ga0373947_0046308 | Ga0373947_0046308_1481_2338 | 270 |
| 714 | 3300036401 | Ga0373937_0000824 | Ga0373937_0000824_7294_8154 | 270 |
| 715 | 3300036401 | Ga0373937_0003327 | Ga0373937_0003327_3657_4517 | 270 |
| 716 | 3300036401 | Ga0373937_0005428 | Ga0373937_0005428_8051_8905 | 270 |
| 717 | 3300036401 | Ga0373937_0020693 | Ga0373937_0020693_3865_4725 | 270 |
| 718 | 3300036401 | Ga0373937_0035947 | Ga0373937_0035947_1128_1976 | 270 |
| 719 | 3300036401 | Ga0373937_0043962 | Ga0373937_0043962_3068_3976 | 270 |
| 720 | 3300036401 | Ga0373937_0206769 | Ga0373937_0206769_218_1078 | 270 |
| 721 | 3300036401 | Ga0373937_0406378 | Ga0373937_0406378_71_931 | 270 |
| 722 | 3300037068 | Ga0373925_0009860 | Ga0373925_0009860_4943_5803 | 270 |
| 723 | 3300037068 | Ga0373925_0020221 | Ga0373925_0020221_3087_3944 | 270 |
| 724 | 3300037068 | Ga0373925_0046337 | Ga0373925_0046337_1959_2819 | 270 |
| 725 | 3300037068 | Ga0373925_0121310 | Ga0373925_0121310_989_1843 | 270 |
| 726 | 3300037068 | Ga0373925_0203128 | Ga0373925_0203128_277_1137 | 270 |
| 727 | 3300037068 | Ga0373925_0546680 | Ga0373925_0546680_41_889 | 270 |
| 728 | 3300037312 | Ga0395899_0002233 | Ga0395899_0002233_11991_12842 | 270 |
| 729 | 3300037312 | Ga0395899_0078551 | Ga0395899_0078551_1486_2337 | 270 |
| 730 | 3300037418 | Ga0395900_0001351 | Ga0395900_0001351_3079_3930 | 270 |
| 731 | 3300037418 | Ga0395900_0258646 | Ga0395900_0258646_787_1638 | 270 |
| 732 | 3300037466 | Ga0395898_0014184 | Ga0395898_0014184_3017_3868 | 270 |
| 733 | 3300037466 | Ga0395898_0016934 | Ga0395898_0016934_5443_6303 | 270 |
| 734 | 3300037466 | Ga0395898_0021905 | Ga0395898_0021905_4118_4969 | 270 |
| 735 | 3300037853 | Ga0436364_0335466 | Ga0436364_0335466_78_938 | 270 |
| 736 | 3300037853 | Ga0436364_0341381 | Ga0436364_0341381_9546_10406 | 270 |
| 737 | 3300037853 | Ga0436364_0534960 | Ga0436364_0534960_123_971 | 270 |
| 738 | 3300037853 | Ga0436364_0716978 | Ga0436364_0716978_1286_2164 | 270 |
| 739 | 3300037853 | Ga0436364_1095010 | Ga0436364_1095010_284_1144 | 270 |
| 740 | 3300037853 | Ga0436364_1179675 | Ga0436364_1179675_2493_3374 | 270 |
| 741 | 3300037853 | Ga0436364_1513145 | Ga0436364_1513145_2824_3672 | 270 |
| 742 | 3300038443 | Ga0395901_0013773 | Ga0395901_0013773_2802_3653 | 270 |
| 743 | 3300038443 | Ga0395901_0015782 | Ga0395901_0015782_5454_6314 | 270 |
| 744 | 3300039437 | Ga0436365_0209418 | Ga0436365_0209418_229_1089 | 270 |
| 745 | 3300039437 | Ga0436365_0686558 | Ga0436365_0686558_593_1453 | 270 |
| 746 | 3300039437 | Ga0436365_1151479 | Ga0436365_1151479_512_1390 | 270 |
| 747 | 3300039437 | Ga0436365_1658787 | Ga0436365_1658787_449_1312 | 270 |
| 748 | 3300039438 | Ga0436360_0023402 | Ga0436360_0023402_1760_2620 | 270 |
| 749 | 3300039438 | Ga0436360_0314979 | Ga0436360_0314979_584_1438 | 270 |
| 750 | 3300039438 | Ga0436360_0394148 | Ga0436360_0394148_865_1725 | 270 |
| 751 | 3300039438 | Ga0436360_1044519 | Ga0436360_1044519_850_1713 | 270 |
| 752 | 3300039450 | Ga0436363_0329936 | Ga0436363_0329936_672_1520 | 270 |
| 753 | 3300039450 | Ga0436363_0678607 | Ga0436363_0678607_569_1429 | 270 |
| 754 | 3300039450 | Ga0436363_1347707 | Ga0436363_1347707_290_1150 | 270 |
| 755 | 3300039453 | Ga0436362_0749915 | Ga0436362_0749915_67_930 | 270 |
| 756 | 3300039453 | Ga0436362_1078251 | Ga0436362_1078251_1249_2109 | 270 |
| 757 | 3300044658 | Ga0466972_0030800 | Ga0466972_0030800_507_1355 | 270 |
| 758 | 3300044684 | Ga0466966_0048885 | Ga0466966_0048885_1360_2229 | 270 |
| 759 | 3300044693 | Ga0466961_0069813 | Ga0466961_0069813_91_960 | 270 |
| 760 | 3300044693 | Ga0466961_0177552 | Ga0466961_0177552_25_876 | 270 |
| 761 | 3300044694 | Ga0466963_0151206 | Ga0466963_0151206_332_1210 | 270 |
| 762 | 3300044694 | Ga0466963_0232437 | Ga0466963_0232437_65_916 | 270 |
| 763 | 3300044694 | Ga0466963_0272778 | Ga0466963_0272778_260_1111 | 270 |
| 764 | 3300044719 | Ga0466971_0052565 | Ga0466971_0052565_691_1542 | 270 |
| 765 | 3300044735 | Ga0466968_0042004 | Ga0466968_0042004_334_1182 | 270 |
| 766 | 3300044765 | Ga0466970_0211593 | Ga0466970_0211593_102_953 | 270 |
| 767 | 3300044901 | Ga0466960_0066169 | Ga0466960_0066169_451_1320 | 270 |
| 768 | 3300044901 | Ga0466960_0067827 | Ga0466960_0067827_33_884 | 270 |
| 769 | 3300044901 | Ga0466960_0302647 | Ga0466960_0302647_33_884 | 270 |
| 770 | 3300045049 | Ga0466959_0093137 | Ga0466959_0093137_1300_2151 | 270 |
| 771 | 3300045049 | Ga0466959_0106141 | Ga0466959_0106141_113_964 | 270 |
| 772 | 3300045976 | Ga0466967_0038125 | Ga0466967_0038125_2772_3641 | 270 |
| 773 | 3300045976 | Ga0466967_0091230 | Ga0466967_0091230_273_1124 | 270 |
| 774 | 3300045976 | Ga0466967_0211600 | Ga0466967_0211600_195_1061 | 270 |
| 775 | 3300045976 | Ga0466967_0673365 | Ga0466967_0673365_35_907 | 270 |
| 776 | 3300046454 | Ga0495592_0016974 | Ga0495592_0016974_1797_2705 | 270 |
| 777 | 3300046454 | Ga0495592_0019964 | Ga0495592_0019964_2336_3190 | 270 |
| 778 | 3300046454 | Ga0495592_0176742 | Ga0495592_0176742_209_1063 | 270 |
| 779 | 3300046454 | Ga0495592_0234065 | Ga0495592_0234065_287_1147 | 270 |
| 780 | 3300046455 | Ga0495603_0046352 | Ga0495603_0046352_1508_2365 | 270 |
| 781 | 3300046459 | Ga0495629_0006816 | Ga0495629_0006816_880_1737 | 270 |
| 782 | 3300046461 | Ga0495641_0118462 | Ga0495641_0118462_242_1150 | 270 |
| 783 | 3300046462 | Ga0495651_0010286 | Ga0495651_0010286_2159_3007 | 270 |
| 784 | 3300046462 | Ga0495651_0051025 | Ga0495651_0051025_1798_2658 | 270 |
| 785 | 3300046462 | Ga0495651_0088366 | Ga0495651_0088366_1097_1957 | 270 |
| 786 | 3300046463 | Ga0495653_0064776 | Ga0495653_0064776_121_975 | 270 |
| 787 | 3300046463 | Ga0495653_0128709 | Ga0495653_0128709_161_1021 | 270 |
| 788 | 3300046472 | Ga0495580_0083844 | Ga0495580_0083844_1232_2134 | 270 |
| 789 | 3300046475 | Ga0495639_0109221 | Ga0495639_0109221_232_1137 | 270 |
| 790 | 3300046477 | Ga0495664_0005387 | Ga0495664_0005387_4880_5740 | 270 |
| 791 | 3300046477 | Ga0495664_0194775 | Ga0495664_0194775_52_960 | 270 |
| 792 | 3300046499 | Ga0495594_0065426 | Ga0495594_0065426_667_1572 | 270 |
| 793 | 3300046511 | Ga0495608_0133658 | Ga0495608_0133658_312_1172 | 270 |
| 794 | 3300046511 | Ga0495608_0230235 | Ga0495608_0230235_165_1019 | 270 |
| 795 | 3300046516 | Ga0495628_0002495 | Ga0495628_0002495_13698_14552 | 270 |
| 796 | 3300046516 | Ga0495628_0189170 | Ga0495628_0189170_681_1529 | 270 |
| 797 | 3300046533 | Ga0495640_0054279 | Ga0495640_0054279_1051_1956 | 270 |
| 798 | 3300046533 | Ga0495640_0126671 | Ga0495640_0126671_301_1161 | 270 |
| 799 | 3300046536 | Ga0495587_0015685 | Ga0495587_0015685_2291_3145 | 270 |
| 800 | 3300046536 | Ga0495587_0025425 | Ga0495587_0025425_972_1826 | 270 |
| 801 | 3300046536 | Ga0495587_0050288 | Ga0495587_0050288_411_1271 | 270 |
| 802 | 3300046543 | Ga0495645_0039395 | Ga0495645_0039395_79_939 | 270 |
| 803 | 3300046559 | Ga0495667_0005423 | Ga0495667_0005423_246_1106 | 270 |
| 804 | 3300046559 | Ga0495667_0007799 | Ga0495667_0007799_5511_6419 | 270 |
| 805 | 3300046559 | Ga0495667_0029059 | Ga0495667_0029059_694_1548 | 270 |
| 806 | 3300046559 | Ga0495667_0063057 | Ga0495667_0063057_1317_2171 | 270 |
| 807 | 3300046559 | Ga0495667_0123470 | Ga0495667_0123470_246_1106 | 270 |
| 808 | 3300046559 | Ga0495667_0329835 | Ga0495667_0329835_49_909 | 270 |
| 809 | 3300046642 | Ga0495634_0055785 | Ga0495634_0055785_1586_2488 | 270 |
| 810 | 3300046663 | Ga0495635_0013367 | Ga0495635_0013367_381_1289 | 270 |
| 811 | 3300046663 | Ga0495635_0014990 | Ga0495635_0014990_1327_2181 | 270 |
| 812 | 3300046663 | Ga0495635_0117174 | Ga0495635_0117174_532_1392 | 270 |
| 813 | 3300046675 | Ga0495657_0007004 | Ga0495657_0007004_4307_5215 | 270 |
| 814 | 3300046675 | Ga0495657_0117051 | Ga0495657_0117051_206_1054 | 270 |
| 815 | 3300046675 | Ga0495657_0121432 | Ga0495657_0121432_780_1634 | 270 |
| 816 | 3300046678 | Ga0495599_0015899 | Ga0495599_0015899_2076_2930 | 270 |
| 817 | 3300046678 | Ga0495599_0071204 | Ga0495599_0071204_804_1664 | 270 |
| 818 | 3300046680 | Ga0495646_0007579 | Ga0495646_0007579_486_1346 | 270 |
| 819 | 3300046680 | Ga0495646_0205501 | Ga0495646_0205501_164_1024 | 270 |
| 820 | 3300046683 | Ga0495658_0000857 | Ga0495658_0000857_9964_10821 | 270 |
| 821 | 3300046689 | Ga0495613_0005530 | Ga0495613_0005530_5237_6094 | 270 |
| 822 | 3300046689 | Ga0495613_0199293 | Ga0495613_0199293_433_1287 | 270 |
| 823 | 3300047317 | Ga0495604_0007736 | Ga0495604_0007736_6313_7167 | 270 |
| 824 | 3300047317 | Ga0495604_0029158 | Ga0495604_0029158_105_1013 | 270 |
| 825 | 3300047317 | Ga0495604_0052727 | Ga0495604_0052727_470_1330 | 270 |
| 826 | 3300047317 | Ga0495604_0064971 | Ga0495604_0064971_282_1136 | 270 |
| 827 | 3300047317 | Ga0495604_0196319 | Ga0495604_0196319_163_1011 | 270 |
| 828 | 3300047319 | Ga0495674_0042794 | Ga0495674_0042794_3030_3890 | 270 |
| 829 | 3300047319 | Ga0495674_0116521 | Ga0495674_0116521_441_1295 | 270 |
| 830 | 3300047321 | Ga0495676_0062701 | Ga0495676_0062701_1791_2639 | 270 |
| 831 | 3300047321 | Ga0495676_0082339 | Ga0495676_0082339_692_1549 | 270 |
| 832 | 3300047322 | Ga0495680_0007406 | Ga0495680_0007406_4738_5592 | 270 |
| 833 | 3300047322 | Ga0495680_0019787 | Ga0495680_0019787_3240_4094 | 270 |
| 834 | 3300047322 | Ga0495680_0155661 | Ga0495680_0155661_187_1047 | 270 |
| 835 | 3300047322 | Ga0495680_0164646 | Ga0495680_0164646_490_1350 | 270 |
| 836 | 3300047444 | Ga0495675_0008439 | Ga0495675_0008439_4085_4945 | 270 |
| 837 | 3300047471 | Ga0495684_0072882 | Ga0495684_0072882_1681_2586 | 270 |
| 838 | 3300047471 | Ga0495684_0147958 | Ga0495684_0147958_518_1390 | 270 |
| 839 | 3300047471 | Ga0495684_0249205 | Ga0495684_0249205_373_1233 | 270 |
| 840 | 3300047471 | Ga0495684_0266262 | Ga0495684_0266262_208_1068 | 270 |
| 841 | 3300047673 | Ga0495593_0073081 | Ga0495593_0073081_880_1731 | 270 |
| 842 | 3300048088 | Ga0495602_0007703 | Ga0495602_0007703_3622_4482 | 270 |
| 843 | 3300048088 | Ga0495602_0008247 | Ga0495602_0008247_4333_5241 | 270 |
| 844 | 3300048088 | Ga0495602_0056229 | Ga0495602_0056229_1025_1879 | 270 |
| 845 | 3300048903 | Ga0496100_0010727 | Ga0496100_0010727_2232_3140 | 270 |
| 846 | 3300048903 | Ga0496100_0016956 | Ga0496100_0016956_660_1511 | 270 |
| 847 | 3300048904 | Ga0496101_0030950 | Ga0496101_0030950_1536_2387 | 270 |
| 848 | 3300048905 | Ga0496102_0054690 | Ga0496102_0054690_746_1654 | 270 |
| 849 | 3300048905 | Ga0496102_0093976 | Ga0496102_0093976_850_1698 | 270 |
| 850 | 3300048905 | Ga0496102_0229204 | Ga0496102_0229204_413_1321 | 270 |
| 851 | 3300048905 | Ga0496102_0300223 | Ga0496102_0300223_601_1452 | 270 |
| 852 | 3300048906 | Ga0496103_0007284 | Ga0496103_0007284_1536_2387 | 270 |
| 853 | 3300048907 | Ga0496104_0000055 | Ga0496104_0000055_40372_41271 | 270 |
| 854 | 3300048907 | Ga0496104_0003540 | Ga0496104_0003540_9450_10298 | 270 |
| 855 | 3300048908 | Ga0496105_0000797 | Ga0496105_0000797_2824_3672 | 270 |
| 856 | 3300048908 | Ga0496105_0012262 | Ga0496105_0012262_5847_6746 | 270 |
| 857 | 3300048908 | Ga0496105_0115646 | Ga0496105_0115646_1026_1877 | 270 |
| 858 | 3300048910 | Ga0496107_0015062 | Ga0496107_0015062_3509_4360 | 270 |
| 859 | 3300048910 | Ga0496107_0024577 | Ga0496107_0024577_744_1652 | 270 |
| 860 | 3300048911 | Ga0496108_0002024 | Ga0496108_0002024_9599_10450 | 270 |
| 861 | 3300048911 | Ga0496108_0121897 | Ga0496108_0121897_1206_2114 | 270 |
| 862 | 3300048912 | Ga0496109_0001887 | Ga0496109_0001887_11026_11874 | 270 |
| 863 | 3300048912 | Ga0496109_0050361 | Ga0496109_0050361_979_1830 | 270 |
| 864 | 3300048912 | Ga0496109_0075889 | Ga0496109_0075889_629_1480 | 270 |
| 865 | 3300048913 | Ga0496110_0303778 | Ga0496110_0303778_437_1285 | 270 |
| 866 | 3300048914 | Ga0496111_0082817 | Ga0496111_0082817_668_1519 | 270 |
| 867 | 3300048914 | Ga0496111_0138127 | Ga0496111_0138127_145_1053 | 270 |
| 868 | 3300048915 | Ga0496112_0008278 | Ga0496112_0008278_629_1480 | 270 |
| 869 | 3300048915 | Ga0496112_0152710 | Ga0496112_0152710_797_1648 | 270 |
| 870 | 3300048916 | Ga0496113_0008064 | Ga0496113_0008064_1391_2239 | 270 |
| 871 | 3300048916 | Ga0496113_0020314 | Ga0496113_0020314_2206_3057 | 270 |
| 872 | 3300048916 | Ga0496113_0080341 | Ga0496113_0080341_183_1091 | 270 |
| 873 | 3300048917 | Ga0496114_0211875 | Ga0496114_0211875_611_1459 | 270 |
| 874 | 3300048918 | Ga0496115_0039056 | Ga0496115_0039056_1903_2751 | 270 |
| 875 | 3300048918 | Ga0496115_0071180 | Ga0496115_0071180_1720_2619 | 270 |
| 876 | 3300048918 | Ga0496115_0077469 | Ga0496115_0077469_984_1835 | 270 |
| 877 | 3300048922 | Ga0496119_0000344 | Ga0496119_0000344_6984_7832 | 270 |
| 878 | 3300048925 | Ga0496122_0011879 | Ga0496122_0011879_1852_2706 | 270 |
| 879 | 3300048926 | Ga0496123_0005458 | Ga0496123_0005458_5839_6693 | 270 |
| 880 | 3300049568 | Ga0501031_0130464 | Ga0501031_0130464_447_1298 | 270 |
| 881 | 3300049568 | Ga0501031_0156460 | Ga0501031_0156460_113_967 | 270 |
| 882 | 3300049570 | Ga0501033_0034340 | Ga0501033_0034340_2517_3407 | 270 |
| 883 | 3300049570 | Ga0501033_0036461 | Ga0501033_0036461_895_1764 | 270 |
| 884 | 3300049571 | Ga0501034_0041858 | Ga0501034_0041858_2349_3203 | 270 |
| 885 | 3300049573 | Ga0501037_0045725 | Ga0501037_0045725_632_1486 | 270 |
| 886 | 3300049574 | Ga0501038_0099584 | Ga0501038_0099584_145_999 | 270 |
| 887 | 3300049579 | Ga0501043_0057397 | Ga0501043_0057397_303_1172 | 270 |
| 888 | 3300049581 | Ga0501047_0182779 | Ga0501047_0182779_681_1535 | 270 |
| 889 | 3300049585 | Ga0501069_0241699 | Ga0501069_0241699_14_868 | 270 |
| 890 | 3300049586 | Ga0501070_0154614 | Ga0501070_0154614_586_1446 | 270 |
| 891 | 3300049587 | Ga0501071_0170165 | Ga0501071_0170165_620_1474 | 270 |
| 892 | 3300049588 | Ga0501072_0004195 | Ga0501072_0004195_6756_7604 | 270 |
| 893 | 3300049589 | Ga0501073_0025687 | Ga0501073_0025687_1895_2746 | 270 |
| 894 | 3300049590 | Ga0501074_0093956 | Ga0501074_0093956_1148_2002 | 270 |
| 895 | 3300049590 | Ga0501074_0130257 | Ga0501074_0130257_193_1047 | 270 |
| 896 | 3300049742 | Ga0501080_0485492 | Ga0501080_0485492_177_1037 | 270 |
| 897 | 3300049742 | Ga0501080_0698425 | Ga0501080_0698425_24_878 | 270 |
| 898 | 3300049744 | Ga0501083_0067811 | Ga0501083_0067811_94_942 | 270 |
| 899 | 3300049823 | Ga0501044_0025214 | Ga0501044_0025214_1233_2081 | 270 |
| 900 | 3300049823 | Ga0501044_0056088 | Ga0501044_0056088_3128_3997 | 270 |
| 901 | 3300049823 | Ga0501044_0211761 | Ga0501044_0211761_732_1586 | 270 |
| 902 | 3300050489 | nmdc:mga03683_47570_c1 | nmdc:mga03683_47570_c1_763_1611 | 270 |
| 903 | 3300050490 | nmdc:mga03n38_16303_c1 | nmdc:mga03n38_16303_c1_234_1082 | 270 |
| 904 | 3300050491 | nmdc:mga00v17_16996_c1 | nmdc:mga00v17_16996_c1_1091_1939 | 270 |
| 905 | 3300050492 | nmdc:mga0yw44_20790_c1 | nmdc:mga0yw44_20790_c1_2184_3032 | 270 |
| 906 | 3300050492 | nmdc:mga0yw44_8593_c1 | nmdc:mga0yw44_8593_c1_661_1509 | 270 |
| 907 | 3300050493 | nmdc:mga0k408_28578_c1 | nmdc:mga0k408_28578_c1_456_1304 | 270 |
| 908 | 3300050494 | nmdc:mga06z11_38624_c1 | nmdc:mga06z11_38624_c1_1032_1880 | 270 |
| 909 | 3300050494 | nmdc:mga06z11_659_c1 | nmdc:mga06z11_659_c1_7478_8326 | 270 |
| 910 | 3300050507 | nmdc:mga05p37_4816_c1 | nmdc:mga05p37_4816_c1_14292_15146 | 270 |
| 911 | 3300050510 | nmdc:mga06r32_209654_c1 | nmdc:mga06r32_209654_c1_116_964 | 270 |
| 912 | 3300050512 | nmdc:mga0n895_103856_c1 | nmdc:mga0n895_103856_c1_209_1066 | 270 |
| 913 | 3300050512 | nmdc:mga0n895_42236_c1 | nmdc:mga0n895_42236_c1_517_1371 | 270 |
| 914 | 3300050513 | nmdc:mga0rr50_205118_c1 | nmdc:mga0rr50_205118_c1_337_1191 | 270 |
| 915 | 3300050513 | nmdc:mga0rr50_24524_c1 | nmdc:mga0rr50_24524_c1_353_1204 | 270 |
| 916 | 3300050515 | nmdc:mga0a205_86288_c1 | nmdc:mga0a205_86288_c1_78_929 | 270 |
| 917 | 3300050516 | nmdc:mga0sz30_16451_c1 | nmdc:mga0sz30_16451_c1_1306_2154 | 270 |
| 918 | 3300053077 | Ga0495601_0004059 | Ga0495601_0004059_3742_4647 | 270 |
| 919 | 3300053077 | Ga0495601_0005636 | Ga0495601_0005636_275_1129 | 270 |
| 920 | 3300053077 | Ga0495601_0016725 | Ga0495601_0016725_2907_3767 | 270 |
| 921 | 3300053078 | Ga0495612_0001521 | Ga0495612_0001521_8139_8993 | 270 |
| 922 | 3300053078 | Ga0495612_0002491 | Ga0495612_0002491_5503_6363 | 270 |
| 923 | 3300053078 | Ga0495612_0015912 | Ga0495612_0015912_2006_2914 | 270 |
| 924 | 3300053078 | Ga0495612_0030188 | Ga0495612_0030188_29_877 | 270 |
| 925 | 3300053078 | Ga0495612_0046200 | Ga0495612_0046200_769_1623 | 270 |
| 926 | 3300053084 | Ga0495595_0000380 | Ga0495595_0000380_8967_9821 | 270 |
| 927 | 3300053084 | Ga0495595_0007849 | Ga0495595_0007849_3195_4103 | 270 |
| 928 | 3300053085 | Ga0495619_0000085 | Ga0495619_0000085_10830_11684 | 270 |
| 929 | 3300053085 | Ga0495619_0000442 | Ga0495619_0000442_15988_16842 | 270 |
| 930 | 3300053085 | Ga0495619_0000536 | Ga0495619_0000536_19693_20550 | 270 |
| 931 | 3300053085 | Ga0495619_0011298 | Ga0495619_0011298_2634_3539 | 270 |
| 932 | 3300053085 | Ga0495619_0020082 | Ga0495619_0020082_2667_3575 | 270 |
| 933 | 3300053085 | Ga0495619_0061326 | Ga0495619_0061326_1135_1983 | 270 |
| 934 | 3300053104 | Ga0500556_0000122 | Ga0500556_0000122_7575_8423 | 270 |
| 935 | 3300053117 | Ga0500593_000036 | Ga0500593_000036_16375_17223 | 270 |
| 936 | 3300053139 | Ga0500568_0000002 | Ga0500568_0000002_161218_162066 | 270 |
| 937 | 3300054114 | Ga0501084_0282195 | Ga0501084_0282195_202_1050 | 270 |
| 938 | 3300060353 | Ga0501082_0000032 | Ga0501082_0000032_12209_13057 | 270 |
| 939 | 3300061719 | Ga0466962_0050053 | Ga0466962_0050053_1058_1927 | 270 |
| 940 | iso_pu_bacteria | 2524614857 | 2526063588 | 270 |
| 941 | iso_pu_bacteria | 2739367875 | 2740061938 | 270 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5b6a-assembly1.cif.gz_A-2 | structure of pyridoxal kinasefrom pseudomonas aeruginosa | 0.9594 | 2 | 269 |
| 5b6a-assembly1.cif.gz_A-2 | structure of pyridoxal kinasefrom pseudomonas aeruginosa | 0.9524 | 2 | 269 |
| 3pzs-assembly1.cif.gz_A | crystal structure of a pyridoxamine kinase from yersinia pestis co92 | 0.9514 | 1 | 269 |
| 1vi9-assembly2.cif.gz_D | crystal structure of pyridoxamine kinase | 0.9509 | 2 | 269 |
| 1td2-assembly1.cif.gz_B | crystal structure of the pdxy protein from escherichia coli | 0.9495 | 2 | 269 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q7KUC2_7_303_3.40.1190.20 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.9255 | 2 | 269 | 3.40.1190.20 |
| af_P53727_6_307_3.40.1190.20 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.9234 | 2 | 222 | 3.40.1190.20 |
| af_P40191_1_283_3.40.1190.20 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.9217 | 3 | 249 | 3.40.1190.20 |
| af_Q59MC6_1_336_3.40.1190.20 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.9203 | 2 | 230 | 3.40.1190.20 |
| 1vi9C00 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.9197 | 2 | 269 | 3.40.1190.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537MWP1-F1-model_v4 | pyridoxal kinase (EC 2.7.1.35) | 0.9973 | 1 | 100 |
GO:0005829
GO:0008478 GO:0009443 |
| AF-A0A7Z1UXG6-F1-model_v4 | deleted | 0.9972 | 1 | 137 |
|
| AF-A0A258SQ85-F1-model_v4 | pyridoxal kinase (EC 2.7.1.35) | 0.9951 | 1 | 109 |
GO:0005829
GO:0008478 GO:0009443 |
| AF-A0A537QCB7-F1-model_v4 | pyridoxal kinase (EC 2.7.1.35) | 0.9931 | 2 | 182 |
GO:0005829
GO:0008478 GO:0009443 |
| AF-A0A258SQ85-F1-model_v4 | pyridoxal kinase (EC 2.7.1.35) | 0.9861 | 1 | 109 |
GO:0005829
GO:0008478 GO:0009443 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar