F486334

General Info

Members Datasets Scaffolds Average Seq Length
941 612 666 287

Family's Representative Sequence

Representative Sequence 3300035725|Ga0373947_0018767|Ga0373947_0018767_706_1647
Length 313
Sequence VSHLWLSALVTSSGYTGARRTALHEAAMNILSIQSWVAYGHVGNASAVFPLQRLGAEVWSINTVQFSNHTGYGHWTGQVYTGDAVRDLVDGIAARDVLRHCDAVLSGYMGDAGIGEAILHAVTRVREENPRAIYCCDPVIGDTEEGVYVREGIEEFLRDHALPQADIATPNRFELERLTGLDCGTLTGAKDAVERLAATMRPDGLRCVLLTSLETELTPGDHMDLLVGEGGSFHLLRTPRLPVSVNGAGDAVAALFLFHRLDTGSAVKAMEAAGSAVHGLLRRTAEAGSREILTVAAQDEFVAPATRFVAHPC

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
7 2512875024 Mesorhizobium loti R88b Isolate Nodule
8 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
9 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
10 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
11 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
12 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
13 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
14 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
15 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
16 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
17 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
18 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
19 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
20 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
21 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
22 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
23 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
24 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
25 2738543024 Aminobacter sp. AP02 Isolate Unclassified
26 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
27 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
28 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
29 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
30 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
31 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
32 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
33 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
34 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
35 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
36 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
37 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
38 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
39 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
40 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
41 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
42 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
43 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
44 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
45 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
46 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
47 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
48 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
49 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
50 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
51 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
52 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
53 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
54 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
55 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
56 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
57 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
58 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
59 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
60 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
61 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
62 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
63 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
64 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
65 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
66 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
67 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
68 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
69 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
70 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
71 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
72 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
73 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
74 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
75 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
76 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
77 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
78 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
79 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
80 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
81 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
82 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
83 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
84 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
85 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
86 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
87 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
88 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
89 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
90 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
91 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
92 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
93 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
94 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
95 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
96 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
97 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
98 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
99 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
100 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
101 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
102 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
103 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
104 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
105 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
106 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
107 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
108 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
109 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
110 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
111 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
112 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
113 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
114 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
115 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
116 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
117 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
118 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
119 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
120 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
121 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
122 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
123 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
124 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
125 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
126 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
127 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
128 2909042592 Labrys sp. LIt4 Isolate Nodule
129 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
130 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
131 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
132 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
133 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
134 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
135 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
136 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
137 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
138 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
139 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
140 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
141 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
142 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
143 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
144 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
145 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
146 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
147 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
148 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
149 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
150 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
151 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
152 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
153 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
154 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
155 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
156 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
157 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
158 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
159 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
160 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
161 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
162 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
163 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
164 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
165 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
166 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
167 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
168 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
169 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
170 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
171 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
172 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
173 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
174 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
175 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
176 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
177 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
178 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
179 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
180 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
181 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
182 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
183 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
184 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
185 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
186 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
187 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
188 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
189 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
190 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
191 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
192 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
193 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
194 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
195 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
196 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
197 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
198 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
199 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
200 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
201 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
202 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
203 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
204 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
205 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
206 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
207 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
208 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
209 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
210 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
211 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
212 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
213 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
214 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
215 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
216 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
217 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
218 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
219 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
220 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
221 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
222 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
223 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
224 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
225 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
226 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
227 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
228 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
229 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
230 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
231 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
232 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
233 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
234 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
235 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
236 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
237 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
238 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
239 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
240 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
241 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
242 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
243 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
244 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
245 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
246 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
247 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
248 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
249 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
250 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
251 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
252 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
253 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
254 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
255 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
256 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
257 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
258 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
259 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
260 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
261 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
262 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
263 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
264 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
265 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
266 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
267 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
268 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
269 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
270 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
271 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
272 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
273 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
274 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
275 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
276 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
277 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
278 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
279 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
280 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
281 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
282 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
283 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
284 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
285 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
286 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
287 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
288 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
289 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
290 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
291 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
292 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
293 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
294 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
295 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
296 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
297 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
298 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
299 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
300 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
301 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
302 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
303 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
304 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
305 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
306 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
307 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
308 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
309 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
310 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
311 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
312 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
313 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
314 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
315 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
316 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
317 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
318 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
319 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
320 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
321 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
322 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
323 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
324 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
325 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
326 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
327 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
328 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
329 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
330 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
331 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
332 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
333 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
334 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
335 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
336 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
337 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
338 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
339 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
340 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
341 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
342 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
343 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
344 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
345 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
346 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
347 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
348 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
349 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
350 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
351 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
352 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
353 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
354 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
355 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
356 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
357 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
358 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
359 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
360 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
361 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
362 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
363 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
364 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
365 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
366 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
402 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
403 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
406 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
407 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
408 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
409 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
410 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
412 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
414 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
415 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
416 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
417 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
418 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
419 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
420 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
421 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
422 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
423 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
424 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
425 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
426 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
427 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
428 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
429 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
430 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
431 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
432 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
433 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
434 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
435 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
436 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
437 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
438 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
439 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
440 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
441 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
442 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
443 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
444 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
445 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
446 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
447 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
448 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
449 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
450 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
451 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
452 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
453 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
454 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
455 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
456 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
457 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
458 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
459 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
460 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
461 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
462 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
463 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
464 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
465 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
466 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
467 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
468 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
469 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
470 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
471 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
472 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
473 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
474 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
475 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
476 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
477 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
478 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
479 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
480 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
481 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
482 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
483 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
484 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
485 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
486 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
487 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
488 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
489 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
490 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
491 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
492 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
493 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
494 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
495 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
496 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
497 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
498 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
499 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
500 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
501 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
502 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
503 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
504 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
505 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
506 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
507 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
508 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
509 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
510 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
511 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
512 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
513 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
514 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
515 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
516 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
517 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
518 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
519 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
520 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
521 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
522 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
523 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
524 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
525 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
526 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
527 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
528 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
529 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
530 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
531 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
532 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
533 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
534 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
535 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
536 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
537 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
538 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
539 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
540 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
541 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
542 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
543 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
544 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
545 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
546 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
547 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
548 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
549 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
550 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
551 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
552 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
553 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
554 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
555 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
556 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
557 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
558 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
559 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
560 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
561 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
562 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
563 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
564 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
565 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
566 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
567 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
568 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
569 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
570 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
571 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
572 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
573 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
574 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
575 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
576 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
577 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
578 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
579 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
580 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
581 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
582 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
583 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
584 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
585 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
586 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
587 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
588 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
589 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
590 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
591 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
592 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
593 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
594 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
595 641522639 Methylobacterium sp. 4-46 Isolate Nodule
596 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
597 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
598 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
599 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
600 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
601 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
602 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
603 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
604 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
605 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
606 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
607 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
608 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
609 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
610 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
611 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
612 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 70.46
Metatranscriptomes 0.32
Isolates 29.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.14
Nodule 24.44
Rhizoplane 5.31
Rhizosphere 59.3
Stem 0
Stem Tuber 0
Unclassified 6.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000109 3300003203 Bacteria 36339
2 JGI25404J52841_10000082 3300003659 Bacteria 8763
3 Ga0070658_10056505 3300005327 Bacteria 3190
4 Ga0070683_100069233 3300005329 Bacteria 3289
5 Ga0070683_100163430 3300005329 Bacteria 2112
6 Ga0070683_100182341 3300005329 Bacteria 1993
7 Ga0070690_100036374 3300005330 Bacteria 3094
8 Ga0070670_100050719 3300005331 Bacteria 3565
9 Ga0070666_10006286 3300005335 Bacteria 7304
10 Ga0070666_10014730 3300005335 Bacteria 4981
11 Ga0070680_100159738 3300005336 Bacteria 1894
12 Ga0070680_100365256 3300005336 Bacteria 1228
13 Ga0070682_100263438 3300005337 Bacteria 1248
14 Ga0068868_100013509 3300005338 Bacteria 5988
15 Ga0070660_100213575 3300005339 Bacteria 1567
16 Ga0070687_100085215 3300005343 Bacteria 1734
17 Ga0070661_100022274 3300005344 Bacteria 4536
18 Ga0070692_10257612 3300005345 Bacteria 1047
19 Ga0070668_100200150 3300005347 Bacteria 1639
20 Ga0070668_100325935 3300005347 Bacteria 1294
21 Ga0070669_100164922 3300005353 Bacteria 1724
22 Ga0070675_100278038 3300005354 Bacteria 1470
23 Ga0070671_100097885 3300005355 Bacteria 2460
24 Ga0070673_100041471 3300005364 Bacteria 3540
25 Ga0070688_100007241 3300005365 Bacteria 5976
26 Ga0070659_100086396 3300005366 Bacteria 2510
27 Ga0070667_100032087 3300005367 Bacteria 4380
28 Ga0070667_100060010 3300005367 Bacteria 3219
29 Ga0070709_10010315 3300005434 Bacteria 5168
30 Ga0070709_10021445 3300005434 Bacteria 3762
31 Ga0070714_100085603 3300005435 Bacteria 2753
32 Ga0070714_100445834 3300005435 Bacteria 1229
33 Ga0070714_100687792 3300005435 Bacteria 986
34 Ga0070713_100016764 3300005436 Bacteria 5516
35 Ga0070713_100022844 3300005436 Bacteria 4841
36 Ga0070713_100119143 3300005436 Bacteria 2312
37 Ga0070710_10002270 3300005437 Bacteria 9092
38 Ga0070710_10009019 3300005437 Bacteria 4875
39 Ga0070710_10067927 3300005437 Bacteria 2047
40 Ga0070701_10113335 3300005438 Bacteria 1518
41 Ga0070701_10127453 3300005438 Bacteria 1442
42 Ga0070711_100016805 3300005439 Bacteria 4651
43 Ga0070711_100047333 3300005439 Bacteria 2935
44 Ga0070663_100624251 3300005455 Bacteria 909
45 Ga0070678_100004557 3300005456 Bacteria 7865
46 Ga0070678_100033282 3300005456 Bacteria 3577
47 Ga0070662_100313836 3300005457 Bacteria 1277
48 Ga0070681_10058748 3300005458 Bacteria 3826
49 Ga0070685_10006589 3300005466 Bacteria 5924
50 Ga0070679_100002598 3300005530 Bacteria 16417
51 Ga0070679_100079164 3300005530 Bacteria 3276
52 Ga0070679_100163069 3300005530 Bacteria 2203
53 Ga0070679_100510759 3300005530 Bacteria 1146
54 Ga0070684_100529592 3300005535 Bacteria 1092
55 Ga0070672_100376566 3300005543 Bacteria 1214
56 Ga0070672_100389092 3300005543 Bacteria 1194
57 Ga0070686_100003427 3300005544 Bacteria 8705
58 Ga0070695_100099238 3300005545 Bacteria 1958
59 Ga0070693_100006523 3300005547 Bacteria 5659
60 Ga0070665_100014656 3300005548 Bacteria 7868
61 Ga0070665_100065860 3300005548 Bacteria 3634
62 Ga0070665_100189359 3300005548 Bacteria 2058
63 Ga0068855_100099540 3300005563 Bacteria 3348
64 Ga0070664_100221706 3300005564 Bacteria 1692
65 Ga0068857_100454614 3300005577 Bacteria 1198
66 Ga0068856_100201818 3300005614 Bacteria 2003
67 Ga0068852_100335647 3300005616 Bacteria 1472
68 Ga0068859_100080273 3300005617 Bacteria 3303
69 Ga0068864_100009012 3300005618 Bacteria 8227
70 Ga0068866_10011785 3300005718 Bacteria 3793
71 Ga0068866_10091414 3300005718 Bacteria 1658
72 Ga0068861_100185416 3300005719 Bacteria 1735
73 Ga0068863_100078487 3300005841 Bacteria 3126
74 Ga0068858_100033296 3300005842 Bacteria 4784
75 Ga0068858_100271812 3300005842 Bacteria 1613
76 Ga0081455_10002387 3300005937 Bacteria 22423
77 Ga0081455_10002827 3300005937 Bacteria 20442
78 Ga0081455_10051220 3300005937 Bacteria 3542
79 Ga0081538_10059592 3300005981 Bacteria 2203
80 Ga0081540_1015854 3300005983 Bacteria 4749
81 Ga0081540_1087122 3300005983 Bacteria 1385
82 Ga0081539_10001010 3300005985 Bacteria 51943
83 Ga0081539_10001777 3300005985 Bacteria 34287
84 Ga0070717_10000870 3300006028 Bacteria 19960
85 Ga0070717_10291515 3300006028 Bacteria 1449
86 Ga0075365_10006435 3300006038 Bacteria 6464
87 Ga0075365_10092287 3300006038 Bacteria 2064
88 Ga0075365_10160544 3300006038 Bacteria 1566
89 Ga0075368_10039114 3300006042 Bacteria 1858
90 Ga0075363_100005578 3300006048 Bacteria 5615
91 Ga0075363_100013754 3300006048 Bacteria 3936
92 Ga0075363_100117986 3300006048 Bacteria 1480
93 Ga0075364_10005368 3300006051 Bacteria 7443
94 Ga0075364_10043125 3300006051 Bacteria 2932
95 Ga0070715_10004329 3300006163 Bacteria 4640
96 Ga0070716_100000405 3300006173 Bacteria 17764
97 Ga0070712_100006107 3300006175 Bacteria 7457
98 Ga0070712_100054743 3300006175 Bacteria 2790
99 Ga0070712_100323869 3300006175 Bacteria 1254
100 Ga0070712_100453504 3300006175 Bacteria 1068
101 Ga0075362_10017365 3300006177 Bacteria 2964
102 Ga0075362_10089358 3300006177 Bacteria 1428
103 Ga0075367_10002138 3300006178 Bacteria 8895
104 Ga0075367_10023750 3300006178 Bacteria 3453
105 Ga0075369_10016092 3300006186 Bacteria 3011
106 Ga0075369_10120529 3300006186 Bacteria 1187
107 Ga0097621_100012752 3300006237 Bacteria 6245
108 Ga0075370_10041958 3300006353 Bacteria 2583
109 Ga0068871_100005825 3300006358 Bacteria 8660
110 Ga0075428_100174181 3300006844 Bacteria 2331
111 Ga0075428_100289642 3300006844 Bacteria 1761
112 Ga0075431_100241413 3300006847 Bacteria 1838
113 Ga0075433_10054160 3300006852 Bacteria 3499
114 Ga0075433_10065447 3300006852 Bacteria 3188
115 Ga0075434_100065236 3300006871 Bacteria 3626
116 Ga0075436_100008760 3300006914 Bacteria 6918
117 Ga0075436_100049534 3300006914 Bacteria 2899
118 Ga0097620_100080265 3300006931 Bacteria 3303
119 Ga0075435_100101881 3300007076 Bacteria 2379
120 Ga0105251_10025457 3300009011 Bacteria 3026
121 Ga0105240_10026513 3300009093 Bacteria 7604
122 Ga0105240_10041350 3300009093 Bacteria 5884
123 Ga0111539_10351140 3300009094 Bacteria 1716
124 Ga0105245_10030429 3300009098 Bacteria 4773
125 Ga0105245_10070476 3300009098 Bacteria 3172
126 Ga0105245_10185072 3300009098 Bacteria 1992
127 Ga0105245_10759657 3300009098 Bacteria 1006
128 Ga0105247_10066254 3300009101 Bacteria 2248
129 Ga0114129_10604466 3300009147 Bacteria 1420
130 Ga0105243_10030161 3300009148 Bacteria 4174
131 Ga0105241_10005705 3300009174 Bacteria 9189
132 Ga0105241_10079582 3300009174 Bacteria 2563
133 Ga0105242_10061684 3300009176 Bacteria 3084
134 Ga0105248_10134950 3300009177 Bacteria 2784
135 Ga0105237_10068044 3300009545 Bacteria 3555
136 Ga0105237_10112538 3300009545 Bacteria 2714
137 Ga0105238_10005562 3300009551 Bacteria 12449
138 Ga0105238_10015166 3300009551 Bacteria 7802
139 Ga0105249_10154668 3300009553 Bacteria 2211
140 Ga0105249_10236978 3300009553 Bacteria 1802
141 Ga0105239_10022803 3300010375 Bacteria 6901
142 Ga0105239_10030197 3300010375 Bacteria 5959
143 Ga0105239_10061573 3300010375 Bacteria 4119
144 Ga0105239_10201567 3300010375 Bacteria 2229
145 Ga0105239_10246944 3300010375 Bacteria 2004
146 Ga0105246_10006169 3300011119 Bacteria 7315
147 Ga0105246_10164679 3300011119 Bacteria 1692
148 Ga0105246_10218187 3300011119 Bacteria 1493
149 Ga0157316_1003708 3300012510 Bacteria 1118
150 Ga0157370_10012471 3300013104 Bacteria 8809
151 Ga0157369_10087271 3300013105 Bacteria 3331
152 Ga0157374_10045210 3300013296 Bacteria 4075
153 Ga0163162_10089104 3300013306 Bacteria 3166
154 Ga0163162_10443199 3300013306 Bacteria 1431
155 Ga0157372_10263811 3300013307 Bacteria 2000
156 Ga0157372_10754354 3300013307 Bacteria 1131
157 Ga0157375_10177508 3300013308 Bacteria 2280
158 Ga0163163_10030377 3300014325 Bacteria 5206
159 Ga0163163_10066561 3300014325 Bacteria 3579
160 Ga0163163_10078997 3300014325 Bacteria 3288
161 Ga0182008_10072215 3300014497 Bacteria 1698
162 Ga0157377_10109951 3300014745 Bacteria 1655
163 Ga0157379_10124798 3300014968 Bacteria 2316
164 Ga0157376_10104693 3300014969 Bacteria 2480
165 Ga0182006_1027380 3300015261 Bacteria 2327
166 Ga0206356_11202692 3300020070 Bacteria 1320
167 Ga0206353_10492257 3300020082 Bacteria 2718
168 Ga0206353_11116635 3300020082 Bacteria 2996
169 Ga0213875_10001607 3300021388 Bacteria 14297
170 Ga0213875_10012138 3300021388 Bacteria 4261
171 Ga0213875_10079050 3300021388 Bacteria 1534
172 Ga0213871_10026807 3300021441 Bacteria 1477
173 Ga0209026_1000032 3300025250 Bacteria 322378
174 Ga0209759_1000142 3300025256 Bacteria 124090
175 Ga0209233_1000030 3300025261 Bacteria 636702
176 Ga0209233_1009633 3300025261 Bacteria 2933
177 Ga0207713_1014372 3300025735 Bacteria 4118
178 Ga0207692_10005119 3300025898 Bacteria 5231
179 Ga0207692_10007113 3300025898 Bacteria 4573
180 Ga0207692_10010180 3300025898 Bacteria 3955
181 Ga0207692_10053560 3300025898 Bacteria 2056
182 Ga0207710_10001149 3300025900 Bacteria 13486
183 Ga0207647_10005873 3300025904 Bacteria 8946
184 Ga0207685_10004995 3300025905 Bacteria 3446
185 Ga0207699_10001920 3300025906 Bacteria 9798
186 Ga0207699_10374379 3300025906 Bacteria 1009
187 Ga0207645_10037731 3300025907 Bacteria 3100
188 Ga0207705_10018366 3300025909 Bacteria 5001
189 Ga0207654_10077909 3300025911 Bacteria 1988
190 Ga0207707_10094608 3300025912 Bacteria 2611
191 Ga0207707_10413448 3300025912 Bacteria 1157
192 Ga0207695_10026753 3300025913 Bacteria 6433
193 Ga0207671_10288687 3300025914 Bacteria 1295
194 Ga0207693_10004498 3300025915 Bacteria 11795
195 Ga0207693_10006034 3300025915 Bacteria 10045
196 Ga0207693_10009769 3300025915 Bacteria 7810
197 Ga0207663_10026882 3300025916 Bacteria 3345
198 Ga0207663_10228336 3300025916 Bacteria 1358
199 Ga0207660_10129825 3300025917 Bacteria 1917
200 Ga0207662_10149627 3300025918 Bacteria 1484
201 Ga0207657_10034662 3300025919 Bacteria 4536
202 Ga0207657_10054719 3300025919 Bacteria 3449
203 Ga0207694_10008304 3300025924 Bacteria 7849
204 Ga0207650_10004278 3300025925 Bacteria 9744
205 Ga0207687_10008663 3300025927 Bacteria 6648
206 Ga0207700_10000884 3300025928 Bacteria 17256
207 Ga0207700_10063123 3300025928 Bacteria 2816
208 Ga0207664_10028839 3300025929 Bacteria 4221
209 Ga0207664_10396407 3300025929 Bacteria 1227
210 Ga0207644_10011873 3300025931 Bacteria 5772
211 Ga0207644_10056747 3300025931 Bacteria 2826
212 Ga0207706_10043327 3300025933 Bacteria 3988
213 Ga0207706_10054929 3300025933 Bacteria 3514
214 Ga0207709_10025546 3300025935 Bacteria 3383
215 Ga0207670_10006927 3300025936 Bacteria 6309
216 Ga0207669_10025973 3300025937 Bacteria 3177
217 Ga0207704_10092321 3300025938 Bacteria 1992
218 Ga0207665_10000996 3300025939 Bacteria 19123
219 Ga0207691_10475398 3300025940 Bacteria 1062
220 Ga0207711_10027773 3300025941 Bacteria 4756
221 Ga0207667_10063594 3300025949 Bacteria 3856
222 Ga0207651_10020536 3300025960 Bacteria 3989
223 Ga0207712_10049036 3300025961 Bacteria 2940
224 Ga0207712_10309000 3300025961 Bacteria 1300
225 Ga0207658_10009968 3300025986 Bacteria 6457
226 Ga0207703_10079032 3300026035 Bacteria 2735
227 Ga0207639_10282780 3300026041 Bacteria 1460
228 Ga0207678_10016681 3300026067 Bacteria 6450
229 Ga0207678_10112700 3300026067 Bacteria 2320
230 Ga0207678_10413604 3300026067 Bacteria 1169
231 Ga0207702_10220404 3300026078 Bacteria 1768
232 Ga0207702_10268115 3300026078 Bacteria 1610
233 Ga0207641_10012369 3300026088 Bacteria 7001
234 Ga0207648_10483688 3300026089 Bacteria 1131
235 Ga0207676_10008443 3300026095 Bacteria 7323
236 Ga0207674_10275389 3300026116 Bacteria 1631
237 Ga0207675_100016232 3300026118 Bacteria 6951
238 Ga0207675_100177464 3300026118 Bacteria 2038
239 Ga0207675_100235960 3300026118 Bacteria 1766
240 Ga0207683_10003153 3300026121 Bacteria 14397
241 Ga0207683_10056939 3300026121 Bacteria 3430
242 Ga0207698_10058439 3300026142 Bacteria 2989
243 Ga0207698_10090301 3300026142 Bacteria 2505
244 Ga0268266_10003978 3300028379 Bacteria 14334
245 Ga0268266_10019048 3300028379 Bacteria 5846
246 Ga0268266_10131554 3300028379 Bacteria 2238
247 Ga0268266_10152584 3300028379 Bacteria 2084
248 Ga0268265_10035234 3300028380 Bacteria 3655
249 Ga0268265_10586000 3300028380 Bacteria 1064
250 Ga0268264_10016368 3300028381 Bacteria 6071
251 Ga0265337_1001512 3300028556 Bacteria 11408
252 Ga0265338_10018836 3300028800 Bacteria 7363
253 Ga0265338_10030205 3300028800 Bacteria 5347
254 Ga0265313_10007874 3300031595 Bacteria 7182
255 Ga0307508_10085557 3300031616 Bacteria 2736
256 Ga0316579_10024534 3300031691 Bacteria 2716
257 Ga0265314_10071571 3300031711 Bacteria 2319
258 Ga0265314_10108940 3300031711 Bacteria 1764
259 Ga0307413_10013520 3300031824 Bacteria 4108
260 Ga0307410_10379299 3300031852 Bacteria 1137
261 Ga0307410_10396523 3300031852 Bacteria 1114
262 Ga0307407_10304197 3300031903 Bacteria 1113
263 Ga0307407_10427340 3300031903 Bacteria 956
264 Ga0307412_10052877 3300031911 Bacteria 2691
265 Ga0307409_100124461 3300031995 Bacteria 2190
266 Ga0307409_100128668 3300031995 Bacteria 2159
267 Ga0307409_100203465 3300031995 Bacteria 1773
268 Ga0307416_100220795 3300032002 Bacteria 1817
269 Ga0307416_101126389 3300032002 Bacteria 890
270 Ga0307415_100094346 3300032126 Bacteria 2175
271 Ga0307415_100096430 3300032126 Bacteria 2155
272 Ga0307510_10113650 3300033180 Bacteria 2440
273 Ga0373930_0009127 3300034816 Bacteria 1749
274 Ga0373930_0021193 3300034816 Bacteria 1274
275 Ga0373948_0022159 3300034817 Bacteria 1223
276 Ga0373959_0025617 3300034820 Bacteria 1160
277 Ga0373938_0029931 3300034957 Bacteria 1159
278 Ga0373926_0071044 3300035083 Bacteria 1279
279 Ga0373926_0133000 3300035083 Bacteria 942
280 Ga0373928_0032971 3300035084 Bacteria 1157
281 Ga0373940_0062743 3300035088 Bacteria 1067
282 Ga0373944_0013917 3300035089 Bacteria 2239
283 Ga0373944_0036829 3300035089 Bacteria 1496
284 Ga0373949_0019193 3300035090 Bacteria 1555
285 Ga0373951_0013595 3300035091 Bacteria 1829
286 Ga0373952_0022384 3300035092 Bacteria 1342
287 Ga0373923_0072157 3300035111 Bacteria 1484
288 Ga0373932_0008124 3300035112 Bacteria 2505
289 Ga0373936_0128024 3300035113 Bacteria 1089
290 Ga0373939_0000595 3300035114 Bacteria 9020
291 Ga0373939_0008360 3300035114 Bacteria 2536
292 Ga0373941_0024519 3300035115 Bacteria 1733
293 Ga0373954_0005645 3300035118 Bacteria 5420
294 Ga0373954_0009134 3300035118 Bacteria 4362
295 Ga0373954_0035220 3300035118 Bacteria 2321
296 Ga0373956_0017690 3300035119 Bacteria 3010
297 Ga0373957_0072477 3300035120 Unclassified 1349
298 Ga0373957_0075762 3300035120 Bacteria 1322
299 Ga0373943_0014695 3300035170 Bacteria 3550
300 Ga0373943_0058322 3300035170 Bacteria 1921
301 Ga0373943_0164217 3300035170 Bacteria 1211
302 Ga0373955_0003027 3300035172 Bacteria 7369
303 Ga0373955_0007627 3300035172 Bacteria 4985
304 Ga0373955_0007756 3300035172 Bacteria 4946
305 Ga0373924_0005315 3300035410 Bacteria 4554
306 Ga0373924_0080189 3300035410 Bacteria 1387
307 Ga0373931_0052368 3300035691 Bacteria 2176
308 Ga0373931_0167389 3300035691 Bacteria 1292
309 Ga0373935_0016511 3300035692 Bacteria 4466
310 Ga0373935_0035975 3300035692 Bacteria 3093
311 Ga0373935_0077427 3300035692 Bacteria 2155
312 Ga0373935_0175544 3300035692 Bacteria 1468
313 Ga0373935_0204050 3300035692 Bacteria 1367
314 Ga0373927_0020566 3300035695 Bacteria 4328
315 Ga0373927_0067623 3300035695 Bacteria 2312
316 Ga0373933_0007683 3300035724 Bacteria 5888
317 Ga0373933_0008207 3300035724 Bacteria 5701
318 Ga0373933_0034906 3300035724 Bacteria 2934
319 Ga0373933_0042484 3300035724 Bacteria 2687
320 Ga0373933_0087061 3300035724 Bacteria 1923
321 Ga0373947_0018767 3300035725 Bacteria 3983
322 Ga0373947_0045098 3300035725 Bacteria 2638
323 Ga0373947_0046308 3300035725 Bacteria 2604
324 Ga0373937_0000824 3300036401 Bacteria 26565
325 Ga0373937_0003327 3300036401 Bacteria 13492
326 Ga0373937_0005428 3300036401 Bacteria 10911
327 Ga0373937_0020693 3300036401 Bacteria 5901
328 Ga0373937_0035947 3300036401 Bacteria 4512
329 Ga0373937_0043962 3300036401 Bacteria 4079
330 Ga0373937_0206769 3300036401 Bacteria 1846
331 Ga0373937_0406378 3300036401 Bacteria 1292
332 Ga0373937_0636318 3300036401 Unclassified 1012
333 Ga0373925_0009860 3300037068 Bacteria 6939
334 Ga0373925_0020221 3300037068 Bacteria 4844
335 Ga0373925_0046337 3300037068 Bacteria 3233
336 Ga0373925_0121310 3300037068 Bacteria 2029
337 Ga0373925_0203128 3300037068 Bacteria 1576
338 Ga0373925_0546680 3300037068 Bacteria 952
339 Ga0395899_0000058 3300037312 Bacteria 213049
340 Ga0395899_0002233 3300037312 Bacteria 15864
341 Ga0395899_0078551 3300037312 Bacteria 2405
342 Ga0395900_0001351 3300037418 Bacteria 29638
343 Ga0395900_0043962 3300037418 Bacteria 4604
344 Ga0395900_0144680 3300037418 Bacteria 2432
345 Ga0395900_0228201 3300037418 Bacteria 1874
346 Ga0395900_0258646 3300037418 Bacteria 1739
347 Ga0395898_0014184 3300037466 Bacteria 8194
348 Ga0395898_0016934 3300037466 Bacteria 7441
349 Ga0395898_0021905 3300037466 Bacteria 6473
350 Ga0395898_0038675 3300037466 Bacteria 4727
351 Ga0395905_0263078 3300037471 Bacteria 1610
352 Ga0395905_0459597 3300037471 Bacteria 1171
353 Ga0436364_0127534 3300037853 Bacteria 4097
354 Ga0436364_0335466 3300037853 Bacteria 1895
355 Ga0436364_0341381 3300037853 Bacteria 15601
356 Ga0436364_0534960 3300037853 Bacteria 1060
357 Ga0436364_0716978 3300037853 Bacteria 4965
358 Ga0436364_1095010 3300037853 Bacteria 1263
359 Ga0436364_1179675 3300037853 Bacteria 7860
360 Ga0436364_1505086 3300037853 Bacteria 23518
361 Ga0436364_1513145 3300037853 Bacteria 16116
362 Ga0395901_0013773 3300038443 Bacteria 8221
363 Ga0395901_0015782 3300038443 Bacteria 7696
364 Ga0395901_0044071 3300038443 Bacteria 4627
365 Ga0395901_0131108 3300038443 Bacteria 2634
366 Ga0436365_0209418 3300039437 Bacteria 1799
367 Ga0436365_0686558 3300039437 Bacteria 2799
368 Ga0436365_0696682 3300039437 Bacteria 2067
369 Ga0436365_1151479 3300039437 Bacteria 9186
370 Ga0436365_1658787 3300039437 Bacteria 3409
371 Ga0436360_0023402 3300039438 Bacteria 3422
372 Ga0436360_0314979 3300039438 Bacteria 1486
373 Ga0436360_0394148 3300039438 Bacteria 6296
374 Ga0436360_1044519 3300039438 Bacteria 2578
375 Ga0436361_0582741 3300039447 Bacteria 1535
376 Ga0436363_0329936 3300039450 Bacteria 1735
377 Ga0436363_0678607 3300039450 Bacteria 1648
378 Ga0436363_1347707 3300039450 Bacteria 1307
379 Ga0436362_0749915 3300039453 Bacteria 1522
380 Ga0436362_1078251 3300039453 Bacteria 3010
381 Ga0466972_0030800 3300044658 Bacteria 2641
382 Ga0466965_0112551 3300044683 Bacteria 1400
383 Ga0466965_0133181 3300044683 Bacteria 1290
384 Ga0466966_0048885 3300044684 Bacteria 2694
385 Ga0466961_0069813 3300044693 Bacteria 2230
386 Ga0466961_0177552 3300044693 Bacteria 1323
387 Ga0466963_0151206 3300044694 Bacteria 1612
388 Ga0466963_0232437 3300044694 Bacteria 1292
389 Ga0466963_0272778 3300044694 Bacteria 1188
390 Ga0466963_0319368 3300044694 Bacteria 1093
391 Ga0466971_0052565 3300044719 Bacteria 1835
392 Ga0466968_0042004 3300044735 Bacteria 1932
393 Ga0466970_0211593 3300044765 Bacteria 1080
394 Ga0466957_0301227 3300044842 Bacteria 1077
395 Ga0466960_0065737 3300044901 Bacteria 1792
396 Ga0466960_0066169 3300044901 Bacteria 1786
397 Ga0466960_0067827 3300044901 Bacteria 1768
398 Ga0466960_0302647 3300044901 Bacteria 901
399 Ga0466959_0093137 3300045049 Bacteria 2162
400 Ga0466959_0103152 3300045049 Bacteria 2041
401 Ga0466959_0106141 3300045049 Bacteria 2008
402 Ga0466967_0038125 3300045976 Bacteria 4119
403 Ga0466967_0091230 3300045976 Bacteria 2768
404 Ga0466967_0211600 3300045976 Bacteria 1839
405 Ga0466967_0673365 3300045976 Bacteria 1024
406 Ga0495592_0016974 3300046454 Bacteria 5526
407 Ga0495592_0019964 3300046454 Bacteria 5094
408 Ga0495592_0176742 3300046454 Unclassified 1457
409 Ga0495592_0234065 3300046454 Bacteria 1222
410 Ga0495603_0046352 3300046455 Bacteria 2591
411 Ga0495629_0006816 3300046459 Bacteria 8445
412 Ga0495638_0021151 3300046460 Bacteria 4291
413 Ga0495641_0118462 3300046461 Bacteria 1181
414 Ga0495651_0010286 3300046462 Bacteria 7188
415 Ga0495651_0051025 3300046462 Bacteria 3191
416 Ga0495651_0088366 3300046462 Bacteria 2329
417 Ga0495653_0064776 3300046463 Bacteria 2753
418 Ga0495653_0128709 3300046463 Bacteria 1795
419 Ga0495580_0083844 3300046472 Bacteria 2220
420 Ga0495639_0109221 3300046475 Bacteria 1311
421 Ga0495664_0005387 3300046477 Bacteria 7023
422 Ga0495664_0151921 3300046477 Bacteria 1404
423 Ga0495664_0194775 3300046477 Bacteria 1228
424 Ga0495594_0065426 3300046499 Bacteria 2016
425 Ga0495606_0213347 3300046507 Bacteria 1092
426 Ga0495608_0133658 3300046511 Bacteria 1586
427 Ga0495608_0143047 3300046511 Bacteria 1526
428 Ga0495608_0230235 3300046511 Bacteria 1160
429 Ga0495628_0002495 3300046516 Bacteria 16570
430 Ga0495628_0189170 3300046516 Bacteria 1555
431 Ga0495643_0020016 3300046522 Bacteria 3865
432 Ga0495640_0054279 3300046533 Bacteria 2745
433 Ga0495640_0126671 3300046533 Bacteria 1656
434 Ga0495587_0015685 3300046536 Bacteria 4726
435 Ga0495587_0025425 3300046536 Bacteria 3618
436 Ga0495587_0050288 3300046536 Bacteria 2466
437 Ga0495645_0039395 3300046543 Bacteria 3446
438 Ga0495667_0005423 3300046559 Bacteria 8621
439 Ga0495667_0007799 3300046559 Bacteria 7249
440 Ga0495667_0029059 3300046559 Bacteria 3721
441 Ga0495667_0063057 3300046559 Bacteria 2427
442 Ga0495667_0123470 3300046559 Bacteria 1671
443 Ga0495667_0329835 3300046559 Bacteria 965
444 Ga0495634_0055785 3300046642 Bacteria 2641
445 Ga0495635_0013367 3300046663 Bacteria 5745
446 Ga0495635_0014990 3300046663 Bacteria 5422
447 Ga0495635_0117174 3300046663 Bacteria 1817
448 Ga0495588_0301765 3300046674 Bacteria 843
449 Ga0495657_0007004 3300046675 Bacteria 8746
450 Ga0495657_0117051 3300046675 Bacteria 1682
451 Ga0495657_0121432 3300046675 Bacteria 1645
452 Ga0495599_0015899 3300046678 Bacteria 4670
453 Ga0495599_0071204 3300046678 Bacteria 2170
454 Ga0495623_0339024 3300046679 Bacteria 821
455 Ga0495646_0007579 3300046680 Bacteria 6898
456 Ga0495646_0205501 3300046680 Bacteria 1071
457 Ga0495658_0000857 3300046683 Bacteria 16367
458 Ga0495658_0182417 3300046683 Bacteria 1303
459 Ga0495613_0005530 3300046689 Bacteria 9485
460 Ga0495613_0199293 3300046689 Bacteria 1412
461 Ga0495604_0007736 3300047317 Bacteria 8512
462 Ga0495604_0029158 3300047317 Bacteria 4390
463 Ga0495604_0052727 3300047317 Bacteria 3148
464 Ga0495604_0064971 3300047317 Bacteria 2779
465 Ga0495604_0196319 3300047317 Bacteria 1403
466 Ga0495674_0042794 3300047319 Bacteria 4037
467 Ga0495674_0116521 3300047319 Bacteria 2260
468 Ga0495676_0062701 3300047321 Bacteria 2901
469 Ga0495676_0082339 3300047321 Bacteria 2436
470 Ga0495680_0007406 3300047322 Bacteria 10066
471 Ga0495680_0019787 3300047322 Bacteria 5676
472 Ga0495680_0155661 3300047322 Bacteria 1663
473 Ga0495680_0164646 3300047322 Bacteria 1608
474 Ga0495687_033246 3300047443 Bacteria 2342
475 Ga0495675_0008439 3300047444 Bacteria 6383
476 Ga0495679_094254 3300047446 Bacteria 837
477 Ga0495684_0072882 3300047471 Bacteria 2609
478 Ga0495684_0147958 3300047471 Bacteria 1758
479 Ga0495684_0249205 3300047471 Bacteria 1293
480 Ga0495684_0266262 3300047471 Bacteria 1241
481 Ga0495593_0073081 3300047673 Bacteria 1779
482 Ga0495602_0007703 3300048088 Bacteria 11258
483 Ga0495602_0008247 3300048088 Bacteria 10879
484 Ga0495602_0040749 3300048088 Bacteria 4253
485 Ga0495602_0056229 3300048088 Bacteria 3461
486 Ga0495614_0227468 3300048089 Bacteria 849
487 Ga0495626_0146227 3300048091 Bacteria 999
488 Ga0496100_0010727 3300048903 Bacteria 5195
489 Ga0496100_0016956 3300048903 Bacteria 4287
490 Ga0496101_0030950 3300048904 Bacteria 3757
491 Ga0496102_0004469 3300048905 Bacteria 11799
492 Ga0496102_0054690 3300048905 Bacteria 3640
493 Ga0496102_0093976 3300048905 Bacteria 2778
494 Ga0496102_0144634 3300048905 Bacteria 2231
495 Ga0496102_0183389 3300048905 Bacteria 1972
496 Ga0496102_0229204 3300048905 Bacteria 1751
497 Ga0496102_0283571 3300048905 Bacteria 1561
498 Ga0496102_0300223 3300048905 Bacteria 1513
499 Ga0496103_0007284 3300048906 Bacteria 6593
500 Ga0496103_0116220 3300048906 Bacteria 1702
501 Ga0496104_0000055 3300048907 Bacteria 124267
502 Ga0496104_0003540 3300048907 Bacteria 13466
503 Ga0496104_0008257 3300048907 Bacteria 9245
504 Ga0496104_0435682 3300048907 Bacteria 1223
505 Ga0496105_0000797 3300048908 Bacteria 21298
506 Ga0496105_0012262 3300048908 Bacteria 6786
507 Ga0496105_0020421 3300048908 Bacteria 5352
508 Ga0496105_0115646 3300048908 Bacteria 2212
509 Ga0496107_0015062 3300048910 Bacteria 5417
510 Ga0496107_0024577 3300048910 Bacteria 4262
511 Ga0496108_0002024 3300048911 Bacteria 16234
512 Ga0496108_0004408 3300048911 Bacteria 11325
513 Ga0496108_0121897 3300048911 Bacteria 2237
514 Ga0496109_0001887 3300048912 Bacteria 17391
515 Ga0496109_0017110 3300048912 Bacteria 6346
516 Ga0496109_0050361 3300048912 Bacteria 3793
517 Ga0496109_0075889 3300048912 Bacteria 3090
518 Ga0496110_0004828 3300048913 Bacteria 10504
519 Ga0496110_0303778 3300048913 Bacteria 1453
520 Ga0496110_0311797 3300048913 Bacteria 1433
521 Ga0496111_0001458 3300048914 Bacteria 13525
522 Ga0496111_0082817 3300048914 Bacteria 2343
523 Ga0496111_0138127 3300048914 Bacteria 1806
524 Ga0496112_0008278 3300048915 Bacteria 9305
525 Ga0496112_0026418 3300048915 Bacteria 5586
526 Ga0496112_0152710 3300048915 Bacteria 2276
527 Ga0496113_0008064 3300048916 Bacteria 6834
528 Ga0496113_0011316 3300048916 Bacteria 5946
529 Ga0496113_0020314 3300048916 Bacteria 4667
530 Ga0496113_0080341 3300048916 Bacteria 2498
531 Ga0496114_0078664 3300048917 Bacteria 2782
532 Ga0496114_0211875 3300048917 Bacteria 1699
533 Ga0496115_0039056 3300048918 Bacteria 3769
534 Ga0496115_0071180 3300048918 Bacteria 2820
535 Ga0496115_0077469 3300048918 Bacteria 2703
536 Ga0496115_0293493 3300048918 Bacteria 1333
537 Ga0496117_0053718 3300048920 Bacteria 2829
538 Ga0496119_0000344 3300048922 Bacteria 65097
539 Ga0496119_0002572 3300048922 Bacteria 19717
540 Ga0496121_0166975 3300048924 Bacteria 1603
541 Ga0496122_0011879 3300048925 Bacteria 8749
542 Ga0496123_0005458 3300048926 Bacteria 12799
543 Ga0496124_0158266 3300048927 Bacteria 1769
544 Ga0501031_0000166 3300049568 Bacteria 37199
545 Ga0501031_0025653 3300049568 Bacteria 3844
546 Ga0501031_0130464 3300049568 Bacteria 1642
547 Ga0501031_0156460 3300049568 Bacteria 1490
548 Ga0501032_0000384 3300049569 Bacteria 36492
549 Ga0501032_0005222 3300049569 Bacteria 9665
550 Ga0501033_0000511 3300049570 Bacteria 36490
551 Ga0501033_0034340 3300049570 Bacteria 3806
552 Ga0501033_0036461 3300049570 Bacteria 3685
553 Ga0501033_0072778 3300049570 Bacteria 2523
554 Ga0501033_0073043 3300049570 Bacteria 2518
555 Ga0501034_0001159 3300049571 Bacteria 36532
556 Ga0501034_0001769 3300049571 Bacteria 27612
557 Ga0501034_0041858 3300049571 Bacteria 4635
558 Ga0501034_0278589 3300049571 Bacteria 1612
559 Ga0501034_0471844 3300049571 Bacteria 1171
560 Ga0501036_0000248 3300049572 Bacteria 36490
561 Ga0501037_0000389 3300049573 Bacteria 36523
562 Ga0501037_0020819 3300049573 Bacteria 4842
563 Ga0501037_0045208 3300049573 Bacteria 3232
564 Ga0501037_0045725 3300049573 Bacteria 3213
565 Ga0501038_0000433 3300049574 Bacteria 36490
566 Ga0501038_0060799 3300049574 Bacteria 3232
567 Ga0501038_0099584 3300049574 Bacteria 2423
568 Ga0501039_0000279 3300049575 Bacteria 36490
569 Ga0501039_0175451 3300049575 Bacteria 1685
570 Ga0501040_0015093 3300049576 Bacteria 5104
571 Ga0501042_0108850 3300049578 Bacteria 1995
572 Ga0501043_0000452 3300049579 Bacteria 36530
573 Ga0501043_0057397 3300049579 Bacteria 3057
574 Ga0501043_0174320 3300049579 Bacteria 1677
575 Ga0501047_0000677 3300049581 Bacteria 35497
576 Ga0501047_0074907 3300049581 Bacteria 3258
577 Ga0501047_0128563 3300049581 Bacteria 2413
578 Ga0501047_0182779 3300049581 Bacteria 1963
579 Ga0501047_0827165 3300049581 Bacteria 740
580 Ga0501048_0004698 3300049582 Bacteria 10399
581 Ga0501067_0009463 3300049583 Bacteria 5399
582 Ga0501067_0018832 3300049583 Bacteria 3821
583 Ga0501068_0003218 3300049584 Bacteria 8747
584 Ga0501069_0135635 3300049585 Bacteria 1411
585 Ga0501069_0241699 3300049585 Bacteria 1052
586 Ga0501070_0032726 3300049586 Bacteria 4350
587 Ga0501070_0043124 3300049586 Bacteria 3755
588 Ga0501070_0154614 3300049586 Bacteria 1892
589 Ga0501071_0069902 3300049587 Bacteria 2557
590 Ga0501071_0170165 3300049587 Bacteria 1631
591 Ga0501072_0004195 3300049588 Bacteria 10925
592 Ga0501073_0025687 3300049589 Bacteria 4221
593 Ga0501073_0038639 3300049589 Bacteria 3384
594 Ga0501073_0066587 3300049589 Bacteria 2511
595 Ga0501074_0044730 3300049590 Bacteria 3204
596 Ga0501074_0093956 3300049590 Bacteria 2148
597 Ga0501074_0130257 3300049590 Bacteria 1800
598 Ga0501080_0044678 3300049742 Bacteria 4124
599 Ga0501080_0485492 3300049742 Bacteria 1105
600 Ga0501080_0698425 3300049742 Bacteria 895
601 Ga0501083_0046096 3300049744 Bacteria 2948
602 Ga0501083_0067811 3300049744 Bacteria 2374
603 Ga0501083_0086999 3300049744 Bacteria 2067
604 Ga0501083_0309078 3300049744 Bacteria 1028
605 Ga0501035_0000651 3300049822 Bacteria 38225
606 Ga0501035_0064636 3300049822 Bacteria 3251
607 Ga0501044_0000862 3300049823 Bacteria 36490
608 Ga0501044_0019854 3300049823 Bacteria 7177
609 Ga0501044_0025214 3300049823 Bacteria 6305
610 Ga0501044_0056088 3300049823 Bacteria 4045
611 Ga0501044_0211761 3300049823 Bacteria 1892
612 Ga0501044_0278927 3300049823 Bacteria 1605
613 Ga0501045_0018395 3300049824 Bacteria 4970
614 nmdc:mga03683_47570_c1 3300050489 Bacteria 1780
615 nmdc:mga03n38_16303_c1 3300050490 Bacteria 2888
616 nmdc:mga00v17_114749_c1 3300050491 Bacteria 1711
617 nmdc:mga00v17_16996_c1 3300050491 Bacteria 4109
618 nmdc:mga00v17_37745_c1 3300050491 Bacteria 2886
619 nmdc:mga0yw44_153322_c1 3300050492 Bacteria 1504
620 nmdc:mga0yw44_20790_c1 3300050492 Bacteria 3649
621 nmdc:mga0yw44_8593_c1 3300050492 Bacteria 5099
622 nmdc:mga0yw44_99598_c1 3300050492 Bacteria 1849
623 nmdc:mga0k408_28578_c1 3300050493 Bacteria 3171
624 nmdc:mga06z11_38624_c1 3300050494 Bacteria 2372
625 nmdc:mga06z11_659_c1 3300050494 Bacteria 11138
626 nmdc:mga07m45_267935_c1 3300050496 Bacteria 994
627 nmdc:mga05p37_4816_c1 3300050507 Bacteria 15790
628 nmdc:mga06r32_209654_c1 3300050510 Bacteria 1936
629 nmdc:mga06r32_99192_c1 3300050510 Bacteria 2856
630 nmdc:mga0n895_103856_c1 3300050512 Bacteria 2854
631 nmdc:mga0n895_42236_c1 3300050512 Bacteria 4436
632 nmdc:mga0rr50_205118_c1 3300050513 Bacteria 1622
633 nmdc:mga0rr50_24524_c1 3300050513 Bacteria 4178
634 nmdc:mga08x19_9716_c1 3300050514 Bacteria 5760
635 nmdc:mga0a205_86288_c1 3300050515 Bacteria 3031
636 nmdc:mga0sz30_16451_c1 3300050516 Bacteria 2938
637 nmdc:mga0sz30_76197_c1 3300050516 Bacteria 1448
638 Ga0495601_0004059 3300053077 Bacteria 8442
639 Ga0495601_0005636 3300053077 Bacteria 7300
640 Ga0495601_0016725 3300053077 Bacteria 4447
641 Ga0495612_0001521 3300053078 Bacteria 9544
642 Ga0495612_0002491 3300053078 Bacteria 7590
643 Ga0495612_0015912 3300053078 Bacteria 3014
644 Ga0495612_0030188 3300053078 Bacteria 2184
645 Ga0495612_0046200 3300053078 Bacteria 1783
646 Ga0495595_0000380 3300053084 Bacteria 16825
647 Ga0495595_0007849 3300053084 Bacteria 4371
648 Ga0495619_0000085 3300053085 Bacteria 70073
649 Ga0495619_0000442 3300053085 Bacteria 27859
650 Ga0495619_0000536 3300053085 Bacteria 25079
651 Ga0495619_0011298 3300053085 Bacteria 5618
652 Ga0495619_0020082 3300053085 Bacteria 4251
653 Ga0495619_0061326 3300053085 Bacteria 2502
654 Ga0500556_0000122 3300053104 Bacteria 67150
655 Ga0500593_000036 3300053117 Bacteria 47889
656 Ga0500568_0000002 3300053139 Bacteria 880601
657 Ga0500568_0000104 3300053139 Bacteria 78075
658 Ga0500604_0079305 3300053151 Bacteria 1058
659 Ga0500620_021403 3300053155 Bacteria 1932
660 Ga0501084_0037737 3300054114 Bacteria 4038
661 Ga0501084_0054562 3300054114 Bacteria 3343
662 Ga0501084_0282195 3300054114 Bacteria 1402
663 Ga0501082_0000032 3300060353 Bacteria 99261
664 Ga0466962_0032763 3300061719 Bacteria 2487
665 Ga0466962_0050053 3300061719 Bacteria 1997
666 Ga0466962_0050886 3300061719 Bacteria 1981

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036401 Ga0373937_0636318 Ga0373937_0636318_45_731 214
2 3300047446 Ga0495679_094254 Ga0495679_094254_29_715 214
3 3300053151 Ga0500604_0079305 Ga0500604_0079305_290_1033 218
4 3300048089 Ga0495614_0227468 Ga0495614_0227468_24_719 219
5 3300049581 Ga0501047_0827165 Ga0501047_0827165_19_723 219
6 3300037418 Ga0395900_0144680 Ga0395900_0144680_767_1453 228
7 3300037466 Ga0395898_0038675 Ga0395898_0038675_131_817 228
8 3300005530 Ga0070679_100510759 Ga0070679_1005107591 233
9 3300034817 Ga0373948_0022159 Ga0373948_0022159_405_1178 244
10 3300035115 Ga0373941_0024519 Ga0373941_0024519_950_1723 244
11 3300035691 Ga0373931_0167389 Ga0373931_0167389_508_1281 244
12 3300046674 Ga0495588_0301765 Ga0495588_0301765_53_832 244
13 3300046679 Ga0495623_0339024 Ga0495623_0339024_32_808 244
14 3300049571 Ga0501034_0278589 Ga0501034_0278589_818_1594 244
15 iso_pu_bacteria 2919450847 2919454906 246
16 iso_pu_bacteria 8001845381 8001849347 246
17 3300035170 Ga0373943_0164217 Ga0373943_0164217_19_798 247
18 3300005718 Ga0068866_10091414 Ga0068866_100914142 249
19 3300037853 Ga0436364_1505086 Ga0436364_1505086_15470_16267 249
20 3300009098 Ga0105245_10759657 Ga0105245_107596571 250
21 3300044683 Ga0466965_0133181 Ga0466965_0133181_133_1023 251
22 iso_pu_bacteria 2965032056 2965032098 251
23 3300026118 Ga0207675_100016232 Ga0207675_1000162325 252
24 3300049583 Ga0501067_0009463 Ga0501067_0009463_3489_4322 252
25 3300049583 Ga0501067_0018832 Ga0501067_0018832_292_1128 252
26 3300049589 Ga0501073_0066587 Ga0501073_0066587_884_1717 252
27 3300049744 Ga0501083_0086999 Ga0501083_0086999_105_938 252
28 3300054114 Ga0501084_0054562 Ga0501084_0054562_661_1494 252
29 3300054114 Ga0501084_0037737 Ga0501084_0037737_1610_2452 253
30 iso_pu_bacteria 2917554339 2917554934 253
31 3300005985 Ga0081539_10001777 Ga0081539_100017779 254
32 3300044694 Ga0466963_0319368 Ga0466963_0319368_162_1013 254
33 3300045049 Ga0466959_0103152 Ga0466959_0103152_30_881 254
34 3300046460 Ga0495638_0021151 Ga0495638_0021151_813_1691 254
35 3300048907 Ga0496104_0435682 Ga0496104_0435682_357_1208 254
36 3300050492 nmdc:mga0yw44_153322_c1 nmdc:mga0yw44_153322_c1_474_1352 254
37 iso_pu_bacteria 2503198000 2503199165 254
38 iso_pu_bacteria 2508501123 2509116541 254
39 iso_pu_bacteria 2508501127 2509144290 254
40 iso_pu_bacteria 2509276018 2509372515 254
41 iso_pu_bacteria 2509276022 2509394105 254
42 iso_pu_bacteria 2512875016 2512933440 254
43 iso_pu_bacteria 2512875024 2512961556 254
44 iso_pu_bacteria 2513237090 2513613342 254
45 iso_pu_bacteria 2513237164 2514036841 254
46 iso_pu_bacteria 2513237305 2514418131 254
47 iso_pu_bacteria 2513237351 2514586908 254
48 iso_pu_bacteria 2588253730 2588519511 254
49 iso_pu_bacteria 2597489875 2597811787 254
50 iso_pu_bacteria 2599185301 2599937050 254
51 iso_pu_bacteria 2643221551 2643777471 254
52 iso_pu_bacteria 2643221555 2643795919 254
53 iso_pu_bacteria 2687453392 2688596450 254
54 iso_pu_bacteria 2693429783 2694630130 254
55 iso_pu_bacteria 2721755686 2723573540 254
56 iso_pu_bacteria 2738543024 2739306137 254
57 iso_pu_bacteria 2837678835 2837682524 254
58 iso_pu_bacteria 2841734538 2841736871 254
59 iso_pu_bacteria 2844009547 2844011276 254
60 iso_pu_bacteria 2847670302 2847673855 254
61 iso_pu_bacteria 2847686936 2847690350 254
62 iso_pu_bacteria 2856314179 2856320494 254
63 iso_pu_bacteria 2856320880 2856327308 254
64 iso_pu_bacteria 2856328259 2856328405 254
65 iso_pu_bacteria 2856334872 2856338593 254
66 iso_pu_bacteria 2856342000 2856344591 254
67 iso_pu_bacteria 2856349417 2856350841 254
68 iso_pu_bacteria 2856356410 2856356739 254
69 iso_pu_bacteria 2856364286 2856364963 254
70 iso_pu_bacteria 2857349434 2857353347 254
71 iso_pu_bacteria 2857367948 2857373407 254
72 iso_pu_bacteria 2869169390 2869174427 254
73 iso_pu_bacteria 2869234852 2869235963 254
74 iso_pu_bacteria 2869242130 2869244428 254
75 iso_pu_bacteria 2869249662 2869254069 254
76 iso_pu_bacteria 2869256925 2869257182 254
77 iso_pu_bacteria 2869264136 2869266410 254
78 iso_pu_bacteria 2869271264 2869273102 254
79 iso_pu_bacteria 2869278585 2869279465 254
80 iso_pu_bacteria 2869285874 2869286412 254
81 iso_pu_bacteria 2871429161 2871430381 254
82 iso_pu_bacteria 2871435913 2871440122 254
83 iso_pu_bacteria 2871444079 2871450556 254
84 iso_pu_bacteria 2871451962 2871452074 254
85 iso_pu_bacteria 2871474448 2871477133 254
86 iso_pu_bacteria 2871481445 2871483774 254
87 iso_pu_bacteria 2871488783 2871494809 254
88 iso_pu_bacteria 2874102143 2874102889 254
89 iso_pu_bacteria 2874109183 2874116329 254
90 iso_pu_bacteria 2874116593 2874119661 254
91 iso_pu_bacteria 2874123672 2874130188 254
92 iso_pu_bacteria 2874131515 2874135960 254
93 iso_pu_bacteria 2874139085 2874139544 254
94 iso_pu_bacteria 2874146452 2874146799 254
95 iso_pu_bacteria 2874155637 2874155872 254
96 iso_pu_bacteria 2874162495 2874165497 254
97 iso_pu_bacteria 2874168670 2874176710 254
98 iso_pu_bacteria 2876363079 2876364306 254
99 iso_pu_bacteria 2876369609 2876377607 254
100 iso_pu_bacteria 2876377896 2876385159 254
101 iso_pu_bacteria 2876386047 2876386370 254
102 iso_pu_bacteria 2876399893 2876402245 254
103 iso_pu_bacteria 2876413966 2876414201 254
104 iso_pu_bacteria 2876420981 2876421331 254
105 iso_pu_bacteria 2878035449 2878038909 254
106 iso_pu_bacteria 2878730984 2878737036 254
107 iso_pu_bacteria 2878738818 2878741991 254
108 iso_pu_bacteria 2878745973 2878746577 254
109 iso_pu_bacteria 2878753008 2878759942 254
110 iso_pu_bacteria 2878760144 2878765079 254
111 iso_pu_bacteria 2878767105 2878772251 254
112 iso_pu_bacteria 2878774303 2878776494 254
113 iso_pu_bacteria 2878781027 2878785775 254
114 iso_pu_bacteria 2881147464 2881148651 254
115 iso_pu_bacteria 2881155292 2881159730 254
116 iso_pu_bacteria 2881161766 2881165432 254
117 iso_pu_bacteria 2881845957 2881851216 254
118 iso_pu_bacteria 2881861095 2881866955 254
119 iso_pu_bacteria 2882632389 2882640253 254
120 iso_pu_bacteria 2882912400 2882914155 254
121 iso_pu_bacteria 2885305155 2885307287 254
122 iso_pu_bacteria 2885312484 2885313673 254
123 iso_pu_bacteria 2885318864 2885322822 254
124 iso_pu_bacteria 2885326080 2885329056 254
125 iso_pu_bacteria 2885334103 2885339364 254
126 iso_pu_bacteria 2885342637 2885343615 254
127 iso_pu_bacteria 2885350715 2885352456 254
128 iso_pu_bacteria 2888337043 2888337126 254
129 iso_pu_bacteria 2888343758 2888344838 254
130 iso_pu_bacteria 2888350351 2888353607 254
131 iso_pu_bacteria 2889010040 2889015327 254
132 iso_pu_bacteria 2889016732 2889019599 254
133 iso_pu_bacteria 2891048133 2891048767 254
134 iso_pu_bacteria 2903448605 2903455170 254
135 iso_pu_bacteria 2903492973 2903494167 254
136 iso_pu_bacteria 2903492973 2903499767 254
137 iso_pu_bacteria 2903521522 2903523927 254
138 iso_pu_bacteria 2903528002 2903530426 254
139 iso_pu_bacteria 2903540706 2903545881 254
140 iso_pu_bacteria 2906308376 2906308979 254
141 iso_pu_bacteria 2906321335 2906322259 254
142 iso_pu_bacteria 2906328253 2906333788 254
143 iso_pu_bacteria 2906363423 2906367577 254
144 iso_pu_bacteria 2906370794 2906373810 254
145 iso_pu_bacteria 2906386501 2906390269 254
146 iso_pu_bacteria 2906393657 2906398157 254
147 iso_pu_bacteria 2906401398 2906402686 254
148 iso_pu_bacteria 2906408224 2906409972 254
149 iso_pu_bacteria 2906414383 2906421273 254
150 iso_pu_bacteria 2922130491 2922136709 254
151 iso_pu_bacteria 2922151315 2922157601 254
152 iso_pu_bacteria 2922158528 2922161308 254
153 iso_pu_bacteria 2922172374 2922173562 254
154 iso_pu_bacteria 2922178524 2922183708 254
155 iso_pu_bacteria 2922185730 2922193556 254
156 iso_pu_bacteria 2924710171 2924714556 254
157 iso_pu_bacteria 2924718760 2924725504 254
158 iso_pu_bacteria 2924726620 2924730450 254
159 iso_pu_bacteria 2924733363 2924734412 254
160 iso_pu_bacteria 2924741084 2924744531 254
161 iso_pu_bacteria 2924748358 2924751012 254
162 iso_pu_bacteria 2924754689 2924759883 254
163 iso_pu_bacteria 2924762789 2924765404 254
164 iso_pu_bacteria 2924776078 2924779675 254
165 iso_pu_bacteria 2924784321 2924790747 254
166 iso_pu_bacteria 2937813078 2937822319 254
167 iso_pu_bacteria 2937822353 2937826890 254
168 iso_pu_bacteria 2937836603 2937841280 254
169 iso_pu_bacteria 2937861824 2937866204 254
170 iso_pu_bacteria 2937868953 2937873903 254
171 iso_pu_bacteria 2937877337 2937878169 254
172 iso_pu_bacteria 2937891427 2937896331 254
173 iso_pu_bacteria 2937972304 2937972924 254
174 iso_pu_bacteria 2937980651 2937982799 254
175 iso_pu_bacteria 2937994558 2937999735 254
176 iso_pu_bacteria 2938014810 2938022276 254
177 iso_pu_bacteria 2958034702 2958035043 254
178 iso_pu_bacteria 2958041894 2958044074 254
179 iso_pu_bacteria 2958041894 2958057330 254
180 iso_pu_bacteria 2958064165 2958068544 254
181 iso_pu_bacteria 2958071322 2958073147 254
182 iso_pu_bacteria 2958084443 2958085283 254
183 iso_pu_bacteria 2958092219 2958098747 254
184 iso_pu_bacteria 2958100919 2958107667 254
185 iso_pu_bacteria 2958108152 2958110765 254
186 iso_pu_bacteria 2958115193 2958120523 254
187 iso_pu_bacteria 2958122699 2958122947 254
188 iso_pu_bacteria 2958130278 2958130813 254
189 iso_pu_bacteria 2958137437 2958143015 254
190 iso_pu_bacteria 2958158011 2958164045 254
191 iso_pu_bacteria 2958165035 2958170203 254
192 iso_pu_bacteria 2958172287 2958173573 254
193 iso_pu_bacteria 2958179912 2958180151 254
194 iso_pu_bacteria 2961077736 2961077978 254
195 iso_pu_bacteria 2961127735 2961130543 254
196 iso_pu_bacteria 2961136820 2961136925 254
197 iso_pu_bacteria 2961163497 2961168654 254
198 iso_pu_bacteria 2961170736 2961177214 254
199 iso_pu_bacteria 2961183825 2961185207 254
200 iso_pu_bacteria 2963644680 2963645764 254
201 iso_pu_bacteria 2965018300 2965023466 254
202 iso_pu_bacteria 2965025482 2965030939 254
203 iso_pu_bacteria 2965040258 2965041782 254
204 iso_pu_bacteria 2965047637 2965052175 254
205 iso_pu_bacteria 2965062239 2965062261 254
206 iso_pu_bacteria 2965089291 2965094418 254
207 iso_pu_bacteria 2965102966 2965106301 254
208 iso_pu_bacteria 2965119406 2965125894 254
209 iso_pu_bacteria 2967996073 2968002305 254
210 iso_pu_bacteria 2968003550 2968009539 254
211 iso_pu_bacteria 2968016561 2968023463 254
212 iso_pu_bacteria 2968083720 2968089272 254
213 iso_pu_bacteria 2968097103 2968101939 254
214 iso_pu_bacteria 2968117919 2968122255 254
215 iso_pu_bacteria 2968128360 2968133209 254
216 iso_pu_bacteria 2968138860 2968143041 254
217 iso_pu_bacteria 2968171901 2968177066 254
218 iso_pu_bacteria 2970469710 2970476045 254
219 iso_pu_bacteria 2970489779 2970493732 254
220 iso_pu_bacteria 2970503327 2970509888 254
221 iso_pu_bacteria 2970510686 2970512591 254
222 iso_pu_bacteria 2970524798 2970526563 254
223 iso_pu_bacteria 2970532167 2970537167 254
224 iso_pu_bacteria 2970540015 2970540042 254
225 iso_pu_bacteria 2970547951 2970552343 254
226 iso_pu_bacteria 2970554993 2970559926 254
227 iso_pu_bacteria 2970593180 2970594065 254
228 iso_pu_bacteria 2970627176 2970627209 254
229 iso_pu_bacteria 2977821940 2977828464 254
230 iso_pu_bacteria 2977828996 2977836485 254
231 iso_pu_bacteria 2977843712 2977844185 254
232 iso_pu_bacteria 2977851361 2977857658 254
233 iso_pu_bacteria 2977858184 2977864907 254
234 iso_pu_bacteria 2977864932 2977869779 254
235 iso_pu_bacteria 2977872689 2977878376 254
236 iso_pu_bacteria 2977898635 2977906273 254
237 iso_pu_bacteria 2977907340 2977914183 254
238 iso_pu_bacteria 2977915119 2977922566 254
239 iso_pu_bacteria 2977935797 2977941791 254
240 iso_pu_bacteria 2977942078 2977942319 254
241 iso_pu_bacteria 2977950692 2977954456 254
242 iso_pu_bacteria 2977957713 2977962686 254
243 iso_pu_bacteria 2977971508 2977975117 254
244 iso_pu_bacteria 2977986579 2977991227 254
245 iso_pu_bacteria 2979710463 2979710835 254
246 iso_pu_bacteria 2979742915 2979745545 254
247 iso_pu_bacteria 2979764755 2979770811 254
248 iso_pu_bacteria 2979772303 2979776811 254
249 iso_pu_bacteria 2979779861 2979782398 254
250 iso_pu_bacteria 2979793036 2979794832 254
251 iso_pu_bacteria 2979808191 2979814764 254
252 iso_pu_bacteria 2987636660 2987641940 254
253 iso_pu_bacteria 2987645492 2987646318 254
254 iso_pu_bacteria 2987652177 2987655314 254
255 iso_pu_bacteria 2987659509 2987664683 254
256 iso_pu_bacteria 2987666974 2987669748 254
257 iso_pu_bacteria 2987673487 2987680773 254
258 iso_pu_bacteria 2996310559 2996315310 254
259 iso_pu_bacteria 2996341866 2996346716 254
260 iso_pu_bacteria 2996348954 2996354626 254
261 iso_pu_bacteria 2996386984 2996389558 254
262 iso_pu_bacteria 3000135777 3000137841 254
263 iso_pu_bacteria 3004188549 3004193738 254
264 iso_pu_bacteria 3004195979 3004202666 254
265 iso_pu_bacteria 3004203850 3004209249 254
266 iso_pu_bacteria 3004232784 3004237783 254
267 iso_pu_bacteria 3004239961 3004243251 254
268 iso_pu_bacteria 3004248173 3004251952 254
269 iso_pu_bacteria 3004268573 3004269094 254
270 iso_pu_bacteria 3004275668 3004281274 254
271 iso_pu_bacteria 3004334049 3004336704 254
272 iso_pu_bacteria 637000159 637076541 254
273 iso_pu_bacteria 649633066 649871001 254
274 iso_pu_bacteria 8002285264 8002290697 254
275 iso_pu_bacteria 8004300914 8004306830 254
276 iso_pu_bacteria 8004361976 8004363709 254
277 iso_pu_bacteria 8004374579 8004381441 254
278 iso_pu_bacteria 8004387939 8004388614 254
279 iso_pu_bacteria 8004445564 8004452218 254
280 iso_pu_bacteria 8004633249 8004635437 254
281 iso_pu_bacteria 8004640170 8004646414 254
282 iso_pu_bacteria 8004695233 8004700419 254
283 iso_pu_bacteria 8004703790 8004706319 254
284 iso_pu_bacteria 8004714634 8004715235 254
285 iso_pu_bacteria 8004727605 8004728998 254
286 iso_pu_bacteria 8055617313 8055618392 254
287 3300044842 Ga0466957_0301227 Ga0466957_0301227_184_1032 255
288 3300061719 Ga0466962_0032763 Ga0466962_0032763_91_939 255
289 3300005353 Ga0070669_100164922 Ga0070669_1001649222 256
290 3300005548 Ga0070665_100065860 Ga0070665_1000658604 256
291 3300006038 Ga0075365_10092287 Ga0075365_100922873 256
292 3300006042 Ga0075368_10039114 Ga0075368_100391143 256
293 3300006048 Ga0075363_100117986 Ga0075363_1001179863 256
294 3300006177 Ga0075362_10089358 Ga0075362_100893582 256
295 3300006186 Ga0075369_10120529 Ga0075369_101205292 256
296 3300009093 Ga0105240_10041350 Ga0105240_100413505 256
297 3300009148 Ga0105243_10030161 Ga0105243_100301615 256
298 3300009545 Ga0105237_10068044 Ga0105237_100680444 256
299 3300009551 Ga0105238_10005562 Ga0105238_100055628 256
300 3300010375 Ga0105239_10022803 Ga0105239_100228033 256
301 3300010375 Ga0105239_10030197 Ga0105239_100301973 256
302 3300010375 Ga0105239_10201567 Ga0105239_102015672 256
303 3300015261 Ga0182006_1027380 Ga0182006_10273802 256
304 3300025250 Ga0209026_1000032 Ga0209026_1000032166 256
305 3300025256 Ga0209759_1000142 Ga0209759_100014231 256
306 3300025261 Ga0209233_1000030 Ga0209233_100003037 256
307 3300025261 Ga0209233_1009633 Ga0209233_10096333 256
308 3300025904 Ga0207647_10005873 Ga0207647_1000587310 256
309 3300025924 Ga0207694_10008304 Ga0207694_100083044 256
310 3300026067 Ga0207678_10413604 Ga0207678_104136041 256
311 3300026089 Ga0207648_10483688 Ga0207648_104836881 256
312 3300026142 Ga0207698_10058439 Ga0207698_100584394 256
313 3300028379 Ga0268266_10019048 Ga0268266_100190485 256
314 3300028379 Ga0268266_10131554 Ga0268266_101315544 256
315 3300037312 Ga0395899_0000058 Ga0395899_0000058_159212_160078 256
316 3300037418 Ga0395900_0043962 Ga0395900_0043962_587_1471 256
317 3300037418 Ga0395900_0228201 Ga0395900_0228201_298_1182 256
318 3300037471 Ga0395905_0263078 Ga0395905_0263078_273_1157 256
319 3300037471 Ga0395905_0459597 Ga0395905_0459597_155_1039 256
320 3300038443 Ga0395901_0044071 Ga0395901_0044071_2354_3211 256
321 3300038443 Ga0395901_0131108 Ga0395901_0131108_895_1779 256
322 3300044683 Ga0466965_0112551 Ga0466965_0112551_305_1189 256
323 3300044901 Ga0466960_0065737 Ga0466960_0065737_168_1052 256
324 3300046507 Ga0495606_0213347 Ga0495606_0213347_106_990 256
325 3300046522 Ga0495643_0020016 Ga0495643_0020016_2737_3621 256
326 3300047443 Ga0495687_033246 Ga0495687_033246_611_1495 256
327 3300048091 Ga0495626_0146227 Ga0495626_0146227_73_957 256
328 3300048905 Ga0496102_0283571 Ga0496102_0283571_625_1509 256
329 3300048915 Ga0496112_0026418 Ga0496112_0026418_1201_2085 256
330 3300048920 Ga0496117_0053718 Ga0496117_0053718_1551_2435 256
331 3300048924 Ga0496121_0166975 Ga0496121_0166975_221_1105 256
332 3300048927 Ga0496124_0158266 Ga0496124_0158266_604_1488 256
333 3300049568 Ga0501031_0000166 Ga0501031_0000166_24526_25410 256
334 3300049568 Ga0501031_0025653 Ga0501031_0025653_1960_2844 256
335 3300049569 Ga0501032_0000384 Ga0501032_0000384_24528_25412 256
336 3300049569 Ga0501032_0005222 Ga0501032_0005222_6664_7548 256
337 3300049570 Ga0501033_0000511 Ga0501033_0000511_24526_25410 256
338 3300049570 Ga0501033_0073043 Ga0501033_0073043_1238_2125 256
339 3300049571 Ga0501034_0001159 Ga0501034_0001159_24526_25410 256
340 3300049571 Ga0501034_0001769 Ga0501034_0001769_19233_20126 256
341 3300049572 Ga0501036_0000248 Ga0501036_0000248_24526_25410 256
342 3300049573 Ga0501037_0000389 Ga0501037_0000389_11114_11998 256
343 3300049573 Ga0501037_0045208 Ga0501037_0045208_1512_2396 256
344 3300049574 Ga0501038_0000433 Ga0501038_0000433_24526_25410 256
345 3300049574 Ga0501038_0060799 Ga0501038_0060799_837_1721 256
346 3300049575 Ga0501039_0000279 Ga0501039_0000279_24526_25410 256
347 3300049575 Ga0501039_0175451 Ga0501039_0175451_110_994 256
348 3300049576 Ga0501040_0015093 Ga0501040_0015093_1998_2882 256
349 3300049578 Ga0501042_0108850 Ga0501042_0108850_239_1123 256
350 3300049579 Ga0501043_0000452 Ga0501043_0000452_11122_12006 256
351 3300049579 Ga0501043_0174320 Ga0501043_0174320_527_1414 256
352 3300049581 Ga0501047_0000677 Ga0501047_0000677_17831_18715 256
353 3300049581 Ga0501047_0074907 Ga0501047_0074907_719_1609 256
354 3300049581 Ga0501047_0128563 Ga0501047_0128563_692_1576 256
355 3300049582 Ga0501048_0004698 Ga0501048_0004698_7718_8602 256
356 3300049584 Ga0501068_0003218 Ga0501068_0003218_6808_7692 256
357 3300049585 Ga0501069_0135635 Ga0501069_0135635_472_1356 256
358 3300049586 Ga0501070_0032726 Ga0501070_0032726_2262_3146 256
359 3300049586 Ga0501070_0043124 Ga0501070_0043124_1513_2397 256
360 3300049587 Ga0501071_0069902 Ga0501071_0069902_297_1181 256
361 3300049589 Ga0501073_0038639 Ga0501073_0038639_525_1409 256
362 3300049590 Ga0501074_0044730 Ga0501074_0044730_169_1053 256
363 3300049742 Ga0501080_0044678 Ga0501080_0044678_1266_2150 256
364 3300049744 Ga0501083_0309078 Ga0501083_0309078_16_900 256
365 3300049822 Ga0501035_0000651 Ga0501035_0000651_25253_26137 256
366 3300049822 Ga0501035_0064636 Ga0501035_0064636_451_1338 256
367 3300049823 Ga0501044_0000862 Ga0501044_0000862_11081_11965 256
368 3300049823 Ga0501044_0019854 Ga0501044_0019854_5457_6341 256
369 3300049823 Ga0501044_0278927 Ga0501044_0278927_337_1224 256
370 3300049824 Ga0501045_0018395 Ga0501045_0018395_2118_3002 256
371 3300050491 nmdc:mga00v17_114749_c1 nmdc:mga00v17_114749_c1_73_957 256
372 3300050492 nmdc:mga0yw44_99598_c1 nmdc:mga0yw44_99598_c1_366_1250 256
373 3300050496 nmdc:mga07m45_267935_c1 nmdc:mga07m45_267935_c1_78_962 256
374 3300050516 nmdc:mga0sz30_76197_c1 nmdc:mga0sz30_76197_c1_546_1430 256
375 3300053139 Ga0500568_0000104 Ga0500568_0000104_10857_11741 256
376 3300053155 Ga0500620_021403 Ga0500620_021403_775_1659 256
377 3300006051 Ga0075364_10043125 Ga0075364_100431253 257
378 3300021388 Ga0213875_10012138 Ga0213875_100121382 257
379 3300037853 Ga0436364_0127534 Ga0436364_0127534_2907_3767 257
380 3300050491 nmdc:mga00v17_37745_c1 nmdc:mga00v17_37745_c1_921_1832 257
381 3300028800 Ga0265338_10030205 Ga0265338_100302051 259
382 3300039447 Ga0436361_0582741 Ga0436361_0582741_663_1505 259
383 3300048922 Ga0496119_0002572 Ga0496119_0002572_12930_13790 259
384 3300049570 Ga0501033_0072778 Ga0501033_0072778_1579_2439 259
385 3300049573 Ga0501037_0020819 Ga0501037_0020819_1963_2823 259
386 3300050510 nmdc:mga06r32_99192_c1 nmdc:mga06r32_99192_c1_1067_1888 261
387 3300049571 Ga0501034_0471844 Ga0501034_0471844_200_1069 262
388 3300048088 Ga0495602_0040749 Ga0495602_0040749_1112_1972 263
389 3300061719 Ga0466962_0050886 Ga0466962_0050886_689_1537 265
390 iso_pu_bacteria 2523231067 2523467409 266
391 iso_pu_bacteria 2545555834 2545675643 266
392 iso_pu_bacteria 2595698237 2596375007 266
393 iso_pu_bacteria 2738543031 2739347852 266
394 iso_pu_bacteria 2842698319 2842702458 266
395 iso_pu_bacteria 2842775625 2842777744 266
396 iso_pu_bacteria 2883577096 2883578302 266
397 iso_pu_bacteria 2884298095 2884299575 266
398 iso_pu_bacteria 2902405164 2902411364 266
399 iso_pu_bacteria 2909042592 2909044198 266
400 iso_pu_bacteria 2928125067 2928129930 266
401 iso_pu_bacteria 641522639 641641709 266
402 3300031852 Ga0307410_10379299 Ga0307410_103792992 267
403 iso_pu_bacteria 2622736605 2623500983 267
404 iso_pu_bacteria 2828305725 2828308722 267
405 iso_pu_bacteria 2842333319 2842336437 267
406 iso_pu_bacteria 2894772417 2894775621 267
407 iso_pu_bacteria 8057160832 8057163766 267
408 3300035113 Ga0373936_0128024 Ga0373936_0128024_21_866 268
409 3300046477 Ga0495664_0151921 Ga0495664_0151921_14_883 268
410 3300046511 Ga0495608_0143047 Ga0495608_0143047_534_1403 268
411 3300046683 Ga0495658_0182417 Ga0495658_0182417_139_1008 268
412 3300048905 Ga0496102_0004469 Ga0496102_0004469_2252_3121 268
413 3300048905 Ga0496102_0144634 Ga0496102_0144634_952_1821 268
414 3300048905 Ga0496102_0183389 Ga0496102_0183389_482_1351 268
415 3300048906 Ga0496103_0116220 Ga0496103_0116220_620_1489 268
416 3300048907 Ga0496104_0008257 Ga0496104_0008257_7202_8071 268
417 3300048908 Ga0496105_0020421 Ga0496105_0020421_1174_2043 268
418 3300048911 Ga0496108_0004408 Ga0496108_0004408_104_973 268
419 3300048912 Ga0496109_0017110 Ga0496109_0017110_2005_2874 268
420 3300048913 Ga0496110_0004828 Ga0496110_0004828_7559_8428 268
421 3300048913 Ga0496110_0311797 Ga0496110_0311797_76_1098 268
422 3300048914 Ga0496111_0001458 Ga0496111_0001458_7789_8658 268
423 3300048916 Ga0496113_0011316 Ga0496113_0011316_2672_3541 268
424 3300048917 Ga0496114_0078664 Ga0496114_0078664_1845_2714 268
425 3300048918 Ga0496115_0293493 Ga0496115_0293493_108_977 268
426 3300049744 Ga0501083_0046096 Ga0501083_0046096_1302_2147 268
427 iso_pu_bacteria 2929199973 2929204148 268
428 iso_pu_bacteria 8055909800 8055911324 268
429 3300005438 Ga0070701_10127453 Ga0070701_101274531 269
430 3300006914 Ga0075436_100008760 Ga0075436_1000087606 269
431 3300021388 Ga0213875_10001607 Ga0213875_1000160710 269
432 3300039437 Ga0436365_0696682 Ga0436365_0696682_659_1516 269
433 3300050514 nmdc:mga08x19_9716_c1 nmdc:mga08x19_9716_c1_2856_3701 269
434 3300003203 JGI25406J46586_10000109 JGI25406J46586_1000010929 270
435 3300003659 JGI25404J52841_10000082 JGI25404J52841_100000828 270
436 3300005327 Ga0070658_10056505 Ga0070658_100565052 270
437 3300005329 Ga0070683_100069233 Ga0070683_1000692333 270
438 3300005329 Ga0070683_100163430 Ga0070683_1001634302 270
439 3300005329 Ga0070683_100182341 Ga0070683_1001823412 270
440 3300005330 Ga0070690_100036374 Ga0070690_1000363742 270
441 3300005331 Ga0070670_100050719 Ga0070670_1000507193 270
442 3300005335 Ga0070666_10006286 Ga0070666_100062864 270
443 3300005335 Ga0070666_10014730 Ga0070666_100147302 270
444 3300005336 Ga0070680_100159738 Ga0070680_1001597381 270
445 3300005336 Ga0070680_100365256 Ga0070680_1003652561 270
446 3300005337 Ga0070682_100263438 Ga0070682_1002634382 270
447 3300005338 Ga0068868_100013509 Ga0068868_1000135092 270
448 3300005339 Ga0070660_100213575 Ga0070660_1002135752 270
449 3300005343 Ga0070687_100085215 Ga0070687_1000852152 270
450 3300005344 Ga0070661_100022274 Ga0070661_1000222743 270
451 3300005345 Ga0070692_10257612 Ga0070692_102576121 270
452 3300005347 Ga0070668_100200150 Ga0070668_1002001502 270
453 3300005347 Ga0070668_100325935 Ga0070668_1003259352 270
454 3300005354 Ga0070675_100278038 Ga0070675_1002780382 270
455 3300005355 Ga0070671_100097885 Ga0070671_1000978852 270
456 3300005364 Ga0070673_100041471 Ga0070673_1000414714 270
457 3300005365 Ga0070688_100007241 Ga0070688_1000072412 270
458 3300005366 Ga0070659_100086396 Ga0070659_1000863963 270
459 3300005367 Ga0070667_100032087 Ga0070667_1000320873 270
460 3300005367 Ga0070667_100060010 Ga0070667_1000600103 270
461 3300005434 Ga0070709_10010315 Ga0070709_100103153 270
462 3300005434 Ga0070709_10021445 Ga0070709_100214451 270
463 3300005435 Ga0070714_100085603 Ga0070714_1000856032 270
464 3300005435 Ga0070714_100445834 Ga0070714_1004458341 270
465 3300005435 Ga0070714_100687792 Ga0070714_1006877921 270
466 3300005436 Ga0070713_100016764 Ga0070713_1000167645 270
467 3300005436 Ga0070713_100022844 Ga0070713_1000228442 270
468 3300005436 Ga0070713_100119143 Ga0070713_1001191433 270
469 3300005437 Ga0070710_10002270 Ga0070710_100022704 270
470 3300005437 Ga0070710_10009019 Ga0070710_100090196 270
471 3300005437 Ga0070710_10067927 Ga0070710_100679271 270
472 3300005438 Ga0070701_10113335 Ga0070701_101133352 270
473 3300005439 Ga0070711_100016805 Ga0070711_1000168055 270
474 3300005439 Ga0070711_100047333 Ga0070711_1000473332 270
475 3300005455 Ga0070663_100624251 Ga0070663_1006242511 270
476 3300005456 Ga0070678_100004557 Ga0070678_1000045573 270
477 3300005456 Ga0070678_100033282 Ga0070678_1000332823 270
478 3300005457 Ga0070662_100313836 Ga0070662_1003138361 270
479 3300005458 Ga0070681_10058748 Ga0070681_100587484 270
480 3300005466 Ga0070685_10006589 Ga0070685_100065896 270
481 3300005530 Ga0070679_100002598 Ga0070679_1000025985 270
482 3300005530 Ga0070679_100079164 Ga0070679_1000791642 270
483 3300005530 Ga0070679_100163069 Ga0070679_1001630692 270
484 3300005535 Ga0070684_100529592 Ga0070684_1005295921 270
485 3300005543 Ga0070672_100376566 Ga0070672_1003765662 270
486 3300005543 Ga0070672_100389092 Ga0070672_1003890922 270
487 3300005544 Ga0070686_100003427 Ga0070686_1000034273 270
488 3300005545 Ga0070695_100099238 Ga0070695_1000992382 270
489 3300005547 Ga0070693_100006523 Ga0070693_1000065232 270
490 3300005548 Ga0070665_100014656 Ga0070665_1000146567 270
491 3300005548 Ga0070665_100189359 Ga0070665_1001893593 270
492 3300005563 Ga0068855_100099540 Ga0068855_1000995402 270
493 3300005564 Ga0070664_100221706 Ga0070664_1002217062 270
494 3300005577 Ga0068857_100454614 Ga0068857_1004546142 270
495 3300005614 Ga0068856_100201818 Ga0068856_1002018182 270
496 3300005616 Ga0068852_100335647 Ga0068852_1003356472 270
497 3300005617 Ga0068859_100080273 Ga0068859_1000802732 270
498 3300005618 Ga0068864_100009012 Ga0068864_1000090123 270
499 3300005718 Ga0068866_10011785 Ga0068866_100117852 270
500 3300005719 Ga0068861_100185416 Ga0068861_1001854163 270
501 3300005841 Ga0068863_100078487 Ga0068863_1000784872 270
502 3300005842 Ga0068858_100033296 Ga0068858_1000332964 270
503 3300005842 Ga0068858_100271812 Ga0068858_1002718122 270
504 3300005937 Ga0081455_10002387 Ga0081455_1000238712 270
505 3300005937 Ga0081455_10002827 Ga0081455_1000282720 270
506 3300005937 Ga0081455_10051220 Ga0081455_100512204 270
507 3300005981 Ga0081538_10059592 Ga0081538_100595923 270
508 3300005983 Ga0081540_1015854 Ga0081540_10158543 270
509 3300005983 Ga0081540_1087122 Ga0081540_10871222 270
510 3300005985 Ga0081539_10001010 Ga0081539_1000101048 270
511 3300006028 Ga0070717_10000870 Ga0070717_100008704 270
512 3300006028 Ga0070717_10291515 Ga0070717_102915152 270
513 3300006038 Ga0075365_10006435 Ga0075365_100064352 270
514 3300006038 Ga0075365_10160544 Ga0075365_101605442 270
515 3300006048 Ga0075363_100005578 Ga0075363_1000055782 270
516 3300006048 Ga0075363_100013754 Ga0075363_1000137543 270
517 3300006051 Ga0075364_10005368 Ga0075364_100053686 270
518 3300006163 Ga0070715_10004329 Ga0070715_100043292 270
519 3300006173 Ga0070716_100000405 Ga0070716_1000004058 270
520 3300006175 Ga0070712_100006107 Ga0070712_1000061074 270
521 3300006175 Ga0070712_100054743 Ga0070712_1000547432 270
522 3300006175 Ga0070712_100323869 Ga0070712_1003238692 270
523 3300006175 Ga0070712_100453504 Ga0070712_1004535041 270
524 3300006177 Ga0075362_10017365 Ga0075362_100173652 270
525 3300006178 Ga0075367_10002138 Ga0075367_100021384 270
526 3300006178 Ga0075367_10023750 Ga0075367_100237502 270
527 3300006186 Ga0075369_10016092 Ga0075369_100160924 270
528 3300006237 Ga0097621_100012752 Ga0097621_1000127526 270
529 3300006353 Ga0075370_10041958 Ga0075370_100419582 270
530 3300006358 Ga0068871_100005825 Ga0068871_1000058258 270
531 3300006844 Ga0075428_100174181 Ga0075428_1001741812 270
532 3300006844 Ga0075428_100289642 Ga0075428_1002896422 270
533 3300006847 Ga0075431_100241413 Ga0075431_1002414133 270
534 3300006852 Ga0075433_10054160 Ga0075433_100541603 270
535 3300006852 Ga0075433_10065447 Ga0075433_100654475 270
536 3300006871 Ga0075434_100065236 Ga0075434_1000652362 270
537 3300006914 Ga0075436_100049534 Ga0075436_1000495341 270
538 3300006931 Ga0097620_100080265 Ga0097620_1000802652 270
539 3300007076 Ga0075435_100101881 Ga0075435_1001018814 270
540 3300009011 Ga0105251_10025457 Ga0105251_100254574 270
541 3300009093 Ga0105240_10026513 Ga0105240_100265133 270
542 3300009094 Ga0111539_10351140 Ga0111539_103511402 270
543 3300009098 Ga0105245_10030429 Ga0105245_100304295 270
544 3300009098 Ga0105245_10070476 Ga0105245_100704762 270
545 3300009098 Ga0105245_10185072 Ga0105245_101850722 270
546 3300009101 Ga0105247_10066254 Ga0105247_100662542 270
547 3300009147 Ga0114129_10604466 Ga0114129_106044662 270
548 3300009174 Ga0105241_10005705 Ga0105241_100057057 270
549 3300009174 Ga0105241_10079582 Ga0105241_100795823 270
550 3300009176 Ga0105242_10061684 Ga0105242_100616841 270
551 3300009177 Ga0105248_10134950 Ga0105248_101349502 270
552 3300009545 Ga0105237_10112538 Ga0105237_101125383 270
553 3300009551 Ga0105238_10015166 Ga0105238_100151666 270
554 3300009553 Ga0105249_10154668 Ga0105249_101546682 270
555 3300009553 Ga0105249_10236978 Ga0105249_102369782 270
556 3300010375 Ga0105239_10061573 Ga0105239_100615734 270
557 3300010375 Ga0105239_10246944 Ga0105239_102469443 270
558 3300011119 Ga0105246_10006169 Ga0105246_100061693 270
559 3300011119 Ga0105246_10164679 Ga0105246_101646792 270
560 3300011119 Ga0105246_10218187 Ga0105246_102181872 270
561 3300012510 Ga0157316_1003708 Ga0157316_10037081 270
562 3300013104 Ga0157370_10012471 Ga0157370_100124716 270
563 3300013105 Ga0157369_10087271 Ga0157369_100872714 270
564 3300013296 Ga0157374_10045210 Ga0157374_100452104 270
565 3300013306 Ga0163162_10089104 Ga0163162_100891042 270
566 3300013306 Ga0163162_10443199 Ga0163162_104431991 270
567 3300013307 Ga0157372_10263811 Ga0157372_102638112 270
568 3300013307 Ga0157372_10754354 Ga0157372_107543542 270
569 3300013308 Ga0157375_10177508 Ga0157375_101775083 270
570 3300014325 Ga0163163_10030377 Ga0163163_100303774 270
571 3300014325 Ga0163163_10066561 Ga0163163_100665613 270
572 3300014325 Ga0163163_10078997 Ga0163163_100789973 270
573 3300014497 Ga0182008_10072215 Ga0182008_100722152 270
574 3300014745 Ga0157377_10109951 Ga0157377_101099512 270
575 3300014968 Ga0157379_10124798 Ga0157379_101247983 270
576 3300014969 Ga0157376_10104693 Ga0157376_101046932 270
577 3300020070 Ga0206356_11202692 Ga0206356_112026921 270
578 3300020082 Ga0206353_10492257 Ga0206353_104922571 270
579 3300020082 Ga0206353_11116635 Ga0206353_111166351 270
580 3300021388 Ga0213875_10079050 Ga0213875_100790502 270
581 3300021441 Ga0213871_10026807 Ga0213871_100268072 270
582 3300025735 Ga0207713_1014372 Ga0207713_10143723 270
583 3300025898 Ga0207692_10005119 Ga0207692_100051196 270
584 3300025898 Ga0207692_10007113 Ga0207692_100071132 270
585 3300025898 Ga0207692_10010180 Ga0207692_100101803 270
586 3300025898 Ga0207692_10053560 Ga0207692_100535602 270
587 3300025900 Ga0207710_10001149 Ga0207710_1000114910 270
588 3300025905 Ga0207685_10004995 Ga0207685_100049952 270
589 3300025906 Ga0207699_10001920 Ga0207699_100019206 270
590 3300025906 Ga0207699_10374379 Ga0207699_103743791 270
591 3300025907 Ga0207645_10037731 Ga0207645_100377314 270
592 3300025909 Ga0207705_10018366 Ga0207705_100183665 270
593 3300025911 Ga0207654_10077909 Ga0207654_100779091 270
594 3300025912 Ga0207707_10094608 Ga0207707_100946083 270
595 3300025912 Ga0207707_10413448 Ga0207707_104134481 270
596 3300025913 Ga0207695_10026753 Ga0207695_100267535 270
597 3300025914 Ga0207671_10288687 Ga0207671_102886872 270
598 3300025915 Ga0207693_10004498 Ga0207693_100044984 270
599 3300025915 Ga0207693_10006034 Ga0207693_100060343 270
600 3300025915 Ga0207693_10009769 Ga0207693_100097697 270
601 3300025916 Ga0207663_10026882 Ga0207663_100268822 270
602 3300025916 Ga0207663_10228336 Ga0207663_102283362 270
603 3300025917 Ga0207660_10129825 Ga0207660_101298251 270
604 3300025918 Ga0207662_10149627 Ga0207662_101496272 270
605 3300025919 Ga0207657_10034662 Ga0207657_100346625 270
606 3300025919 Ga0207657_10054719 Ga0207657_100547194 270
607 3300025925 Ga0207650_10004278 Ga0207650_100042785 270
608 3300025927 Ga0207687_10008663 Ga0207687_100086634 270
609 3300025928 Ga0207700_10000884 Ga0207700_1000088412 270
610 3300025928 Ga0207700_10063123 Ga0207700_100631233 270
611 3300025929 Ga0207664_10028839 Ga0207664_100288395 270
612 3300025929 Ga0207664_10396407 Ga0207664_103964072 270
613 3300025931 Ga0207644_10011873 Ga0207644_100118733 270
614 3300025931 Ga0207644_10056747 Ga0207644_100567472 270
615 3300025933 Ga0207706_10043327 Ga0207706_100433275 270
616 3300025933 Ga0207706_10054929 Ga0207706_100549294 270
617 3300025935 Ga0207709_10025546 Ga0207709_100255463 270
618 3300025936 Ga0207670_10006927 Ga0207670_100069276 270
619 3300025937 Ga0207669_10025973 Ga0207669_100259733 270
620 3300025938 Ga0207704_10092321 Ga0207704_100923212 270
621 3300025939 Ga0207665_10000996 Ga0207665_1000099610 270
622 3300025940 Ga0207691_10475398 Ga0207691_104753982 270
623 3300025941 Ga0207711_10027773 Ga0207711_100277732 270
624 3300025949 Ga0207667_10063594 Ga0207667_100635942 270
625 3300025960 Ga0207651_10020536 Ga0207651_100205364 270
626 3300025961 Ga0207712_10049036 Ga0207712_100490363 270
627 3300025961 Ga0207712_10309000 Ga0207712_103090001 270
628 3300025986 Ga0207658_10009968 Ga0207658_100099686 270
629 3300026035 Ga0207703_10079032 Ga0207703_100790322 270
630 3300026041 Ga0207639_10282780 Ga0207639_102827802 270
631 3300026067 Ga0207678_10016681 Ga0207678_100166816 270
632 3300026067 Ga0207678_10112700 Ga0207678_101127003 270
633 3300026078 Ga0207702_10220404 Ga0207702_102204042 270
634 3300026078 Ga0207702_10268115 Ga0207702_102681152 270
635 3300026088 Ga0207641_10012369 Ga0207641_100123693 270
636 3300026095 Ga0207676_10008443 Ga0207676_100084436 270
637 3300026116 Ga0207674_10275389 Ga0207674_102753892 270
638 3300026118 Ga0207675_100177464 Ga0207675_1001774642 270
639 3300026118 Ga0207675_100235960 Ga0207675_1002359601 270
640 3300026121 Ga0207683_10003153 Ga0207683_1000315310 270
641 3300026121 Ga0207683_10056939 Ga0207683_100569393 270
642 3300026142 Ga0207698_10090301 Ga0207698_100903013 270
643 3300028379 Ga0268266_10003978 Ga0268266_1000397810 270
644 3300028379 Ga0268266_10152584 Ga0268266_101525842 270
645 3300028380 Ga0268265_10035234 Ga0268265_100352342 270
646 3300028380 Ga0268265_10586000 Ga0268265_105860002 270
647 3300028381 Ga0268264_10016368 Ga0268264_100163684 270
648 3300028556 Ga0265337_1001512 Ga0265337_10015126 270
649 3300028800 Ga0265338_10018836 Ga0265338_100188362 270
650 3300031595 Ga0265313_10007874 Ga0265313_100078744 270
651 3300031616 Ga0307508_10085557 Ga0307508_100855573 270
652 3300031691 Ga0316579_10024534 Ga0316579_100245342 270
653 3300031711 Ga0265314_10071571 Ga0265314_100715712 270
654 3300031711 Ga0265314_10108940 Ga0265314_101089402 270
655 3300031824 Ga0307413_10013520 Ga0307413_100135204 270
656 3300031852 Ga0307410_10396523 Ga0307410_103965232 270
657 3300031903 Ga0307407_10304197 Ga0307407_103041971 270
658 3300031903 Ga0307407_10427340 Ga0307407_104273401 270
659 3300031911 Ga0307412_10052877 Ga0307412_100528775 270
660 3300031995 Ga0307409_100124461 Ga0307409_1001244613 270
661 3300031995 Ga0307409_100128668 Ga0307409_1001286681 270
662 3300031995 Ga0307409_100203465 Ga0307409_1002034653 270
663 3300032002 Ga0307416_100220795 Ga0307416_1002207953 270
664 3300032002 Ga0307416_101126389 Ga0307416_1011263891 270
665 3300032126 Ga0307415_100094346 Ga0307415_1000943463 270
666 3300032126 Ga0307415_100096430 Ga0307415_1000964301 270
667 3300033180 Ga0307510_10113650 Ga0307510_101136501 270
668 3300034816 Ga0373930_0009127 Ga0373930_0009127_768_1619 270
669 3300034816 Ga0373930_0021193 Ga0373930_0021193_287_1195 270
670 3300034820 Ga0373959_0025617 Ga0373959_0025617_47_898 270
671 3300034957 Ga0373938_0029931 Ga0373938_0029931_144_995 270
672 3300035083 Ga0373926_0071044 Ga0373926_0071044_289_1149 270
673 3300035083 Ga0373926_0133000 Ga0373926_0133000_17_922 270
674 3300035084 Ga0373928_0032971 Ga0373928_0032971_227_1078 270
675 3300035088 Ga0373940_0062743 Ga0373940_0062743_76_927 270
676 3300035089 Ga0373944_0013917 Ga0373944_0013917_31_891 270
677 3300035089 Ga0373944_0036829 Ga0373944_0036829_257_1114 270
678 3300035090 Ga0373949_0019193 Ga0373949_0019193_178_1029 270
679 3300035091 Ga0373951_0013595 Ga0373951_0013595_562_1413 270
680 3300035092 Ga0373952_0022384 Ga0373952_0022384_128_1036 270
681 3300035111 Ga0373923_0072157 Ga0373923_0072157_274_1134 270
682 3300035112 Ga0373932_0008124 Ga0373932_0008124_1511_2362 270
683 3300035114 Ga0373939_0000595 Ga0373939_0000595_5727_6581 270
684 3300035114 Ga0373939_0008360 Ga0373939_0008360_256_1107 270
685 3300035118 Ga0373954_0005645 Ga0373954_0005645_2589_3497 270
686 3300035118 Ga0373954_0009134 Ga0373954_0009134_566_1426 270
687 3300035118 Ga0373954_0035220 Ga0373954_0035220_242_1096 270
688 3300035119 Ga0373956_0017690 Ga0373956_0017690_979_1827 270
689 3300035120 Ga0373957_0072477 Ga0373957_0072477_118_972 270
690 3300035120 Ga0373957_0075762 Ga0373957_0075762_124_984 270
691 3300035170 Ga0373943_0014695 Ga0373943_0014695_184_1038 270
692 3300035170 Ga0373943_0058322 Ga0373943_0058322_296_1153 270
693 3300035172 Ga0373955_0003027 Ga0373955_0003027_6124_6972 270
694 3300035172 Ga0373955_0007627 Ga0373955_0007627_3999_4859 270
695 3300035172 Ga0373955_0007756 Ga0373955_0007756_589_1443 270
696 3300035410 Ga0373924_0005315 Ga0373924_0005315_2794_3702 270
697 3300035410 Ga0373924_0080189 Ga0373924_0080189_82_942 270
698 3300035691 Ga0373931_0052368 Ga0373931_0052368_588_1442 270
699 3300035692 Ga0373935_0016511 Ga0373935_0016511_3320_4180 270
700 3300035692 Ga0373935_0035975 Ga0373935_0035975_553_1407 270
701 3300035692 Ga0373935_0077427 Ga0373935_0077427_150_1055 270
702 3300035692 Ga0373935_0175544 Ga0373935_0175544_320_1180 270
703 3300035692 Ga0373935_0204050 Ga0373935_0204050_130_990 270
704 3300035695 Ga0373927_0020566 Ga0373927_0020566_289_1149 270
705 3300035695 Ga0373927_0067623 Ga0373927_0067623_114_974 270
706 3300035724 Ga0373933_0007683 Ga0373933_0007683_3774_4628 270
707 3300035724 Ga0373933_0008207 Ga0373933_0008207_4829_5689 270
708 3300035724 Ga0373933_0034906 Ga0373933_0034906_364_1272 270
709 3300035724 Ga0373933_0042484 Ga0373933_0042484_1344_2192 270
710 3300035724 Ga0373933_0087061 Ga0373933_0087061_582_1442 270
711 3300035725 Ga0373947_0018767 Ga0373947_0018767_706_1647 270
712 3300035725 Ga0373947_0045098 Ga0373947_0045098_1602_2462 270
713 3300035725 Ga0373947_0046308 Ga0373947_0046308_1481_2338 270
714 3300036401 Ga0373937_0000824 Ga0373937_0000824_7294_8154 270
715 3300036401 Ga0373937_0003327 Ga0373937_0003327_3657_4517 270
716 3300036401 Ga0373937_0005428 Ga0373937_0005428_8051_8905 270
717 3300036401 Ga0373937_0020693 Ga0373937_0020693_3865_4725 270
718 3300036401 Ga0373937_0035947 Ga0373937_0035947_1128_1976 270
719 3300036401 Ga0373937_0043962 Ga0373937_0043962_3068_3976 270
720 3300036401 Ga0373937_0206769 Ga0373937_0206769_218_1078 270
721 3300036401 Ga0373937_0406378 Ga0373937_0406378_71_931 270
722 3300037068 Ga0373925_0009860 Ga0373925_0009860_4943_5803 270
723 3300037068 Ga0373925_0020221 Ga0373925_0020221_3087_3944 270
724 3300037068 Ga0373925_0046337 Ga0373925_0046337_1959_2819 270
725 3300037068 Ga0373925_0121310 Ga0373925_0121310_989_1843 270
726 3300037068 Ga0373925_0203128 Ga0373925_0203128_277_1137 270
727 3300037068 Ga0373925_0546680 Ga0373925_0546680_41_889 270
728 3300037312 Ga0395899_0002233 Ga0395899_0002233_11991_12842 270
729 3300037312 Ga0395899_0078551 Ga0395899_0078551_1486_2337 270
730 3300037418 Ga0395900_0001351 Ga0395900_0001351_3079_3930 270
731 3300037418 Ga0395900_0258646 Ga0395900_0258646_787_1638 270
732 3300037466 Ga0395898_0014184 Ga0395898_0014184_3017_3868 270
733 3300037466 Ga0395898_0016934 Ga0395898_0016934_5443_6303 270
734 3300037466 Ga0395898_0021905 Ga0395898_0021905_4118_4969 270
735 3300037853 Ga0436364_0335466 Ga0436364_0335466_78_938 270
736 3300037853 Ga0436364_0341381 Ga0436364_0341381_9546_10406 270
737 3300037853 Ga0436364_0534960 Ga0436364_0534960_123_971 270
738 3300037853 Ga0436364_0716978 Ga0436364_0716978_1286_2164 270
739 3300037853 Ga0436364_1095010 Ga0436364_1095010_284_1144 270
740 3300037853 Ga0436364_1179675 Ga0436364_1179675_2493_3374 270
741 3300037853 Ga0436364_1513145 Ga0436364_1513145_2824_3672 270
742 3300038443 Ga0395901_0013773 Ga0395901_0013773_2802_3653 270
743 3300038443 Ga0395901_0015782 Ga0395901_0015782_5454_6314 270
744 3300039437 Ga0436365_0209418 Ga0436365_0209418_229_1089 270
745 3300039437 Ga0436365_0686558 Ga0436365_0686558_593_1453 270
746 3300039437 Ga0436365_1151479 Ga0436365_1151479_512_1390 270
747 3300039437 Ga0436365_1658787 Ga0436365_1658787_449_1312 270
748 3300039438 Ga0436360_0023402 Ga0436360_0023402_1760_2620 270
749 3300039438 Ga0436360_0314979 Ga0436360_0314979_584_1438 270
750 3300039438 Ga0436360_0394148 Ga0436360_0394148_865_1725 270
751 3300039438 Ga0436360_1044519 Ga0436360_1044519_850_1713 270
752 3300039450 Ga0436363_0329936 Ga0436363_0329936_672_1520 270
753 3300039450 Ga0436363_0678607 Ga0436363_0678607_569_1429 270
754 3300039450 Ga0436363_1347707 Ga0436363_1347707_290_1150 270
755 3300039453 Ga0436362_0749915 Ga0436362_0749915_67_930 270
756 3300039453 Ga0436362_1078251 Ga0436362_1078251_1249_2109 270
757 3300044658 Ga0466972_0030800 Ga0466972_0030800_507_1355 270
758 3300044684 Ga0466966_0048885 Ga0466966_0048885_1360_2229 270
759 3300044693 Ga0466961_0069813 Ga0466961_0069813_91_960 270
760 3300044693 Ga0466961_0177552 Ga0466961_0177552_25_876 270
761 3300044694 Ga0466963_0151206 Ga0466963_0151206_332_1210 270
762 3300044694 Ga0466963_0232437 Ga0466963_0232437_65_916 270
763 3300044694 Ga0466963_0272778 Ga0466963_0272778_260_1111 270
764 3300044719 Ga0466971_0052565 Ga0466971_0052565_691_1542 270
765 3300044735 Ga0466968_0042004 Ga0466968_0042004_334_1182 270
766 3300044765 Ga0466970_0211593 Ga0466970_0211593_102_953 270
767 3300044901 Ga0466960_0066169 Ga0466960_0066169_451_1320 270
768 3300044901 Ga0466960_0067827 Ga0466960_0067827_33_884 270
769 3300044901 Ga0466960_0302647 Ga0466960_0302647_33_884 270
770 3300045049 Ga0466959_0093137 Ga0466959_0093137_1300_2151 270
771 3300045049 Ga0466959_0106141 Ga0466959_0106141_113_964 270
772 3300045976 Ga0466967_0038125 Ga0466967_0038125_2772_3641 270
773 3300045976 Ga0466967_0091230 Ga0466967_0091230_273_1124 270
774 3300045976 Ga0466967_0211600 Ga0466967_0211600_195_1061 270
775 3300045976 Ga0466967_0673365 Ga0466967_0673365_35_907 270
776 3300046454 Ga0495592_0016974 Ga0495592_0016974_1797_2705 270
777 3300046454 Ga0495592_0019964 Ga0495592_0019964_2336_3190 270
778 3300046454 Ga0495592_0176742 Ga0495592_0176742_209_1063 270
779 3300046454 Ga0495592_0234065 Ga0495592_0234065_287_1147 270
780 3300046455 Ga0495603_0046352 Ga0495603_0046352_1508_2365 270
781 3300046459 Ga0495629_0006816 Ga0495629_0006816_880_1737 270
782 3300046461 Ga0495641_0118462 Ga0495641_0118462_242_1150 270
783 3300046462 Ga0495651_0010286 Ga0495651_0010286_2159_3007 270
784 3300046462 Ga0495651_0051025 Ga0495651_0051025_1798_2658 270
785 3300046462 Ga0495651_0088366 Ga0495651_0088366_1097_1957 270
786 3300046463 Ga0495653_0064776 Ga0495653_0064776_121_975 270
787 3300046463 Ga0495653_0128709 Ga0495653_0128709_161_1021 270
788 3300046472 Ga0495580_0083844 Ga0495580_0083844_1232_2134 270
789 3300046475 Ga0495639_0109221 Ga0495639_0109221_232_1137 270
790 3300046477 Ga0495664_0005387 Ga0495664_0005387_4880_5740 270
791 3300046477 Ga0495664_0194775 Ga0495664_0194775_52_960 270
792 3300046499 Ga0495594_0065426 Ga0495594_0065426_667_1572 270
793 3300046511 Ga0495608_0133658 Ga0495608_0133658_312_1172 270
794 3300046511 Ga0495608_0230235 Ga0495608_0230235_165_1019 270
795 3300046516 Ga0495628_0002495 Ga0495628_0002495_13698_14552 270
796 3300046516 Ga0495628_0189170 Ga0495628_0189170_681_1529 270
797 3300046533 Ga0495640_0054279 Ga0495640_0054279_1051_1956 270
798 3300046533 Ga0495640_0126671 Ga0495640_0126671_301_1161 270
799 3300046536 Ga0495587_0015685 Ga0495587_0015685_2291_3145 270
800 3300046536 Ga0495587_0025425 Ga0495587_0025425_972_1826 270
801 3300046536 Ga0495587_0050288 Ga0495587_0050288_411_1271 270
802 3300046543 Ga0495645_0039395 Ga0495645_0039395_79_939 270
803 3300046559 Ga0495667_0005423 Ga0495667_0005423_246_1106 270
804 3300046559 Ga0495667_0007799 Ga0495667_0007799_5511_6419 270
805 3300046559 Ga0495667_0029059 Ga0495667_0029059_694_1548 270
806 3300046559 Ga0495667_0063057 Ga0495667_0063057_1317_2171 270
807 3300046559 Ga0495667_0123470 Ga0495667_0123470_246_1106 270
808 3300046559 Ga0495667_0329835 Ga0495667_0329835_49_909 270
809 3300046642 Ga0495634_0055785 Ga0495634_0055785_1586_2488 270
810 3300046663 Ga0495635_0013367 Ga0495635_0013367_381_1289 270
811 3300046663 Ga0495635_0014990 Ga0495635_0014990_1327_2181 270
812 3300046663 Ga0495635_0117174 Ga0495635_0117174_532_1392 270
813 3300046675 Ga0495657_0007004 Ga0495657_0007004_4307_5215 270
814 3300046675 Ga0495657_0117051 Ga0495657_0117051_206_1054 270
815 3300046675 Ga0495657_0121432 Ga0495657_0121432_780_1634 270
816 3300046678 Ga0495599_0015899 Ga0495599_0015899_2076_2930 270
817 3300046678 Ga0495599_0071204 Ga0495599_0071204_804_1664 270
818 3300046680 Ga0495646_0007579 Ga0495646_0007579_486_1346 270
819 3300046680 Ga0495646_0205501 Ga0495646_0205501_164_1024 270
820 3300046683 Ga0495658_0000857 Ga0495658_0000857_9964_10821 270
821 3300046689 Ga0495613_0005530 Ga0495613_0005530_5237_6094 270
822 3300046689 Ga0495613_0199293 Ga0495613_0199293_433_1287 270
823 3300047317 Ga0495604_0007736 Ga0495604_0007736_6313_7167 270
824 3300047317 Ga0495604_0029158 Ga0495604_0029158_105_1013 270
825 3300047317 Ga0495604_0052727 Ga0495604_0052727_470_1330 270
826 3300047317 Ga0495604_0064971 Ga0495604_0064971_282_1136 270
827 3300047317 Ga0495604_0196319 Ga0495604_0196319_163_1011 270
828 3300047319 Ga0495674_0042794 Ga0495674_0042794_3030_3890 270
829 3300047319 Ga0495674_0116521 Ga0495674_0116521_441_1295 270
830 3300047321 Ga0495676_0062701 Ga0495676_0062701_1791_2639 270
831 3300047321 Ga0495676_0082339 Ga0495676_0082339_692_1549 270
832 3300047322 Ga0495680_0007406 Ga0495680_0007406_4738_5592 270
833 3300047322 Ga0495680_0019787 Ga0495680_0019787_3240_4094 270
834 3300047322 Ga0495680_0155661 Ga0495680_0155661_187_1047 270
835 3300047322 Ga0495680_0164646 Ga0495680_0164646_490_1350 270
836 3300047444 Ga0495675_0008439 Ga0495675_0008439_4085_4945 270
837 3300047471 Ga0495684_0072882 Ga0495684_0072882_1681_2586 270
838 3300047471 Ga0495684_0147958 Ga0495684_0147958_518_1390 270
839 3300047471 Ga0495684_0249205 Ga0495684_0249205_373_1233 270
840 3300047471 Ga0495684_0266262 Ga0495684_0266262_208_1068 270
841 3300047673 Ga0495593_0073081 Ga0495593_0073081_880_1731 270
842 3300048088 Ga0495602_0007703 Ga0495602_0007703_3622_4482 270
843 3300048088 Ga0495602_0008247 Ga0495602_0008247_4333_5241 270
844 3300048088 Ga0495602_0056229 Ga0495602_0056229_1025_1879 270
845 3300048903 Ga0496100_0010727 Ga0496100_0010727_2232_3140 270
846 3300048903 Ga0496100_0016956 Ga0496100_0016956_660_1511 270
847 3300048904 Ga0496101_0030950 Ga0496101_0030950_1536_2387 270
848 3300048905 Ga0496102_0054690 Ga0496102_0054690_746_1654 270
849 3300048905 Ga0496102_0093976 Ga0496102_0093976_850_1698 270
850 3300048905 Ga0496102_0229204 Ga0496102_0229204_413_1321 270
851 3300048905 Ga0496102_0300223 Ga0496102_0300223_601_1452 270
852 3300048906 Ga0496103_0007284 Ga0496103_0007284_1536_2387 270
853 3300048907 Ga0496104_0000055 Ga0496104_0000055_40372_41271 270
854 3300048907 Ga0496104_0003540 Ga0496104_0003540_9450_10298 270
855 3300048908 Ga0496105_0000797 Ga0496105_0000797_2824_3672 270
856 3300048908 Ga0496105_0012262 Ga0496105_0012262_5847_6746 270
857 3300048908 Ga0496105_0115646 Ga0496105_0115646_1026_1877 270
858 3300048910 Ga0496107_0015062 Ga0496107_0015062_3509_4360 270
859 3300048910 Ga0496107_0024577 Ga0496107_0024577_744_1652 270
860 3300048911 Ga0496108_0002024 Ga0496108_0002024_9599_10450 270
861 3300048911 Ga0496108_0121897 Ga0496108_0121897_1206_2114 270
862 3300048912 Ga0496109_0001887 Ga0496109_0001887_11026_11874 270
863 3300048912 Ga0496109_0050361 Ga0496109_0050361_979_1830 270
864 3300048912 Ga0496109_0075889 Ga0496109_0075889_629_1480 270
865 3300048913 Ga0496110_0303778 Ga0496110_0303778_437_1285 270
866 3300048914 Ga0496111_0082817 Ga0496111_0082817_668_1519 270
867 3300048914 Ga0496111_0138127 Ga0496111_0138127_145_1053 270
868 3300048915 Ga0496112_0008278 Ga0496112_0008278_629_1480 270
869 3300048915 Ga0496112_0152710 Ga0496112_0152710_797_1648 270
870 3300048916 Ga0496113_0008064 Ga0496113_0008064_1391_2239 270
871 3300048916 Ga0496113_0020314 Ga0496113_0020314_2206_3057 270
872 3300048916 Ga0496113_0080341 Ga0496113_0080341_183_1091 270
873 3300048917 Ga0496114_0211875 Ga0496114_0211875_611_1459 270
874 3300048918 Ga0496115_0039056 Ga0496115_0039056_1903_2751 270
875 3300048918 Ga0496115_0071180 Ga0496115_0071180_1720_2619 270
876 3300048918 Ga0496115_0077469 Ga0496115_0077469_984_1835 270
877 3300048922 Ga0496119_0000344 Ga0496119_0000344_6984_7832 270
878 3300048925 Ga0496122_0011879 Ga0496122_0011879_1852_2706 270
879 3300048926 Ga0496123_0005458 Ga0496123_0005458_5839_6693 270
880 3300049568 Ga0501031_0130464 Ga0501031_0130464_447_1298 270
881 3300049568 Ga0501031_0156460 Ga0501031_0156460_113_967 270
882 3300049570 Ga0501033_0034340 Ga0501033_0034340_2517_3407 270
883 3300049570 Ga0501033_0036461 Ga0501033_0036461_895_1764 270
884 3300049571 Ga0501034_0041858 Ga0501034_0041858_2349_3203 270
885 3300049573 Ga0501037_0045725 Ga0501037_0045725_632_1486 270
886 3300049574 Ga0501038_0099584 Ga0501038_0099584_145_999 270
887 3300049579 Ga0501043_0057397 Ga0501043_0057397_303_1172 270
888 3300049581 Ga0501047_0182779 Ga0501047_0182779_681_1535 270
889 3300049585 Ga0501069_0241699 Ga0501069_0241699_14_868 270
890 3300049586 Ga0501070_0154614 Ga0501070_0154614_586_1446 270
891 3300049587 Ga0501071_0170165 Ga0501071_0170165_620_1474 270
892 3300049588 Ga0501072_0004195 Ga0501072_0004195_6756_7604 270
893 3300049589 Ga0501073_0025687 Ga0501073_0025687_1895_2746 270
894 3300049590 Ga0501074_0093956 Ga0501074_0093956_1148_2002 270
895 3300049590 Ga0501074_0130257 Ga0501074_0130257_193_1047 270
896 3300049742 Ga0501080_0485492 Ga0501080_0485492_177_1037 270
897 3300049742 Ga0501080_0698425 Ga0501080_0698425_24_878 270
898 3300049744 Ga0501083_0067811 Ga0501083_0067811_94_942 270
899 3300049823 Ga0501044_0025214 Ga0501044_0025214_1233_2081 270
900 3300049823 Ga0501044_0056088 Ga0501044_0056088_3128_3997 270
901 3300049823 Ga0501044_0211761 Ga0501044_0211761_732_1586 270
902 3300050489 nmdc:mga03683_47570_c1 nmdc:mga03683_47570_c1_763_1611 270
903 3300050490 nmdc:mga03n38_16303_c1 nmdc:mga03n38_16303_c1_234_1082 270
904 3300050491 nmdc:mga00v17_16996_c1 nmdc:mga00v17_16996_c1_1091_1939 270
905 3300050492 nmdc:mga0yw44_20790_c1 nmdc:mga0yw44_20790_c1_2184_3032 270
906 3300050492 nmdc:mga0yw44_8593_c1 nmdc:mga0yw44_8593_c1_661_1509 270
907 3300050493 nmdc:mga0k408_28578_c1 nmdc:mga0k408_28578_c1_456_1304 270
908 3300050494 nmdc:mga06z11_38624_c1 nmdc:mga06z11_38624_c1_1032_1880 270
909 3300050494 nmdc:mga06z11_659_c1 nmdc:mga06z11_659_c1_7478_8326 270
910 3300050507 nmdc:mga05p37_4816_c1 nmdc:mga05p37_4816_c1_14292_15146 270
911 3300050510 nmdc:mga06r32_209654_c1 nmdc:mga06r32_209654_c1_116_964 270
912 3300050512 nmdc:mga0n895_103856_c1 nmdc:mga0n895_103856_c1_209_1066 270
913 3300050512 nmdc:mga0n895_42236_c1 nmdc:mga0n895_42236_c1_517_1371 270
914 3300050513 nmdc:mga0rr50_205118_c1 nmdc:mga0rr50_205118_c1_337_1191 270
915 3300050513 nmdc:mga0rr50_24524_c1 nmdc:mga0rr50_24524_c1_353_1204 270
916 3300050515 nmdc:mga0a205_86288_c1 nmdc:mga0a205_86288_c1_78_929 270
917 3300050516 nmdc:mga0sz30_16451_c1 nmdc:mga0sz30_16451_c1_1306_2154 270
918 3300053077 Ga0495601_0004059 Ga0495601_0004059_3742_4647 270
919 3300053077 Ga0495601_0005636 Ga0495601_0005636_275_1129 270
920 3300053077 Ga0495601_0016725 Ga0495601_0016725_2907_3767 270
921 3300053078 Ga0495612_0001521 Ga0495612_0001521_8139_8993 270
922 3300053078 Ga0495612_0002491 Ga0495612_0002491_5503_6363 270
923 3300053078 Ga0495612_0015912 Ga0495612_0015912_2006_2914 270
924 3300053078 Ga0495612_0030188 Ga0495612_0030188_29_877 270
925 3300053078 Ga0495612_0046200 Ga0495612_0046200_769_1623 270
926 3300053084 Ga0495595_0000380 Ga0495595_0000380_8967_9821 270
927 3300053084 Ga0495595_0007849 Ga0495595_0007849_3195_4103 270
928 3300053085 Ga0495619_0000085 Ga0495619_0000085_10830_11684 270
929 3300053085 Ga0495619_0000442 Ga0495619_0000442_15988_16842 270
930 3300053085 Ga0495619_0000536 Ga0495619_0000536_19693_20550 270
931 3300053085 Ga0495619_0011298 Ga0495619_0011298_2634_3539 270
932 3300053085 Ga0495619_0020082 Ga0495619_0020082_2667_3575 270
933 3300053085 Ga0495619_0061326 Ga0495619_0061326_1135_1983 270
934 3300053104 Ga0500556_0000122 Ga0500556_0000122_7575_8423 270
935 3300053117 Ga0500593_000036 Ga0500593_000036_16375_17223 270
936 3300053139 Ga0500568_0000002 Ga0500568_0000002_161218_162066 270
937 3300054114 Ga0501084_0282195 Ga0501084_0282195_202_1050 270
938 3300060353 Ga0501082_0000032 Ga0501082_0000032_12209_13057 270
939 3300061719 Ga0466962_0050053 Ga0466962_0050053_1058_1927 270
940 iso_pu_bacteria 2524614857 2526063588 270
941 iso_pu_bacteria 2739367875 2740061938 270

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08543

Phos_pyr_kin

Phosphomethylpyrimidine kinase

82

295

0.85

PF00294

PfkB

pfkB family carbohydrate kinase

103

287

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b6a-assembly1.cif.gz_A-2 structure of pyridoxal kinasefrom pseudomonas aeruginosa 0.9594 2 269
5b6a-assembly1.cif.gz_A-2 structure of pyridoxal kinasefrom pseudomonas aeruginosa 0.9524 2 269
3pzs-assembly1.cif.gz_A crystal structure of a pyridoxamine kinase from yersinia pestis co92 0.9514 1 269
1vi9-assembly2.cif.gz_D crystal structure of pyridoxamine kinase 0.9509 2 269
1td2-assembly1.cif.gz_B crystal structure of the pdxy protein from escherichia coli 0.9495 2 269
ID Description Score Start End Superfamily
af_Q7KUC2_7_303_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9255 2 269 3.40.1190.20
af_P53727_6_307_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9234 2 222 3.40.1190.20
af_P40191_1_283_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9217 3 249 3.40.1190.20
af_Q59MC6_1_336_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9203 2 230 3.40.1190.20
1vi9C00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9197 2 269 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A537MWP1-F1-model_v4 pyridoxal kinase (EC 2.7.1.35) 0.9973 1 100 GO:0005829
GO:0008478
GO:0009443
AF-A0A7Z1UXG6-F1-model_v4 deleted 0.9972 1 137
AF-A0A258SQ85-F1-model_v4 pyridoxal kinase (EC 2.7.1.35) 0.9951 1 109 GO:0005829
GO:0008478
GO:0009443
AF-A0A537QCB7-F1-model_v4 pyridoxal kinase (EC 2.7.1.35) 0.9931 2 182 GO:0005829
GO:0008478
GO:0009443
AF-A0A258SQ85-F1-model_v4 pyridoxal kinase (EC 2.7.1.35) 0.9861 1 109 GO:0005829
GO:0008478
GO:0009443

Feature Viewer

pLDDT pTM Quality
92.18 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map