F486323

General Info

Members Datasets Scaffolds Average Seq Length
941 679 515 211

Family's Representative Sequence

Representative Sequence 3300002739|JGI25158J39367_1000169|JGI25158J39367_10001699
Length 216
Sequence MSEAISRIYPPFSAAEFRRRALNQVGAPVDHAWRDHGDHVLNPDIVALAETLKLRDAAVLVPVVDDGDEAKVIFTKRTSTLRKHSGQIAFPGGSIDPDDVSPEKAAIRETEEEIGLDGGFVETVGRLPNYLSSTGFRITPVLGVVQRGFSLQLNPIEVDDVFEVPLSFLMNPANHNRDKRVVDGIDRHFYRMPYETWMIWGITAGIVRTLYERLYA

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
5 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
6 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
7 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
8 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
9 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
10 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
11 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
12 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
13 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
14 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
15 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
16 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
17 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
18 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
19 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
20 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
21 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
22 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
23 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
24 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
25 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
26 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
27 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
28 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
29 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
30 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
31 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
32 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
33 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
34 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
35 2519899620 Rhizobium sp. Pop5 Isolate Nodule
36 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
37 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
38 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
39 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
40 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
41 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
42 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
43 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
44 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
45 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
46 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
47 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
48 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
49 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
50 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
51 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
52 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
53 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
54 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
55 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
56 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
57 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
58 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
59 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
60 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
61 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
62 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
63 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
64 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
65 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
66 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
67 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
68 2643221599 Rhizobium sp. Root708 Isolate Unclassified
69 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
70 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
71 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
72 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
73 2643221719 Rhizobium sp. Root274 Isolate Unclassified
74 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
75 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
76 2718217882 Rhizobium sp. N741 Isolate Nodule
77 2718217927 Rhizobium sp. N324 Isolate Nodule
78 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
79 2718218009 Rhizobium sp. N561 Isolate Nodule
80 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
81 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
82 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
83 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
84 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
85 2718218363 Rhizobium sp. N113 Isolate Nodule
86 2718218365 Rhizobium sp. N731 Isolate Nodule
87 2718218366 Rhizobium sp. N621 Isolate Nodule
88 2718218423 Rhizobium sp. N941 Isolate Nodule
89 2721755514 Rhizobium sp. N6212 Isolate Nodule
90 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
91 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
92 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
93 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
94 2721755809 Rhizobium sp. N541 Isolate Nodule
95 2721755810 Rhizobium sp. N871 Isolate Nodule
96 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
97 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
98 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
99 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
100 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
101 2728369365 Rhizobium sp. N1341 Isolate Nodule
102 2728369397 Rhizobium sp. N1314 Isolate Nodule
103 2738541293 Rhizobium sp. GV031 Isolate Unclassified
104 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
105 2738543024 Aminobacter sp. AP02 Isolate Unclassified
106 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
107 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
108 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
109 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
110 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
111 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
112 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
113 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
114 2791355256 Rhizobium sp. M10 Isolate Nodule
115 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
116 2791355260 Rhizobium sp. L9 Isolate Nodule
117 2791355261 Rhizobium sp. J15 Isolate Nodule
118 2791355262 Rhizobium sp. M1 Isolate Nodule
119 2791355263 Rhizobium chutanense C5 Isolate Nodule
120 2791355264 Rhizobium sp. S9 Isolate Nodule
121 2791355265 Rhizobium sp. H4 Isolate Nodule
122 2791355266 Rhizobium sp. L43 Isolate Nodule
123 2791355267 Rhizobium sp. L18 Isolate Nodule
124 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
125 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
126 2802429633 Rhizobium anhuiense J3 Isolate Nodule
127 2802429634 Rhizobium anhuiense S10 Isolate Nodule
128 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
129 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
130 2802429637 Rhizobium anhuiense C15 Isolate Nodule
131 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
132 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
133 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
134 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
135 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
136 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
137 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
138 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
139 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
140 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
141 2838048938 Rhizobium pisi 27/80 Isolate Nodule
142 2838061910 Rhizobium phaseoli L15 Isolate Nodule
143 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
144 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
145 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
146 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
147 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
148 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
149 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
150 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
151 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
152 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
153 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
154 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
155 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
156 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
157 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
158 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
159 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
160 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
161 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
162 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
163 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
164 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
165 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
166 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
167 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
168 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
169 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
170 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
171 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
172 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
173 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
174 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
175 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
176 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
177 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
178 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
179 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
180 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
181 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
182 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
183 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
184 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
185 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
186 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
187 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
188 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
189 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
190 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
191 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
192 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
193 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
194 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
195 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
196 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
197 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
198 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
199 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
200 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
201 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
202 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
203 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
204 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
205 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
206 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
207 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
208 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
209 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
210 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
211 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
212 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
213 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
214 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
215 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
216 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
217 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
218 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
219 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
220 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
221 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
222 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
223 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
224 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
225 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
226 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
227 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
228 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
229 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
230 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
231 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
232 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
233 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
234 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
235 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
236 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
237 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
238 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
239 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
240 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
241 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
242 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
243 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
244 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
245 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
246 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
247 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
248 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
249 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
250 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
251 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
252 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
253 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
254 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
255 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
256 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
257 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
258 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
259 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
260 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
261 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
262 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
263 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
264 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
265 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
266 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
267 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
268 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
269 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
270 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
271 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
272 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
273 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
274 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
275 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
276 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
277 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
278 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
279 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
280 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
281 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
282 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
283 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
284 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
285 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
286 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
287 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
288 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
289 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
290 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
291 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
292 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
293 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
294 2933599457 Rhizobium phaseoli M3 Isolate Nodule
295 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
296 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
297 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
298 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
299 2936381700 Rhizobium chutanense C16 Isolate Unclassified
300 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
301 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
302 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
303 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
304 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
305 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
306 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
307 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
308 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
309 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
310 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
311 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
312 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
313 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
314 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
315 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
316 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
317 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
318 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
319 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
320 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
321 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
322 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
323 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
324 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
325 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
326 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
327 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
328 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
329 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
330 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
331 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
332 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
333 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
334 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
335 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
336 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
337 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
338 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
339 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
340 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
341 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
342 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
343 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
344 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
345 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
346 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
347 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
348 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
349 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
350 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
351 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
352 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
353 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
354 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
355 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
356 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
357 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
358 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
359 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
360 2996887358 Rhizobium sp. R711 Isolate Nodule
361 2996893221 Rhizobium sp. R635 Isolate Nodule
362 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
363 3004167301 Mesorhizobium loti 582 Isolate Unclassified
364 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
365 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
366 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
367 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
368 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
369 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
370 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
371 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
372 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
373 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
374 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
375 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
376 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
377 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
378 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
379 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
380 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
381 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
382 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
383 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
384 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
385 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
386 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
387 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
388 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
389 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
390 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
391 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
392 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
393 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
394 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
395 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
396 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
397 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
398 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
399 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
400 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
401 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
402 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
403 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
404 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
405 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
406 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
407 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
408 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
409 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
410 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
411 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
412 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
413 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
414 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
415 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
416 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
417 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
418 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
419 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
420 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
421 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
422 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
423 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
424 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
425 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
426 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
427 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
428 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
429 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
430 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
431 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
432 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
433 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
434 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
435 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
436 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
437 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
438 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
439 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
440 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
441 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
442 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
443 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
444 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
445 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
446 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
447 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
448 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
449 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
450 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
451 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
452 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
453 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
454 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
455 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
456 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
457 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
458 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
459 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
460 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
461 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
462 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
463 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
464 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
465 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
466 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
467 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
468 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
469 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
470 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
471 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
472 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
473 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
474 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
475 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
476 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
477 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
478 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
479 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
480 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
481 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
482 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
483 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
484 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
485 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
486 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
487 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
488 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
489 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
490 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
491 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
492 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
493 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
494 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
495 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
496 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
497 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
498 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
499 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
500 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
501 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
502 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
503 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
504 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
505 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
506 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
507 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
508 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
509 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
510 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
511 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
512 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
513 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
514 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
515 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
516 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
517 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
518 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
519 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
520 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
521 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
522 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
523 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
524 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
525 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
526 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
527 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
528 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
529 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
530 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
531 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
532 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
533 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
534 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
535 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
536 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
537 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
538 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
539 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
540 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
541 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
542 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
543 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
544 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
545 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
546 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
547 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
548 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
549 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
550 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
551 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
552 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
553 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
554 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
555 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
556 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
557 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
558 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
559 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
560 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
561 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
562 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
563 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
564 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
565 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
566 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
567 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
568 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
569 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
570 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
571 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
572 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
573 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
574 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
575 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
576 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
577 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
578 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
579 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
580 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
581 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
582 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
583 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
584 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
585 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
586 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
587 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
588 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
589 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
590 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
591 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
592 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
593 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
594 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
595 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
596 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
597 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
598 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
599 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
600 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
601 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
602 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
603 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
604 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
605 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
606 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
607 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
608 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
609 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
610 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
611 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
612 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
613 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
614 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
615 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
616 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
617 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
618 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
619 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
620 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
621 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
622 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
623 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
624 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
625 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
626 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
627 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
628 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
629 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
630 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
631 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
632 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
633 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
634 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
635 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
636 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
637 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
638 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
639 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
640 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
641 8005258706 Rhizobium sp. R693 Isolate Nodule
642 8005275841 Rhizobium sp. N4311 Isolate Nodule
643 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
644 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
645 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
646 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
647 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
648 8005321885 Rhizobium sp. R72 Isolate Nodule
649 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
650 8005382845 Rhizobium sp. R634 Isolate Nodule
651 8005395548 Rhizobium sp. R339 Isolate Nodule
652 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
653 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
654 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
655 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
656 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
657 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
658 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
659 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
660 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
661 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
662 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
663 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
664 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
665 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
666 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
667 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
668 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
669 8018176218 Rhizobium sp. N122 Isolate Nodule
670 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
671 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
672 8024501048 Rhizobium sp. H4 Isolate Nodule
673 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
674 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
675 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
676 8056382006 Rhizobium croatiense 13T Isolate Nodule
677 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
678 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
679 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 54.73
Metatranscriptomes 0
Isolates 45.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.07
Nodule 34.75
Rhizoplane 2.55
Rhizosphere 28.8
Stem 0
Stem Tuber 0
Unclassified 15.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002656 3300001979 Bacteria 8038
2 JGI25155J39150_1000014 3300002704 Bacteria 196159
3 JGI25156J39149_1000037 3300002705 Bacteria 109690
4 JGI25156J39149_1004395 3300002705 Bacteria 4305
5 JGI25162J39368_1000379 3300002737 Bacteria 37841
6 JGI25154J39366_1000052 3300002738 Bacteria 120209
7 JGI25154J39366_1000229 3300002738 Bacteria 37528
8 JGI25158J39367_1000169 3300002739 Bacteria 15587
9 JGI25157J39369_1000040 3300002741 Bacteria 126165
10 JGI25157J39369_1000710 3300002741 Bacteria 17962
11 JGI25152J39213_1000401 3300002773 Bacteria 26413
12 JGI25152J39213_1000670 3300002773 Bacteria 17822
13 JGI25152J39213_1005468 3300002773 Bacteria 3693
14 JGI25152J39213_1006845 3300002773 Bacteria 3022
15 JGI25152J39213_1008189 3300002773 Bacteria 2619
16 JGI25152J39213_1008772 3300002773 Bacteria 2472
17 JGI25150J39212_1000088 3300002774 Bacteria 53538
18 JGI25150J39212_1012828 3300002774 Bacteria 1470
19 JGI25150J39212_1017228 3300002774 Bacteria 1170
20 JGI25159J45721_1000120 3300002987 Bacteria 37322
21 JGI25151J46595_10000215 3300003187 Bacteria 69771
22 JGI25151J46595_10000280 3300003187 Bacteria 58125
23 JGI25151J46595_10019207 3300003187 Bacteria 2908
24 JGI25165J46597_1000006 3300003214 Bacteria 529784
25 JGI25165J46597_1000469 3300003214 Bacteria 39844
26 JGI25153J46596_10012354 3300003215 Bacteria 3693
27 JGI25153J46596_10012823 3300003215 Bacteria 3586
28 JGI25153J46596_10017279 3300003215 Bacteria 2846
29 JGI25153J46596_10017963 3300003215 Bacteria 2765
30 JGI25153J46596_10019278 3300003215 Bacteria 2619
31 rootH2_10013960 3300003320 Bacteria 6866
32 rootL2_10001418 3300003322 Bacteria 8682
33 rootL2_10183749 3300003322 Bacteria 1108
34 rootH1_10128178 3300003323 Bacteria 3616
35 JGI25160J50197_1000001 3300003354 Bacteria 782301
36 JGI25160J50197_1001620 3300003354 Bacteria 11052
37 JGI25160J50197_1004466 3300003354 Bacteria 6045
38 JGI25160J50197_1009073 3300003354 Bacteria 3722
39 JGI25161J50226_1000001 3300003374 Bacteria 655036
40 JGI25161J50226_1000068 3300003374 Bacteria 90522
41 JGI25161J50226_1002317 3300003374 Bacteria 4955
42 Ga0055526_1001827 3300003771 Bacteria 14719
43 Ga0055526_1004459 3300003771 Bacteria 8398
44 Ga0055526_1005133 3300003771 Bacteria 7633
45 Ga0055526_1011309 3300003771 Bacteria 4039
46 Ga0055524_1002683 3300003775 Bacteria 9014
47 Ga0055524_1006497 3300003775 Bacteria 5063
48 Ga0055528_1001415 3300003790 Bacteria 14697
49 Ga0055528_1001467 3300003790 Bacteria 14328
50 Ga0055540_1000592 3300003792 Bacteria 26360
51 Ga0055540_1013767 3300003792 Bacteria 2451
52 Ga0055540_1013895 3300003792 Bacteria 2432
53 Ga0055543_1000003 3300004625 Bacteria 358656
54 Ga0055543_1000189 3300004625 Bacteria 50188
55 Ga0055543_1000662 3300004625 Bacteria 18194
56 Ga0065165_1000008 3300005262 Bacteria 334429
57 Ga0065165_1010902 3300005262 Bacteria 3865
58 Ga0065165_1021641 3300005262 Bacteria 2227
59 Ga0070676_10243217 3300005328 Bacteria 1198
60 Ga0070666_10232608 3300005335 Bacteria 1302
61 Ga0070660_100053524 3300005339 Bacteria 3114
62 Ga0070668_100307665 3300005347 Bacteria 1331
63 Ga0070668_100521272 3300005347 Bacteria 1031
64 Ga0070671_100180300 3300005355 Bacteria 1788
65 Ga0070663_100074640 3300005455 Bacteria 2477
66 Ga0070663_100248250 3300005455 Bacteria 1408
67 Ga0070662_100342118 3300005457 Bacteria 1224
68 Ga0068867_100026106 3300005459 Bacteria 4193
69 Ga0068867_100113860 3300005459 Bacteria 2082
70 Ga0068853_100109766 3300005539 Bacteria 2449
71 Ga0068853_100145615 3300005539 Bacteria 2129
72 Ga0070665_100184163 3300005548 Bacteria 2089
73 Ga0068855_100471350 3300005563 Bacteria 1368
74 Ga0068854_100160269 3300005578 Bacteria 1742
75 Ga0068856_100041846 3300005614 Bacteria 4505
76 Ga0068852_100231602 3300005616 Bacteria 1761
77 Ga0068851_10046965 3300005834 Bacteria 2185
78 Ga0070717_10249994 3300006028 Bacteria 1566
79 Ga0075365_10002611 3300006038 Bacteria 8916
80 Ga0075365_10002699 3300006038 Bacteria 8841
81 Ga0075365_10017790 3300006038 Bacteria 4358
82 Ga0075365_10602350 3300006038 Bacteria 777
83 Ga0075363_100006159 3300006048 Bacteria 5422
84 Ga0075363_100032615 3300006048 Bacteria 2707
85 Ga0075363_100145048 3300006048 Bacteria 1338
86 Ga0075364_10334532 3300006051 Bacteria 1032
87 Ga0075362_10007590 3300006177 Bacteria 4117
88 Ga0075367_10025336 3300006178 Bacteria 3354
89 Ga0075367_10028325 3300006178 Bacteria 3195
90 Ga0075369_10000814 3300006186 Bacteria 10260
91 Ga0075369_10017791 3300006186 Bacteria 2887
92 Ga0075370_10000522 3300006353 Bacteria 14644
93 Ga0075370_10004914 3300006353 Bacteria 6566
94 Ga0105251_10027604 3300009011 Bacteria 2876
95 Ga0105244_10143565 3300009036 Bacteria 1147
96 Ga0105250_10041635 3300009092 Bacteria 1841
97 Ga0105250_10134313 3300009092 Bacteria 1023
98 Ga0105240_10000014 3300009093 Bacteria 482033
99 Ga0105240_10099498 3300009093 Bacteria 3539
100 Ga0105240_10478398 3300009093 Bacteria 1389
101 Ga0105245_10743845 3300009098 Bacteria 1016
102 Ga0105243_10586801 3300009148 Bacteria 1071
103 Ga0105241_10097880 3300009174 Bacteria 2327
104 Ga0105248_10005639 3300009177 Bacteria 13745
105 Ga0105248_10332898 3300009177 Bacteria 1710
106 Ga0105237_10002417 3300009545 Bacteria 23180
107 Ga0105237_10030724 3300009545 Bacteria 5453
108 Ga0105238_10002480 3300009551 Bacteria 18475
109 Ga0105238_10354534 3300009551 Bacteria 1456
110 Ga0105238_10372582 3300009551 Bacteria 1418
111 Ga0105249_10148486 3300009553 Bacteria 2254
112 Ga0123341_1000124 3300009765 Bacteria 35033
113 Ga0123342_1005659 3300009766 Bacteria 17915
114 Ga0123342_1027387 3300009766 Bacteria 3193
115 Ga0105239_10000973 3300010375 Bacteria 40196
116 Ga0105239_10077098 3300010375 Bacteria 3667
117 Ga0105239_10301724 3300010375 Bacteria 1804
118 Ga0105246_10108885 3300011119 Bacteria 2031
119 Ga0157373_10451035 3300013100 Bacteria 925
120 Ga0157370_10000327 3300013104 Bacteria 59705
121 Ga0182007_10002502 3300015262 Bacteria 9083
122 Ga0182005_1004223 3300015265 Bacteria 4689
123 Ga0209435_100027 3300025206 Bacteria 196217
124 Ga0209436_100061 3300025208 Bacteria 58629
125 Ga0209437_100060 3300025233 Bacteria 355034
126 Ga0207425_1000055 3300025245 Bacteria 152820
127 Ga0207425_1003073 3300025245 Bacteria 5528
128 Ga0207425_1003575 3300025245 Bacteria 4926
129 Ga0207425_1005271 3300025245 Bacteria 3714
130 Ga0209646_1000086 3300025246 Bacteria 196217
131 Ga0209646_1006486 3300025246 Bacteria 1964
132 Ga0209646_1006725 3300025246 Bacteria 1916
133 Ga0209026_1000082 3300025250 Bacteria 196315
134 Ga0209026_1000089 3300025250 Bacteria 175907
135 Ga0209677_100420 3300025253 Bacteria 25145
136 Ga0209148_1000124 3300025254 Bacteria 185123
137 Ga0209759_1000040 3300025256 Bacteria 254501
138 Ga0209759_1000063 3300025256 Bacteria 196315
139 Ga0209759_1030080 3300025256 Bacteria 1078
140 Ga0209129_1000029 3300025258 Bacteria 401149
141 Ga0209129_1000607 3300025258 Bacteria 24231
142 Ga0209129_1000827 3300025258 Bacteria 19479
143 Ga0209129_1000980 3300025258 Bacteria 17125
144 Ga0209129_1003272 3300025258 Bacteria 7176
145 Ga0209233_1000010 3300025261 Bacteria 1194329
146 Ga0209233_1000095 3300025261 Bacteria 303783
147 Ga0209233_1000113 3300025261 Bacteria 253455
148 Ga0209565_1029992 3300025263 Bacteria 1065
149 Ga0209455_1000062 3300025272 Bacteria 335169
150 Ga0209673_1000025 3300025273 Bacteria 404572
151 Ga0209673_1000858 3300025273 Bacteria 39511
152 Ga0209673_1000878 3300025273 Bacteria 39065
153 Ga0209673_1001058 3300025273 Bacteria 31480
154 Ga0209673_1002625 3300025273 Bacteria 12075
155 Ga0209673_1005843 3300025273 Bacteria 6094
156 Ga0209673_1018391 3300025273 Bacteria 2542
157 Ga0209130_1000003 3300025284 Bacteria 677988
158 Ga0209130_1000020 3300025284 Bacteria 379297
159 Ga0209130_1015542 3300025284 Bacteria 1871
160 Ga0209676_1055198 3300025292 Bacteria 1019
161 Ga0209025_1000070 3300025294 Bacteria 287776
162 Ga0209025_1000091 3300025294 Bacteria 250401
163 Ga0209025_1003763 3300025294 Bacteria 13899
164 Ga0209025_1015180 3300025294 Bacteria 4669
165 Ga0209025_1016502 3300025294 Bacteria 4346
166 Ga0209564_1000265 3300025295 Bacteria 110606
167 Ga0209564_1001272 3300025295 Bacteria 27752
168 Ga0209564_1001274 3300025295 Bacteria 27732
169 Ga0209564_1015499 3300025295 Bacteria 3094
170 Ga0209758_1000094 3300025297 Bacteria 241068
171 Ga0209758_1001587 3300025297 Bacteria 26013
172 Ga0209758_1001902 3300025297 Bacteria 22788
173 Ga0209758_1002315 3300025297 Bacteria 19697
174 Ga0209758_1002367 3300025297 Bacteria 19402
175 Ga0209758_1002590 3300025297 Bacteria 18143
176 Ga0209758_1021042 3300025297 Bacteria 3058
177 Ga0209758_1051359 3300025297 Bacteria 1436
178 Ga0209050_1005990 3300025298 Bacteria 7378
179 Ga0209256_1000381 3300025299 Bacteria 70973
180 Ga0209256_1002239 3300025299 Bacteria 16454
181 Ga0209256_1004292 3300025299 Bacteria 9080
182 Ga0209256_1009559 3300025299 Bacteria 4226
183 Ga0209256_1057140 3300025299 Bacteria 921
184 Ga0207426_1000008 3300025302 Bacteria 848730
185 Ga0207426_1000011 3300025302 Bacteria 791203
186 Ga0207426_1000218 3300025302 Bacteria 135865
187 Ga0207426_1000941 3300025302 Bacteria 28895
188 Ga0209051_1000393 3300025303 Bacteria 60776
189 Ga0209051_1001581 3300025303 Bacteria 18750
190 Ga0209051_1006611 3300025303 Bacteria 6499
191 Ga0209051_1011717 3300025303 Bacteria 4306
192 Ga0209257_1002259 3300025304 Bacteria 19695
193 Ga0209257_1024874 3300025304 Bacteria 2060
194 Ga0207696_1062773 3300025711 Bacteria 1042
195 Ga0207713_1066957 3300025735 Bacteria 1341
196 Ga0207680_10325932 3300025903 Bacteria 1075
197 Ga0207645_10228245 3300025907 Bacteria 1228
198 Ga0207654_10602462 3300025911 Bacteria 784
199 Ga0207695_10000037 3300025913 Bacteria 476303
200 Ga0207695_10096719 3300025913 Bacteria 2954
201 Ga0207695_10226720 3300025913 Bacteria 1774
202 Ga0207671_10000271 3300025914 Bacteria 77228
203 Ga0207671_10011901 3300025914 Bacteria 7035
204 Ga0207657_10027453 3300025919 Bacteria 5213
205 Ga0207681_10603691 3300025923 Bacteria 907
206 Ga0207694_10002308 3300025924 Bacteria 15599
207 Ga0207694_10364566 3300025924 Bacteria 1198
208 Ga0207687_10465741 3300025927 Bacteria 1050
209 Ga0207709_10262761 3300025935 Bacteria 1266
210 Ga0207669_10171224 3300025937 Bacteria 1546
211 Ga0207667_10722992 3300025949 Bacteria 997
212 Ga0207668_10207649 3300025972 Bacteria 1564
213 Ga0207668_10889386 3300025972 Bacteria 792
214 Ga0207640_10338716 3300025981 Bacteria 1204
215 Ga0207639_10096450 3300026041 Bacteria 2379
216 Ga0207678_10031493 3300026067 Bacteria 4627
217 Ga0207678_10033300 3300026067 Bacteria 4490
218 Ga0207678_10655825 3300026067 Bacteria 922
219 Ga0207648_10064666 3300026089 Bacteria 3188
220 Ga0207698_10092184 3300026142 Bacteria 2483
221 Ga0207698_10215413 3300026142 Bacteria 1731
222 Ga0207698_10752715 3300026142 Bacteria 973
223 Ga0209281_1000034 3300027111 Bacteria 382562
224 Ga0209371_1001220 3300027312 Bacteria 18539
225 Ga0307515_10004087 3300028794 Bacteria 30420
226 Ga0307515_10391290 3300028794 Bacteria 1019
227 Ga0268256_1006647 3300030500 Bacteria 4261
228 Ga0265330_10167873 3300031235 Bacteria 931
229 Ga0265325_10272857 3300031241 Bacteria 760
230 Ga0265340_10002710 3300031247 Bacteria 10078
231 Ga0265331_10036251 3300031250 Bacteria 2422
232 Ga0265316_10027424 3300031344 Bacteria 4716
233 Ga0307513_10045937 3300031456 Bacteria 4769
234 Ga0265313_10003872 3300031595 Bacteria 11798
235 Ga0265314_10049360 3300031711 Bacteria 2947
236 Ga0265314_10088377 3300031711 Bacteria 2024
237 Ga0265342_10004715 3300031712 Bacteria 10611
238 Ga0307405_10028572 3300031731 Bacteria 3250
239 Ga0307406_10015020 3300031901 Bacteria 4471
240 Ga0307412_10018275 3300031911 Bacteria 4215
241 Ga0307414_10148286 3300032004 Bacteria 1847
242 Ga0307510_10185038 3300033180 Bacteria 1639
243 Ga0395900_0043259 3300037418 Bacteria 4642
244 Ga0395900_0164584 3300037418 Bacteria 2261
245 Ga0395900_0538056 3300037418 Bacteria 1114
246 Ga0395901_0017106 3300038443 Bacteria 7393
247 Ga0395901_0061000 3300038443 Bacteria 3925
248 Ga0395901_0066050 3300038443 Bacteria 3768
249 Ga0395901_0762018 3300038443 Bacteria 960
250 Ga0439436_0004741 3300041404 Bacteria 4170
251 Ga0439466_0056683 3300041411 Bacteria 1271
252 Ga0439465_0003533 3300041413 Bacteria 5095
253 Ga0439465_0060305 3300041413 Bacteria 1256
254 Ga0451797_0076574 3300041453 Bacteria 2253
255 Ga0451798_0635833 3300041458 Bacteria 1548
256 Ga0451847_0389759 3300041503 Bacteria 2748
257 Ga0451849_0307898 3300041505 Bacteria 996
258 Ga0451851_0256480 3300041507 Bacteria 1194
259 Ga0451855_0806073 3300041511 Bacteria 3678
260 Ga0451855_1544524 3300041511 Bacteria 1057
261 Ga0450907_023065 3300042146 Bacteria 1049
262 Ga0466966_0097533 3300044684 Bacteria 1820
263 Ga0466970_0002933 3300044765 Bacteria 8263
264 Ga0466959_0047621 3300045049 Bacteria 3153
265 Ga0466958_0016942 3300045836 Bacteria 4204
266 Ga0466967_0253790 3300045976 Bacteria 1681
267 Ga0495638_0002551 3300046460 Bacteria 14767
268 Ga0495638_0071142 3300046460 Bacteria 2128
269 Ga0495638_0178706 3300046460 Bacteria 1212
270 Ga0495638_0369859 3300046460 Bacteria 752
271 Ga0495650_0025883 3300046471 Bacteria 2740
272 Ga0495650_0036172 3300046471 Bacteria 2164
273 Ga0495605_0001730 3300046474 Bacteria 13987
274 Ga0495585_0013280 3300046492 Bacteria 4824
275 Ga0495585_0099884 3300046492 Bacteria 1553
276 Ga0495596_0182026 3300046500 Bacteria 817
277 Ga0495607_0072619 3300046501 Bacteria 1915
278 Ga0495607_0078339 3300046501 Bacteria 1823
279 Ga0495583_0002632 3300046506 Bacteria 14983
280 Ga0495583_0026756 3300046506 Bacteria 2854
281 Ga0495583_0029606 3300046506 Bacteria 2677
282 Ga0495583_0046093 3300046506 Bacteria 2012
283 Ga0495606_0015037 3300046507 Bacteria 5993
284 Ga0495606_0019899 3300046507 Bacteria 4971
285 Ga0495606_0030262 3300046507 Bacteria 3785
286 Ga0495606_0102576 3300046507 Bacteria 1739
287 Ga0495606_0115199 3300046507 Bacteria 1616
288 Ga0495606_0215222 3300046507 Bacteria 1086
289 Ga0495610_0001520 3300046512 Bacteria 20427
290 Ga0495610_0017115 3300046512 Bacteria 4143
291 Ga0495610_0024024 3300046512 Bacteria 3297
292 Ga0495610_0198560 3300046512 Bacteria 823
293 Ga0495616_0014048 3300046513 Bacteria 4497
294 Ga0495616_0039405 3300046513 Bacteria 2420
295 Ga0495620_0009706 3300046515 Bacteria 5109
296 Ga0495620_0017647 3300046515 Bacteria 3550
297 Ga0495631_0000977 3300046518 Bacteria 17746
298 Ga0495631_0063800 3300046518 Bacteria 1595
299 Ga0495632_0004030 3300046519 Bacteria 10143
300 Ga0495632_0004699 3300046519 Bacteria 9226
301 Ga0495632_0009534 3300046519 Bacteria 5841
302 Ga0495643_0019883 3300046522 Bacteria 3881
303 Ga0495643_0029557 3300046522 Bacteria 3065
304 Ga0495643_0072449 3300046522 Bacteria 1806
305 Ga0495648_0055944 3300046524 Bacteria 2376
306 Ga0495654_0098787 3300046530 Bacteria 1346
307 Ga0495609_0076366 3300046538 Bacteria 1468
308 Ga0495597_0077697 3300046542 Bacteria 1422
309 Ga0495668_0017591 3300046616 Bacteria 4142
310 Ga0495668_0047316 3300046616 Bacteria 2388
311 Ga0495668_0051725 3300046616 Bacteria 2274
312 Ga0495668_0182045 3300046616 Bacteria 1151
313 Ga0495611_0290709 3300046648 Bacteria 754
314 Ga0495625_0007821 3300046660 Bacteria 9216
315 Ga0495625_0012470 3300046660 Bacteria 6887
316 Ga0495625_0085789 3300046660 Bacteria 2185
317 Ga0495625_0592899 3300046660 Bacteria 666
318 Ga0495661_0149257 3300046665 Bacteria 1264
319 Ga0495670_0003409 3300046691 Bacteria 7811
320 Ga0495649_0009649 3300046694 Bacteria 5722
321 Ga0495660_0010273 3300046810 Bacteria 5442
322 Ga0495660_0034266 3300046810 Bacteria 2842
323 Ga0495660_0178277 3300046810 Bacteria 1030
324 Ga0495636_0005706 3300047318 Bacteria 4880
325 Ga0495672_0061399 3300047320 Bacteria 2166
326 Ga0495683_0110123 3300047323 Bacteria 1315
327 Ga0495687_013048 3300047443 Bacteria 4356
328 Ga0495677_0128489 3300047445 Bacteria 969
329 Ga0495685_072090 3300047447 Bacteria 1156
330 Ga0495686_0006043 3300047472 Bacteria 9393
331 Ga0495686_0009070 3300047472 Bacteria 7215
332 Ga0495686_0078790 3300047472 Bacteria 2016
333 Ga0495686_0249973 3300047472 Bacteria 997
334 Ga0495615_0002096 3300048090 Bacteria 3126
335 Ga0496102_0009649 3300048905 Bacteria 8302
336 Ga0496102_0058400 3300048905 Bacteria 3525
337 Ga0496102_0083725 3300048905 Bacteria 2943
338 Ga0496102_0169943 3300048905 Bacteria 2053
339 Ga0496103_0060501 3300048906 Bacteria 2354
340 Ga0496104_0120448 3300048907 Bacteria 2519
341 Ga0496105_0085877 3300048908 Bacteria 2600
342 Ga0496105_0477611 3300048908 Bacteria 981
343 Ga0496106_0000489 3300048909 Bacteria 28107
344 Ga0496107_0370631 3300048910 Bacteria 1065
345 Ga0496110_0055553 3300048913 Bacteria 3484
346 Ga0496111_0051433 3300048914 Bacteria 2974
347 Ga0496112_0062056 3300048915 Bacteria 3686
348 Ga0496113_0051756 3300048916 Bacteria 3065
349 Ga0496113_0053724 3300048916 Bacteria 3012
350 Ga0496113_0138370 3300048916 Bacteria 1915
351 Ga0496114_0061746 3300048917 Bacteria 3135
352 Ga0496114_0191942 3300048917 Bacteria 1787
353 Ga0496115_0340981 3300048918 Bacteria 1223
354 Ga0496116_0008133 3300048919 Bacteria 9162
355 Ga0496116_0011450 3300048919 Bacteria 7338
356 Ga0496116_0017768 3300048919 Bacteria 5508
357 Ga0496116_0027515 3300048919 Bacteria 4139
358 Ga0496116_0055401 3300048919 Bacteria 2604
359 Ga0496116_0065930 3300048919 Bacteria 2319
360 Ga0496116_0094526 3300048919 Bacteria 1806
361 Ga0496117_0001519 3300048920 Bacteria 33158
362 Ga0496117_0025223 3300048920 Bacteria 4679
363 Ga0496117_0039603 3300048920 Bacteria 3476
364 Ga0496117_0039812 3300048920 Bacteria 3465
365 Ga0496117_0085383 3300048920 Bacteria 2055
366 Ga0496118_0001657 3300048921 Bacteria 32712
367 Ga0496118_0011382 3300048921 Bacteria 8690
368 Ga0496118_0027496 3300048921 Bacteria 4812
369 Ga0496118_0040375 3300048921 Bacteria 3711
370 Ga0496118_0052840 3300048921 Bacteria 3094
371 Ga0496119_0002067 3300048922 Bacteria 22707
372 Ga0496119_0011198 3300048922 Bacteria 7465
373 Ga0496119_0101493 3300048922 Bacteria 1615
374 Ga0496119_0175292 3300048922 Bacteria 1129
375 Ga0496120_0001080 3300048923 Bacteria 35851
376 Ga0496120_0003006 3300048923 Bacteria 15992
377 Ga0496120_0037980 3300048923 Bacteria 2853
378 Ga0496121_0003379 3300048924 Bacteria 22866
379 Ga0496121_0030191 3300048924 Bacteria 4984
380 Ga0496121_0046715 3300048924 Bacteria 3702
381 Ga0496121_0085401 3300048924 Bacteria 2484
382 Ga0496121_0128568 3300048924 Bacteria 1900
383 Ga0496121_0130149 3300048924 Bacteria 1885
384 Ga0496121_0136686 3300048924 Bacteria 1825
385 Ga0496121_0168743 3300048924 Bacteria 1592
386 Ga0496122_0003108 3300048925 Bacteria 22287
387 Ga0496122_0005117 3300048925 Bacteria 15820
388 Ga0496122_0022073 3300048925 Bacteria 5671
389 Ga0496122_0045909 3300048925 Bacteria 3389
390 Ga0496123_0012900 3300048926 Bacteria 7071
391 Ga0496123_0078063 3300048926 Bacteria 2030
392 Ga0496123_0078380 3300048926 Bacteria 2024
393 Ga0496124_0002807 3300048927 Bacteria 22062
394 Ga0496124_0003951 3300048927 Bacteria 17704
395 Ga0496124_0042342 3300048927 Bacteria 3922
396 Ga0496124_0054740 3300048927 Bacteria 3375
397 Ga0496124_0061031 3300048927 Bacteria 3161
398 Ga0496124_0091096 3300048927 Bacteria 2485
399 Ga0496124_0155577 3300048927 Bacteria 1788
400 Ga0496124_0172146 3300048927 Bacteria 1675
401 Ga0496124_0177298 3300048927 Bacteria 1644
402 Ga0496124_0181086 3300048927 Bacteria 1621
403 Ga0496125_0009582 3300048928 Bacteria 9913
404 Ga0496125_0057240 3300048928 Bacteria 3159
405 Ga0496125_0059311 3300048928 Bacteria 3085
406 Ga0496125_0079744 3300048928 Bacteria 2509
407 Ga0496125_0111047 3300048928 Bacteria 1985
408 Ga0496126_0011193 3300048929 Bacteria 9310
409 Ga0496126_0115941 3300048929 Bacteria 2328
410 Ga0496126_0374092 3300048929 Bacteria 1161
411 Ga0495678_008794 3300049459 Bacteria 5058
412 Ga0495678_034167 3300049459 Bacteria 2094
413 Ga0501031_0000021 3300049568 Bacteria 95923
414 Ga0501031_0170993 3300049568 Bacteria 1420
415 Ga0501032_0055845 3300049569 Bacteria 2656
416 Ga0501032_0111617 3300049569 Bacteria 1809
417 Ga0501033_0030441 3300049570 Bacteria 4056
418 Ga0501033_0061615 3300049570 Bacteria 2765
419 Ga0501033_0254290 3300049570 Bacteria 1244
420 Ga0501034_0002652 3300049571 Bacteria 21172
421 Ga0501034_0026972 3300049571 Bacteria 5844
422 Ga0501034_0142204 3300049571 Bacteria 2378
423 Ga0501034_0192412 3300049571 Bacteria 2001
424 Ga0501034_0715197 3300049571 Bacteria 899
425 Ga0501036_0094988 3300049572 Bacteria 2520
426 Ga0501036_0406720 3300049572 Bacteria 1135
427 Ga0501037_0091933 3300049573 Bacteria 2195
428 Ga0501037_0258568 3300049573 Bacteria 1217
429 Ga0501038_0029029 3300049574 Bacteria 4906
430 Ga0501038_0038619 3300049574 Bacteria 4180
431 Ga0501038_0062096 3300049574 Bacteria 3193
432 Ga0501038_0122371 3300049574 Bacteria 2144
433 Ga0501038_0149954 3300049574 Bacteria 1901
434 Ga0501038_0518570 3300049574 Bacteria 910
435 Ga0501039_0103704 3300049575 Bacteria 2220
436 Ga0501039_0230610 3300049575 Bacteria 1456
437 Ga0501043_0085025 3300049579 Bacteria 2486
438 Ga0501043_0514173 3300049579 Bacteria 893
439 Ga0501046_0176923 3300049580 Bacteria 1598
440 Ga0501046_0278064 3300049580 Bacteria 1227
441 Ga0501046_0303918 3300049580 Bacteria 1165
442 Ga0501047_0056423 3300049581 Bacteria 3798
443 Ga0501047_0057492 3300049581 Bacteria 3761
444 Ga0501047_0082819 3300049581 Bacteria 3084
445 Ga0501047_0207260 3300049581 Bacteria 1820
446 Ga0501047_0836792 3300049581 Bacteria 734
447 Ga0501067_0042702 3300049583 Bacteria 2517
448 Ga0501068_0078702 3300049584 Bacteria 2021
449 Ga0501068_0111688 3300049584 Bacteria 1700
450 Ga0501069_0010135 3300049585 Bacteria 4985
451 Ga0501070_0016605 3300049586 Bacteria 6184
452 Ga0501070_0056816 3300049586 Bacteria 3244
453 Ga0501070_0874299 3300049586 Bacteria 702
454 Ga0501073_0022789 3300049589 Bacteria 4505
455 Ga0501073_0110777 3300049589 Bacteria 1904
456 Ga0501073_0216127 3300049589 Bacteria 1325
457 Ga0501074_0160551 3300049590 Bacteria 1605
458 Ga0501080_0030018 3300049742 Bacteria 5062
459 Ga0501083_0060651 3300049744 Bacteria 2526
460 Ga0501083_0138858 3300049744 Bacteria 1592
461 Ga0501083_0308294 3300049744 Bacteria 1030
462 Ga0501035_0101303 3300049822 Bacteria 2527
463 Ga0501035_0383410 3300049822 Bacteria 1172
464 Ga0501044_0019600 3300049823 Bacteria 7232
465 Ga0501044_0058719 3300049823 Bacteria 3944
466 nmdc:mga03683_2241_c1 3300050489 Bacteria 5964
467 nmdc:mga03n38_67139_c1 3300050490 Bacteria 1650
468 nmdc:mga03n38_68128_c1 3300050490 Bacteria 1640
469 nmdc:mga00v17_211842_c1 3300050491 Bacteria 1254
470 nmdc:mga00v17_93638_c1 3300050491 Bacteria 1889
471 nmdc:mga0yw44_1816_c1 3300050492 Bacteria 8737
472 nmdc:mga0yw44_37668_c1 3300050492 Bacteria 2857
473 nmdc:mga0yw44_70044_c1 3300050492 Bacteria 2174
474 nmdc:mga0k408_2883_c2 3300050493 Bacteria 8115
475 nmdc:mga06z11_22742_c1 3300050494 Bacteria 2933
476 nmdc:mga07m45_11346_c1 3300050496 Bacteria 4679
477 nmdc:mga07m45_152188_c1 3300050496 Bacteria 1342
478 nmdc:mga0sz30_30206_c1 3300050516 Bacteria 2238
479 Ga0500610_0068538 3300053079 Bacteria 1850
480 Ga0495655_0173491 3300053083 Bacteria 691
481 Ga0500578_0028293 3300053086 Bacteria 3600
482 Ga0500578_0068281 3300053086 Bacteria 2266
483 Ga0500644_0007457 3300053088 Bacteria 2849
484 Ga0500651_0175533 3300053093 Bacteria 1275
485 Ga0500566_0242475 3300053094 Bacteria 882
486 Ga0500650_0268895 3300053098 Bacteria 760
487 Ga0500557_018128 3300053105 Bacteria 1958
488 Ga0500562_033838 3300053108 Bacteria 1351
489 Ga0500569_000274 3300053109 Bacteria 8125
490 Ga0500594_0001349 3300053118 Bacteria 5317
491 Ga0500618_007178 3300053125 Bacteria 3202
492 Ga0500618_013225 3300053125 Bacteria 2140
493 Ga0500658_0000240 3300053134 Bacteria 25716
494 Ga0500658_0010234 3300053134 Bacteria 3456
495 Ga0500568_0000128 3300053139 Bacteria 68634
496 Ga0500568_0001687 3300053139 Bacteria 13790
497 Ga0500568_0009038 3300053139 Bacteria 4755
498 Ga0500573_0007453 3300053140 Bacteria 5966
499 Ga0500573_0154679 3300053140 Bacteria 1252
500 Ga0500577_0043058 3300053142 Bacteria 1657
501 Ga0500577_0166048 3300053142 Bacteria 942
502 Ga0500604_0025099 3300053151 Bacteria 1711
503 Ga0500616_0001260 3300053153 Bacteria 25329
504 Ga0500616_0001634 3300053153 Bacteria 20765
505 Ga0500616_0014867 3300053153 Bacteria 4461
506 Ga0500616_0066439 3300053153 Bacteria 1851
507 Ga0500620_005112 3300053155 Bacteria 3005
508 Ga0500622_0000486 3300053156 Bacteria 37244
509 Ga0500622_0000743 3300053156 Bacteria 28461
510 Ga0500622_0023839 3300053156 Bacteria 3240
511 Ga0500627_0011075 3300053158 Bacteria 3313
512 Ga0500627_0085196 3300053158 Bacteria 1411
513 Ga0500645_008090 3300053730 Bacteria 3619
514 Ga0501082_0093128 3300060353 Bacteria 2603
515 Ga0501082_0777555 3300060353 Bacteria 838

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049575 Ga0501039_0230610 Ga0501039_0230610_19_528 163
2 3300046501 Ga0495607_0072619 Ga0495607_0072619_85_627 175
3 3300046660 Ga0495625_0592899 Ga0495625_0592899_108_644 177
4 3300026067 Ga0207678_10655825 Ga0207678_106558252 188
5 iso_pu_bacteria 2643221550 2643773856 192
6 iso_pu_bacteria 2643221564 2643839192 192
7 3300053153 Ga0500616_0001634 Ga0500616_0001634_1215_1850 193
8 3300053158 Ga0500627_0085196 Ga0500627_0085196_244_879 193
9 3300005339 Ga0070660_100053524 Ga0070660_1000535242 194
10 3300005455 Ga0070663_100248250 Ga0070663_1002482502 194
11 3300005539 Ga0068853_100145615 Ga0068853_1001456153 194
12 3300005563 Ga0068855_100471350 Ga0068855_1004713502 194
13 3300005578 Ga0068854_100160269 Ga0068854_1001602692 194
14 3300006038 Ga0075365_10017790 Ga0075365_100177903 194
15 3300006048 Ga0075363_100006159 Ga0075363_1000061593 194
16 3300009093 Ga0105240_10478398 Ga0105240_104783981 194
17 3300025924 Ga0207694_10364566 Ga0207694_103645662 194
18 3300026041 Ga0207639_10096450 Ga0207639_100964502 194
19 3300026067 Ga0207678_10033300 Ga0207678_100333004 194
20 3300026142 Ga0207698_10215413 Ga0207698_102154132 194
21 3300031235 Ga0265330_10167873 Ga0265330_101678731 194
22 3300031247 Ga0265340_10002710 Ga0265340_100027106 194
23 3300031344 Ga0265316_10027424 Ga0265316_100274243 194
24 3300031595 Ga0265313_10003872 Ga0265313_100038726 194
25 3300031711 Ga0265314_10088377 Ga0265314_100883772 194
26 3300031712 Ga0265342_10004715 Ga0265342_100047152 194
27 3300048905 Ga0496102_0169943 Ga0496102_0169943_1084_1719 194
28 3300048928 Ga0496125_0059311 Ga0496125_0059311_1701_2336 194
29 3300048929 Ga0496126_0374092 Ga0496126_0374092_58_693 194
30 3300050491 nmdc:mga00v17_211842_c1 nmdc:mga00v17_211842_c1_128_763 194
31 3300050492 nmdc:mga0yw44_37668_c1 nmdc:mga0yw44_37668_c1_1012_1647 194
32 3300048919 Ga0496116_0011450 Ga0496116_0011450_6723_7310 195
33 3300048919 Ga0496116_0065930 Ga0496116_0065930_1704_2291 195
34 3300048920 Ga0496117_0085383 Ga0496117_0085383_1431_2018 195
35 3300048926 Ga0496123_0078063 Ga0496123_0078063_12_599 195
36 3300053083 Ga0495655_0173491 Ga0495655_0173491_43_672 195
37 3300049573 Ga0501037_0258568 Ga0501037_0258568_333_944 197
38 3300049581 Ga0501047_0056423 Ga0501047_0056423_2982_3593 197
39 iso_pu_bacteria 2894817345 2894820494 199
40 3300049574 Ga0501038_0122371 Ga0501038_0122371_200_844 200
41 3300049574 Ga0501038_0149954 Ga0501038_0149954_239_883 200
42 3300049580 Ga0501046_0303918 Ga0501046_0303918_289_933 200
43 3300049581 Ga0501047_0057492 Ga0501047_0057492_1673_2317 200
44 3300049589 Ga0501073_0216127 Ga0501073_0216127_405_1049 200
45 3300049744 Ga0501083_0138858 Ga0501083_0138858_201_845 200
46 3300049822 Ga0501035_0101303 Ga0501035_0101303_445_1089 200
47 3300049823 Ga0501044_0058719 Ga0501044_0058719_1730_2374 200
48 iso_pu_bacteria 637000159 637075448 200
49 3300031241 Ga0265325_10272857 Ga0265325_102728571 201
50 3300049568 Ga0501031_0170993 Ga0501031_0170993_348_959 203
51 3300049571 Ga0501034_0002652 Ga0501034_0002652_20515_21126 203
52 3300049571 Ga0501034_0715197 Ga0501034_0715197_201_845 204
53 3300060353 Ga0501082_0777555 Ga0501082_0777555_37_681 204
54 iso_pu_bacteria 8045864390 8045864479 204
55 iso_pu_bacteria 2513237351 2514587700 205
56 iso_pu_bacteria 2643221653 2644298833 205
57 iso_pu_bacteria 2643221719 2644657062 205
58 iso_pu_bacteria 2818991272 2819241164 205
59 iso_pu_bacteria 8005246636 8005248936 205
60 3300005328 Ga0070676_10243217 Ga0070676_102432172 206
61 3300005459 Ga0068867_100026106 Ga0068867_1000261063 206
62 3300009148 Ga0105243_10586801 Ga0105243_105868012 206
63 3300025907 Ga0207645_10228245 Ga0207645_102282452 206
64 3300025927 Ga0207687_10465741 Ga0207687_104657412 206
65 3300025935 Ga0207709_10262761 Ga0207709_102627612 206
66 3300025937 Ga0207669_10171224 Ga0207669_101712242 206
67 3300026089 Ga0207648_10064666 Ga0207648_100646664 206
68 iso_pu_bacteria 2503198000 2503200281 206
69 iso_pu_bacteria 2508501123 2509115080 206
70 iso_pu_bacteria 2509276022 2509395096 206
71 iso_pu_bacteria 2510461069 2510842775 206
72 iso_pu_bacteria 2512875016 2512932349 206
73 iso_pu_bacteria 2513237164 2514034541 206
74 iso_pu_bacteria 2513237305 2514419468 206
75 iso_pu_bacteria 2643221595 2643985533 206
76 iso_pu_bacteria 2643221627 2644158327 206
77 iso_pu_bacteria 2693429783 2694632354 206
78 iso_pu_bacteria 2721755686 2723574684 206
79 iso_pu_bacteria 2738543024 2739310058 206
80 iso_pu_bacteria 2756170246 2756671747 206
81 iso_pu_bacteria 2791355123 2792751950 206
82 iso_pu_bacteria 2844002411 2844008318 206
83 iso_pu_bacteria 2856320880 2856323363 206
84 iso_pu_bacteria 2856364286 2856368247 206
85 iso_pu_bacteria 2857349434 2857351560 206
86 iso_pu_bacteria 2869234852 2869235895 206
87 iso_pu_bacteria 2869278585 2869282842 206
88 iso_pu_bacteria 2869285874 2869290134 206
89 iso_pu_bacteria 2871429161 2871432418 206
90 iso_pu_bacteria 2871435913 2871438700 206
91 iso_pu_bacteria 2871451962 2871452326 206
92 iso_pu_bacteria 2871466892 2871471312 206
93 iso_pu_bacteria 2871495908 2871502502 206
94 iso_pu_bacteria 2874109183 2874109985 206
95 iso_pu_bacteria 2874139085 2874142503 206
96 iso_pu_bacteria 2874146452 2874152382 206
97 iso_pu_bacteria 2874155637 2874159785 206
98 iso_pu_bacteria 2874168670 2874168890 206
99 iso_pu_bacteria 2876377896 2876378616 206
100 iso_pu_bacteria 2876413966 2876418301 206
101 iso_pu_bacteria 2878738818 2878739259 206
102 iso_pu_bacteria 2878745973 2878750031 206
103 iso_pu_bacteria 2878760144 2878766394 206
104 iso_pu_bacteria 2878767105 2878773590 206
105 iso_pu_bacteria 2882632389 2882640743 206
106 iso_pu_bacteria 2885305155 2885308543 206
107 iso_pu_bacteria 2885326080 2885332424 206
108 iso_pu_bacteria 2888337043 2888338526 206
109 iso_pu_bacteria 2888350351 2888355348 206
110 iso_pu_bacteria 2889010040 2889010324 206
111 iso_pu_bacteria 2889016732 2889018009 206
112 iso_pu_bacteria 2903492973 2903504432 206
113 iso_pu_bacteria 2903513507 2903518262 206
114 iso_pu_bacteria 2903540706 2903547543 206
115 iso_pu_bacteria 2906308376 2906312390 206
116 iso_pu_bacteria 2906321335 2906325099 206
117 iso_pu_bacteria 2906354277 2906356813 206
118 iso_pu_bacteria 2906378014 2906378567 206
119 iso_pu_bacteria 2922130491 2922136880 206
120 iso_pu_bacteria 2922185730 2922190776 206
121 iso_pu_bacteria 2924710171 2924713478 206
122 iso_pu_bacteria 2924718760 2924724198 206
123 iso_pu_bacteria 2924776078 2924776724 206
124 iso_pu_bacteria 2937813078 2937819468 206
125 iso_pu_bacteria 2937877337 2937880885 206
126 iso_pu_bacteria 2937972304 2937977078 206
127 iso_pu_bacteria 2937994558 2938001418 206
128 iso_pu_bacteria 2938014810 2938021740 206
129 iso_pu_bacteria 2958034702 2958039625 206
130 iso_pu_bacteria 2958041894 2958052746 206
131 iso_pu_bacteria 2958041894 2958055083 206
132 iso_pu_bacteria 2958064165 2958065160 206
133 iso_pu_bacteria 2958084443 2958088559 206
134 iso_pu_bacteria 2958092219 2958097632 206
135 iso_pu_bacteria 2958100919 2958106611 206
136 iso_pu_bacteria 2958130278 2958134521 206
137 iso_pu_bacteria 2958165035 2958171572 206
138 iso_pu_bacteria 2958172287 2958179705 206
139 iso_pu_bacteria 2958179912 2958181002 206
140 iso_pu_bacteria 2961077736 2961078839 206
141 iso_pu_bacteria 2961163497 2961170013 206
142 iso_pu_bacteria 2965018300 2965024764 206
143 iso_pu_bacteria 2965062239 2965069912 206
144 iso_pu_bacteria 2968016561 2968020954 206
145 iso_pu_bacteria 2968083720 2968088343 206
146 iso_pu_bacteria 2968117919 2968119574 206
147 iso_pu_bacteria 2968128360 2968130567 206
148 iso_pu_bacteria 2968138860 2968142555 206
149 iso_pu_bacteria 2968171901 2968178405 206
150 iso_pu_bacteria 2970469710 2970474251 206
151 iso_pu_bacteria 2970554993 2970561250 206
152 iso_pu_bacteria 2970593180 2970597451 206
153 iso_pu_bacteria 2970619444 2970624842 206
154 iso_pu_bacteria 2977843712 2977848178 206
155 iso_pu_bacteria 2977942078 2977944545 206
156 iso_pu_bacteria 2977971508 2977977189 206
157 iso_pu_bacteria 2979710463 2979717495 206
158 iso_pu_bacteria 2979742915 2979750960 206
159 iso_pu_bacteria 2987636660 2987638744 206
160 iso_pu_bacteria 2987652177 2987653410 206
161 iso_pu_bacteria 2987659509 2987666254 206
162 iso_pu_bacteria 2996348954 2996352415 206
163 iso_pu_bacteria 2996386984 2996390249 206
164 iso_pu_bacteria 3004167301 3004167889 206
165 iso_pu_bacteria 3004188549 3004195260 206
166 iso_pu_bacteria 3004203850 3004205013 206
167 iso_pu_bacteria 3004211236 3004215265 206
168 iso_pu_bacteria 3004218560 3004220693 206
169 iso_pu_bacteria 3004232784 3004236538 206
170 iso_pu_bacteria 3004275668 3004279097 206
171 iso_pu_bacteria 3004289098 3004293276 206
172 iso_pu_bacteria 8002285264 8002289364 206
173 iso_pu_bacteria 8004387939 8004392339 206
174 iso_pu_bacteria 8004640170 8004641186 206
175 iso_pu_bacteria 8004714634 8004718649 206
176 3300002705 JGI25156J39149_1004395 JGI25156J39149_10043956 207
177 3300002741 JGI25157J39369_1000710 JGI25157J39369_100071014 207
178 3300003214 JGI25165J46597_1000006 JGI25165J46597_1000006366 207
179 3300005459 Ga0068867_100113860 Ga0068867_1001138602 207
180 3300005539 Ga0068853_100109766 Ga0068853_1001097662 207
181 3300006038 Ga0075365_10602350 Ga0075365_106023501 207
182 3300006048 Ga0075363_100032615 Ga0075363_1000326152 207
183 3300009093 Ga0105240_10099498 Ga0105240_100994983 207
184 3300009098 Ga0105245_10743845 Ga0105245_107438452 207
185 3300009174 Ga0105241_10097880 Ga0105241_100978803 207
186 3300009545 Ga0105237_10030724 Ga0105237_100307246 207
187 3300009551 Ga0105238_10002480 Ga0105238_100024802 207
188 3300009551 Ga0105238_10372582 Ga0105238_103725821 207
189 3300010375 Ga0105239_10077098 Ga0105239_100770983 207
190 3300025246 Ga0209646_1006725 Ga0209646_10067252 207
191 3300025250 Ga0209026_1000089 Ga0209026_100008948 207
192 3300025254 Ga0209148_1000124 Ga0209148_1000124194 207
193 3300025256 Ga0209759_1000040 Ga0209759_1000040234 207
194 3300025261 Ga0209233_1000010 Ga0209233_1000010947 207
195 3300025272 Ga0209455_1000062 Ga0209455_100006258 207
196 3300025911 Ga0207654_10602462 Ga0207654_106024621 207
197 3300025913 Ga0207695_10096719 Ga0207695_100967192 207
198 3300025913 Ga0207695_10226720 Ga0207695_102267202 207
199 3300025914 Ga0207671_10011901 Ga0207671_100119013 207
200 3300025919 Ga0207657_10027453 Ga0207657_100274532 207
201 3300025924 Ga0207694_10002308 Ga0207694_1000230812 207
202 3300025949 Ga0207667_10722992 Ga0207667_107229922 207
203 3300026067 Ga0207678_10031493 Ga0207678_100314935 207
204 3300026142 Ga0207698_10752715 Ga0207698_107527151 207
205 3300028794 Ga0307515_10391290 Ga0307515_103912902 207
206 3300037418 Ga0395900_0043259 Ga0395900_0043259_3767_4399 207
207 3300037418 Ga0395900_0164584 Ga0395900_0164584_1244_1876 207
208 3300037418 Ga0395900_0538056 Ga0395900_0538056_42_674 207
209 3300038443 Ga0395901_0017106 Ga0395901_0017106_4181_4816 207
210 3300038443 Ga0395901_0061000 Ga0395901_0061000_3213_3845 207
211 3300038443 Ga0395901_0066050 Ga0395901_0066050_157_789 207
212 3300038443 Ga0395901_0762018 Ga0395901_0762018_94_726 207
213 3300046616 Ga0495668_0051725 Ga0495668_0051725_358_990 207
214 3300047472 Ga0495686_0249973 Ga0495686_0249973_115_747 207
215 3300048905 Ga0496102_0083725 Ga0496102_0083725_1871_2503 207
216 3300048915 Ga0496112_0062056 Ga0496112_0062056_2754_3386 207
217 3300048918 Ga0496115_0340981 Ga0496115_0340981_530_1162 207
218 3300048923 Ga0496120_0001080 Ga0496120_0001080_1516_2148 207
219 3300048923 Ga0496120_0037980 Ga0496120_0037980_735_1367 207
220 3300048928 Ga0496125_0057240 Ga0496125_0057240_1229_1861 207
221 3300049568 Ga0501031_0000021 Ga0501031_0000021_83951_84586 207
222 3300049569 Ga0501032_0055845 Ga0501032_0055845_1957_2592 207
223 3300049570 Ga0501033_0030441 Ga0501033_0030441_2412_3050 207
224 3300049570 Ga0501033_0254290 Ga0501033_0254290_224_859 207
225 3300049571 Ga0501034_0026972 Ga0501034_0026972_2249_2884 207
226 3300049571 Ga0501034_0142204 Ga0501034_0142204_155_790 207
227 3300049572 Ga0501036_0094988 Ga0501036_0094988_1612_2250 207
228 3300049573 Ga0501037_0091933 Ga0501037_0091933_1416_2051 207
229 3300049574 Ga0501038_0029029 Ga0501038_0029029_913_1551 207
230 3300049574 Ga0501038_0062096 Ga0501038_0062096_571_1206 207
231 3300049574 Ga0501038_0518570 Ga0501038_0518570_250_885 207
232 3300049575 Ga0501039_0103704 Ga0501039_0103704_421_1059 207
233 3300049579 Ga0501043_0514173 Ga0501043_0514173_13_648 207
234 3300049580 Ga0501046_0278064 Ga0501046_0278064_271_909 207
235 3300049581 Ga0501047_0082819 Ga0501047_0082819_932_1567 207
236 3300049581 Ga0501047_0836792 Ga0501047_0836792_33_671 207
237 3300049584 Ga0501068_0078702 Ga0501068_0078702_435_1070 207
238 3300049585 Ga0501069_0010135 Ga0501069_0010135_723_1358 207
239 3300049586 Ga0501070_0016605 Ga0501070_0016605_28_663 207
240 3300049586 Ga0501070_0056816 Ga0501070_0056816_826_1461 207
241 3300049586 Ga0501070_0874299 Ga0501070_0874299_16_651 207
242 3300049589 Ga0501073_0110777 Ga0501073_0110777_947_1582 207
243 3300049590 Ga0501074_0160551 Ga0501074_0160551_184_819 207
244 3300049742 Ga0501080_0030018 Ga0501080_0030018_3281_3916 207
245 3300049822 Ga0501035_0383410 Ga0501035_0383410_22_657 207
246 3300049823 Ga0501044_0019600 Ga0501044_0019600_5467_6102 207
247 3300050490 nmdc:mga03n38_67139_c1 nmdc:mga03n38_67139_c1_425_1057 207
248 3300050492 nmdc:mga0yw44_70044_c1 nmdc:mga0yw44_70044_c1_17_649 207
249 3300050496 nmdc:mga07m45_152188_c1 nmdc:mga07m45_152188_c1_32_664 207
250 3300053153 Ga0500616_0014867 Ga0500616_0014867_409_1044 207
251 3300053155 Ga0500620_005112 Ga0500620_005112_743_1378 207
252 iso_pu_bacteria 2510917022 2511133256 207
253 iso_pu_bacteria 2524023209 2524458820 207
254 iso_pu_bacteria 2582581307 2585271314 207
255 iso_pu_bacteria 2582581308 2585279252 207
256 iso_pu_bacteria 2582581315 2585323143 207
257 iso_pu_bacteria 2582581316 2585331249 207
258 iso_pu_bacteria 2585427527 2585531263 207
259 iso_pu_bacteria 2585427530 2585552814 207
260 iso_pu_bacteria 2585427531 2585559057 207
261 iso_pu_bacteria 2585427608 2585898439 207
262 iso_pu_bacteria 2585427609 2585903996 207
263 iso_pu_bacteria 2585428125 2587980886 207
264 iso_pu_bacteria 2588253730 2588518418 207
265 iso_pu_bacteria 2615840626 2616311419 207
266 iso_pu_bacteria 2615840698 2616554434 207
267 iso_pu_bacteria 2617270742 2617384798 207
268 iso_pu_bacteria 2667528174 2671111246 207
269 iso_pu_bacteria 2775507266 2778175616 207
270 iso_pu_bacteria 2818991448 2819609324 207
271 iso_pu_bacteria 2818991453 2819641367 207
272 iso_pu_bacteria 2838029111 2838033733 207
273 iso_pu_bacteria 2842298080 2842298169 207
274 iso_pu_bacteria 2842357229 2842360231 207
275 iso_pu_bacteria 2842475841 2842480480 207
276 iso_pu_bacteria 2842482326 2842483883 207
277 iso_pu_bacteria 2842502639 2842505299 207
278 iso_pu_bacteria 2842509118 2842514306 207
279 iso_pu_bacteria 2847686936 2847691367 207
280 iso_pu_bacteria 2852387548 2852390444 207
281 iso_pu_bacteria 2854896431 2854901308 207
282 iso_pu_bacteria 2854916844 2854918688 207
283 iso_pu_bacteria 2856328259 2856329331 207
284 iso_pu_bacteria 2856334872 2856336439 207
285 iso_pu_bacteria 2857367948 2857370934 207
286 iso_pu_bacteria 2869271264 2869272342 207
287 iso_pu_bacteria 2871444079 2871451530 207
288 iso_pu_bacteria 2874102143 2874106147 207
289 iso_pu_bacteria 2874162495 2874162803 207
290 iso_pu_bacteria 2876363079 2876367619 207
291 iso_pu_bacteria 2876399893 2876404866 207
292 iso_pu_bacteria 2876406927 2876407747 207
293 iso_pu_bacteria 2878774303 2878776319 207
294 iso_pu_bacteria 2881147464 2881150762 207
295 iso_pu_bacteria 2885334103 2885339403 207
296 iso_pu_bacteria 2903448605 2903450397 207
297 iso_pu_bacteria 2903521522 2903521864 207
298 iso_pu_bacteria 2903528002 2903528241 207
299 iso_pu_bacteria 2906328253 2906330446 207
300 iso_pu_bacteria 2906386501 2906391051 207
301 iso_pu_bacteria 2906408224 2906408766 207
302 iso_pu_bacteria 2919408235 2919410185 207
303 iso_pu_bacteria 2922158528 2922163950 207
304 iso_pu_bacteria 2922172374 2922173581 207
305 iso_pu_bacteria 2922178524 2922179698 207
306 iso_pu_bacteria 2924726620 2924727180 207
307 iso_pu_bacteria 2924748358 2924753306 207
308 iso_pu_bacteria 2937848649 2937850995 207
309 iso_pu_bacteria 2958115193 2958116479 207
310 iso_pu_bacteria 2958158011 2958161021 207
311 iso_pu_bacteria 2963644680 2963646856 207
312 iso_pu_bacteria 2965025482 2965029698 207
313 iso_pu_bacteria 2965102966 2965103307 207
314 iso_pu_bacteria 2968091066 2968095008 207
315 iso_pu_bacteria 2968097103 2968102564 207
316 iso_pu_bacteria 2970489779 2970494929 207
317 iso_pu_bacteria 2970510686 2970511502 207
318 iso_pu_bacteria 2970547951 2970554224 207
319 iso_pu_bacteria 2977922695 2977927405 207
320 iso_pu_bacteria 2977935797 2977936488 207
321 iso_pu_bacteria 2977957713 2977959007 207
322 iso_pu_bacteria 2977986579 2977986624 207
323 iso_pu_bacteria 2979779861 2979784185 207
324 iso_pu_bacteria 2987645492 2987651778 207
325 iso_pu_bacteria 2996341866 2996343748 207
326 iso_pu_bacteria 3004239961 3004246169 207
327 iso_pu_bacteria 3004334049 3004335481 207
328 iso_pu_bacteria 3005416602 3005417557 207
329 iso_pu_bacteria 8004300914 8004303527 207
330 iso_pu_bacteria 8004695233 8004700569 207
331 iso_pu_bacteria 8004703790 8004705412 207
332 iso_pu_bacteria 8005314921 8005315654 207
333 iso_pu_bacteria 8005484373 8005489012 207
334 iso_pu_bacteria 8005645114 8005646090 207
335 iso_pu_bacteria 8005682033 8005682703 207
336 iso_pu_bacteria 8046767195 8046771756 207
337 iso_pu_bacteria 8056875544 8056875738 207
338 iso_pu_bacteria 8057575449 8057575512 207
339 3300006028 Ga0070717_10249994 Ga0070717_102499943 208
340 3300031250 Ga0265331_10036251 Ga0265331_100362512 208
341 3300031711 Ga0265314_10049360 Ga0265314_100493601 208
342 3300046460 Ga0495638_0071142 Ga0495638_0071142_1424_2050 208
343 3300046460 Ga0495638_0369859 Ga0495638_0369859_26_667 208
344 3300053088 Ga0500644_0007457 Ga0500644_0007457_1370_1996 208
345 3300053156 Ga0500622_0000486 Ga0500622_0000486_14874_15500 208
346 iso_pu_bacteria 2511231027 2511390143 208
347 iso_pu_bacteria 2582581304 2585258307 208
348 iso_pu_bacteria 2643221599 2644007070 208
349 iso_pu_bacteria 2765235802 2765466531 208
350 iso_pu_bacteria 2767802442 2770196952 208
351 iso_pu_bacteria 2775506902 2776270440 208
352 iso_pu_bacteria 2775506904 2776281641 208
353 iso_pu_bacteria 2837678835 2837682640 208
354 iso_pu_bacteria 2839993093 2839997490 208
355 iso_pu_bacteria 2840764183 2840768965 208
356 iso_pu_bacteria 2842871566 2842872133 208
357 iso_pu_bacteria 2894652903 2894655739 208
358 iso_pu_bacteria 2904578770 2904582072 208
359 iso_pu_bacteria 2919119836 2919123150 208
360 iso_pu_bacteria 2928521798 2928524065 208
361 iso_pu_bacteria 2961136820 2961143611 208
362 iso_pu_bacteria 2965032056 2965036776 208
363 iso_pu_bacteria 2965047637 2965051284 208
364 iso_pu_bacteria 3002141150 3002144957 208
365 iso_pu_bacteria 3005452660 3005454881 208
366 3300049583 Ga0501067_0042702 Ga0501067_0042702_1596_2228 209
367 3300053139 Ga0500568_0000128 Ga0500568_0000128_50769_51407 209
368 3300001979 JGI24740J21852_10002656 JGI24740J21852_100026566 211
369 3300002704 JGI25155J39150_1000014 JGI25155J39150_100001454 211
370 3300002705 JGI25156J39149_1000037 JGI25156J39149_100003758 211
371 3300002737 JGI25162J39368_1000379 JGI25162J39368_100037918 211
372 3300002738 JGI25154J39366_1000052 JGI25154J39366_1000052111 211
373 3300002738 JGI25154J39366_1000229 JGI25154J39366_100022936 211
374 3300002739 JGI25158J39367_1000169 JGI25158J39367_10001699 211
375 3300002741 JGI25157J39369_1000040 JGI25157J39369_100004052 211
376 3300002773 JGI25152J39213_1000401 JGI25152J39213_10004015 211
377 3300002773 JGI25152J39213_1000670 JGI25152J39213_100067016 211
378 3300002773 JGI25152J39213_1005468 JGI25152J39213_10054685 211
379 3300002773 JGI25152J39213_1006845 JGI25152J39213_10068452 211
380 3300002773 JGI25152J39213_1008189 JGI25152J39213_10081893 211
381 3300002773 JGI25152J39213_1008772 JGI25152J39213_10087723 211
382 3300002774 JGI25150J39212_1000088 JGI25150J39212_100008833 211
383 3300002774 JGI25150J39212_1012828 JGI25150J39212_10128281 211
384 3300002774 JGI25150J39212_1017228 JGI25150J39212_10172282 211
385 3300002987 JGI25159J45721_1000120 JGI25159J45721_100012027 211
386 3300003187 JGI25151J46595_10000215 JGI25151J46595_1000021526 211
387 3300003187 JGI25151J46595_10000280 JGI25151J46595_1000028028 211
388 3300003187 JGI25151J46595_10019207 JGI25151J46595_100192072 211
389 3300003214 JGI25165J46597_1000469 JGI25165J46597_100046924 211
390 3300003215 JGI25153J46596_10012354 JGI25153J46596_100123545 211
391 3300003215 JGI25153J46596_10012823 JGI25153J46596_100128234 211
392 3300003215 JGI25153J46596_10017279 JGI25153J46596_100172791 211
393 3300003215 JGI25153J46596_10017963 JGI25153J46596_100179631 211
394 3300003215 JGI25153J46596_10019278 JGI25153J46596_100192782 211
395 3300003320 rootH2_10013960 rootH2_100139603 211
396 3300003322 rootL2_10001418 rootL2_100014183 211
397 3300003322 rootL2_10183749 rootL2_101837492 211
398 3300003323 rootH1_10128178 rootH1_101281785 211
399 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001431 211
400 3300003354 JGI25160J50197_1001620 JGI25160J50197_10016204 211
401 3300003354 JGI25160J50197_1004466 JGI25160J50197_10044662 211
402 3300003354 JGI25160J50197_1009073 JGI25160J50197_10090732 211
403 3300003374 JGI25161J50226_1000001 JGI25161J50226_1000001326 211
404 3300003374 JGI25161J50226_1000068 JGI25161J50226_10000686 211
405 3300003374 JGI25161J50226_1002317 JGI25161J50226_10023174 211
406 3300003771 Ga0055526_1001827 Ga0055526_10018279 211
407 3300003771 Ga0055526_1004459 Ga0055526_10044595 211
408 3300003771 Ga0055526_1005133 Ga0055526_10051332 211
409 3300003771 Ga0055526_1011309 Ga0055526_10113094 211
410 3300003775 Ga0055524_1002683 Ga0055524_10026835 211
411 3300003775 Ga0055524_1006497 Ga0055524_10064975 211
412 3300003790 Ga0055528_1001415 Ga0055528_10014156 211
413 3300003790 Ga0055528_1001467 Ga0055528_100146712 211
414 3300003792 Ga0055540_1000592 Ga0055540_10005923 211
415 3300003792 Ga0055540_1013767 Ga0055540_10137672 211
416 3300003792 Ga0055540_1013895 Ga0055540_10138953 211
417 3300004625 Ga0055543_1000003 Ga0055543_1000003342 211
418 3300004625 Ga0055543_1000189 Ga0055543_100018947 211
419 3300004625 Ga0055543_1000662 Ga0055543_10006625 211
420 3300005262 Ga0065165_1000008 Ga0065165_100000821 211
421 3300005262 Ga0065165_1010902 Ga0065165_10109025 211
422 3300005262 Ga0065165_1021641 Ga0065165_10216412 211
423 3300005335 Ga0070666_10232608 Ga0070666_102326082 211
424 3300005347 Ga0070668_100307665 Ga0070668_1003076652 211
425 3300005347 Ga0070668_100521272 Ga0070668_1005212722 211
426 3300005355 Ga0070671_100180300 Ga0070671_1001803002 211
427 3300005455 Ga0070663_100074640 Ga0070663_1000746402 211
428 3300005457 Ga0070662_100342118 Ga0070662_1003421182 211
429 3300005548 Ga0070665_100184163 Ga0070665_1001841633 211
430 3300005614 Ga0068856_100041846 Ga0068856_1000418462 211
431 3300005616 Ga0068852_100231602 Ga0068852_1002316022 211
432 3300005834 Ga0068851_10046965 Ga0068851_100469653 211
433 3300006038 Ga0075365_10002611 Ga0075365_100026119 211
434 3300006038 Ga0075365_10002699 Ga0075365_100026998 211
435 3300006048 Ga0075363_100145048 Ga0075363_1001450481 211
436 3300006051 Ga0075364_10334532 Ga0075364_103345321 211
437 3300006177 Ga0075362_10007590 Ga0075362_100075902 211
438 3300006178 Ga0075367_10025336 Ga0075367_100253362 211
439 3300006178 Ga0075367_10028325 Ga0075367_100283254 211
440 3300006186 Ga0075369_10000814 Ga0075369_100008145 211
441 3300006186 Ga0075369_10017791 Ga0075369_100177914 211
442 3300006353 Ga0075370_10000522 Ga0075370_100005223 211
443 3300006353 Ga0075370_10004914 Ga0075370_100049145 211
444 3300009011 Ga0105251_10027604 Ga0105251_100276044 211
445 3300009036 Ga0105244_10143565 Ga0105244_101435652 211
446 3300009092 Ga0105250_10041635 Ga0105250_100416352 211
447 3300009092 Ga0105250_10134313 Ga0105250_101343132 211
448 3300009093 Ga0105240_10000014 Ga0105240_10000014332 211
449 3300009177 Ga0105248_10005639 Ga0105248_100056399 211
450 3300009177 Ga0105248_10332898 Ga0105248_103328982 211
451 3300009545 Ga0105237_10002417 Ga0105237_1000241713 211
452 3300009551 Ga0105238_10354534 Ga0105238_103545342 211
453 3300009553 Ga0105249_10148486 Ga0105249_101484863 211
454 3300009765 Ga0123341_1000124 Ga0123341_10001245 211
455 3300009766 Ga0123342_1005659 Ga0123342_10056594 211
456 3300009766 Ga0123342_1027387 Ga0123342_10273872 211
457 3300010375 Ga0105239_10000973 Ga0105239_1000097310 211
458 3300010375 Ga0105239_10301724 Ga0105239_103017242 211
459 3300011119 Ga0105246_10108885 Ga0105246_101088852 211
460 3300013100 Ga0157373_10451035 Ga0157373_104510352 211
461 3300013104 Ga0157370_10000327 Ga0157370_1000032742 211
462 3300015262 Ga0182007_10002502 Ga0182007_100025026 211
463 3300015265 Ga0182005_1004223 Ga0182005_10042236 211
464 3300025206 Ga0209435_100027 Ga0209435_10002753 211
465 3300025208 Ga0209436_100061 Ga0209436_1000619 211
466 3300025233 Ga0209437_100060 Ga0209437_100060330 211
467 3300025245 Ga0207425_1000055 Ga0207425_1000055146 211
468 3300025245 Ga0207425_1003073 Ga0207425_10030734 211
469 3300025245 Ga0207425_1003575 Ga0207425_10035752 211
470 3300025245 Ga0207425_1005271 Ga0207425_10052712 211
471 3300025246 Ga0209646_1000086 Ga0209646_100008653 211
472 3300025246 Ga0209646_1006486 Ga0209646_10064862 211
473 3300025250 Ga0209026_1000082 Ga0209026_100008253 211
474 3300025253 Ga0209677_100420 Ga0209677_10042019 211
475 3300025256 Ga0209759_1000063 Ga0209759_1000063148 211
476 3300025256 Ga0209759_1030080 Ga0209759_10300802 211
477 3300025258 Ga0209129_1000029 Ga0209129_1000029347 211
478 3300025258 Ga0209129_1000607 Ga0209129_100060711 211
479 3300025258 Ga0209129_1000827 Ga0209129_100082710 211
480 3300025258 Ga0209129_1000980 Ga0209129_100098012 211
481 3300025258 Ga0209129_1003272 Ga0209129_10032725 211
482 3300025261 Ga0209233_1000095 Ga0209233_1000095102 211
483 3300025261 Ga0209233_1000113 Ga0209233_1000113230 211
484 3300025263 Ga0209565_1029992 Ga0209565_10299922 211
485 3300025273 Ga0209673_1000025 Ga0209673_1000025236 211
486 3300025273 Ga0209673_1000858 Ga0209673_100085815 211
487 3300025273 Ga0209673_1000878 Ga0209673_100087814 211
488 3300025273 Ga0209673_1001058 Ga0209673_100105820 211
489 3300025273 Ga0209673_1002625 Ga0209673_100262512 211
490 3300025273 Ga0209673_1005843 Ga0209673_10058435 211
491 3300025273 Ga0209673_1018391 Ga0209673_10183911 211
492 3300025284 Ga0209130_1000003 Ga0209130_1000003343 211
493 3300025284 Ga0209130_1000020 Ga0209130_100002058 211
494 3300025284 Ga0209130_1015542 Ga0209130_10155422 211
495 3300025292 Ga0209676_1055198 Ga0209676_10551982 211
496 3300025294 Ga0209025_1000070 Ga0209025_100007034 211
497 3300025294 Ga0209025_1000091 Ga0209025_100009195 211
498 3300025294 Ga0209025_1003763 Ga0209025_10037635 211
499 3300025294 Ga0209025_1015180 Ga0209025_10151807 211
500 3300025294 Ga0209025_1016502 Ga0209025_10165026 211
501 3300025295 Ga0209564_1000265 Ga0209564_100026527 211
502 3300025295 Ga0209564_1001272 Ga0209564_10012725 211
503 3300025295 Ga0209564_1001274 Ga0209564_100127412 211
504 3300025295 Ga0209564_1015499 Ga0209564_10154994 211
505 3300025297 Ga0209758_1000094 Ga0209758_1000094200 211
506 3300025297 Ga0209758_1001587 Ga0209758_100158716 211
507 3300025297 Ga0209758_1001902 Ga0209758_100190219 211
508 3300025297 Ga0209758_1002315 Ga0209758_100231511 211
509 3300025297 Ga0209758_1002367 Ga0209758_10023676 211
510 3300025297 Ga0209758_1002590 Ga0209758_10025906 211
511 3300025297 Ga0209758_1021042 Ga0209758_10210423 211
512 3300025297 Ga0209758_1051359 Ga0209758_10513592 211
513 3300025298 Ga0209050_1005990 Ga0209050_10059904 211
514 3300025299 Ga0209256_1000381 Ga0209256_100038120 211
515 3300025299 Ga0209256_1002239 Ga0209256_10022392 211
516 3300025299 Ga0209256_1004292 Ga0209256_10042922 211
517 3300025299 Ga0209256_1009559 Ga0209256_10095592 211
518 3300025299 Ga0209256_1057140 Ga0209256_10571402 211
519 3300025302 Ga0207426_1000008 Ga0207426_1000008127 211
520 3300025302 Ga0207426_1000011 Ga0207426_1000011432 211
521 3300025302 Ga0207426_1000218 Ga0207426_100021817 211
522 3300025302 Ga0207426_1000941 Ga0207426_100094117 211
523 3300025303 Ga0209051_1000393 Ga0209051_100039348 211
524 3300025303 Ga0209051_1001581 Ga0209051_100158111 211
525 3300025303 Ga0209051_1006611 Ga0209051_10066115 211
526 3300025303 Ga0209051_1011717 Ga0209051_10117173 211
527 3300025304 Ga0209257_1002259 Ga0209257_10022599 211
528 3300025304 Ga0209257_1024874 Ga0209257_10248742 211
529 3300025711 Ga0207696_1062773 Ga0207696_10627732 211
530 3300025735 Ga0207713_1066957 Ga0207713_10669572 211
531 3300025903 Ga0207680_10325932 Ga0207680_103259322 211
532 3300025913 Ga0207695_10000037 Ga0207695_10000037334 211
533 3300025914 Ga0207671_10000271 Ga0207671_1000027156 211
534 3300025923 Ga0207681_10603691 Ga0207681_106036911 211
535 3300025972 Ga0207668_10207649 Ga0207668_102076492 211
536 3300025972 Ga0207668_10889386 Ga0207668_108893862 211
537 3300025981 Ga0207640_10338716 Ga0207640_103387162 211
538 3300026142 Ga0207698_10092184 Ga0207698_100921843 211
539 3300027111 Ga0209281_1000034 Ga0209281_1000034232 211
540 3300027312 Ga0209371_1001220 Ga0209371_10012206 211
541 3300028794 Ga0307515_10004087 Ga0307515_1000408719 211
542 3300030500 Ga0268256_1006647 Ga0268256_10066473 211
543 3300031456 Ga0307513_10045937 Ga0307513_100459374 211
544 3300031731 Ga0307405_10028572 Ga0307405_100285722 211
545 3300031901 Ga0307406_10015020 Ga0307406_100150202 211
546 3300031911 Ga0307412_10018275 Ga0307412_100182753 211
547 3300032004 Ga0307414_10148286 Ga0307414_101482862 211
548 3300033180 Ga0307510_10185038 Ga0307510_101850382 211
549 3300041404 Ga0439436_0004741 Ga0439436_0004741_2247_2897 211
550 3300041411 Ga0439466_0056683 Ga0439466_0056683_471_1121 211
551 3300041413 Ga0439465_0003533 Ga0439465_0003533_1233_1883 211
552 3300041413 Ga0439465_0060305 Ga0439465_0060305_361_1011 211
553 3300041453 Ga0451797_0076574 Ga0451797_0076574_622_1272 211
554 3300041458 Ga0451798_0635833 Ga0451798_0635833_106_756 211
555 3300041503 Ga0451847_0389759 Ga0451847_0389759_1920_2570 211
556 3300041505 Ga0451849_0307898 Ga0451849_0307898_76_726 211
557 3300041507 Ga0451851_0256480 Ga0451851_0256480_276_926 211
558 3300041511 Ga0451855_0806073 Ga0451855_0806073_2138_2788 211
559 3300041511 Ga0451855_1544524 Ga0451855_1544524_181_831 211
560 3300042146 Ga0450907_023065 Ga0450907_023065_294_944 211
561 3300044684 Ga0466966_0097533 Ga0466966_0097533_1115_1750 211
562 3300044765 Ga0466970_0002933 Ga0466970_0002933_6464_7099 211
563 3300045049 Ga0466959_0047621 Ga0466959_0047621_2133_2768 211
564 3300045836 Ga0466958_0016942 Ga0466958_0016942_3079_3714 211
565 3300045976 Ga0466967_0253790 Ga0466967_0253790_65_700 211
566 3300046460 Ga0495638_0002551 Ga0495638_0002551_12049_12699 211
567 3300046460 Ga0495638_0178706 Ga0495638_0178706_346_996 211
568 3300046471 Ga0495650_0025883 Ga0495650_0025883_1871_2521 211
569 3300046471 Ga0495650_0036172 Ga0495650_0036172_1344_1994 211
570 3300046474 Ga0495605_0001730 Ga0495605_0001730_1595_2245 211
571 3300046492 Ga0495585_0013280 Ga0495585_0013280_3069_3719 211
572 3300046492 Ga0495585_0099884 Ga0495585_0099884_762_1412 211
573 3300046500 Ga0495596_0182026 Ga0495596_0182026_59_709 211
574 3300046501 Ga0495607_0078339 Ga0495607_0078339_516_1166 211
575 3300046506 Ga0495583_0002632 Ga0495583_0002632_7722_8372 211
576 3300046506 Ga0495583_0026756 Ga0495583_0026756_1098_1748 211
577 3300046506 Ga0495583_0029606 Ga0495583_0029606_151_801 211
578 3300046506 Ga0495583_0046093 Ga0495583_0046093_27_677 211
579 3300046507 Ga0495606_0015037 Ga0495606_0015037_3120_3770 211
580 3300046507 Ga0495606_0019899 Ga0495606_0019899_4112_4747 211
581 3300046507 Ga0495606_0030262 Ga0495606_0030262_3071_3715 211
582 3300046507 Ga0495606_0102576 Ga0495606_0102576_30_680 211
583 3300046507 Ga0495606_0115199 Ga0495606_0115199_482_1132 211
584 3300046507 Ga0495606_0215222 Ga0495606_0215222_330_980 211
585 3300046512 Ga0495610_0001520 Ga0495610_0001520_1745_2395 211
586 3300046512 Ga0495610_0017115 Ga0495610_0017115_1510_2160 211
587 3300046512 Ga0495610_0024024 Ga0495610_0024024_2499_3149 211
588 3300046512 Ga0495610_0198560 Ga0495610_0198560_147_797 211
589 3300046513 Ga0495616_0014048 Ga0495616_0014048_2902_3552 211
590 3300046513 Ga0495616_0039405 Ga0495616_0039405_955_1605 211
591 3300046515 Ga0495620_0009706 Ga0495620_0009706_3446_4096 211
592 3300046515 Ga0495620_0017647 Ga0495620_0017647_2133_2783 211
593 3300046518 Ga0495631_0000977 Ga0495631_0000977_7479_8129 211
594 3300046518 Ga0495631_0063800 Ga0495631_0063800_601_1251 211
595 3300046519 Ga0495632_0004030 Ga0495632_0004030_2085_2735 211
596 3300046519 Ga0495632_0004699 Ga0495632_0004699_6284_6934 211
597 3300046519 Ga0495632_0009534 Ga0495632_0009534_4001_4651 211
598 3300046522 Ga0495643_0019883 Ga0495643_0019883_1179_1829 211
599 3300046522 Ga0495643_0029557 Ga0495643_0029557_68_718 211
600 3300046522 Ga0495643_0072449 Ga0495643_0072449_190_840 211
601 3300046524 Ga0495648_0055944 Ga0495648_0055944_794_1444 211
602 3300046530 Ga0495654_0098787 Ga0495654_0098787_527_1177 211
603 3300046538 Ga0495609_0076366 Ga0495609_0076366_11_661 211
604 3300046542 Ga0495597_0077697 Ga0495597_0077697_353_1003 211
605 3300046616 Ga0495668_0017591 Ga0495668_0017591_1349_1999 211
606 3300046616 Ga0495668_0047316 Ga0495668_0047316_1478_2128 211
607 3300046616 Ga0495668_0182045 Ga0495668_0182045_225_875 211
608 3300046648 Ga0495611_0290709 Ga0495611_0290709_56_706 211
609 3300046660 Ga0495625_0007821 Ga0495625_0007821_7183_7833 211
610 3300046660 Ga0495625_0012470 Ga0495625_0012470_5862_6512 211
611 3300046660 Ga0495625_0085789 Ga0495625_0085789_577_1227 211
612 3300046665 Ga0495661_0149257 Ga0495661_0149257_372_1022 211
613 3300046691 Ga0495670_0003409 Ga0495670_0003409_7005_7655 211
614 3300046694 Ga0495649_0009649 Ga0495649_0009649_4556_5206 211
615 3300046810 Ga0495660_0010273 Ga0495660_0010273_2358_3008 211
616 3300046810 Ga0495660_0034266 Ga0495660_0034266_1200_1850 211
617 3300046810 Ga0495660_0178277 Ga0495660_0178277_304_954 211
618 3300047318 Ga0495636_0005706 Ga0495636_0005706_2636_3286 211
619 3300047320 Ga0495672_0061399 Ga0495672_0061399_186_836 211
620 3300047323 Ga0495683_0110123 Ga0495683_0110123_318_968 211
621 3300047443 Ga0495687_013048 Ga0495687_013048_2577_3227 211
622 3300047445 Ga0495677_0128489 Ga0495677_0128489_30_680 211
623 3300047447 Ga0495685_072090 Ga0495685_072090_210_860 211
624 3300047472 Ga0495686_0006043 Ga0495686_0006043_7512_8162 211
625 3300047472 Ga0495686_0009070 Ga0495686_0009070_2498_3148 211
626 3300047472 Ga0495686_0078790 Ga0495686_0078790_1319_1969 211
627 3300048090 Ga0495615_0002096 Ga0495615_0002096_885_1535 211
628 3300048905 Ga0496102_0009649 Ga0496102_0009649_30_665 211
629 3300048905 Ga0496102_0058400 Ga0496102_0058400_612_1262 211
630 3300048906 Ga0496103_0060501 Ga0496103_0060501_153_803 211
631 3300048907 Ga0496104_0120448 Ga0496104_0120448_507_1157 211
632 3300048908 Ga0496105_0085877 Ga0496105_0085877_1280_1930 211
633 3300048908 Ga0496105_0477611 Ga0496105_0477611_33_677 211
634 3300048909 Ga0496106_0000489 Ga0496106_0000489_12068_12718 211
635 3300048910 Ga0496107_0370631 Ga0496107_0370631_35_670 211
636 3300048913 Ga0496110_0055553 Ga0496110_0055553_586_1236 211
637 3300048914 Ga0496111_0051433 Ga0496111_0051433_377_1027 211
638 3300048916 Ga0496113_0051756 Ga0496113_0051756_21_656 211
639 3300048916 Ga0496113_0053724 Ga0496113_0053724_157_807 211
640 3300048916 Ga0496113_0138370 Ga0496113_0138370_452_1102 211
641 3300048917 Ga0496114_0061746 Ga0496114_0061746_179_823 211
642 3300048917 Ga0496114_0191942 Ga0496114_0191942_600_1250 211
643 3300048919 Ga0496116_0008133 Ga0496116_0008133_5671_6306 211
644 3300048919 Ga0496116_0017768 Ga0496116_0017768_2771_3421 211
645 3300048919 Ga0496116_0027515 Ga0496116_0027515_2897_3547 211
646 3300048919 Ga0496116_0055401 Ga0496116_0055401_422_1072 211
647 3300048919 Ga0496116_0094526 Ga0496116_0094526_273_923 211
648 3300048920 Ga0496117_0001519 Ga0496117_0001519_19384_20019 211
649 3300048920 Ga0496117_0025223 Ga0496117_0025223_925_1575 211
650 3300048920 Ga0496117_0039603 Ga0496117_0039603_2174_2824 211
651 3300048920 Ga0496117_0039812 Ga0496117_0039812_1542_2192 211
652 3300048921 Ga0496118_0001657 Ga0496118_0001657_19419_20054 211
653 3300048921 Ga0496118_0011382 Ga0496118_0011382_1575_2225 211
654 3300048921 Ga0496118_0027496 Ga0496118_0027496_2175_2825 211
655 3300048921 Ga0496118_0040375 Ga0496118_0040375_659_1309 211
656 3300048921 Ga0496118_0052840 Ga0496118_0052840_1674_2324 211
657 3300048922 Ga0496119_0002067 Ga0496119_0002067_8178_8813 211
658 3300048922 Ga0496119_0011198 Ga0496119_0011198_251_886 211
659 3300048922 Ga0496119_0101493 Ga0496119_0101493_708_1358 211
660 3300048922 Ga0496119_0175292 Ga0496119_0175292_173_823 211
661 3300048923 Ga0496120_0003006 Ga0496120_0003006_2985_3620 211
662 3300048924 Ga0496121_0003379 Ga0496121_0003379_19123_19758 211
663 3300048924 Ga0496121_0030191 Ga0496121_0030191_3205_3855 211
664 3300048924 Ga0496121_0046715 Ga0496121_0046715_2022_2672 211
665 3300048924 Ga0496121_0085401 Ga0496121_0085401_348_998 211
666 3300048924 Ga0496121_0128568 Ga0496121_0128568_348_998 211
667 3300048924 Ga0496121_0130149 Ga0496121_0130149_680_1330 211
668 3300048924 Ga0496121_0136686 Ga0496121_0136686_767_1417 211
669 3300048924 Ga0496121_0168743 Ga0496121_0168743_471_1121 211
670 3300048925 Ga0496122_0003108 Ga0496122_0003108_857_1507 211
671 3300048925 Ga0496122_0005117 Ga0496122_0005117_6663_7298 211
672 3300048925 Ga0496122_0022073 Ga0496122_0022073_3707_4357 211
673 3300048925 Ga0496122_0045909 Ga0496122_0045909_517_1167 211
674 3300048926 Ga0496123_0012900 Ga0496123_0012900_6234_6869 211
675 3300048926 Ga0496123_0078380 Ga0496123_0078380_1052_1702 211
676 3300048927 Ga0496124_0002807 Ga0496124_0002807_1487_2137 211
677 3300048927 Ga0496124_0003951 Ga0496124_0003951_7000_7650 211
678 3300048927 Ga0496124_0042342 Ga0496124_0042342_1254_1904 211
679 3300048927 Ga0496124_0054740 Ga0496124_0054740_736_1371 211
680 3300048927 Ga0496124_0061031 Ga0496124_0061031_1301_1951 211
681 3300048927 Ga0496124_0091096 Ga0496124_0091096_348_998 211
682 3300048927 Ga0496124_0155577 Ga0496124_0155577_445_1080 211
683 3300048927 Ga0496124_0172146 Ga0496124_0172146_804_1454 211
684 3300048927 Ga0496124_0177298 Ga0496124_0177298_238_888 211
685 3300048927 Ga0496124_0181086 Ga0496124_0181086_649_1299 211
686 3300048928 Ga0496125_0009582 Ga0496125_0009582_3130_3780 211
687 3300048928 Ga0496125_0079744 Ga0496125_0079744_1733_2368 211
688 3300048928 Ga0496125_0111047 Ga0496125_0111047_393_1043 211
689 3300048929 Ga0496126_0011193 Ga0496126_0011193_5799_6434 211
690 3300048929 Ga0496126_0115941 Ga0496126_0115941_1160_1810 211
691 3300049459 Ga0495678_008794 Ga0495678_008794_3572_4222 211
692 3300049459 Ga0495678_034167 Ga0495678_034167_1010_1660 211
693 3300049569 Ga0501032_0111617 Ga0501032_0111617_1044_1694 211
694 3300049570 Ga0501033_0061615 Ga0501033_0061615_1706_2356 211
695 3300049571 Ga0501034_0192412 Ga0501034_0192412_482_1132 211
696 3300049572 Ga0501036_0406720 Ga0501036_0406720_323_973 211
697 3300049574 Ga0501038_0038619 Ga0501038_0038619_2288_2938 211
698 3300049579 Ga0501043_0085025 Ga0501043_0085025_586_1236 211
699 3300049580 Ga0501046_0176923 Ga0501046_0176923_723_1373 211
700 3300049581 Ga0501047_0207260 Ga0501047_0207260_767_1417 211
701 3300049584 Ga0501068_0111688 Ga0501068_0111688_892_1542 211
702 3300049589 Ga0501073_0022789 Ga0501073_0022789_219_869 211
703 3300049744 Ga0501083_0060651 Ga0501083_0060651_51_701 211
704 3300049744 Ga0501083_0308294 Ga0501083_0308294_107_757 211
705 3300050489 nmdc:mga03683_2241_c1 nmdc:mga03683_2241_c1_1572_2222 211
706 3300050490 nmdc:mga03n38_68128_c1 nmdc:mga03n38_68128_c1_792_1442 211
707 3300050491 nmdc:mga00v17_93638_c1 nmdc:mga00v17_93638_c1_1156_1806 211
708 3300050492 nmdc:mga0yw44_1816_c1 nmdc:mga0yw44_1816_c1_6534_7184 211
709 3300050493 nmdc:mga0k408_2883_c2 nmdc:mga0k408_2883_c2_1025_1675 211
710 3300050494 nmdc:mga06z11_22742_c1 nmdc:mga06z11_22742_c1_682_1332 211
711 3300050496 nmdc:mga07m45_11346_c1 nmdc:mga07m45_11346_c1_2924_3574 211
712 3300050516 nmdc:mga0sz30_30206_c1 nmdc:mga0sz30_30206_c1_1270_1920 211
713 3300053079 Ga0500610_0068538 Ga0500610_0068538_1072_1722 211
714 3300053086 Ga0500578_0028293 Ga0500578_0028293_1489_2139 211
715 3300053086 Ga0500578_0068281 Ga0500578_0068281_1202_1852 211
716 3300053093 Ga0500651_0175533 Ga0500651_0175533_195_845 211
717 3300053094 Ga0500566_0242475 Ga0500566_0242475_58_708 211
718 3300053098 Ga0500650_0268895 Ga0500650_0268895_53_703 211
719 3300053105 Ga0500557_018128 Ga0500557_018128_261_911 211
720 3300053108 Ga0500562_033838 Ga0500562_033838_246_896 211
721 3300053109 Ga0500569_000274 Ga0500569_000274_2981_3631 211
722 3300053118 Ga0500594_0001349 Ga0500594_0001349_3578_4228 211
723 3300053125 Ga0500618_007178 Ga0500618_007178_476_1111 211
724 3300053125 Ga0500618_013225 Ga0500618_013225_1039_1689 211
725 3300053134 Ga0500658_0000240 Ga0500658_0000240_19153_19803 211
726 3300053134 Ga0500658_0010234 Ga0500658_0010234_2504_3154 211
727 3300053139 Ga0500568_0001687 Ga0500568_0001687_1179_1829 211
728 3300053139 Ga0500568_0009038 Ga0500568_0009038_1626_2276 211
729 3300053140 Ga0500573_0007453 Ga0500573_0007453_3727_4362 211
730 3300053140 Ga0500573_0154679 Ga0500573_0154679_525_1160 211
731 3300053142 Ga0500577_0043058 Ga0500577_0043058_562_1212 211
732 3300053142 Ga0500577_0166048 Ga0500577_0166048_17_667 211
733 3300053151 Ga0500604_0025099 Ga0500604_0025099_1051_1701 211
734 3300053153 Ga0500616_0001260 Ga0500616_0001260_4674_5324 211
735 3300053153 Ga0500616_0066439 Ga0500616_0066439_517_1167 211
736 3300053156 Ga0500622_0000743 Ga0500622_0000743_11636_12286 211
737 3300053156 Ga0500622_0023839 Ga0500622_0023839_1207_1857 211
738 3300053158 Ga0500627_0011075 Ga0500627_0011075_408_1058 211
739 3300053730 Ga0500645_008090 Ga0500645_008090_813_1463 211
740 3300060353 Ga0501082_0093128 Ga0501082_0093128_746_1396 211
741 iso_pu_bacteria 2509276021 2509391835 211
742 iso_pu_bacteria 2509276033 2509447309 211
743 iso_pu_bacteria 2510065019 2510134149 211
744 iso_pu_bacteria 2510461076 2510895582 211
745 iso_pu_bacteria 2510917028 2511182507 211
746 iso_pu_bacteria 2510917030 2511199219 211
747 iso_pu_bacteria 2513237084 2513567774 211
748 iso_pu_bacteria 2513237085 2513577144 211
749 iso_pu_bacteria 2513237088 2513597702 211
750 iso_pu_bacteria 2513237093 2513633185 211
751 iso_pu_bacteria 2513237103 2513707811 211
752 iso_pu_bacteria 2513237138 2513865889 211
753 iso_pu_bacteria 2513237144 2513908577 211
754 iso_pu_bacteria 2513237146 2513925214 211
755 iso_pu_bacteria 2513237162 2514018105 211
756 iso_pu_bacteria 2515075009 2515113255 211
757 iso_pu_bacteria 2515154113 2515636796 211
758 iso_pu_bacteria 2515154114 2515646338 211
759 iso_pu_bacteria 2515154116 2515655146 211
760 iso_pu_bacteria 2515154134 2515739677 211
761 iso_pu_bacteria 2516653077 2517036917 211
762 iso_pu_bacteria 2516653085 2517077274 211
763 iso_pu_bacteria 2517093000 2517096032 211
764 iso_pu_bacteria 2517287029 2517407651 211
765 iso_pu_bacteria 2519899620 2520377059 211
766 iso_pu_bacteria 2529292951 2530646604 211
767 iso_pu_bacteria 2534681796 2535517072 211
768 iso_pu_bacteria 2582581298 2585223049 211
769 iso_pu_bacteria 2582581299 2585228487 211
770 iso_pu_bacteria 2582581867 2585400922 211
771 iso_pu_bacteria 2585427526 2585524701 211
772 iso_pu_bacteria 2585427528 2585538389 211
773 iso_pu_bacteria 2585427529 2585545632 211
774 iso_pu_bacteria 2585427590 2585822176 211
775 iso_pu_bacteria 2585427593 2585836342 211
776 iso_pu_bacteria 2585427594 2585843429 211
777 iso_pu_bacteria 2599185170 2599417121 211
778 iso_pu_bacteria 2615840624 2616293167 211
779 iso_pu_bacteria 2643221634 2644191852 211
780 iso_pu_bacteria 2643221643 2644242533 211
781 iso_pu_bacteria 2718217882 2719181990 211
782 iso_pu_bacteria 2718217927 2719386601 211
783 iso_pu_bacteria 2718217997 2719666349 211
784 iso_pu_bacteria 2718218009 2719732707 211
785 iso_pu_bacteria 2718218199 2720492769 211
786 iso_pu_bacteria 2718218232 2720614237 211
787 iso_pu_bacteria 2718218233 2720621005 211
788 iso_pu_bacteria 2718218235 2720632329 211
789 iso_pu_bacteria 2718218269 2720776057 211
790 iso_pu_bacteria 2718218363 2721148081 211
791 iso_pu_bacteria 2718218365 2721159532 211
792 iso_pu_bacteria 2718218366 2721164917 211
793 iso_pu_bacteria 2718218423 2721400305 211
794 iso_pu_bacteria 2721755514 2722841087 211
795 iso_pu_bacteria 2721755556 2723027656 211
796 iso_pu_bacteria 2721755684 2723561284 211
797 iso_pu_bacteria 2721755685 2723567907 211
798 iso_pu_bacteria 2721755809 2724039118 211
799 iso_pu_bacteria 2721755810 2724045463 211
800 iso_pu_bacteria 2721755819 2724090664 211
801 iso_pu_bacteria 2721755822 2724105172 211
802 iso_pu_bacteria 2721755823 2724111000 211
803 iso_pu_bacteria 2724679232 2725951405 211
804 iso_pu_bacteria 2728369352 2730108592 211
805 iso_pu_bacteria 2728369365 2730165225 211
806 iso_pu_bacteria 2728369397 2730299164 211
807 iso_pu_bacteria 2738541293 2738800285 211
808 iso_pu_bacteria 2738541333 2739033030 211
809 iso_pu_bacteria 2765235942 2766066074 211
810 iso_pu_bacteria 2791355256 2793294240 211
811 iso_pu_bacteria 2791355259 2793315897 211
812 iso_pu_bacteria 2791355260 2793319371 211
813 iso_pu_bacteria 2791355261 2793328456 211
814 iso_pu_bacteria 2791355262 2793335416 211
815 iso_pu_bacteria 2791355263 2793339467 211
816 iso_pu_bacteria 2791355264 2793347056 211
817 iso_pu_bacteria 2791355265 2793351648 211
818 iso_pu_bacteria 2791355266 2793361944 211
819 iso_pu_bacteria 2791355267 2793367701 211
820 iso_pu_bacteria 2802429605 2805926879 211
821 iso_pu_bacteria 2802429606 2805932794 211
822 iso_pu_bacteria 2802429633 2806045169 211
823 iso_pu_bacteria 2802429634 2806050036 211
824 iso_pu_bacteria 2802429635 2806056874 211
825 iso_pu_bacteria 2802429636 2806064255 211
826 iso_pu_bacteria 2802429637 2806071523 211
827 iso_pu_bacteria 2821123053 2821125695 211
828 iso_pu_bacteria 2838016132 2838021645 211
829 iso_pu_bacteria 2838022645 2838023659 211
830 iso_pu_bacteria 2838035591 2838038672 211
831 iso_pu_bacteria 2838042994 2838045161 211
832 iso_pu_bacteria 2838048938 2838053360 211
833 iso_pu_bacteria 2838061910 2838065480 211
834 iso_pu_bacteria 2838068647 2838069959 211
835 iso_pu_bacteria 2838661181 2838661406 211
836 iso_pu_bacteria 2838668709 2838670553 211
837 iso_pu_bacteria 2838680041 2838683257 211
838 iso_pu_bacteria 2838686498 2838686853 211
839 iso_pu_bacteria 2838694306 2838697799 211
840 iso_pu_bacteria 2838701080 2838702924 211
841 iso_pu_bacteria 2838707686 2838710914 211
842 iso_pu_bacteria 2838729681 2838730189 211
843 iso_pu_bacteria 2838736955 2838737854 211
844 iso_pu_bacteria 2838742623 2838742796 211
845 iso_pu_bacteria 2841840854 2841841777 211
846 iso_pu_bacteria 2841851746 2841852299 211
847 iso_pu_bacteria 2841864319 2841867150 211
848 iso_pu_bacteria 2842077413 2842079088 211
849 iso_pu_bacteria 2842110456 2842113065 211
850 iso_pu_bacteria 2842118031 2842118402 211
851 iso_pu_bacteria 2842140634 2842141555 211
852 iso_pu_bacteria 2842146304 2842147818 211
853 iso_pu_bacteria 2842156927 2842158243 211
854 iso_pu_bacteria 2842163707 2842168598 211
855 iso_pu_bacteria 2842180545 2842181863 211
856 iso_pu_bacteria 2842192696 2842195866 211
857 iso_pu_bacteria 2842198810 2842199173 211
858 iso_pu_bacteria 2842205361 2842209622 211
859 iso_pu_bacteria 2842217011 2842218142 211
860 iso_pu_bacteria 2842229732 2842230086 211
861 iso_pu_bacteria 2842237096 2842240314 211
862 iso_pu_bacteria 2842243621 2842243975 211
863 iso_pu_bacteria 2842250916 2842252884 211
864 iso_pu_bacteria 2842257432 2842257940 211
865 iso_pu_bacteria 2842264693 2842269476 211
866 iso_pu_bacteria 2842271015 2842271609 211
867 iso_pu_bacteria 2842278818 2842283076 211
868 iso_pu_bacteria 2842285085 2842285412 211
869 iso_pu_bacteria 2842291075 2842292750 211
870 iso_pu_bacteria 2842304105 2842305240 211
871 iso_pu_bacteria 2842311132 2842314030 211
872 iso_pu_bacteria 2842317721 2842319731 211
873 iso_pu_bacteria 2842341865 2842347324 211
874 iso_pu_bacteria 2842363717 2842370232 211
875 iso_pu_bacteria 2842370503 2842373888 211
876 iso_pu_bacteria 2842377471 2842379147 211
877 iso_pu_bacteria 2842384541 2842384912 211
878 iso_pu_bacteria 2842395702 2842400152 211
879 iso_pu_bacteria 2842402390 2842402772 211
880 iso_pu_bacteria 2842409023 2842409857 211
881 iso_pu_bacteria 2842415677 2842416506 211
882 iso_pu_bacteria 2842422224 2842423573 211
883 iso_pu_bacteria 2842428310 2842430522 211
884 iso_pu_bacteria 2842434925 2842436666 211
885 iso_pu_bacteria 2842441272 2842443492 211
886 iso_pu_bacteria 2842447887 2842449362 211
887 iso_pu_bacteria 2842462802 2842466776 211
888 iso_pu_bacteria 2842469257 2842471464 211
889 iso_pu_bacteria 2842489311 2842492261 211
890 iso_pu_bacteria 2842495871 2842497879 211
891 iso_pu_bacteria 2844454524 2844458150 211
892 iso_pu_bacteria 2857516855 2857517224 211
893 iso_pu_bacteria 2857531043 2857532256 211
894 iso_pu_bacteria 2919100787 2919106265 211
895 iso_pu_bacteria 2919166419 2919169472 211
896 iso_pu_bacteria 2923556063 2923559297 211
897 iso_pu_bacteria 2933016740 2933020856 211
898 iso_pu_bacteria 2933570622 2933571047 211
899 iso_pu_bacteria 2933586486 2933588878 211
900 iso_pu_bacteria 2933599457 2933600765 211
901 iso_pu_bacteria 2935894831 2935896816 211
902 iso_pu_bacteria 2935901341 2935901760 211
903 iso_pu_bacteria 2936367885 2936371842 211
904 iso_pu_bacteria 2936375103 2936379676 211
905 iso_pu_bacteria 2936381700 2936387847 211
906 iso_pu_bacteria 2996887358 2996892847 211
907 iso_pu_bacteria 2996893221 2996894948 211
908 iso_pu_bacteria 3005409236 3005414373 211
909 iso_pu_bacteria 3005445848 3005448644 211
910 iso_pu_bacteria 639633055 639649372 211
911 iso_pu_bacteria 8005258706 8005259386 211
912 iso_pu_bacteria 8005275841 8005281407 211
913 iso_pu_bacteria 8005282627 8005284624 211
914 iso_pu_bacteria 8005289223 8005295709 211
915 iso_pu_bacteria 8005301065 8005303322 211
916 iso_pu_bacteria 8005307578 8005309587 211
917 iso_pu_bacteria 8005321885 8005327374 211
918 iso_pu_bacteria 8005376324 8005381126 211
919 iso_pu_bacteria 8005382845 8005388924 211
920 iso_pu_bacteria 8005395548 8005395906 211
921 iso_pu_bacteria 8005430974 8005437475 211
922 iso_pu_bacteria 8005460587 8005463938 211
923 iso_pu_bacteria 8005497431 8005501088 211
924 iso_pu_bacteria 8005542996 8005545886 211
925 iso_pu_bacteria 8005556819 8005556825 211
926 iso_pu_bacteria 8005563573 8005568193 211
927 iso_pu_bacteria 8005570704 8005573268 211
928 iso_pu_bacteria 8005619151 8005622455 211
929 iso_pu_bacteria 8005626139 8005629956 211
930 iso_pu_bacteria 8005668836 8005672505 211
931 iso_pu_bacteria 8005688590 8005691906 211
932 iso_pu_bacteria 8005695170 8005697603 211
933 iso_pu_bacteria 8018127388 8018128009 211
934 iso_pu_bacteria 8018163183 8018164376 211
935 iso_pu_bacteria 8018176218 8018176859 211
936 iso_pu_bacteria 8023680758 8023682973 211
937 iso_pu_bacteria 8024479707 8024482667 211
938 iso_pu_bacteria 8024501048 8024504628 211
939 iso_pu_bacteria 8056375014 8056378334 211
940 iso_pu_bacteria 8056382006 8056384225 211
941 iso_pu_bacteria 8057874678 8057878515 211

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

53

183

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ktg-assembly2.cif.gz_B crystal structure of a c. elegans ap4a hydrolase binary complex 0.867 52 162
2pig-assembly1.cif.gz_A crystal structure of ydck from salmonella cholerae at 2.38 a resolution. northeast structural genomics target scr6 0.8486 170 187
5cfi-assembly4.cif.gz_D structural and functional attributes of malaria parasite ap4a hydrolase 0.8365 49 159
5cfi-assembly3.cif.gz_C structural and functional attributes of malaria parasite ap4a hydrolase 0.8291 51 159
5t3p-assembly1.cif.gz_A crystal structure of human peroxisomal coenzyme a diphosphatase nudt7 0.8159 10 206
ID Description Score Start End Superfamily
af_P43337_8_187_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9559 47 207 3.90.79.10
af_A0A1D8PU14_38_158_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8987 53 152 3.90.79.10
af_Q9VY79_60_241_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8828 46 207 3.90.79.10
af_Q8LET2_2_201_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8811 50 206 3.90.79.10
af_Q92350_85_273_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8589 46 207 3.90.79.10
ID Description Score Start End GO Terms
AF-B5ZY77-F1-model_v4 deleted 0.9972 1 211
AF-A0A0Q6FB61-F1-model_v4 DNA mismatch repair protein MutT 0.9956 5 211 GO:0010945
AF-B5ZY77-F1-model_v4 deleted 0.9925 1 211
AF-A0A7W6P2D5-F1-model_v4 8-oxo-dGTP pyrophosphatase MutT (NUDIX family) 0.9908 1 211 GO:0010945
AF-A0A537RS48-F1-model_v4 CoA pyrophosphatase 0.9886 47 207 GO:0010945

Feature Viewer

pLDDT pTM Quality
93.27 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map