F486323
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 941 | 679 | 515 | 211 |
Family's Representative Sequence
| Representative Sequence | 3300002739|JGI25158J39367_1000169|JGI25158J39367_10001699 |
| Length | 216 |
| Sequence | MSEAISRIYPPFSAAEFRRRALNQVGAPVDHAWRDHGDHVLNPDIVALAETLKLRDAAVLVPVVDDGDEAKVIFTKRTSTLRKHSGQIAFPGGSIDPDDVSPEKAAIRETEEEIGLDGGFVETVGRLPNYLSSTGFRITPVLGVVQRGFSLQLNPIEVDDVFEVPLSFLMNPANHNRDKRVVDGIDRHFYRMPYETWMIWGITAGIVRTLYERLYA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 3 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 4 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 5 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 6 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 7 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 8 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 9 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 10 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 11 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 12 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 13 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 14 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 15 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 16 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 17 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 18 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 19 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 20 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 21 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 22 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 23 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 24 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 25 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 26 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 27 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 28 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 29 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 30 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 31 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 32 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 33 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 34 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 35 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 36 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 37 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 38 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 39 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 40 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 41 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 42 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 43 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 44 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 45 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 46 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 47 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 48 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 49 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 50 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 51 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 52 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 53 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 54 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 55 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 56 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 57 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 58 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 59 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 60 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 61 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 62 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 63 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 64 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 65 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 66 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 67 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 68 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 69 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 70 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 71 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 72 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 73 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 74 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 75 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 76 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 77 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 78 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 79 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 80 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 81 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 82 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 83 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 84 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 85 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 86 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 87 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 88 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 89 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 90 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 91 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 92 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 93 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 94 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 95 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 96 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 97 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 98 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 99 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 100 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 101 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 102 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 103 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 104 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 105 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 106 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 107 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 108 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 109 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 110 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 111 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 112 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 113 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 114 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 115 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 116 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 117 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 118 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 119 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 120 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 121 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 122 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 123 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 124 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 125 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 126 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 127 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 128 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 129 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 130 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 131 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 132 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 133 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 134 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 135 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 136 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 137 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 138 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 139 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 140 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 141 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 142 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 143 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 144 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 145 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 146 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 147 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 148 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 149 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 150 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 151 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 152 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 153 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 154 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 155 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 156 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 157 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 158 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 159 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 160 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 161 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 162 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 163 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 164 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 165 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 166 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 167 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 168 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 169 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 170 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 171 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 172 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 173 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 174 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 175 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 176 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 177 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 178 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 179 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 180 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 181 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 182 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 183 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 184 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 185 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 186 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 187 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 188 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 189 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 190 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 191 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 192 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 193 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 194 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 195 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 196 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 197 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 198 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 199 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 200 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 201 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 202 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 203 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 204 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 205 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 206 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 207 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 208 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 209 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 210 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 211 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 212 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 213 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 214 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 215 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 216 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 217 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 218 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 219 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 220 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 221 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 222 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 223 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 224 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 225 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 226 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 227 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 228 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 229 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 230 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 231 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 232 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 233 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 234 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 235 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 236 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 237 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 238 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 239 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 240 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 241 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 242 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 243 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 244 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 245 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 246 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 247 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 248 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 249 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 250 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 251 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 252 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 253 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 254 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 255 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 256 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 257 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 258 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 259 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 260 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 261 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 262 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 263 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 264 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 265 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 266 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 267 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 268 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 269 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 270 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 271 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 272 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 273 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 274 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 275 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 276 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 277 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 278 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 279 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 280 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 281 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 282 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 283 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 284 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 285 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 286 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 287 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 288 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 289 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 290 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 291 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 292 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 293 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 294 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 295 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 296 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 297 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 298 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 299 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 300 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 301 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 302 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 303 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 304 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 305 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 306 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 307 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 308 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 309 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 310 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 311 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 312 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 313 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 314 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 315 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 316 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 317 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 318 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 319 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 320 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 321 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 322 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 323 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 324 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 325 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 326 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 327 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 328 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 329 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 330 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 331 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 332 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 333 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 334 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 335 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 336 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 337 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 338 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 339 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 340 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 341 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 342 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 343 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 344 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 345 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 346 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 347 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 348 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 349 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 350 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 351 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 352 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 353 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 354 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 355 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 356 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 357 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 358 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 359 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 360 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 361 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 362 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 363 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 364 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 365 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 366 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 367 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 368 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 369 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 370 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 371 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 372 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 373 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 374 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 375 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 376 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 377 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 378 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 379 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 380 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 381 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 382 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 383 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 384 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 385 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 386 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 387 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 388 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 389 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 390 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 391 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 392 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 393 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 394 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 395 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 396 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 397 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 398 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 399 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 400 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 401 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 402 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 403 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 404 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 405 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 406 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 407 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 408 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 409 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 410 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 411 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 412 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 413 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 414 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 415 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 416 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 417 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 418 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 419 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 420 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 421 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 422 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 423 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 424 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 425 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 426 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 427 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 428 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 429 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 430 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 431 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 432 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 433 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 434 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 435 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 436 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 437 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 438 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 439 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 440 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 441 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 442 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 443 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 444 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 445 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 446 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 447 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 448 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 449 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 450 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 451 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 452 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 453 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 454 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 455 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 456 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 457 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 458 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 459 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 460 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 461 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 462 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 463 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 464 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 465 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 466 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 467 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 468 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 469 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 470 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 471 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 472 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 473 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 474 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 475 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 476 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 477 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 478 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 479 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 480 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 481 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 482 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 483 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 484 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 485 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 486 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 487 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 488 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 489 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 490 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 491 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 492 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 493 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 494 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 495 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 496 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 497 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 498 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 499 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 500 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 501 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 502 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 503 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 504 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 505 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 506 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 507 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 508 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 509 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 510 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 511 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 512 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 513 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 514 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 515 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 516 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 517 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 518 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 519 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 520 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 521 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 522 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 556 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 557 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 558 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 559 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 560 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 561 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 562 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 563 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 564 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 565 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 566 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 567 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 568 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 569 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 570 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 571 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 572 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 573 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 574 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 575 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 576 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 577 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 578 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 580 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 581 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 582 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 583 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 584 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 585 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 586 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 587 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 588 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 589 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 590 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 591 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 592 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 593 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 594 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 595 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 596 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 597 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 598 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 599 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 600 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 601 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 602 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 603 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 604 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 605 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 606 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 607 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 608 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 609 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 611 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 612 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 613 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 614 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 615 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 616 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 617 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 618 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 619 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 620 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 621 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 622 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 623 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 624 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 625 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 626 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 627 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 628 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 629 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 630 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 631 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 632 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 633 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 634 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 635 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 636 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 637 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 638 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 639 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 640 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 641 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 642 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 643 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 644 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 645 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 646 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 647 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 648 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 649 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 650 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 651 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 652 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 653 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 654 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 655 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 656 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 657 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 658 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 659 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 660 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 661 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 662 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 663 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 664 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 665 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 666 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 667 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 668 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 669 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 670 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 671 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 672 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 673 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 674 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 675 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 676 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 677 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 678 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 679 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 54.73 |
| Metatranscriptomes | 0 |
| Isolates | 45.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.07 |
| Nodule | 34.75 |
| Rhizoplane | 2.55 |
| Rhizosphere | 28.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10002656 | 3300001979 | Bacteria | 8038 |
| 2 | JGI25155J39150_1000014 | 3300002704 | Bacteria | 196159 |
| 3 | JGI25156J39149_1000037 | 3300002705 | Bacteria | 109690 |
| 4 | JGI25156J39149_1004395 | 3300002705 | Bacteria | 4305 |
| 5 | JGI25162J39368_1000379 | 3300002737 | Bacteria | 37841 |
| 6 | JGI25154J39366_1000052 | 3300002738 | Bacteria | 120209 |
| 7 | JGI25154J39366_1000229 | 3300002738 | Bacteria | 37528 |
| 8 | JGI25158J39367_1000169 | 3300002739 | Bacteria | 15587 |
| 9 | JGI25157J39369_1000040 | 3300002741 | Bacteria | 126165 |
| 10 | JGI25157J39369_1000710 | 3300002741 | Bacteria | 17962 |
| 11 | JGI25152J39213_1000401 | 3300002773 | Bacteria | 26413 |
| 12 | JGI25152J39213_1000670 | 3300002773 | Bacteria | 17822 |
| 13 | JGI25152J39213_1005468 | 3300002773 | Bacteria | 3693 |
| 14 | JGI25152J39213_1006845 | 3300002773 | Bacteria | 3022 |
| 15 | JGI25152J39213_1008189 | 3300002773 | Bacteria | 2619 |
| 16 | JGI25152J39213_1008772 | 3300002773 | Bacteria | 2472 |
| 17 | JGI25150J39212_1000088 | 3300002774 | Bacteria | 53538 |
| 18 | JGI25150J39212_1012828 | 3300002774 | Bacteria | 1470 |
| 19 | JGI25150J39212_1017228 | 3300002774 | Bacteria | 1170 |
| 20 | JGI25159J45721_1000120 | 3300002987 | Bacteria | 37322 |
| 21 | JGI25151J46595_10000215 | 3300003187 | Bacteria | 69771 |
| 22 | JGI25151J46595_10000280 | 3300003187 | Bacteria | 58125 |
| 23 | JGI25151J46595_10019207 | 3300003187 | Bacteria | 2908 |
| 24 | JGI25165J46597_1000006 | 3300003214 | Bacteria | 529784 |
| 25 | JGI25165J46597_1000469 | 3300003214 | Bacteria | 39844 |
| 26 | JGI25153J46596_10012354 | 3300003215 | Bacteria | 3693 |
| 27 | JGI25153J46596_10012823 | 3300003215 | Bacteria | 3586 |
| 28 | JGI25153J46596_10017279 | 3300003215 | Bacteria | 2846 |
| 29 | JGI25153J46596_10017963 | 3300003215 | Bacteria | 2765 |
| 30 | JGI25153J46596_10019278 | 3300003215 | Bacteria | 2619 |
| 31 | rootH2_10013960 | 3300003320 | Bacteria | 6866 |
| 32 | rootL2_10001418 | 3300003322 | Bacteria | 8682 |
| 33 | rootL2_10183749 | 3300003322 | Bacteria | 1108 |
| 34 | rootH1_10128178 | 3300003323 | Bacteria | 3616 |
| 35 | JGI25160J50197_1000001 | 3300003354 | Bacteria | 782301 |
| 36 | JGI25160J50197_1001620 | 3300003354 | Bacteria | 11052 |
| 37 | JGI25160J50197_1004466 | 3300003354 | Bacteria | 6045 |
| 38 | JGI25160J50197_1009073 | 3300003354 | Bacteria | 3722 |
| 39 | JGI25161J50226_1000001 | 3300003374 | Bacteria | 655036 |
| 40 | JGI25161J50226_1000068 | 3300003374 | Bacteria | 90522 |
| 41 | JGI25161J50226_1002317 | 3300003374 | Bacteria | 4955 |
| 42 | Ga0055526_1001827 | 3300003771 | Bacteria | 14719 |
| 43 | Ga0055526_1004459 | 3300003771 | Bacteria | 8398 |
| 44 | Ga0055526_1005133 | 3300003771 | Bacteria | 7633 |
| 45 | Ga0055526_1011309 | 3300003771 | Bacteria | 4039 |
| 46 | Ga0055524_1002683 | 3300003775 | Bacteria | 9014 |
| 47 | Ga0055524_1006497 | 3300003775 | Bacteria | 5063 |
| 48 | Ga0055528_1001415 | 3300003790 | Bacteria | 14697 |
| 49 | Ga0055528_1001467 | 3300003790 | Bacteria | 14328 |
| 50 | Ga0055540_1000592 | 3300003792 | Bacteria | 26360 |
| 51 | Ga0055540_1013767 | 3300003792 | Bacteria | 2451 |
| 52 | Ga0055540_1013895 | 3300003792 | Bacteria | 2432 |
| 53 | Ga0055543_1000003 | 3300004625 | Bacteria | 358656 |
| 54 | Ga0055543_1000189 | 3300004625 | Bacteria | 50188 |
| 55 | Ga0055543_1000662 | 3300004625 | Bacteria | 18194 |
| 56 | Ga0065165_1000008 | 3300005262 | Bacteria | 334429 |
| 57 | Ga0065165_1010902 | 3300005262 | Bacteria | 3865 |
| 58 | Ga0065165_1021641 | 3300005262 | Bacteria | 2227 |
| 59 | Ga0070676_10243217 | 3300005328 | Bacteria | 1198 |
| 60 | Ga0070666_10232608 | 3300005335 | Bacteria | 1302 |
| 61 | Ga0070660_100053524 | 3300005339 | Bacteria | 3114 |
| 62 | Ga0070668_100307665 | 3300005347 | Bacteria | 1331 |
| 63 | Ga0070668_100521272 | 3300005347 | Bacteria | 1031 |
| 64 | Ga0070671_100180300 | 3300005355 | Bacteria | 1788 |
| 65 | Ga0070663_100074640 | 3300005455 | Bacteria | 2477 |
| 66 | Ga0070663_100248250 | 3300005455 | Bacteria | 1408 |
| 67 | Ga0070662_100342118 | 3300005457 | Bacteria | 1224 |
| 68 | Ga0068867_100026106 | 3300005459 | Bacteria | 4193 |
| 69 | Ga0068867_100113860 | 3300005459 | Bacteria | 2082 |
| 70 | Ga0068853_100109766 | 3300005539 | Bacteria | 2449 |
| 71 | Ga0068853_100145615 | 3300005539 | Bacteria | 2129 |
| 72 | Ga0070665_100184163 | 3300005548 | Bacteria | 2089 |
| 73 | Ga0068855_100471350 | 3300005563 | Bacteria | 1368 |
| 74 | Ga0068854_100160269 | 3300005578 | Bacteria | 1742 |
| 75 | Ga0068856_100041846 | 3300005614 | Bacteria | 4505 |
| 76 | Ga0068852_100231602 | 3300005616 | Bacteria | 1761 |
| 77 | Ga0068851_10046965 | 3300005834 | Bacteria | 2185 |
| 78 | Ga0070717_10249994 | 3300006028 | Bacteria | 1566 |
| 79 | Ga0075365_10002611 | 3300006038 | Bacteria | 8916 |
| 80 | Ga0075365_10002699 | 3300006038 | Bacteria | 8841 |
| 81 | Ga0075365_10017790 | 3300006038 | Bacteria | 4358 |
| 82 | Ga0075365_10602350 | 3300006038 | Bacteria | 777 |
| 83 | Ga0075363_100006159 | 3300006048 | Bacteria | 5422 |
| 84 | Ga0075363_100032615 | 3300006048 | Bacteria | 2707 |
| 85 | Ga0075363_100145048 | 3300006048 | Bacteria | 1338 |
| 86 | Ga0075364_10334532 | 3300006051 | Bacteria | 1032 |
| 87 | Ga0075362_10007590 | 3300006177 | Bacteria | 4117 |
| 88 | Ga0075367_10025336 | 3300006178 | Bacteria | 3354 |
| 89 | Ga0075367_10028325 | 3300006178 | Bacteria | 3195 |
| 90 | Ga0075369_10000814 | 3300006186 | Bacteria | 10260 |
| 91 | Ga0075369_10017791 | 3300006186 | Bacteria | 2887 |
| 92 | Ga0075370_10000522 | 3300006353 | Bacteria | 14644 |
| 93 | Ga0075370_10004914 | 3300006353 | Bacteria | 6566 |
| 94 | Ga0105251_10027604 | 3300009011 | Bacteria | 2876 |
| 95 | Ga0105244_10143565 | 3300009036 | Bacteria | 1147 |
| 96 | Ga0105250_10041635 | 3300009092 | Bacteria | 1841 |
| 97 | Ga0105250_10134313 | 3300009092 | Bacteria | 1023 |
| 98 | Ga0105240_10000014 | 3300009093 | Bacteria | 482033 |
| 99 | Ga0105240_10099498 | 3300009093 | Bacteria | 3539 |
| 100 | Ga0105240_10478398 | 3300009093 | Bacteria | 1389 |
| 101 | Ga0105245_10743845 | 3300009098 | Bacteria | 1016 |
| 102 | Ga0105243_10586801 | 3300009148 | Bacteria | 1071 |
| 103 | Ga0105241_10097880 | 3300009174 | Bacteria | 2327 |
| 104 | Ga0105248_10005639 | 3300009177 | Bacteria | 13745 |
| 105 | Ga0105248_10332898 | 3300009177 | Bacteria | 1710 |
| 106 | Ga0105237_10002417 | 3300009545 | Bacteria | 23180 |
| 107 | Ga0105237_10030724 | 3300009545 | Bacteria | 5453 |
| 108 | Ga0105238_10002480 | 3300009551 | Bacteria | 18475 |
| 109 | Ga0105238_10354534 | 3300009551 | Bacteria | 1456 |
| 110 | Ga0105238_10372582 | 3300009551 | Bacteria | 1418 |
| 111 | Ga0105249_10148486 | 3300009553 | Bacteria | 2254 |
| 112 | Ga0123341_1000124 | 3300009765 | Bacteria | 35033 |
| 113 | Ga0123342_1005659 | 3300009766 | Bacteria | 17915 |
| 114 | Ga0123342_1027387 | 3300009766 | Bacteria | 3193 |
| 115 | Ga0105239_10000973 | 3300010375 | Bacteria | 40196 |
| 116 | Ga0105239_10077098 | 3300010375 | Bacteria | 3667 |
| 117 | Ga0105239_10301724 | 3300010375 | Bacteria | 1804 |
| 118 | Ga0105246_10108885 | 3300011119 | Bacteria | 2031 |
| 119 | Ga0157373_10451035 | 3300013100 | Bacteria | 925 |
| 120 | Ga0157370_10000327 | 3300013104 | Bacteria | 59705 |
| 121 | Ga0182007_10002502 | 3300015262 | Bacteria | 9083 |
| 122 | Ga0182005_1004223 | 3300015265 | Bacteria | 4689 |
| 123 | Ga0209435_100027 | 3300025206 | Bacteria | 196217 |
| 124 | Ga0209436_100061 | 3300025208 | Bacteria | 58629 |
| 125 | Ga0209437_100060 | 3300025233 | Bacteria | 355034 |
| 126 | Ga0207425_1000055 | 3300025245 | Bacteria | 152820 |
| 127 | Ga0207425_1003073 | 3300025245 | Bacteria | 5528 |
| 128 | Ga0207425_1003575 | 3300025245 | Bacteria | 4926 |
| 129 | Ga0207425_1005271 | 3300025245 | Bacteria | 3714 |
| 130 | Ga0209646_1000086 | 3300025246 | Bacteria | 196217 |
| 131 | Ga0209646_1006486 | 3300025246 | Bacteria | 1964 |
| 132 | Ga0209646_1006725 | 3300025246 | Bacteria | 1916 |
| 133 | Ga0209026_1000082 | 3300025250 | Bacteria | 196315 |
| 134 | Ga0209026_1000089 | 3300025250 | Bacteria | 175907 |
| 135 | Ga0209677_100420 | 3300025253 | Bacteria | 25145 |
| 136 | Ga0209148_1000124 | 3300025254 | Bacteria | 185123 |
| 137 | Ga0209759_1000040 | 3300025256 | Bacteria | 254501 |
| 138 | Ga0209759_1000063 | 3300025256 | Bacteria | 196315 |
| 139 | Ga0209759_1030080 | 3300025256 | Bacteria | 1078 |
| 140 | Ga0209129_1000029 | 3300025258 | Bacteria | 401149 |
| 141 | Ga0209129_1000607 | 3300025258 | Bacteria | 24231 |
| 142 | Ga0209129_1000827 | 3300025258 | Bacteria | 19479 |
| 143 | Ga0209129_1000980 | 3300025258 | Bacteria | 17125 |
| 144 | Ga0209129_1003272 | 3300025258 | Bacteria | 7176 |
| 145 | Ga0209233_1000010 | 3300025261 | Bacteria | 1194329 |
| 146 | Ga0209233_1000095 | 3300025261 | Bacteria | 303783 |
| 147 | Ga0209233_1000113 | 3300025261 | Bacteria | 253455 |
| 148 | Ga0209565_1029992 | 3300025263 | Bacteria | 1065 |
| 149 | Ga0209455_1000062 | 3300025272 | Bacteria | 335169 |
| 150 | Ga0209673_1000025 | 3300025273 | Bacteria | 404572 |
| 151 | Ga0209673_1000858 | 3300025273 | Bacteria | 39511 |
| 152 | Ga0209673_1000878 | 3300025273 | Bacteria | 39065 |
| 153 | Ga0209673_1001058 | 3300025273 | Bacteria | 31480 |
| 154 | Ga0209673_1002625 | 3300025273 | Bacteria | 12075 |
| 155 | Ga0209673_1005843 | 3300025273 | Bacteria | 6094 |
| 156 | Ga0209673_1018391 | 3300025273 | Bacteria | 2542 |
| 157 | Ga0209130_1000003 | 3300025284 | Bacteria | 677988 |
| 158 | Ga0209130_1000020 | 3300025284 | Bacteria | 379297 |
| 159 | Ga0209130_1015542 | 3300025284 | Bacteria | 1871 |
| 160 | Ga0209676_1055198 | 3300025292 | Bacteria | 1019 |
| 161 | Ga0209025_1000070 | 3300025294 | Bacteria | 287776 |
| 162 | Ga0209025_1000091 | 3300025294 | Bacteria | 250401 |
| 163 | Ga0209025_1003763 | 3300025294 | Bacteria | 13899 |
| 164 | Ga0209025_1015180 | 3300025294 | Bacteria | 4669 |
| 165 | Ga0209025_1016502 | 3300025294 | Bacteria | 4346 |
| 166 | Ga0209564_1000265 | 3300025295 | Bacteria | 110606 |
| 167 | Ga0209564_1001272 | 3300025295 | Bacteria | 27752 |
| 168 | Ga0209564_1001274 | 3300025295 | Bacteria | 27732 |
| 169 | Ga0209564_1015499 | 3300025295 | Bacteria | 3094 |
| 170 | Ga0209758_1000094 | 3300025297 | Bacteria | 241068 |
| 171 | Ga0209758_1001587 | 3300025297 | Bacteria | 26013 |
| 172 | Ga0209758_1001902 | 3300025297 | Bacteria | 22788 |
| 173 | Ga0209758_1002315 | 3300025297 | Bacteria | 19697 |
| 174 | Ga0209758_1002367 | 3300025297 | Bacteria | 19402 |
| 175 | Ga0209758_1002590 | 3300025297 | Bacteria | 18143 |
| 176 | Ga0209758_1021042 | 3300025297 | Bacteria | 3058 |
| 177 | Ga0209758_1051359 | 3300025297 | Bacteria | 1436 |
| 178 | Ga0209050_1005990 | 3300025298 | Bacteria | 7378 |
| 179 | Ga0209256_1000381 | 3300025299 | Bacteria | 70973 |
| 180 | Ga0209256_1002239 | 3300025299 | Bacteria | 16454 |
| 181 | Ga0209256_1004292 | 3300025299 | Bacteria | 9080 |
| 182 | Ga0209256_1009559 | 3300025299 | Bacteria | 4226 |
| 183 | Ga0209256_1057140 | 3300025299 | Bacteria | 921 |
| 184 | Ga0207426_1000008 | 3300025302 | Bacteria | 848730 |
| 185 | Ga0207426_1000011 | 3300025302 | Bacteria | 791203 |
| 186 | Ga0207426_1000218 | 3300025302 | Bacteria | 135865 |
| 187 | Ga0207426_1000941 | 3300025302 | Bacteria | 28895 |
| 188 | Ga0209051_1000393 | 3300025303 | Bacteria | 60776 |
| 189 | Ga0209051_1001581 | 3300025303 | Bacteria | 18750 |
| 190 | Ga0209051_1006611 | 3300025303 | Bacteria | 6499 |
| 191 | Ga0209051_1011717 | 3300025303 | Bacteria | 4306 |
| 192 | Ga0209257_1002259 | 3300025304 | Bacteria | 19695 |
| 193 | Ga0209257_1024874 | 3300025304 | Bacteria | 2060 |
| 194 | Ga0207696_1062773 | 3300025711 | Bacteria | 1042 |
| 195 | Ga0207713_1066957 | 3300025735 | Bacteria | 1341 |
| 196 | Ga0207680_10325932 | 3300025903 | Bacteria | 1075 |
| 197 | Ga0207645_10228245 | 3300025907 | Bacteria | 1228 |
| 198 | Ga0207654_10602462 | 3300025911 | Bacteria | 784 |
| 199 | Ga0207695_10000037 | 3300025913 | Bacteria | 476303 |
| 200 | Ga0207695_10096719 | 3300025913 | Bacteria | 2954 |
| 201 | Ga0207695_10226720 | 3300025913 | Bacteria | 1774 |
| 202 | Ga0207671_10000271 | 3300025914 | Bacteria | 77228 |
| 203 | Ga0207671_10011901 | 3300025914 | Bacteria | 7035 |
| 204 | Ga0207657_10027453 | 3300025919 | Bacteria | 5213 |
| 205 | Ga0207681_10603691 | 3300025923 | Bacteria | 907 |
| 206 | Ga0207694_10002308 | 3300025924 | Bacteria | 15599 |
| 207 | Ga0207694_10364566 | 3300025924 | Bacteria | 1198 |
| 208 | Ga0207687_10465741 | 3300025927 | Bacteria | 1050 |
| 209 | Ga0207709_10262761 | 3300025935 | Bacteria | 1266 |
| 210 | Ga0207669_10171224 | 3300025937 | Bacteria | 1546 |
| 211 | Ga0207667_10722992 | 3300025949 | Bacteria | 997 |
| 212 | Ga0207668_10207649 | 3300025972 | Bacteria | 1564 |
| 213 | Ga0207668_10889386 | 3300025972 | Bacteria | 792 |
| 214 | Ga0207640_10338716 | 3300025981 | Bacteria | 1204 |
| 215 | Ga0207639_10096450 | 3300026041 | Bacteria | 2379 |
| 216 | Ga0207678_10031493 | 3300026067 | Bacteria | 4627 |
| 217 | Ga0207678_10033300 | 3300026067 | Bacteria | 4490 |
| 218 | Ga0207678_10655825 | 3300026067 | Bacteria | 922 |
| 219 | Ga0207648_10064666 | 3300026089 | Bacteria | 3188 |
| 220 | Ga0207698_10092184 | 3300026142 | Bacteria | 2483 |
| 221 | Ga0207698_10215413 | 3300026142 | Bacteria | 1731 |
| 222 | Ga0207698_10752715 | 3300026142 | Bacteria | 973 |
| 223 | Ga0209281_1000034 | 3300027111 | Bacteria | 382562 |
| 224 | Ga0209371_1001220 | 3300027312 | Bacteria | 18539 |
| 225 | Ga0307515_10004087 | 3300028794 | Bacteria | 30420 |
| 226 | Ga0307515_10391290 | 3300028794 | Bacteria | 1019 |
| 227 | Ga0268256_1006647 | 3300030500 | Bacteria | 4261 |
| 228 | Ga0265330_10167873 | 3300031235 | Bacteria | 931 |
| 229 | Ga0265325_10272857 | 3300031241 | Bacteria | 760 |
| 230 | Ga0265340_10002710 | 3300031247 | Bacteria | 10078 |
| 231 | Ga0265331_10036251 | 3300031250 | Bacteria | 2422 |
| 232 | Ga0265316_10027424 | 3300031344 | Bacteria | 4716 |
| 233 | Ga0307513_10045937 | 3300031456 | Bacteria | 4769 |
| 234 | Ga0265313_10003872 | 3300031595 | Bacteria | 11798 |
| 235 | Ga0265314_10049360 | 3300031711 | Bacteria | 2947 |
| 236 | Ga0265314_10088377 | 3300031711 | Bacteria | 2024 |
| 237 | Ga0265342_10004715 | 3300031712 | Bacteria | 10611 |
| 238 | Ga0307405_10028572 | 3300031731 | Bacteria | 3250 |
| 239 | Ga0307406_10015020 | 3300031901 | Bacteria | 4471 |
| 240 | Ga0307412_10018275 | 3300031911 | Bacteria | 4215 |
| 241 | Ga0307414_10148286 | 3300032004 | Bacteria | 1847 |
| 242 | Ga0307510_10185038 | 3300033180 | Bacteria | 1639 |
| 243 | Ga0395900_0043259 | 3300037418 | Bacteria | 4642 |
| 244 | Ga0395900_0164584 | 3300037418 | Bacteria | 2261 |
| 245 | Ga0395900_0538056 | 3300037418 | Bacteria | 1114 |
| 246 | Ga0395901_0017106 | 3300038443 | Bacteria | 7393 |
| 247 | Ga0395901_0061000 | 3300038443 | Bacteria | 3925 |
| 248 | Ga0395901_0066050 | 3300038443 | Bacteria | 3768 |
| 249 | Ga0395901_0762018 | 3300038443 | Bacteria | 960 |
| 250 | Ga0439436_0004741 | 3300041404 | Bacteria | 4170 |
| 251 | Ga0439466_0056683 | 3300041411 | Bacteria | 1271 |
| 252 | Ga0439465_0003533 | 3300041413 | Bacteria | 5095 |
| 253 | Ga0439465_0060305 | 3300041413 | Bacteria | 1256 |
| 254 | Ga0451797_0076574 | 3300041453 | Bacteria | 2253 |
| 255 | Ga0451798_0635833 | 3300041458 | Bacteria | 1548 |
| 256 | Ga0451847_0389759 | 3300041503 | Bacteria | 2748 |
| 257 | Ga0451849_0307898 | 3300041505 | Bacteria | 996 |
| 258 | Ga0451851_0256480 | 3300041507 | Bacteria | 1194 |
| 259 | Ga0451855_0806073 | 3300041511 | Bacteria | 3678 |
| 260 | Ga0451855_1544524 | 3300041511 | Bacteria | 1057 |
| 261 | Ga0450907_023065 | 3300042146 | Bacteria | 1049 |
| 262 | Ga0466966_0097533 | 3300044684 | Bacteria | 1820 |
| 263 | Ga0466970_0002933 | 3300044765 | Bacteria | 8263 |
| 264 | Ga0466959_0047621 | 3300045049 | Bacteria | 3153 |
| 265 | Ga0466958_0016942 | 3300045836 | Bacteria | 4204 |
| 266 | Ga0466967_0253790 | 3300045976 | Bacteria | 1681 |
| 267 | Ga0495638_0002551 | 3300046460 | Bacteria | 14767 |
| 268 | Ga0495638_0071142 | 3300046460 | Bacteria | 2128 |
| 269 | Ga0495638_0178706 | 3300046460 | Bacteria | 1212 |
| 270 | Ga0495638_0369859 | 3300046460 | Bacteria | 752 |
| 271 | Ga0495650_0025883 | 3300046471 | Bacteria | 2740 |
| 272 | Ga0495650_0036172 | 3300046471 | Bacteria | 2164 |
| 273 | Ga0495605_0001730 | 3300046474 | Bacteria | 13987 |
| 274 | Ga0495585_0013280 | 3300046492 | Bacteria | 4824 |
| 275 | Ga0495585_0099884 | 3300046492 | Bacteria | 1553 |
| 276 | Ga0495596_0182026 | 3300046500 | Bacteria | 817 |
| 277 | Ga0495607_0072619 | 3300046501 | Bacteria | 1915 |
| 278 | Ga0495607_0078339 | 3300046501 | Bacteria | 1823 |
| 279 | Ga0495583_0002632 | 3300046506 | Bacteria | 14983 |
| 280 | Ga0495583_0026756 | 3300046506 | Bacteria | 2854 |
| 281 | Ga0495583_0029606 | 3300046506 | Bacteria | 2677 |
| 282 | Ga0495583_0046093 | 3300046506 | Bacteria | 2012 |
| 283 | Ga0495606_0015037 | 3300046507 | Bacteria | 5993 |
| 284 | Ga0495606_0019899 | 3300046507 | Bacteria | 4971 |
| 285 | Ga0495606_0030262 | 3300046507 | Bacteria | 3785 |
| 286 | Ga0495606_0102576 | 3300046507 | Bacteria | 1739 |
| 287 | Ga0495606_0115199 | 3300046507 | Bacteria | 1616 |
| 288 | Ga0495606_0215222 | 3300046507 | Bacteria | 1086 |
| 289 | Ga0495610_0001520 | 3300046512 | Bacteria | 20427 |
| 290 | Ga0495610_0017115 | 3300046512 | Bacteria | 4143 |
| 291 | Ga0495610_0024024 | 3300046512 | Bacteria | 3297 |
| 292 | Ga0495610_0198560 | 3300046512 | Bacteria | 823 |
| 293 | Ga0495616_0014048 | 3300046513 | Bacteria | 4497 |
| 294 | Ga0495616_0039405 | 3300046513 | Bacteria | 2420 |
| 295 | Ga0495620_0009706 | 3300046515 | Bacteria | 5109 |
| 296 | Ga0495620_0017647 | 3300046515 | Bacteria | 3550 |
| 297 | Ga0495631_0000977 | 3300046518 | Bacteria | 17746 |
| 298 | Ga0495631_0063800 | 3300046518 | Bacteria | 1595 |
| 299 | Ga0495632_0004030 | 3300046519 | Bacteria | 10143 |
| 300 | Ga0495632_0004699 | 3300046519 | Bacteria | 9226 |
| 301 | Ga0495632_0009534 | 3300046519 | Bacteria | 5841 |
| 302 | Ga0495643_0019883 | 3300046522 | Bacteria | 3881 |
| 303 | Ga0495643_0029557 | 3300046522 | Bacteria | 3065 |
| 304 | Ga0495643_0072449 | 3300046522 | Bacteria | 1806 |
| 305 | Ga0495648_0055944 | 3300046524 | Bacteria | 2376 |
| 306 | Ga0495654_0098787 | 3300046530 | Bacteria | 1346 |
| 307 | Ga0495609_0076366 | 3300046538 | Bacteria | 1468 |
| 308 | Ga0495597_0077697 | 3300046542 | Bacteria | 1422 |
| 309 | Ga0495668_0017591 | 3300046616 | Bacteria | 4142 |
| 310 | Ga0495668_0047316 | 3300046616 | Bacteria | 2388 |
| 311 | Ga0495668_0051725 | 3300046616 | Bacteria | 2274 |
| 312 | Ga0495668_0182045 | 3300046616 | Bacteria | 1151 |
| 313 | Ga0495611_0290709 | 3300046648 | Bacteria | 754 |
| 314 | Ga0495625_0007821 | 3300046660 | Bacteria | 9216 |
| 315 | Ga0495625_0012470 | 3300046660 | Bacteria | 6887 |
| 316 | Ga0495625_0085789 | 3300046660 | Bacteria | 2185 |
| 317 | Ga0495625_0592899 | 3300046660 | Bacteria | 666 |
| 318 | Ga0495661_0149257 | 3300046665 | Bacteria | 1264 |
| 319 | Ga0495670_0003409 | 3300046691 | Bacteria | 7811 |
| 320 | Ga0495649_0009649 | 3300046694 | Bacteria | 5722 |
| 321 | Ga0495660_0010273 | 3300046810 | Bacteria | 5442 |
| 322 | Ga0495660_0034266 | 3300046810 | Bacteria | 2842 |
| 323 | Ga0495660_0178277 | 3300046810 | Bacteria | 1030 |
| 324 | Ga0495636_0005706 | 3300047318 | Bacteria | 4880 |
| 325 | Ga0495672_0061399 | 3300047320 | Bacteria | 2166 |
| 326 | Ga0495683_0110123 | 3300047323 | Bacteria | 1315 |
| 327 | Ga0495687_013048 | 3300047443 | Bacteria | 4356 |
| 328 | Ga0495677_0128489 | 3300047445 | Bacteria | 969 |
| 329 | Ga0495685_072090 | 3300047447 | Bacteria | 1156 |
| 330 | Ga0495686_0006043 | 3300047472 | Bacteria | 9393 |
| 331 | Ga0495686_0009070 | 3300047472 | Bacteria | 7215 |
| 332 | Ga0495686_0078790 | 3300047472 | Bacteria | 2016 |
| 333 | Ga0495686_0249973 | 3300047472 | Bacteria | 997 |
| 334 | Ga0495615_0002096 | 3300048090 | Bacteria | 3126 |
| 335 | Ga0496102_0009649 | 3300048905 | Bacteria | 8302 |
| 336 | Ga0496102_0058400 | 3300048905 | Bacteria | 3525 |
| 337 | Ga0496102_0083725 | 3300048905 | Bacteria | 2943 |
| 338 | Ga0496102_0169943 | 3300048905 | Bacteria | 2053 |
| 339 | Ga0496103_0060501 | 3300048906 | Bacteria | 2354 |
| 340 | Ga0496104_0120448 | 3300048907 | Bacteria | 2519 |
| 341 | Ga0496105_0085877 | 3300048908 | Bacteria | 2600 |
| 342 | Ga0496105_0477611 | 3300048908 | Bacteria | 981 |
| 343 | Ga0496106_0000489 | 3300048909 | Bacteria | 28107 |
| 344 | Ga0496107_0370631 | 3300048910 | Bacteria | 1065 |
| 345 | Ga0496110_0055553 | 3300048913 | Bacteria | 3484 |
| 346 | Ga0496111_0051433 | 3300048914 | Bacteria | 2974 |
| 347 | Ga0496112_0062056 | 3300048915 | Bacteria | 3686 |
| 348 | Ga0496113_0051756 | 3300048916 | Bacteria | 3065 |
| 349 | Ga0496113_0053724 | 3300048916 | Bacteria | 3012 |
| 350 | Ga0496113_0138370 | 3300048916 | Bacteria | 1915 |
| 351 | Ga0496114_0061746 | 3300048917 | Bacteria | 3135 |
| 352 | Ga0496114_0191942 | 3300048917 | Bacteria | 1787 |
| 353 | Ga0496115_0340981 | 3300048918 | Bacteria | 1223 |
| 354 | Ga0496116_0008133 | 3300048919 | Bacteria | 9162 |
| 355 | Ga0496116_0011450 | 3300048919 | Bacteria | 7338 |
| 356 | Ga0496116_0017768 | 3300048919 | Bacteria | 5508 |
| 357 | Ga0496116_0027515 | 3300048919 | Bacteria | 4139 |
| 358 | Ga0496116_0055401 | 3300048919 | Bacteria | 2604 |
| 359 | Ga0496116_0065930 | 3300048919 | Bacteria | 2319 |
| 360 | Ga0496116_0094526 | 3300048919 | Bacteria | 1806 |
| 361 | Ga0496117_0001519 | 3300048920 | Bacteria | 33158 |
| 362 | Ga0496117_0025223 | 3300048920 | Bacteria | 4679 |
| 363 | Ga0496117_0039603 | 3300048920 | Bacteria | 3476 |
| 364 | Ga0496117_0039812 | 3300048920 | Bacteria | 3465 |
| 365 | Ga0496117_0085383 | 3300048920 | Bacteria | 2055 |
| 366 | Ga0496118_0001657 | 3300048921 | Bacteria | 32712 |
| 367 | Ga0496118_0011382 | 3300048921 | Bacteria | 8690 |
| 368 | Ga0496118_0027496 | 3300048921 | Bacteria | 4812 |
| 369 | Ga0496118_0040375 | 3300048921 | Bacteria | 3711 |
| 370 | Ga0496118_0052840 | 3300048921 | Bacteria | 3094 |
| 371 | Ga0496119_0002067 | 3300048922 | Bacteria | 22707 |
| 372 | Ga0496119_0011198 | 3300048922 | Bacteria | 7465 |
| 373 | Ga0496119_0101493 | 3300048922 | Bacteria | 1615 |
| 374 | Ga0496119_0175292 | 3300048922 | Bacteria | 1129 |
| 375 | Ga0496120_0001080 | 3300048923 | Bacteria | 35851 |
| 376 | Ga0496120_0003006 | 3300048923 | Bacteria | 15992 |
| 377 | Ga0496120_0037980 | 3300048923 | Bacteria | 2853 |
| 378 | Ga0496121_0003379 | 3300048924 | Bacteria | 22866 |
| 379 | Ga0496121_0030191 | 3300048924 | Bacteria | 4984 |
| 380 | Ga0496121_0046715 | 3300048924 | Bacteria | 3702 |
| 381 | Ga0496121_0085401 | 3300048924 | Bacteria | 2484 |
| 382 | Ga0496121_0128568 | 3300048924 | Bacteria | 1900 |
| 383 | Ga0496121_0130149 | 3300048924 | Bacteria | 1885 |
| 384 | Ga0496121_0136686 | 3300048924 | Bacteria | 1825 |
| 385 | Ga0496121_0168743 | 3300048924 | Bacteria | 1592 |
| 386 | Ga0496122_0003108 | 3300048925 | Bacteria | 22287 |
| 387 | Ga0496122_0005117 | 3300048925 | Bacteria | 15820 |
| 388 | Ga0496122_0022073 | 3300048925 | Bacteria | 5671 |
| 389 | Ga0496122_0045909 | 3300048925 | Bacteria | 3389 |
| 390 | Ga0496123_0012900 | 3300048926 | Bacteria | 7071 |
| 391 | Ga0496123_0078063 | 3300048926 | Bacteria | 2030 |
| 392 | Ga0496123_0078380 | 3300048926 | Bacteria | 2024 |
| 393 | Ga0496124_0002807 | 3300048927 | Bacteria | 22062 |
| 394 | Ga0496124_0003951 | 3300048927 | Bacteria | 17704 |
| 395 | Ga0496124_0042342 | 3300048927 | Bacteria | 3922 |
| 396 | Ga0496124_0054740 | 3300048927 | Bacteria | 3375 |
| 397 | Ga0496124_0061031 | 3300048927 | Bacteria | 3161 |
| 398 | Ga0496124_0091096 | 3300048927 | Bacteria | 2485 |
| 399 | Ga0496124_0155577 | 3300048927 | Bacteria | 1788 |
| 400 | Ga0496124_0172146 | 3300048927 | Bacteria | 1675 |
| 401 | Ga0496124_0177298 | 3300048927 | Bacteria | 1644 |
| 402 | Ga0496124_0181086 | 3300048927 | Bacteria | 1621 |
| 403 | Ga0496125_0009582 | 3300048928 | Bacteria | 9913 |
| 404 | Ga0496125_0057240 | 3300048928 | Bacteria | 3159 |
| 405 | Ga0496125_0059311 | 3300048928 | Bacteria | 3085 |
| 406 | Ga0496125_0079744 | 3300048928 | Bacteria | 2509 |
| 407 | Ga0496125_0111047 | 3300048928 | Bacteria | 1985 |
| 408 | Ga0496126_0011193 | 3300048929 | Bacteria | 9310 |
| 409 | Ga0496126_0115941 | 3300048929 | Bacteria | 2328 |
| 410 | Ga0496126_0374092 | 3300048929 | Bacteria | 1161 |
| 411 | Ga0495678_008794 | 3300049459 | Bacteria | 5058 |
| 412 | Ga0495678_034167 | 3300049459 | Bacteria | 2094 |
| 413 | Ga0501031_0000021 | 3300049568 | Bacteria | 95923 |
| 414 | Ga0501031_0170993 | 3300049568 | Bacteria | 1420 |
| 415 | Ga0501032_0055845 | 3300049569 | Bacteria | 2656 |
| 416 | Ga0501032_0111617 | 3300049569 | Bacteria | 1809 |
| 417 | Ga0501033_0030441 | 3300049570 | Bacteria | 4056 |
| 418 | Ga0501033_0061615 | 3300049570 | Bacteria | 2765 |
| 419 | Ga0501033_0254290 | 3300049570 | Bacteria | 1244 |
| 420 | Ga0501034_0002652 | 3300049571 | Bacteria | 21172 |
| 421 | Ga0501034_0026972 | 3300049571 | Bacteria | 5844 |
| 422 | Ga0501034_0142204 | 3300049571 | Bacteria | 2378 |
| 423 | Ga0501034_0192412 | 3300049571 | Bacteria | 2001 |
| 424 | Ga0501034_0715197 | 3300049571 | Bacteria | 899 |
| 425 | Ga0501036_0094988 | 3300049572 | Bacteria | 2520 |
| 426 | Ga0501036_0406720 | 3300049572 | Bacteria | 1135 |
| 427 | Ga0501037_0091933 | 3300049573 | Bacteria | 2195 |
| 428 | Ga0501037_0258568 | 3300049573 | Bacteria | 1217 |
| 429 | Ga0501038_0029029 | 3300049574 | Bacteria | 4906 |
| 430 | Ga0501038_0038619 | 3300049574 | Bacteria | 4180 |
| 431 | Ga0501038_0062096 | 3300049574 | Bacteria | 3193 |
| 432 | Ga0501038_0122371 | 3300049574 | Bacteria | 2144 |
| 433 | Ga0501038_0149954 | 3300049574 | Bacteria | 1901 |
| 434 | Ga0501038_0518570 | 3300049574 | Bacteria | 910 |
| 435 | Ga0501039_0103704 | 3300049575 | Bacteria | 2220 |
| 436 | Ga0501039_0230610 | 3300049575 | Bacteria | 1456 |
| 437 | Ga0501043_0085025 | 3300049579 | Bacteria | 2486 |
| 438 | Ga0501043_0514173 | 3300049579 | Bacteria | 893 |
| 439 | Ga0501046_0176923 | 3300049580 | Bacteria | 1598 |
| 440 | Ga0501046_0278064 | 3300049580 | Bacteria | 1227 |
| 441 | Ga0501046_0303918 | 3300049580 | Bacteria | 1165 |
| 442 | Ga0501047_0056423 | 3300049581 | Bacteria | 3798 |
| 443 | Ga0501047_0057492 | 3300049581 | Bacteria | 3761 |
| 444 | Ga0501047_0082819 | 3300049581 | Bacteria | 3084 |
| 445 | Ga0501047_0207260 | 3300049581 | Bacteria | 1820 |
| 446 | Ga0501047_0836792 | 3300049581 | Bacteria | 734 |
| 447 | Ga0501067_0042702 | 3300049583 | Bacteria | 2517 |
| 448 | Ga0501068_0078702 | 3300049584 | Bacteria | 2021 |
| 449 | Ga0501068_0111688 | 3300049584 | Bacteria | 1700 |
| 450 | Ga0501069_0010135 | 3300049585 | Bacteria | 4985 |
| 451 | Ga0501070_0016605 | 3300049586 | Bacteria | 6184 |
| 452 | Ga0501070_0056816 | 3300049586 | Bacteria | 3244 |
| 453 | Ga0501070_0874299 | 3300049586 | Bacteria | 702 |
| 454 | Ga0501073_0022789 | 3300049589 | Bacteria | 4505 |
| 455 | Ga0501073_0110777 | 3300049589 | Bacteria | 1904 |
| 456 | Ga0501073_0216127 | 3300049589 | Bacteria | 1325 |
| 457 | Ga0501074_0160551 | 3300049590 | Bacteria | 1605 |
| 458 | Ga0501080_0030018 | 3300049742 | Bacteria | 5062 |
| 459 | Ga0501083_0060651 | 3300049744 | Bacteria | 2526 |
| 460 | Ga0501083_0138858 | 3300049744 | Bacteria | 1592 |
| 461 | Ga0501083_0308294 | 3300049744 | Bacteria | 1030 |
| 462 | Ga0501035_0101303 | 3300049822 | Bacteria | 2527 |
| 463 | Ga0501035_0383410 | 3300049822 | Bacteria | 1172 |
| 464 | Ga0501044_0019600 | 3300049823 | Bacteria | 7232 |
| 465 | Ga0501044_0058719 | 3300049823 | Bacteria | 3944 |
| 466 | nmdc:mga03683_2241_c1 | 3300050489 | Bacteria | 5964 |
| 467 | nmdc:mga03n38_67139_c1 | 3300050490 | Bacteria | 1650 |
| 468 | nmdc:mga03n38_68128_c1 | 3300050490 | Bacteria | 1640 |
| 469 | nmdc:mga00v17_211842_c1 | 3300050491 | Bacteria | 1254 |
| 470 | nmdc:mga00v17_93638_c1 | 3300050491 | Bacteria | 1889 |
| 471 | nmdc:mga0yw44_1816_c1 | 3300050492 | Bacteria | 8737 |
| 472 | nmdc:mga0yw44_37668_c1 | 3300050492 | Bacteria | 2857 |
| 473 | nmdc:mga0yw44_70044_c1 | 3300050492 | Bacteria | 2174 |
| 474 | nmdc:mga0k408_2883_c2 | 3300050493 | Bacteria | 8115 |
| 475 | nmdc:mga06z11_22742_c1 | 3300050494 | Bacteria | 2933 |
| 476 | nmdc:mga07m45_11346_c1 | 3300050496 | Bacteria | 4679 |
| 477 | nmdc:mga07m45_152188_c1 | 3300050496 | Bacteria | 1342 |
| 478 | nmdc:mga0sz30_30206_c1 | 3300050516 | Bacteria | 2238 |
| 479 | Ga0500610_0068538 | 3300053079 | Bacteria | 1850 |
| 480 | Ga0495655_0173491 | 3300053083 | Bacteria | 691 |
| 481 | Ga0500578_0028293 | 3300053086 | Bacteria | 3600 |
| 482 | Ga0500578_0068281 | 3300053086 | Bacteria | 2266 |
| 483 | Ga0500644_0007457 | 3300053088 | Bacteria | 2849 |
| 484 | Ga0500651_0175533 | 3300053093 | Bacteria | 1275 |
| 485 | Ga0500566_0242475 | 3300053094 | Bacteria | 882 |
| 486 | Ga0500650_0268895 | 3300053098 | Bacteria | 760 |
| 487 | Ga0500557_018128 | 3300053105 | Bacteria | 1958 |
| 488 | Ga0500562_033838 | 3300053108 | Bacteria | 1351 |
| 489 | Ga0500569_000274 | 3300053109 | Bacteria | 8125 |
| 490 | Ga0500594_0001349 | 3300053118 | Bacteria | 5317 |
| 491 | Ga0500618_007178 | 3300053125 | Bacteria | 3202 |
| 492 | Ga0500618_013225 | 3300053125 | Bacteria | 2140 |
| 493 | Ga0500658_0000240 | 3300053134 | Bacteria | 25716 |
| 494 | Ga0500658_0010234 | 3300053134 | Bacteria | 3456 |
| 495 | Ga0500568_0000128 | 3300053139 | Bacteria | 68634 |
| 496 | Ga0500568_0001687 | 3300053139 | Bacteria | 13790 |
| 497 | Ga0500568_0009038 | 3300053139 | Bacteria | 4755 |
| 498 | Ga0500573_0007453 | 3300053140 | Bacteria | 5966 |
| 499 | Ga0500573_0154679 | 3300053140 | Bacteria | 1252 |
| 500 | Ga0500577_0043058 | 3300053142 | Bacteria | 1657 |
| 501 | Ga0500577_0166048 | 3300053142 | Bacteria | 942 |
| 502 | Ga0500604_0025099 | 3300053151 | Bacteria | 1711 |
| 503 | Ga0500616_0001260 | 3300053153 | Bacteria | 25329 |
| 504 | Ga0500616_0001634 | 3300053153 | Bacteria | 20765 |
| 505 | Ga0500616_0014867 | 3300053153 | Bacteria | 4461 |
| 506 | Ga0500616_0066439 | 3300053153 | Bacteria | 1851 |
| 507 | Ga0500620_005112 | 3300053155 | Bacteria | 3005 |
| 508 | Ga0500622_0000486 | 3300053156 | Bacteria | 37244 |
| 509 | Ga0500622_0000743 | 3300053156 | Bacteria | 28461 |
| 510 | Ga0500622_0023839 | 3300053156 | Bacteria | 3240 |
| 511 | Ga0500627_0011075 | 3300053158 | Bacteria | 3313 |
| 512 | Ga0500627_0085196 | 3300053158 | Bacteria | 1411 |
| 513 | Ga0500645_008090 | 3300053730 | Bacteria | 3619 |
| 514 | Ga0501082_0093128 | 3300060353 | Bacteria | 2603 |
| 515 | Ga0501082_0777555 | 3300060353 | Bacteria | 838 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049575 | Ga0501039_0230610 | Ga0501039_0230610_19_528 | 163 |
| 2 | 3300046501 | Ga0495607_0072619 | Ga0495607_0072619_85_627 | 175 |
| 3 | 3300046660 | Ga0495625_0592899 | Ga0495625_0592899_108_644 | 177 |
| 4 | 3300026067 | Ga0207678_10655825 | Ga0207678_106558252 | 188 |
| 5 | iso_pu_bacteria | 2643221550 | 2643773856 | 192 |
| 6 | iso_pu_bacteria | 2643221564 | 2643839192 | 192 |
| 7 | 3300053153 | Ga0500616_0001634 | Ga0500616_0001634_1215_1850 | 193 |
| 8 | 3300053158 | Ga0500627_0085196 | Ga0500627_0085196_244_879 | 193 |
| 9 | 3300005339 | Ga0070660_100053524 | Ga0070660_1000535242 | 194 |
| 10 | 3300005455 | Ga0070663_100248250 | Ga0070663_1002482502 | 194 |
| 11 | 3300005539 | Ga0068853_100145615 | Ga0068853_1001456153 | 194 |
| 12 | 3300005563 | Ga0068855_100471350 | Ga0068855_1004713502 | 194 |
| 13 | 3300005578 | Ga0068854_100160269 | Ga0068854_1001602692 | 194 |
| 14 | 3300006038 | Ga0075365_10017790 | Ga0075365_100177903 | 194 |
| 15 | 3300006048 | Ga0075363_100006159 | Ga0075363_1000061593 | 194 |
| 16 | 3300009093 | Ga0105240_10478398 | Ga0105240_104783981 | 194 |
| 17 | 3300025924 | Ga0207694_10364566 | Ga0207694_103645662 | 194 |
| 18 | 3300026041 | Ga0207639_10096450 | Ga0207639_100964502 | 194 |
| 19 | 3300026067 | Ga0207678_10033300 | Ga0207678_100333004 | 194 |
| 20 | 3300026142 | Ga0207698_10215413 | Ga0207698_102154132 | 194 |
| 21 | 3300031235 | Ga0265330_10167873 | Ga0265330_101678731 | 194 |
| 22 | 3300031247 | Ga0265340_10002710 | Ga0265340_100027106 | 194 |
| 23 | 3300031344 | Ga0265316_10027424 | Ga0265316_100274243 | 194 |
| 24 | 3300031595 | Ga0265313_10003872 | Ga0265313_100038726 | 194 |
| 25 | 3300031711 | Ga0265314_10088377 | Ga0265314_100883772 | 194 |
| 26 | 3300031712 | Ga0265342_10004715 | Ga0265342_100047152 | 194 |
| 27 | 3300048905 | Ga0496102_0169943 | Ga0496102_0169943_1084_1719 | 194 |
| 28 | 3300048928 | Ga0496125_0059311 | Ga0496125_0059311_1701_2336 | 194 |
| 29 | 3300048929 | Ga0496126_0374092 | Ga0496126_0374092_58_693 | 194 |
| 30 | 3300050491 | nmdc:mga00v17_211842_c1 | nmdc:mga00v17_211842_c1_128_763 | 194 |
| 31 | 3300050492 | nmdc:mga0yw44_37668_c1 | nmdc:mga0yw44_37668_c1_1012_1647 | 194 |
| 32 | 3300048919 | Ga0496116_0011450 | Ga0496116_0011450_6723_7310 | 195 |
| 33 | 3300048919 | Ga0496116_0065930 | Ga0496116_0065930_1704_2291 | 195 |
| 34 | 3300048920 | Ga0496117_0085383 | Ga0496117_0085383_1431_2018 | 195 |
| 35 | 3300048926 | Ga0496123_0078063 | Ga0496123_0078063_12_599 | 195 |
| 36 | 3300053083 | Ga0495655_0173491 | Ga0495655_0173491_43_672 | 195 |
| 37 | 3300049573 | Ga0501037_0258568 | Ga0501037_0258568_333_944 | 197 |
| 38 | 3300049581 | Ga0501047_0056423 | Ga0501047_0056423_2982_3593 | 197 |
| 39 | iso_pu_bacteria | 2894817345 | 2894820494 | 199 |
| 40 | 3300049574 | Ga0501038_0122371 | Ga0501038_0122371_200_844 | 200 |
| 41 | 3300049574 | Ga0501038_0149954 | Ga0501038_0149954_239_883 | 200 |
| 42 | 3300049580 | Ga0501046_0303918 | Ga0501046_0303918_289_933 | 200 |
| 43 | 3300049581 | Ga0501047_0057492 | Ga0501047_0057492_1673_2317 | 200 |
| 44 | 3300049589 | Ga0501073_0216127 | Ga0501073_0216127_405_1049 | 200 |
| 45 | 3300049744 | Ga0501083_0138858 | Ga0501083_0138858_201_845 | 200 |
| 46 | 3300049822 | Ga0501035_0101303 | Ga0501035_0101303_445_1089 | 200 |
| 47 | 3300049823 | Ga0501044_0058719 | Ga0501044_0058719_1730_2374 | 200 |
| 48 | iso_pu_bacteria | 637000159 | 637075448 | 200 |
| 49 | 3300031241 | Ga0265325_10272857 | Ga0265325_102728571 | 201 |
| 50 | 3300049568 | Ga0501031_0170993 | Ga0501031_0170993_348_959 | 203 |
| 51 | 3300049571 | Ga0501034_0002652 | Ga0501034_0002652_20515_21126 | 203 |
| 52 | 3300049571 | Ga0501034_0715197 | Ga0501034_0715197_201_845 | 204 |
| 53 | 3300060353 | Ga0501082_0777555 | Ga0501082_0777555_37_681 | 204 |
| 54 | iso_pu_bacteria | 8045864390 | 8045864479 | 204 |
| 55 | iso_pu_bacteria | 2513237351 | 2514587700 | 205 |
| 56 | iso_pu_bacteria | 2643221653 | 2644298833 | 205 |
| 57 | iso_pu_bacteria | 2643221719 | 2644657062 | 205 |
| 58 | iso_pu_bacteria | 2818991272 | 2819241164 | 205 |
| 59 | iso_pu_bacteria | 8005246636 | 8005248936 | 205 |
| 60 | 3300005328 | Ga0070676_10243217 | Ga0070676_102432172 | 206 |
| 61 | 3300005459 | Ga0068867_100026106 | Ga0068867_1000261063 | 206 |
| 62 | 3300009148 | Ga0105243_10586801 | Ga0105243_105868012 | 206 |
| 63 | 3300025907 | Ga0207645_10228245 | Ga0207645_102282452 | 206 |
| 64 | 3300025927 | Ga0207687_10465741 | Ga0207687_104657412 | 206 |
| 65 | 3300025935 | Ga0207709_10262761 | Ga0207709_102627612 | 206 |
| 66 | 3300025937 | Ga0207669_10171224 | Ga0207669_101712242 | 206 |
| 67 | 3300026089 | Ga0207648_10064666 | Ga0207648_100646664 | 206 |
| 68 | iso_pu_bacteria | 2503198000 | 2503200281 | 206 |
| 69 | iso_pu_bacteria | 2508501123 | 2509115080 | 206 |
| 70 | iso_pu_bacteria | 2509276022 | 2509395096 | 206 |
| 71 | iso_pu_bacteria | 2510461069 | 2510842775 | 206 |
| 72 | iso_pu_bacteria | 2512875016 | 2512932349 | 206 |
| 73 | iso_pu_bacteria | 2513237164 | 2514034541 | 206 |
| 74 | iso_pu_bacteria | 2513237305 | 2514419468 | 206 |
| 75 | iso_pu_bacteria | 2643221595 | 2643985533 | 206 |
| 76 | iso_pu_bacteria | 2643221627 | 2644158327 | 206 |
| 77 | iso_pu_bacteria | 2693429783 | 2694632354 | 206 |
| 78 | iso_pu_bacteria | 2721755686 | 2723574684 | 206 |
| 79 | iso_pu_bacteria | 2738543024 | 2739310058 | 206 |
| 80 | iso_pu_bacteria | 2756170246 | 2756671747 | 206 |
| 81 | iso_pu_bacteria | 2791355123 | 2792751950 | 206 |
| 82 | iso_pu_bacteria | 2844002411 | 2844008318 | 206 |
| 83 | iso_pu_bacteria | 2856320880 | 2856323363 | 206 |
| 84 | iso_pu_bacteria | 2856364286 | 2856368247 | 206 |
| 85 | iso_pu_bacteria | 2857349434 | 2857351560 | 206 |
| 86 | iso_pu_bacteria | 2869234852 | 2869235895 | 206 |
| 87 | iso_pu_bacteria | 2869278585 | 2869282842 | 206 |
| 88 | iso_pu_bacteria | 2869285874 | 2869290134 | 206 |
| 89 | iso_pu_bacteria | 2871429161 | 2871432418 | 206 |
| 90 | iso_pu_bacteria | 2871435913 | 2871438700 | 206 |
| 91 | iso_pu_bacteria | 2871451962 | 2871452326 | 206 |
| 92 | iso_pu_bacteria | 2871466892 | 2871471312 | 206 |
| 93 | iso_pu_bacteria | 2871495908 | 2871502502 | 206 |
| 94 | iso_pu_bacteria | 2874109183 | 2874109985 | 206 |
| 95 | iso_pu_bacteria | 2874139085 | 2874142503 | 206 |
| 96 | iso_pu_bacteria | 2874146452 | 2874152382 | 206 |
| 97 | iso_pu_bacteria | 2874155637 | 2874159785 | 206 |
| 98 | iso_pu_bacteria | 2874168670 | 2874168890 | 206 |
| 99 | iso_pu_bacteria | 2876377896 | 2876378616 | 206 |
| 100 | iso_pu_bacteria | 2876413966 | 2876418301 | 206 |
| 101 | iso_pu_bacteria | 2878738818 | 2878739259 | 206 |
| 102 | iso_pu_bacteria | 2878745973 | 2878750031 | 206 |
| 103 | iso_pu_bacteria | 2878760144 | 2878766394 | 206 |
| 104 | iso_pu_bacteria | 2878767105 | 2878773590 | 206 |
| 105 | iso_pu_bacteria | 2882632389 | 2882640743 | 206 |
| 106 | iso_pu_bacteria | 2885305155 | 2885308543 | 206 |
| 107 | iso_pu_bacteria | 2885326080 | 2885332424 | 206 |
| 108 | iso_pu_bacteria | 2888337043 | 2888338526 | 206 |
| 109 | iso_pu_bacteria | 2888350351 | 2888355348 | 206 |
| 110 | iso_pu_bacteria | 2889010040 | 2889010324 | 206 |
| 111 | iso_pu_bacteria | 2889016732 | 2889018009 | 206 |
| 112 | iso_pu_bacteria | 2903492973 | 2903504432 | 206 |
| 113 | iso_pu_bacteria | 2903513507 | 2903518262 | 206 |
| 114 | iso_pu_bacteria | 2903540706 | 2903547543 | 206 |
| 115 | iso_pu_bacteria | 2906308376 | 2906312390 | 206 |
| 116 | iso_pu_bacteria | 2906321335 | 2906325099 | 206 |
| 117 | iso_pu_bacteria | 2906354277 | 2906356813 | 206 |
| 118 | iso_pu_bacteria | 2906378014 | 2906378567 | 206 |
| 119 | iso_pu_bacteria | 2922130491 | 2922136880 | 206 |
| 120 | iso_pu_bacteria | 2922185730 | 2922190776 | 206 |
| 121 | iso_pu_bacteria | 2924710171 | 2924713478 | 206 |
| 122 | iso_pu_bacteria | 2924718760 | 2924724198 | 206 |
| 123 | iso_pu_bacteria | 2924776078 | 2924776724 | 206 |
| 124 | iso_pu_bacteria | 2937813078 | 2937819468 | 206 |
| 125 | iso_pu_bacteria | 2937877337 | 2937880885 | 206 |
| 126 | iso_pu_bacteria | 2937972304 | 2937977078 | 206 |
| 127 | iso_pu_bacteria | 2937994558 | 2938001418 | 206 |
| 128 | iso_pu_bacteria | 2938014810 | 2938021740 | 206 |
| 129 | iso_pu_bacteria | 2958034702 | 2958039625 | 206 |
| 130 | iso_pu_bacteria | 2958041894 | 2958052746 | 206 |
| 131 | iso_pu_bacteria | 2958041894 | 2958055083 | 206 |
| 132 | iso_pu_bacteria | 2958064165 | 2958065160 | 206 |
| 133 | iso_pu_bacteria | 2958084443 | 2958088559 | 206 |
| 134 | iso_pu_bacteria | 2958092219 | 2958097632 | 206 |
| 135 | iso_pu_bacteria | 2958100919 | 2958106611 | 206 |
| 136 | iso_pu_bacteria | 2958130278 | 2958134521 | 206 |
| 137 | iso_pu_bacteria | 2958165035 | 2958171572 | 206 |
| 138 | iso_pu_bacteria | 2958172287 | 2958179705 | 206 |
| 139 | iso_pu_bacteria | 2958179912 | 2958181002 | 206 |
| 140 | iso_pu_bacteria | 2961077736 | 2961078839 | 206 |
| 141 | iso_pu_bacteria | 2961163497 | 2961170013 | 206 |
| 142 | iso_pu_bacteria | 2965018300 | 2965024764 | 206 |
| 143 | iso_pu_bacteria | 2965062239 | 2965069912 | 206 |
| 144 | iso_pu_bacteria | 2968016561 | 2968020954 | 206 |
| 145 | iso_pu_bacteria | 2968083720 | 2968088343 | 206 |
| 146 | iso_pu_bacteria | 2968117919 | 2968119574 | 206 |
| 147 | iso_pu_bacteria | 2968128360 | 2968130567 | 206 |
| 148 | iso_pu_bacteria | 2968138860 | 2968142555 | 206 |
| 149 | iso_pu_bacteria | 2968171901 | 2968178405 | 206 |
| 150 | iso_pu_bacteria | 2970469710 | 2970474251 | 206 |
| 151 | iso_pu_bacteria | 2970554993 | 2970561250 | 206 |
| 152 | iso_pu_bacteria | 2970593180 | 2970597451 | 206 |
| 153 | iso_pu_bacteria | 2970619444 | 2970624842 | 206 |
| 154 | iso_pu_bacteria | 2977843712 | 2977848178 | 206 |
| 155 | iso_pu_bacteria | 2977942078 | 2977944545 | 206 |
| 156 | iso_pu_bacteria | 2977971508 | 2977977189 | 206 |
| 157 | iso_pu_bacteria | 2979710463 | 2979717495 | 206 |
| 158 | iso_pu_bacteria | 2979742915 | 2979750960 | 206 |
| 159 | iso_pu_bacteria | 2987636660 | 2987638744 | 206 |
| 160 | iso_pu_bacteria | 2987652177 | 2987653410 | 206 |
| 161 | iso_pu_bacteria | 2987659509 | 2987666254 | 206 |
| 162 | iso_pu_bacteria | 2996348954 | 2996352415 | 206 |
| 163 | iso_pu_bacteria | 2996386984 | 2996390249 | 206 |
| 164 | iso_pu_bacteria | 3004167301 | 3004167889 | 206 |
| 165 | iso_pu_bacteria | 3004188549 | 3004195260 | 206 |
| 166 | iso_pu_bacteria | 3004203850 | 3004205013 | 206 |
| 167 | iso_pu_bacteria | 3004211236 | 3004215265 | 206 |
| 168 | iso_pu_bacteria | 3004218560 | 3004220693 | 206 |
| 169 | iso_pu_bacteria | 3004232784 | 3004236538 | 206 |
| 170 | iso_pu_bacteria | 3004275668 | 3004279097 | 206 |
| 171 | iso_pu_bacteria | 3004289098 | 3004293276 | 206 |
| 172 | iso_pu_bacteria | 8002285264 | 8002289364 | 206 |
| 173 | iso_pu_bacteria | 8004387939 | 8004392339 | 206 |
| 174 | iso_pu_bacteria | 8004640170 | 8004641186 | 206 |
| 175 | iso_pu_bacteria | 8004714634 | 8004718649 | 206 |
| 176 | 3300002705 | JGI25156J39149_1004395 | JGI25156J39149_10043956 | 207 |
| 177 | 3300002741 | JGI25157J39369_1000710 | JGI25157J39369_100071014 | 207 |
| 178 | 3300003214 | JGI25165J46597_1000006 | JGI25165J46597_1000006366 | 207 |
| 179 | 3300005459 | Ga0068867_100113860 | Ga0068867_1001138602 | 207 |
| 180 | 3300005539 | Ga0068853_100109766 | Ga0068853_1001097662 | 207 |
| 181 | 3300006038 | Ga0075365_10602350 | Ga0075365_106023501 | 207 |
| 182 | 3300006048 | Ga0075363_100032615 | Ga0075363_1000326152 | 207 |
| 183 | 3300009093 | Ga0105240_10099498 | Ga0105240_100994983 | 207 |
| 184 | 3300009098 | Ga0105245_10743845 | Ga0105245_107438452 | 207 |
| 185 | 3300009174 | Ga0105241_10097880 | Ga0105241_100978803 | 207 |
| 186 | 3300009545 | Ga0105237_10030724 | Ga0105237_100307246 | 207 |
| 187 | 3300009551 | Ga0105238_10002480 | Ga0105238_100024802 | 207 |
| 188 | 3300009551 | Ga0105238_10372582 | Ga0105238_103725821 | 207 |
| 189 | 3300010375 | Ga0105239_10077098 | Ga0105239_100770983 | 207 |
| 190 | 3300025246 | Ga0209646_1006725 | Ga0209646_10067252 | 207 |
| 191 | 3300025250 | Ga0209026_1000089 | Ga0209026_100008948 | 207 |
| 192 | 3300025254 | Ga0209148_1000124 | Ga0209148_1000124194 | 207 |
| 193 | 3300025256 | Ga0209759_1000040 | Ga0209759_1000040234 | 207 |
| 194 | 3300025261 | Ga0209233_1000010 | Ga0209233_1000010947 | 207 |
| 195 | 3300025272 | Ga0209455_1000062 | Ga0209455_100006258 | 207 |
| 196 | 3300025911 | Ga0207654_10602462 | Ga0207654_106024621 | 207 |
| 197 | 3300025913 | Ga0207695_10096719 | Ga0207695_100967192 | 207 |
| 198 | 3300025913 | Ga0207695_10226720 | Ga0207695_102267202 | 207 |
| 199 | 3300025914 | Ga0207671_10011901 | Ga0207671_100119013 | 207 |
| 200 | 3300025919 | Ga0207657_10027453 | Ga0207657_100274532 | 207 |
| 201 | 3300025924 | Ga0207694_10002308 | Ga0207694_1000230812 | 207 |
| 202 | 3300025949 | Ga0207667_10722992 | Ga0207667_107229922 | 207 |
| 203 | 3300026067 | Ga0207678_10031493 | Ga0207678_100314935 | 207 |
| 204 | 3300026142 | Ga0207698_10752715 | Ga0207698_107527151 | 207 |
| 205 | 3300028794 | Ga0307515_10391290 | Ga0307515_103912902 | 207 |
| 206 | 3300037418 | Ga0395900_0043259 | Ga0395900_0043259_3767_4399 | 207 |
| 207 | 3300037418 | Ga0395900_0164584 | Ga0395900_0164584_1244_1876 | 207 |
| 208 | 3300037418 | Ga0395900_0538056 | Ga0395900_0538056_42_674 | 207 |
| 209 | 3300038443 | Ga0395901_0017106 | Ga0395901_0017106_4181_4816 | 207 |
| 210 | 3300038443 | Ga0395901_0061000 | Ga0395901_0061000_3213_3845 | 207 |
| 211 | 3300038443 | Ga0395901_0066050 | Ga0395901_0066050_157_789 | 207 |
| 212 | 3300038443 | Ga0395901_0762018 | Ga0395901_0762018_94_726 | 207 |
| 213 | 3300046616 | Ga0495668_0051725 | Ga0495668_0051725_358_990 | 207 |
| 214 | 3300047472 | Ga0495686_0249973 | Ga0495686_0249973_115_747 | 207 |
| 215 | 3300048905 | Ga0496102_0083725 | Ga0496102_0083725_1871_2503 | 207 |
| 216 | 3300048915 | Ga0496112_0062056 | Ga0496112_0062056_2754_3386 | 207 |
| 217 | 3300048918 | Ga0496115_0340981 | Ga0496115_0340981_530_1162 | 207 |
| 218 | 3300048923 | Ga0496120_0001080 | Ga0496120_0001080_1516_2148 | 207 |
| 219 | 3300048923 | Ga0496120_0037980 | Ga0496120_0037980_735_1367 | 207 |
| 220 | 3300048928 | Ga0496125_0057240 | Ga0496125_0057240_1229_1861 | 207 |
| 221 | 3300049568 | Ga0501031_0000021 | Ga0501031_0000021_83951_84586 | 207 |
| 222 | 3300049569 | Ga0501032_0055845 | Ga0501032_0055845_1957_2592 | 207 |
| 223 | 3300049570 | Ga0501033_0030441 | Ga0501033_0030441_2412_3050 | 207 |
| 224 | 3300049570 | Ga0501033_0254290 | Ga0501033_0254290_224_859 | 207 |
| 225 | 3300049571 | Ga0501034_0026972 | Ga0501034_0026972_2249_2884 | 207 |
| 226 | 3300049571 | Ga0501034_0142204 | Ga0501034_0142204_155_790 | 207 |
| 227 | 3300049572 | Ga0501036_0094988 | Ga0501036_0094988_1612_2250 | 207 |
| 228 | 3300049573 | Ga0501037_0091933 | Ga0501037_0091933_1416_2051 | 207 |
| 229 | 3300049574 | Ga0501038_0029029 | Ga0501038_0029029_913_1551 | 207 |
| 230 | 3300049574 | Ga0501038_0062096 | Ga0501038_0062096_571_1206 | 207 |
| 231 | 3300049574 | Ga0501038_0518570 | Ga0501038_0518570_250_885 | 207 |
| 232 | 3300049575 | Ga0501039_0103704 | Ga0501039_0103704_421_1059 | 207 |
| 233 | 3300049579 | Ga0501043_0514173 | Ga0501043_0514173_13_648 | 207 |
| 234 | 3300049580 | Ga0501046_0278064 | Ga0501046_0278064_271_909 | 207 |
| 235 | 3300049581 | Ga0501047_0082819 | Ga0501047_0082819_932_1567 | 207 |
| 236 | 3300049581 | Ga0501047_0836792 | Ga0501047_0836792_33_671 | 207 |
| 237 | 3300049584 | Ga0501068_0078702 | Ga0501068_0078702_435_1070 | 207 |
| 238 | 3300049585 | Ga0501069_0010135 | Ga0501069_0010135_723_1358 | 207 |
| 239 | 3300049586 | Ga0501070_0016605 | Ga0501070_0016605_28_663 | 207 |
| 240 | 3300049586 | Ga0501070_0056816 | Ga0501070_0056816_826_1461 | 207 |
| 241 | 3300049586 | Ga0501070_0874299 | Ga0501070_0874299_16_651 | 207 |
| 242 | 3300049589 | Ga0501073_0110777 | Ga0501073_0110777_947_1582 | 207 |
| 243 | 3300049590 | Ga0501074_0160551 | Ga0501074_0160551_184_819 | 207 |
| 244 | 3300049742 | Ga0501080_0030018 | Ga0501080_0030018_3281_3916 | 207 |
| 245 | 3300049822 | Ga0501035_0383410 | Ga0501035_0383410_22_657 | 207 |
| 246 | 3300049823 | Ga0501044_0019600 | Ga0501044_0019600_5467_6102 | 207 |
| 247 | 3300050490 | nmdc:mga03n38_67139_c1 | nmdc:mga03n38_67139_c1_425_1057 | 207 |
| 248 | 3300050492 | nmdc:mga0yw44_70044_c1 | nmdc:mga0yw44_70044_c1_17_649 | 207 |
| 249 | 3300050496 | nmdc:mga07m45_152188_c1 | nmdc:mga07m45_152188_c1_32_664 | 207 |
| 250 | 3300053153 | Ga0500616_0014867 | Ga0500616_0014867_409_1044 | 207 |
| 251 | 3300053155 | Ga0500620_005112 | Ga0500620_005112_743_1378 | 207 |
| 252 | iso_pu_bacteria | 2510917022 | 2511133256 | 207 |
| 253 | iso_pu_bacteria | 2524023209 | 2524458820 | 207 |
| 254 | iso_pu_bacteria | 2582581307 | 2585271314 | 207 |
| 255 | iso_pu_bacteria | 2582581308 | 2585279252 | 207 |
| 256 | iso_pu_bacteria | 2582581315 | 2585323143 | 207 |
| 257 | iso_pu_bacteria | 2582581316 | 2585331249 | 207 |
| 258 | iso_pu_bacteria | 2585427527 | 2585531263 | 207 |
| 259 | iso_pu_bacteria | 2585427530 | 2585552814 | 207 |
| 260 | iso_pu_bacteria | 2585427531 | 2585559057 | 207 |
| 261 | iso_pu_bacteria | 2585427608 | 2585898439 | 207 |
| 262 | iso_pu_bacteria | 2585427609 | 2585903996 | 207 |
| 263 | iso_pu_bacteria | 2585428125 | 2587980886 | 207 |
| 264 | iso_pu_bacteria | 2588253730 | 2588518418 | 207 |
| 265 | iso_pu_bacteria | 2615840626 | 2616311419 | 207 |
| 266 | iso_pu_bacteria | 2615840698 | 2616554434 | 207 |
| 267 | iso_pu_bacteria | 2617270742 | 2617384798 | 207 |
| 268 | iso_pu_bacteria | 2667528174 | 2671111246 | 207 |
| 269 | iso_pu_bacteria | 2775507266 | 2778175616 | 207 |
| 270 | iso_pu_bacteria | 2818991448 | 2819609324 | 207 |
| 271 | iso_pu_bacteria | 2818991453 | 2819641367 | 207 |
| 272 | iso_pu_bacteria | 2838029111 | 2838033733 | 207 |
| 273 | iso_pu_bacteria | 2842298080 | 2842298169 | 207 |
| 274 | iso_pu_bacteria | 2842357229 | 2842360231 | 207 |
| 275 | iso_pu_bacteria | 2842475841 | 2842480480 | 207 |
| 276 | iso_pu_bacteria | 2842482326 | 2842483883 | 207 |
| 277 | iso_pu_bacteria | 2842502639 | 2842505299 | 207 |
| 278 | iso_pu_bacteria | 2842509118 | 2842514306 | 207 |
| 279 | iso_pu_bacteria | 2847686936 | 2847691367 | 207 |
| 280 | iso_pu_bacteria | 2852387548 | 2852390444 | 207 |
| 281 | iso_pu_bacteria | 2854896431 | 2854901308 | 207 |
| 282 | iso_pu_bacteria | 2854916844 | 2854918688 | 207 |
| 283 | iso_pu_bacteria | 2856328259 | 2856329331 | 207 |
| 284 | iso_pu_bacteria | 2856334872 | 2856336439 | 207 |
| 285 | iso_pu_bacteria | 2857367948 | 2857370934 | 207 |
| 286 | iso_pu_bacteria | 2869271264 | 2869272342 | 207 |
| 287 | iso_pu_bacteria | 2871444079 | 2871451530 | 207 |
| 288 | iso_pu_bacteria | 2874102143 | 2874106147 | 207 |
| 289 | iso_pu_bacteria | 2874162495 | 2874162803 | 207 |
| 290 | iso_pu_bacteria | 2876363079 | 2876367619 | 207 |
| 291 | iso_pu_bacteria | 2876399893 | 2876404866 | 207 |
| 292 | iso_pu_bacteria | 2876406927 | 2876407747 | 207 |
| 293 | iso_pu_bacteria | 2878774303 | 2878776319 | 207 |
| 294 | iso_pu_bacteria | 2881147464 | 2881150762 | 207 |
| 295 | iso_pu_bacteria | 2885334103 | 2885339403 | 207 |
| 296 | iso_pu_bacteria | 2903448605 | 2903450397 | 207 |
| 297 | iso_pu_bacteria | 2903521522 | 2903521864 | 207 |
| 298 | iso_pu_bacteria | 2903528002 | 2903528241 | 207 |
| 299 | iso_pu_bacteria | 2906328253 | 2906330446 | 207 |
| 300 | iso_pu_bacteria | 2906386501 | 2906391051 | 207 |
| 301 | iso_pu_bacteria | 2906408224 | 2906408766 | 207 |
| 302 | iso_pu_bacteria | 2919408235 | 2919410185 | 207 |
| 303 | iso_pu_bacteria | 2922158528 | 2922163950 | 207 |
| 304 | iso_pu_bacteria | 2922172374 | 2922173581 | 207 |
| 305 | iso_pu_bacteria | 2922178524 | 2922179698 | 207 |
| 306 | iso_pu_bacteria | 2924726620 | 2924727180 | 207 |
| 307 | iso_pu_bacteria | 2924748358 | 2924753306 | 207 |
| 308 | iso_pu_bacteria | 2937848649 | 2937850995 | 207 |
| 309 | iso_pu_bacteria | 2958115193 | 2958116479 | 207 |
| 310 | iso_pu_bacteria | 2958158011 | 2958161021 | 207 |
| 311 | iso_pu_bacteria | 2963644680 | 2963646856 | 207 |
| 312 | iso_pu_bacteria | 2965025482 | 2965029698 | 207 |
| 313 | iso_pu_bacteria | 2965102966 | 2965103307 | 207 |
| 314 | iso_pu_bacteria | 2968091066 | 2968095008 | 207 |
| 315 | iso_pu_bacteria | 2968097103 | 2968102564 | 207 |
| 316 | iso_pu_bacteria | 2970489779 | 2970494929 | 207 |
| 317 | iso_pu_bacteria | 2970510686 | 2970511502 | 207 |
| 318 | iso_pu_bacteria | 2970547951 | 2970554224 | 207 |
| 319 | iso_pu_bacteria | 2977922695 | 2977927405 | 207 |
| 320 | iso_pu_bacteria | 2977935797 | 2977936488 | 207 |
| 321 | iso_pu_bacteria | 2977957713 | 2977959007 | 207 |
| 322 | iso_pu_bacteria | 2977986579 | 2977986624 | 207 |
| 323 | iso_pu_bacteria | 2979779861 | 2979784185 | 207 |
| 324 | iso_pu_bacteria | 2987645492 | 2987651778 | 207 |
| 325 | iso_pu_bacteria | 2996341866 | 2996343748 | 207 |
| 326 | iso_pu_bacteria | 3004239961 | 3004246169 | 207 |
| 327 | iso_pu_bacteria | 3004334049 | 3004335481 | 207 |
| 328 | iso_pu_bacteria | 3005416602 | 3005417557 | 207 |
| 329 | iso_pu_bacteria | 8004300914 | 8004303527 | 207 |
| 330 | iso_pu_bacteria | 8004695233 | 8004700569 | 207 |
| 331 | iso_pu_bacteria | 8004703790 | 8004705412 | 207 |
| 332 | iso_pu_bacteria | 8005314921 | 8005315654 | 207 |
| 333 | iso_pu_bacteria | 8005484373 | 8005489012 | 207 |
| 334 | iso_pu_bacteria | 8005645114 | 8005646090 | 207 |
| 335 | iso_pu_bacteria | 8005682033 | 8005682703 | 207 |
| 336 | iso_pu_bacteria | 8046767195 | 8046771756 | 207 |
| 337 | iso_pu_bacteria | 8056875544 | 8056875738 | 207 |
| 338 | iso_pu_bacteria | 8057575449 | 8057575512 | 207 |
| 339 | 3300006028 | Ga0070717_10249994 | Ga0070717_102499943 | 208 |
| 340 | 3300031250 | Ga0265331_10036251 | Ga0265331_100362512 | 208 |
| 341 | 3300031711 | Ga0265314_10049360 | Ga0265314_100493601 | 208 |
| 342 | 3300046460 | Ga0495638_0071142 | Ga0495638_0071142_1424_2050 | 208 |
| 343 | 3300046460 | Ga0495638_0369859 | Ga0495638_0369859_26_667 | 208 |
| 344 | 3300053088 | Ga0500644_0007457 | Ga0500644_0007457_1370_1996 | 208 |
| 345 | 3300053156 | Ga0500622_0000486 | Ga0500622_0000486_14874_15500 | 208 |
| 346 | iso_pu_bacteria | 2511231027 | 2511390143 | 208 |
| 347 | iso_pu_bacteria | 2582581304 | 2585258307 | 208 |
| 348 | iso_pu_bacteria | 2643221599 | 2644007070 | 208 |
| 349 | iso_pu_bacteria | 2765235802 | 2765466531 | 208 |
| 350 | iso_pu_bacteria | 2767802442 | 2770196952 | 208 |
| 351 | iso_pu_bacteria | 2775506902 | 2776270440 | 208 |
| 352 | iso_pu_bacteria | 2775506904 | 2776281641 | 208 |
| 353 | iso_pu_bacteria | 2837678835 | 2837682640 | 208 |
| 354 | iso_pu_bacteria | 2839993093 | 2839997490 | 208 |
| 355 | iso_pu_bacteria | 2840764183 | 2840768965 | 208 |
| 356 | iso_pu_bacteria | 2842871566 | 2842872133 | 208 |
| 357 | iso_pu_bacteria | 2894652903 | 2894655739 | 208 |
| 358 | iso_pu_bacteria | 2904578770 | 2904582072 | 208 |
| 359 | iso_pu_bacteria | 2919119836 | 2919123150 | 208 |
| 360 | iso_pu_bacteria | 2928521798 | 2928524065 | 208 |
| 361 | iso_pu_bacteria | 2961136820 | 2961143611 | 208 |
| 362 | iso_pu_bacteria | 2965032056 | 2965036776 | 208 |
| 363 | iso_pu_bacteria | 2965047637 | 2965051284 | 208 |
| 364 | iso_pu_bacteria | 3002141150 | 3002144957 | 208 |
| 365 | iso_pu_bacteria | 3005452660 | 3005454881 | 208 |
| 366 | 3300049583 | Ga0501067_0042702 | Ga0501067_0042702_1596_2228 | 209 |
| 367 | 3300053139 | Ga0500568_0000128 | Ga0500568_0000128_50769_51407 | 209 |
| 368 | 3300001979 | JGI24740J21852_10002656 | JGI24740J21852_100026566 | 211 |
| 369 | 3300002704 | JGI25155J39150_1000014 | JGI25155J39150_100001454 | 211 |
| 370 | 3300002705 | JGI25156J39149_1000037 | JGI25156J39149_100003758 | 211 |
| 371 | 3300002737 | JGI25162J39368_1000379 | JGI25162J39368_100037918 | 211 |
| 372 | 3300002738 | JGI25154J39366_1000052 | JGI25154J39366_1000052111 | 211 |
| 373 | 3300002738 | JGI25154J39366_1000229 | JGI25154J39366_100022936 | 211 |
| 374 | 3300002739 | JGI25158J39367_1000169 | JGI25158J39367_10001699 | 211 |
| 375 | 3300002741 | JGI25157J39369_1000040 | JGI25157J39369_100004052 | 211 |
| 376 | 3300002773 | JGI25152J39213_1000401 | JGI25152J39213_10004015 | 211 |
| 377 | 3300002773 | JGI25152J39213_1000670 | JGI25152J39213_100067016 | 211 |
| 378 | 3300002773 | JGI25152J39213_1005468 | JGI25152J39213_10054685 | 211 |
| 379 | 3300002773 | JGI25152J39213_1006845 | JGI25152J39213_10068452 | 211 |
| 380 | 3300002773 | JGI25152J39213_1008189 | JGI25152J39213_10081893 | 211 |
| 381 | 3300002773 | JGI25152J39213_1008772 | JGI25152J39213_10087723 | 211 |
| 382 | 3300002774 | JGI25150J39212_1000088 | JGI25150J39212_100008833 | 211 |
| 383 | 3300002774 | JGI25150J39212_1012828 | JGI25150J39212_10128281 | 211 |
| 384 | 3300002774 | JGI25150J39212_1017228 | JGI25150J39212_10172282 | 211 |
| 385 | 3300002987 | JGI25159J45721_1000120 | JGI25159J45721_100012027 | 211 |
| 386 | 3300003187 | JGI25151J46595_10000215 | JGI25151J46595_1000021526 | 211 |
| 387 | 3300003187 | JGI25151J46595_10000280 | JGI25151J46595_1000028028 | 211 |
| 388 | 3300003187 | JGI25151J46595_10019207 | JGI25151J46595_100192072 | 211 |
| 389 | 3300003214 | JGI25165J46597_1000469 | JGI25165J46597_100046924 | 211 |
| 390 | 3300003215 | JGI25153J46596_10012354 | JGI25153J46596_100123545 | 211 |
| 391 | 3300003215 | JGI25153J46596_10012823 | JGI25153J46596_100128234 | 211 |
| 392 | 3300003215 | JGI25153J46596_10017279 | JGI25153J46596_100172791 | 211 |
| 393 | 3300003215 | JGI25153J46596_10017963 | JGI25153J46596_100179631 | 211 |
| 394 | 3300003215 | JGI25153J46596_10019278 | JGI25153J46596_100192782 | 211 |
| 395 | 3300003320 | rootH2_10013960 | rootH2_100139603 | 211 |
| 396 | 3300003322 | rootL2_10001418 | rootL2_100014183 | 211 |
| 397 | 3300003322 | rootL2_10183749 | rootL2_101837492 | 211 |
| 398 | 3300003323 | rootH1_10128178 | rootH1_101281785 | 211 |
| 399 | 3300003354 | JGI25160J50197_1000001 | JGI25160J50197_1000001431 | 211 |
| 400 | 3300003354 | JGI25160J50197_1001620 | JGI25160J50197_10016204 | 211 |
| 401 | 3300003354 | JGI25160J50197_1004466 | JGI25160J50197_10044662 | 211 |
| 402 | 3300003354 | JGI25160J50197_1009073 | JGI25160J50197_10090732 | 211 |
| 403 | 3300003374 | JGI25161J50226_1000001 | JGI25161J50226_1000001326 | 211 |
| 404 | 3300003374 | JGI25161J50226_1000068 | JGI25161J50226_10000686 | 211 |
| 405 | 3300003374 | JGI25161J50226_1002317 | JGI25161J50226_10023174 | 211 |
| 406 | 3300003771 | Ga0055526_1001827 | Ga0055526_10018279 | 211 |
| 407 | 3300003771 | Ga0055526_1004459 | Ga0055526_10044595 | 211 |
| 408 | 3300003771 | Ga0055526_1005133 | Ga0055526_10051332 | 211 |
| 409 | 3300003771 | Ga0055526_1011309 | Ga0055526_10113094 | 211 |
| 410 | 3300003775 | Ga0055524_1002683 | Ga0055524_10026835 | 211 |
| 411 | 3300003775 | Ga0055524_1006497 | Ga0055524_10064975 | 211 |
| 412 | 3300003790 | Ga0055528_1001415 | Ga0055528_10014156 | 211 |
| 413 | 3300003790 | Ga0055528_1001467 | Ga0055528_100146712 | 211 |
| 414 | 3300003792 | Ga0055540_1000592 | Ga0055540_10005923 | 211 |
| 415 | 3300003792 | Ga0055540_1013767 | Ga0055540_10137672 | 211 |
| 416 | 3300003792 | Ga0055540_1013895 | Ga0055540_10138953 | 211 |
| 417 | 3300004625 | Ga0055543_1000003 | Ga0055543_1000003342 | 211 |
| 418 | 3300004625 | Ga0055543_1000189 | Ga0055543_100018947 | 211 |
| 419 | 3300004625 | Ga0055543_1000662 | Ga0055543_10006625 | 211 |
| 420 | 3300005262 | Ga0065165_1000008 | Ga0065165_100000821 | 211 |
| 421 | 3300005262 | Ga0065165_1010902 | Ga0065165_10109025 | 211 |
| 422 | 3300005262 | Ga0065165_1021641 | Ga0065165_10216412 | 211 |
| 423 | 3300005335 | Ga0070666_10232608 | Ga0070666_102326082 | 211 |
| 424 | 3300005347 | Ga0070668_100307665 | Ga0070668_1003076652 | 211 |
| 425 | 3300005347 | Ga0070668_100521272 | Ga0070668_1005212722 | 211 |
| 426 | 3300005355 | Ga0070671_100180300 | Ga0070671_1001803002 | 211 |
| 427 | 3300005455 | Ga0070663_100074640 | Ga0070663_1000746402 | 211 |
| 428 | 3300005457 | Ga0070662_100342118 | Ga0070662_1003421182 | 211 |
| 429 | 3300005548 | Ga0070665_100184163 | Ga0070665_1001841633 | 211 |
| 430 | 3300005614 | Ga0068856_100041846 | Ga0068856_1000418462 | 211 |
| 431 | 3300005616 | Ga0068852_100231602 | Ga0068852_1002316022 | 211 |
| 432 | 3300005834 | Ga0068851_10046965 | Ga0068851_100469653 | 211 |
| 433 | 3300006038 | Ga0075365_10002611 | Ga0075365_100026119 | 211 |
| 434 | 3300006038 | Ga0075365_10002699 | Ga0075365_100026998 | 211 |
| 435 | 3300006048 | Ga0075363_100145048 | Ga0075363_1001450481 | 211 |
| 436 | 3300006051 | Ga0075364_10334532 | Ga0075364_103345321 | 211 |
| 437 | 3300006177 | Ga0075362_10007590 | Ga0075362_100075902 | 211 |
| 438 | 3300006178 | Ga0075367_10025336 | Ga0075367_100253362 | 211 |
| 439 | 3300006178 | Ga0075367_10028325 | Ga0075367_100283254 | 211 |
| 440 | 3300006186 | Ga0075369_10000814 | Ga0075369_100008145 | 211 |
| 441 | 3300006186 | Ga0075369_10017791 | Ga0075369_100177914 | 211 |
| 442 | 3300006353 | Ga0075370_10000522 | Ga0075370_100005223 | 211 |
| 443 | 3300006353 | Ga0075370_10004914 | Ga0075370_100049145 | 211 |
| 444 | 3300009011 | Ga0105251_10027604 | Ga0105251_100276044 | 211 |
| 445 | 3300009036 | Ga0105244_10143565 | Ga0105244_101435652 | 211 |
| 446 | 3300009092 | Ga0105250_10041635 | Ga0105250_100416352 | 211 |
| 447 | 3300009092 | Ga0105250_10134313 | Ga0105250_101343132 | 211 |
| 448 | 3300009093 | Ga0105240_10000014 | Ga0105240_10000014332 | 211 |
| 449 | 3300009177 | Ga0105248_10005639 | Ga0105248_100056399 | 211 |
| 450 | 3300009177 | Ga0105248_10332898 | Ga0105248_103328982 | 211 |
| 451 | 3300009545 | Ga0105237_10002417 | Ga0105237_1000241713 | 211 |
| 452 | 3300009551 | Ga0105238_10354534 | Ga0105238_103545342 | 211 |
| 453 | 3300009553 | Ga0105249_10148486 | Ga0105249_101484863 | 211 |
| 454 | 3300009765 | Ga0123341_1000124 | Ga0123341_10001245 | 211 |
| 455 | 3300009766 | Ga0123342_1005659 | Ga0123342_10056594 | 211 |
| 456 | 3300009766 | Ga0123342_1027387 | Ga0123342_10273872 | 211 |
| 457 | 3300010375 | Ga0105239_10000973 | Ga0105239_1000097310 | 211 |
| 458 | 3300010375 | Ga0105239_10301724 | Ga0105239_103017242 | 211 |
| 459 | 3300011119 | Ga0105246_10108885 | Ga0105246_101088852 | 211 |
| 460 | 3300013100 | Ga0157373_10451035 | Ga0157373_104510352 | 211 |
| 461 | 3300013104 | Ga0157370_10000327 | Ga0157370_1000032742 | 211 |
| 462 | 3300015262 | Ga0182007_10002502 | Ga0182007_100025026 | 211 |
| 463 | 3300015265 | Ga0182005_1004223 | Ga0182005_10042236 | 211 |
| 464 | 3300025206 | Ga0209435_100027 | Ga0209435_10002753 | 211 |
| 465 | 3300025208 | Ga0209436_100061 | Ga0209436_1000619 | 211 |
| 466 | 3300025233 | Ga0209437_100060 | Ga0209437_100060330 | 211 |
| 467 | 3300025245 | Ga0207425_1000055 | Ga0207425_1000055146 | 211 |
| 468 | 3300025245 | Ga0207425_1003073 | Ga0207425_10030734 | 211 |
| 469 | 3300025245 | Ga0207425_1003575 | Ga0207425_10035752 | 211 |
| 470 | 3300025245 | Ga0207425_1005271 | Ga0207425_10052712 | 211 |
| 471 | 3300025246 | Ga0209646_1000086 | Ga0209646_100008653 | 211 |
| 472 | 3300025246 | Ga0209646_1006486 | Ga0209646_10064862 | 211 |
| 473 | 3300025250 | Ga0209026_1000082 | Ga0209026_100008253 | 211 |
| 474 | 3300025253 | Ga0209677_100420 | Ga0209677_10042019 | 211 |
| 475 | 3300025256 | Ga0209759_1000063 | Ga0209759_1000063148 | 211 |
| 476 | 3300025256 | Ga0209759_1030080 | Ga0209759_10300802 | 211 |
| 477 | 3300025258 | Ga0209129_1000029 | Ga0209129_1000029347 | 211 |
| 478 | 3300025258 | Ga0209129_1000607 | Ga0209129_100060711 | 211 |
| 479 | 3300025258 | Ga0209129_1000827 | Ga0209129_100082710 | 211 |
| 480 | 3300025258 | Ga0209129_1000980 | Ga0209129_100098012 | 211 |
| 481 | 3300025258 | Ga0209129_1003272 | Ga0209129_10032725 | 211 |
| 482 | 3300025261 | Ga0209233_1000095 | Ga0209233_1000095102 | 211 |
| 483 | 3300025261 | Ga0209233_1000113 | Ga0209233_1000113230 | 211 |
| 484 | 3300025263 | Ga0209565_1029992 | Ga0209565_10299922 | 211 |
| 485 | 3300025273 | Ga0209673_1000025 | Ga0209673_1000025236 | 211 |
| 486 | 3300025273 | Ga0209673_1000858 | Ga0209673_100085815 | 211 |
| 487 | 3300025273 | Ga0209673_1000878 | Ga0209673_100087814 | 211 |
| 488 | 3300025273 | Ga0209673_1001058 | Ga0209673_100105820 | 211 |
| 489 | 3300025273 | Ga0209673_1002625 | Ga0209673_100262512 | 211 |
| 490 | 3300025273 | Ga0209673_1005843 | Ga0209673_10058435 | 211 |
| 491 | 3300025273 | Ga0209673_1018391 | Ga0209673_10183911 | 211 |
| 492 | 3300025284 | Ga0209130_1000003 | Ga0209130_1000003343 | 211 |
| 493 | 3300025284 | Ga0209130_1000020 | Ga0209130_100002058 | 211 |
| 494 | 3300025284 | Ga0209130_1015542 | Ga0209130_10155422 | 211 |
| 495 | 3300025292 | Ga0209676_1055198 | Ga0209676_10551982 | 211 |
| 496 | 3300025294 | Ga0209025_1000070 | Ga0209025_100007034 | 211 |
| 497 | 3300025294 | Ga0209025_1000091 | Ga0209025_100009195 | 211 |
| 498 | 3300025294 | Ga0209025_1003763 | Ga0209025_10037635 | 211 |
| 499 | 3300025294 | Ga0209025_1015180 | Ga0209025_10151807 | 211 |
| 500 | 3300025294 | Ga0209025_1016502 | Ga0209025_10165026 | 211 |
| 501 | 3300025295 | Ga0209564_1000265 | Ga0209564_100026527 | 211 |
| 502 | 3300025295 | Ga0209564_1001272 | Ga0209564_10012725 | 211 |
| 503 | 3300025295 | Ga0209564_1001274 | Ga0209564_100127412 | 211 |
| 504 | 3300025295 | Ga0209564_1015499 | Ga0209564_10154994 | 211 |
| 505 | 3300025297 | Ga0209758_1000094 | Ga0209758_1000094200 | 211 |
| 506 | 3300025297 | Ga0209758_1001587 | Ga0209758_100158716 | 211 |
| 507 | 3300025297 | Ga0209758_1001902 | Ga0209758_100190219 | 211 |
| 508 | 3300025297 | Ga0209758_1002315 | Ga0209758_100231511 | 211 |
| 509 | 3300025297 | Ga0209758_1002367 | Ga0209758_10023676 | 211 |
| 510 | 3300025297 | Ga0209758_1002590 | Ga0209758_10025906 | 211 |
| 511 | 3300025297 | Ga0209758_1021042 | Ga0209758_10210423 | 211 |
| 512 | 3300025297 | Ga0209758_1051359 | Ga0209758_10513592 | 211 |
| 513 | 3300025298 | Ga0209050_1005990 | Ga0209050_10059904 | 211 |
| 514 | 3300025299 | Ga0209256_1000381 | Ga0209256_100038120 | 211 |
| 515 | 3300025299 | Ga0209256_1002239 | Ga0209256_10022392 | 211 |
| 516 | 3300025299 | Ga0209256_1004292 | Ga0209256_10042922 | 211 |
| 517 | 3300025299 | Ga0209256_1009559 | Ga0209256_10095592 | 211 |
| 518 | 3300025299 | Ga0209256_1057140 | Ga0209256_10571402 | 211 |
| 519 | 3300025302 | Ga0207426_1000008 | Ga0207426_1000008127 | 211 |
| 520 | 3300025302 | Ga0207426_1000011 | Ga0207426_1000011432 | 211 |
| 521 | 3300025302 | Ga0207426_1000218 | Ga0207426_100021817 | 211 |
| 522 | 3300025302 | Ga0207426_1000941 | Ga0207426_100094117 | 211 |
| 523 | 3300025303 | Ga0209051_1000393 | Ga0209051_100039348 | 211 |
| 524 | 3300025303 | Ga0209051_1001581 | Ga0209051_100158111 | 211 |
| 525 | 3300025303 | Ga0209051_1006611 | Ga0209051_10066115 | 211 |
| 526 | 3300025303 | Ga0209051_1011717 | Ga0209051_10117173 | 211 |
| 527 | 3300025304 | Ga0209257_1002259 | Ga0209257_10022599 | 211 |
| 528 | 3300025304 | Ga0209257_1024874 | Ga0209257_10248742 | 211 |
| 529 | 3300025711 | Ga0207696_1062773 | Ga0207696_10627732 | 211 |
| 530 | 3300025735 | Ga0207713_1066957 | Ga0207713_10669572 | 211 |
| 531 | 3300025903 | Ga0207680_10325932 | Ga0207680_103259322 | 211 |
| 532 | 3300025913 | Ga0207695_10000037 | Ga0207695_10000037334 | 211 |
| 533 | 3300025914 | Ga0207671_10000271 | Ga0207671_1000027156 | 211 |
| 534 | 3300025923 | Ga0207681_10603691 | Ga0207681_106036911 | 211 |
| 535 | 3300025972 | Ga0207668_10207649 | Ga0207668_102076492 | 211 |
| 536 | 3300025972 | Ga0207668_10889386 | Ga0207668_108893862 | 211 |
| 537 | 3300025981 | Ga0207640_10338716 | Ga0207640_103387162 | 211 |
| 538 | 3300026142 | Ga0207698_10092184 | Ga0207698_100921843 | 211 |
| 539 | 3300027111 | Ga0209281_1000034 | Ga0209281_1000034232 | 211 |
| 540 | 3300027312 | Ga0209371_1001220 | Ga0209371_10012206 | 211 |
| 541 | 3300028794 | Ga0307515_10004087 | Ga0307515_1000408719 | 211 |
| 542 | 3300030500 | Ga0268256_1006647 | Ga0268256_10066473 | 211 |
| 543 | 3300031456 | Ga0307513_10045937 | Ga0307513_100459374 | 211 |
| 544 | 3300031731 | Ga0307405_10028572 | Ga0307405_100285722 | 211 |
| 545 | 3300031901 | Ga0307406_10015020 | Ga0307406_100150202 | 211 |
| 546 | 3300031911 | Ga0307412_10018275 | Ga0307412_100182753 | 211 |
| 547 | 3300032004 | Ga0307414_10148286 | Ga0307414_101482862 | 211 |
| 548 | 3300033180 | Ga0307510_10185038 | Ga0307510_101850382 | 211 |
| 549 | 3300041404 | Ga0439436_0004741 | Ga0439436_0004741_2247_2897 | 211 |
| 550 | 3300041411 | Ga0439466_0056683 | Ga0439466_0056683_471_1121 | 211 |
| 551 | 3300041413 | Ga0439465_0003533 | Ga0439465_0003533_1233_1883 | 211 |
| 552 | 3300041413 | Ga0439465_0060305 | Ga0439465_0060305_361_1011 | 211 |
| 553 | 3300041453 | Ga0451797_0076574 | Ga0451797_0076574_622_1272 | 211 |
| 554 | 3300041458 | Ga0451798_0635833 | Ga0451798_0635833_106_756 | 211 |
| 555 | 3300041503 | Ga0451847_0389759 | Ga0451847_0389759_1920_2570 | 211 |
| 556 | 3300041505 | Ga0451849_0307898 | Ga0451849_0307898_76_726 | 211 |
| 557 | 3300041507 | Ga0451851_0256480 | Ga0451851_0256480_276_926 | 211 |
| 558 | 3300041511 | Ga0451855_0806073 | Ga0451855_0806073_2138_2788 | 211 |
| 559 | 3300041511 | Ga0451855_1544524 | Ga0451855_1544524_181_831 | 211 |
| 560 | 3300042146 | Ga0450907_023065 | Ga0450907_023065_294_944 | 211 |
| 561 | 3300044684 | Ga0466966_0097533 | Ga0466966_0097533_1115_1750 | 211 |
| 562 | 3300044765 | Ga0466970_0002933 | Ga0466970_0002933_6464_7099 | 211 |
| 563 | 3300045049 | Ga0466959_0047621 | Ga0466959_0047621_2133_2768 | 211 |
| 564 | 3300045836 | Ga0466958_0016942 | Ga0466958_0016942_3079_3714 | 211 |
| 565 | 3300045976 | Ga0466967_0253790 | Ga0466967_0253790_65_700 | 211 |
| 566 | 3300046460 | Ga0495638_0002551 | Ga0495638_0002551_12049_12699 | 211 |
| 567 | 3300046460 | Ga0495638_0178706 | Ga0495638_0178706_346_996 | 211 |
| 568 | 3300046471 | Ga0495650_0025883 | Ga0495650_0025883_1871_2521 | 211 |
| 569 | 3300046471 | Ga0495650_0036172 | Ga0495650_0036172_1344_1994 | 211 |
| 570 | 3300046474 | Ga0495605_0001730 | Ga0495605_0001730_1595_2245 | 211 |
| 571 | 3300046492 | Ga0495585_0013280 | Ga0495585_0013280_3069_3719 | 211 |
| 572 | 3300046492 | Ga0495585_0099884 | Ga0495585_0099884_762_1412 | 211 |
| 573 | 3300046500 | Ga0495596_0182026 | Ga0495596_0182026_59_709 | 211 |
| 574 | 3300046501 | Ga0495607_0078339 | Ga0495607_0078339_516_1166 | 211 |
| 575 | 3300046506 | Ga0495583_0002632 | Ga0495583_0002632_7722_8372 | 211 |
| 576 | 3300046506 | Ga0495583_0026756 | Ga0495583_0026756_1098_1748 | 211 |
| 577 | 3300046506 | Ga0495583_0029606 | Ga0495583_0029606_151_801 | 211 |
| 578 | 3300046506 | Ga0495583_0046093 | Ga0495583_0046093_27_677 | 211 |
| 579 | 3300046507 | Ga0495606_0015037 | Ga0495606_0015037_3120_3770 | 211 |
| 580 | 3300046507 | Ga0495606_0019899 | Ga0495606_0019899_4112_4747 | 211 |
| 581 | 3300046507 | Ga0495606_0030262 | Ga0495606_0030262_3071_3715 | 211 |
| 582 | 3300046507 | Ga0495606_0102576 | Ga0495606_0102576_30_680 | 211 |
| 583 | 3300046507 | Ga0495606_0115199 | Ga0495606_0115199_482_1132 | 211 |
| 584 | 3300046507 | Ga0495606_0215222 | Ga0495606_0215222_330_980 | 211 |
| 585 | 3300046512 | Ga0495610_0001520 | Ga0495610_0001520_1745_2395 | 211 |
| 586 | 3300046512 | Ga0495610_0017115 | Ga0495610_0017115_1510_2160 | 211 |
| 587 | 3300046512 | Ga0495610_0024024 | Ga0495610_0024024_2499_3149 | 211 |
| 588 | 3300046512 | Ga0495610_0198560 | Ga0495610_0198560_147_797 | 211 |
| 589 | 3300046513 | Ga0495616_0014048 | Ga0495616_0014048_2902_3552 | 211 |
| 590 | 3300046513 | Ga0495616_0039405 | Ga0495616_0039405_955_1605 | 211 |
| 591 | 3300046515 | Ga0495620_0009706 | Ga0495620_0009706_3446_4096 | 211 |
| 592 | 3300046515 | Ga0495620_0017647 | Ga0495620_0017647_2133_2783 | 211 |
| 593 | 3300046518 | Ga0495631_0000977 | Ga0495631_0000977_7479_8129 | 211 |
| 594 | 3300046518 | Ga0495631_0063800 | Ga0495631_0063800_601_1251 | 211 |
| 595 | 3300046519 | Ga0495632_0004030 | Ga0495632_0004030_2085_2735 | 211 |
| 596 | 3300046519 | Ga0495632_0004699 | Ga0495632_0004699_6284_6934 | 211 |
| 597 | 3300046519 | Ga0495632_0009534 | Ga0495632_0009534_4001_4651 | 211 |
| 598 | 3300046522 | Ga0495643_0019883 | Ga0495643_0019883_1179_1829 | 211 |
| 599 | 3300046522 | Ga0495643_0029557 | Ga0495643_0029557_68_718 | 211 |
| 600 | 3300046522 | Ga0495643_0072449 | Ga0495643_0072449_190_840 | 211 |
| 601 | 3300046524 | Ga0495648_0055944 | Ga0495648_0055944_794_1444 | 211 |
| 602 | 3300046530 | Ga0495654_0098787 | Ga0495654_0098787_527_1177 | 211 |
| 603 | 3300046538 | Ga0495609_0076366 | Ga0495609_0076366_11_661 | 211 |
| 604 | 3300046542 | Ga0495597_0077697 | Ga0495597_0077697_353_1003 | 211 |
| 605 | 3300046616 | Ga0495668_0017591 | Ga0495668_0017591_1349_1999 | 211 |
| 606 | 3300046616 | Ga0495668_0047316 | Ga0495668_0047316_1478_2128 | 211 |
| 607 | 3300046616 | Ga0495668_0182045 | Ga0495668_0182045_225_875 | 211 |
| 608 | 3300046648 | Ga0495611_0290709 | Ga0495611_0290709_56_706 | 211 |
| 609 | 3300046660 | Ga0495625_0007821 | Ga0495625_0007821_7183_7833 | 211 |
| 610 | 3300046660 | Ga0495625_0012470 | Ga0495625_0012470_5862_6512 | 211 |
| 611 | 3300046660 | Ga0495625_0085789 | Ga0495625_0085789_577_1227 | 211 |
| 612 | 3300046665 | Ga0495661_0149257 | Ga0495661_0149257_372_1022 | 211 |
| 613 | 3300046691 | Ga0495670_0003409 | Ga0495670_0003409_7005_7655 | 211 |
| 614 | 3300046694 | Ga0495649_0009649 | Ga0495649_0009649_4556_5206 | 211 |
| 615 | 3300046810 | Ga0495660_0010273 | Ga0495660_0010273_2358_3008 | 211 |
| 616 | 3300046810 | Ga0495660_0034266 | Ga0495660_0034266_1200_1850 | 211 |
| 617 | 3300046810 | Ga0495660_0178277 | Ga0495660_0178277_304_954 | 211 |
| 618 | 3300047318 | Ga0495636_0005706 | Ga0495636_0005706_2636_3286 | 211 |
| 619 | 3300047320 | Ga0495672_0061399 | Ga0495672_0061399_186_836 | 211 |
| 620 | 3300047323 | Ga0495683_0110123 | Ga0495683_0110123_318_968 | 211 |
| 621 | 3300047443 | Ga0495687_013048 | Ga0495687_013048_2577_3227 | 211 |
| 622 | 3300047445 | Ga0495677_0128489 | Ga0495677_0128489_30_680 | 211 |
| 623 | 3300047447 | Ga0495685_072090 | Ga0495685_072090_210_860 | 211 |
| 624 | 3300047472 | Ga0495686_0006043 | Ga0495686_0006043_7512_8162 | 211 |
| 625 | 3300047472 | Ga0495686_0009070 | Ga0495686_0009070_2498_3148 | 211 |
| 626 | 3300047472 | Ga0495686_0078790 | Ga0495686_0078790_1319_1969 | 211 |
| 627 | 3300048090 | Ga0495615_0002096 | Ga0495615_0002096_885_1535 | 211 |
| 628 | 3300048905 | Ga0496102_0009649 | Ga0496102_0009649_30_665 | 211 |
| 629 | 3300048905 | Ga0496102_0058400 | Ga0496102_0058400_612_1262 | 211 |
| 630 | 3300048906 | Ga0496103_0060501 | Ga0496103_0060501_153_803 | 211 |
| 631 | 3300048907 | Ga0496104_0120448 | Ga0496104_0120448_507_1157 | 211 |
| 632 | 3300048908 | Ga0496105_0085877 | Ga0496105_0085877_1280_1930 | 211 |
| 633 | 3300048908 | Ga0496105_0477611 | Ga0496105_0477611_33_677 | 211 |
| 634 | 3300048909 | Ga0496106_0000489 | Ga0496106_0000489_12068_12718 | 211 |
| 635 | 3300048910 | Ga0496107_0370631 | Ga0496107_0370631_35_670 | 211 |
| 636 | 3300048913 | Ga0496110_0055553 | Ga0496110_0055553_586_1236 | 211 |
| 637 | 3300048914 | Ga0496111_0051433 | Ga0496111_0051433_377_1027 | 211 |
| 638 | 3300048916 | Ga0496113_0051756 | Ga0496113_0051756_21_656 | 211 |
| 639 | 3300048916 | Ga0496113_0053724 | Ga0496113_0053724_157_807 | 211 |
| 640 | 3300048916 | Ga0496113_0138370 | Ga0496113_0138370_452_1102 | 211 |
| 641 | 3300048917 | Ga0496114_0061746 | Ga0496114_0061746_179_823 | 211 |
| 642 | 3300048917 | Ga0496114_0191942 | Ga0496114_0191942_600_1250 | 211 |
| 643 | 3300048919 | Ga0496116_0008133 | Ga0496116_0008133_5671_6306 | 211 |
| 644 | 3300048919 | Ga0496116_0017768 | Ga0496116_0017768_2771_3421 | 211 |
| 645 | 3300048919 | Ga0496116_0027515 | Ga0496116_0027515_2897_3547 | 211 |
| 646 | 3300048919 | Ga0496116_0055401 | Ga0496116_0055401_422_1072 | 211 |
| 647 | 3300048919 | Ga0496116_0094526 | Ga0496116_0094526_273_923 | 211 |
| 648 | 3300048920 | Ga0496117_0001519 | Ga0496117_0001519_19384_20019 | 211 |
| 649 | 3300048920 | Ga0496117_0025223 | Ga0496117_0025223_925_1575 | 211 |
| 650 | 3300048920 | Ga0496117_0039603 | Ga0496117_0039603_2174_2824 | 211 |
| 651 | 3300048920 | Ga0496117_0039812 | Ga0496117_0039812_1542_2192 | 211 |
| 652 | 3300048921 | Ga0496118_0001657 | Ga0496118_0001657_19419_20054 | 211 |
| 653 | 3300048921 | Ga0496118_0011382 | Ga0496118_0011382_1575_2225 | 211 |
| 654 | 3300048921 | Ga0496118_0027496 | Ga0496118_0027496_2175_2825 | 211 |
| 655 | 3300048921 | Ga0496118_0040375 | Ga0496118_0040375_659_1309 | 211 |
| 656 | 3300048921 | Ga0496118_0052840 | Ga0496118_0052840_1674_2324 | 211 |
| 657 | 3300048922 | Ga0496119_0002067 | Ga0496119_0002067_8178_8813 | 211 |
| 658 | 3300048922 | Ga0496119_0011198 | Ga0496119_0011198_251_886 | 211 |
| 659 | 3300048922 | Ga0496119_0101493 | Ga0496119_0101493_708_1358 | 211 |
| 660 | 3300048922 | Ga0496119_0175292 | Ga0496119_0175292_173_823 | 211 |
| 661 | 3300048923 | Ga0496120_0003006 | Ga0496120_0003006_2985_3620 | 211 |
| 662 | 3300048924 | Ga0496121_0003379 | Ga0496121_0003379_19123_19758 | 211 |
| 663 | 3300048924 | Ga0496121_0030191 | Ga0496121_0030191_3205_3855 | 211 |
| 664 | 3300048924 | Ga0496121_0046715 | Ga0496121_0046715_2022_2672 | 211 |
| 665 | 3300048924 | Ga0496121_0085401 | Ga0496121_0085401_348_998 | 211 |
| 666 | 3300048924 | Ga0496121_0128568 | Ga0496121_0128568_348_998 | 211 |
| 667 | 3300048924 | Ga0496121_0130149 | Ga0496121_0130149_680_1330 | 211 |
| 668 | 3300048924 | Ga0496121_0136686 | Ga0496121_0136686_767_1417 | 211 |
| 669 | 3300048924 | Ga0496121_0168743 | Ga0496121_0168743_471_1121 | 211 |
| 670 | 3300048925 | Ga0496122_0003108 | Ga0496122_0003108_857_1507 | 211 |
| 671 | 3300048925 | Ga0496122_0005117 | Ga0496122_0005117_6663_7298 | 211 |
| 672 | 3300048925 | Ga0496122_0022073 | Ga0496122_0022073_3707_4357 | 211 |
| 673 | 3300048925 | Ga0496122_0045909 | Ga0496122_0045909_517_1167 | 211 |
| 674 | 3300048926 | Ga0496123_0012900 | Ga0496123_0012900_6234_6869 | 211 |
| 675 | 3300048926 | Ga0496123_0078380 | Ga0496123_0078380_1052_1702 | 211 |
| 676 | 3300048927 | Ga0496124_0002807 | Ga0496124_0002807_1487_2137 | 211 |
| 677 | 3300048927 | Ga0496124_0003951 | Ga0496124_0003951_7000_7650 | 211 |
| 678 | 3300048927 | Ga0496124_0042342 | Ga0496124_0042342_1254_1904 | 211 |
| 679 | 3300048927 | Ga0496124_0054740 | Ga0496124_0054740_736_1371 | 211 |
| 680 | 3300048927 | Ga0496124_0061031 | Ga0496124_0061031_1301_1951 | 211 |
| 681 | 3300048927 | Ga0496124_0091096 | Ga0496124_0091096_348_998 | 211 |
| 682 | 3300048927 | Ga0496124_0155577 | Ga0496124_0155577_445_1080 | 211 |
| 683 | 3300048927 | Ga0496124_0172146 | Ga0496124_0172146_804_1454 | 211 |
| 684 | 3300048927 | Ga0496124_0177298 | Ga0496124_0177298_238_888 | 211 |
| 685 | 3300048927 | Ga0496124_0181086 | Ga0496124_0181086_649_1299 | 211 |
| 686 | 3300048928 | Ga0496125_0009582 | Ga0496125_0009582_3130_3780 | 211 |
| 687 | 3300048928 | Ga0496125_0079744 | Ga0496125_0079744_1733_2368 | 211 |
| 688 | 3300048928 | Ga0496125_0111047 | Ga0496125_0111047_393_1043 | 211 |
| 689 | 3300048929 | Ga0496126_0011193 | Ga0496126_0011193_5799_6434 | 211 |
| 690 | 3300048929 | Ga0496126_0115941 | Ga0496126_0115941_1160_1810 | 211 |
| 691 | 3300049459 | Ga0495678_008794 | Ga0495678_008794_3572_4222 | 211 |
| 692 | 3300049459 | Ga0495678_034167 | Ga0495678_034167_1010_1660 | 211 |
| 693 | 3300049569 | Ga0501032_0111617 | Ga0501032_0111617_1044_1694 | 211 |
| 694 | 3300049570 | Ga0501033_0061615 | Ga0501033_0061615_1706_2356 | 211 |
| 695 | 3300049571 | Ga0501034_0192412 | Ga0501034_0192412_482_1132 | 211 |
| 696 | 3300049572 | Ga0501036_0406720 | Ga0501036_0406720_323_973 | 211 |
| 697 | 3300049574 | Ga0501038_0038619 | Ga0501038_0038619_2288_2938 | 211 |
| 698 | 3300049579 | Ga0501043_0085025 | Ga0501043_0085025_586_1236 | 211 |
| 699 | 3300049580 | Ga0501046_0176923 | Ga0501046_0176923_723_1373 | 211 |
| 700 | 3300049581 | Ga0501047_0207260 | Ga0501047_0207260_767_1417 | 211 |
| 701 | 3300049584 | Ga0501068_0111688 | Ga0501068_0111688_892_1542 | 211 |
| 702 | 3300049589 | Ga0501073_0022789 | Ga0501073_0022789_219_869 | 211 |
| 703 | 3300049744 | Ga0501083_0060651 | Ga0501083_0060651_51_701 | 211 |
| 704 | 3300049744 | Ga0501083_0308294 | Ga0501083_0308294_107_757 | 211 |
| 705 | 3300050489 | nmdc:mga03683_2241_c1 | nmdc:mga03683_2241_c1_1572_2222 | 211 |
| 706 | 3300050490 | nmdc:mga03n38_68128_c1 | nmdc:mga03n38_68128_c1_792_1442 | 211 |
| 707 | 3300050491 | nmdc:mga00v17_93638_c1 | nmdc:mga00v17_93638_c1_1156_1806 | 211 |
| 708 | 3300050492 | nmdc:mga0yw44_1816_c1 | nmdc:mga0yw44_1816_c1_6534_7184 | 211 |
| 709 | 3300050493 | nmdc:mga0k408_2883_c2 | nmdc:mga0k408_2883_c2_1025_1675 | 211 |
| 710 | 3300050494 | nmdc:mga06z11_22742_c1 | nmdc:mga06z11_22742_c1_682_1332 | 211 |
| 711 | 3300050496 | nmdc:mga07m45_11346_c1 | nmdc:mga07m45_11346_c1_2924_3574 | 211 |
| 712 | 3300050516 | nmdc:mga0sz30_30206_c1 | nmdc:mga0sz30_30206_c1_1270_1920 | 211 |
| 713 | 3300053079 | Ga0500610_0068538 | Ga0500610_0068538_1072_1722 | 211 |
| 714 | 3300053086 | Ga0500578_0028293 | Ga0500578_0028293_1489_2139 | 211 |
| 715 | 3300053086 | Ga0500578_0068281 | Ga0500578_0068281_1202_1852 | 211 |
| 716 | 3300053093 | Ga0500651_0175533 | Ga0500651_0175533_195_845 | 211 |
| 717 | 3300053094 | Ga0500566_0242475 | Ga0500566_0242475_58_708 | 211 |
| 718 | 3300053098 | Ga0500650_0268895 | Ga0500650_0268895_53_703 | 211 |
| 719 | 3300053105 | Ga0500557_018128 | Ga0500557_018128_261_911 | 211 |
| 720 | 3300053108 | Ga0500562_033838 | Ga0500562_033838_246_896 | 211 |
| 721 | 3300053109 | Ga0500569_000274 | Ga0500569_000274_2981_3631 | 211 |
| 722 | 3300053118 | Ga0500594_0001349 | Ga0500594_0001349_3578_4228 | 211 |
| 723 | 3300053125 | Ga0500618_007178 | Ga0500618_007178_476_1111 | 211 |
| 724 | 3300053125 | Ga0500618_013225 | Ga0500618_013225_1039_1689 | 211 |
| 725 | 3300053134 | Ga0500658_0000240 | Ga0500658_0000240_19153_19803 | 211 |
| 726 | 3300053134 | Ga0500658_0010234 | Ga0500658_0010234_2504_3154 | 211 |
| 727 | 3300053139 | Ga0500568_0001687 | Ga0500568_0001687_1179_1829 | 211 |
| 728 | 3300053139 | Ga0500568_0009038 | Ga0500568_0009038_1626_2276 | 211 |
| 729 | 3300053140 | Ga0500573_0007453 | Ga0500573_0007453_3727_4362 | 211 |
| 730 | 3300053140 | Ga0500573_0154679 | Ga0500573_0154679_525_1160 | 211 |
| 731 | 3300053142 | Ga0500577_0043058 | Ga0500577_0043058_562_1212 | 211 |
| 732 | 3300053142 | Ga0500577_0166048 | Ga0500577_0166048_17_667 | 211 |
| 733 | 3300053151 | Ga0500604_0025099 | Ga0500604_0025099_1051_1701 | 211 |
| 734 | 3300053153 | Ga0500616_0001260 | Ga0500616_0001260_4674_5324 | 211 |
| 735 | 3300053153 | Ga0500616_0066439 | Ga0500616_0066439_517_1167 | 211 |
| 736 | 3300053156 | Ga0500622_0000743 | Ga0500622_0000743_11636_12286 | 211 |
| 737 | 3300053156 | Ga0500622_0023839 | Ga0500622_0023839_1207_1857 | 211 |
| 738 | 3300053158 | Ga0500627_0011075 | Ga0500627_0011075_408_1058 | 211 |
| 739 | 3300053730 | Ga0500645_008090 | Ga0500645_008090_813_1463 | 211 |
| 740 | 3300060353 | Ga0501082_0093128 | Ga0501082_0093128_746_1396 | 211 |
| 741 | iso_pu_bacteria | 2509276021 | 2509391835 | 211 |
| 742 | iso_pu_bacteria | 2509276033 | 2509447309 | 211 |
| 743 | iso_pu_bacteria | 2510065019 | 2510134149 | 211 |
| 744 | iso_pu_bacteria | 2510461076 | 2510895582 | 211 |
| 745 | iso_pu_bacteria | 2510917028 | 2511182507 | 211 |
| 746 | iso_pu_bacteria | 2510917030 | 2511199219 | 211 |
| 747 | iso_pu_bacteria | 2513237084 | 2513567774 | 211 |
| 748 | iso_pu_bacteria | 2513237085 | 2513577144 | 211 |
| 749 | iso_pu_bacteria | 2513237088 | 2513597702 | 211 |
| 750 | iso_pu_bacteria | 2513237093 | 2513633185 | 211 |
| 751 | iso_pu_bacteria | 2513237103 | 2513707811 | 211 |
| 752 | iso_pu_bacteria | 2513237138 | 2513865889 | 211 |
| 753 | iso_pu_bacteria | 2513237144 | 2513908577 | 211 |
| 754 | iso_pu_bacteria | 2513237146 | 2513925214 | 211 |
| 755 | iso_pu_bacteria | 2513237162 | 2514018105 | 211 |
| 756 | iso_pu_bacteria | 2515075009 | 2515113255 | 211 |
| 757 | iso_pu_bacteria | 2515154113 | 2515636796 | 211 |
| 758 | iso_pu_bacteria | 2515154114 | 2515646338 | 211 |
| 759 | iso_pu_bacteria | 2515154116 | 2515655146 | 211 |
| 760 | iso_pu_bacteria | 2515154134 | 2515739677 | 211 |
| 761 | iso_pu_bacteria | 2516653077 | 2517036917 | 211 |
| 762 | iso_pu_bacteria | 2516653085 | 2517077274 | 211 |
| 763 | iso_pu_bacteria | 2517093000 | 2517096032 | 211 |
| 764 | iso_pu_bacteria | 2517287029 | 2517407651 | 211 |
| 765 | iso_pu_bacteria | 2519899620 | 2520377059 | 211 |
| 766 | iso_pu_bacteria | 2529292951 | 2530646604 | 211 |
| 767 | iso_pu_bacteria | 2534681796 | 2535517072 | 211 |
| 768 | iso_pu_bacteria | 2582581298 | 2585223049 | 211 |
| 769 | iso_pu_bacteria | 2582581299 | 2585228487 | 211 |
| 770 | iso_pu_bacteria | 2582581867 | 2585400922 | 211 |
| 771 | iso_pu_bacteria | 2585427526 | 2585524701 | 211 |
| 772 | iso_pu_bacteria | 2585427528 | 2585538389 | 211 |
| 773 | iso_pu_bacteria | 2585427529 | 2585545632 | 211 |
| 774 | iso_pu_bacteria | 2585427590 | 2585822176 | 211 |
| 775 | iso_pu_bacteria | 2585427593 | 2585836342 | 211 |
| 776 | iso_pu_bacteria | 2585427594 | 2585843429 | 211 |
| 777 | iso_pu_bacteria | 2599185170 | 2599417121 | 211 |
| 778 | iso_pu_bacteria | 2615840624 | 2616293167 | 211 |
| 779 | iso_pu_bacteria | 2643221634 | 2644191852 | 211 |
| 780 | iso_pu_bacteria | 2643221643 | 2644242533 | 211 |
| 781 | iso_pu_bacteria | 2718217882 | 2719181990 | 211 |
| 782 | iso_pu_bacteria | 2718217927 | 2719386601 | 211 |
| 783 | iso_pu_bacteria | 2718217997 | 2719666349 | 211 |
| 784 | iso_pu_bacteria | 2718218009 | 2719732707 | 211 |
| 785 | iso_pu_bacteria | 2718218199 | 2720492769 | 211 |
| 786 | iso_pu_bacteria | 2718218232 | 2720614237 | 211 |
| 787 | iso_pu_bacteria | 2718218233 | 2720621005 | 211 |
| 788 | iso_pu_bacteria | 2718218235 | 2720632329 | 211 |
| 789 | iso_pu_bacteria | 2718218269 | 2720776057 | 211 |
| 790 | iso_pu_bacteria | 2718218363 | 2721148081 | 211 |
| 791 | iso_pu_bacteria | 2718218365 | 2721159532 | 211 |
| 792 | iso_pu_bacteria | 2718218366 | 2721164917 | 211 |
| 793 | iso_pu_bacteria | 2718218423 | 2721400305 | 211 |
| 794 | iso_pu_bacteria | 2721755514 | 2722841087 | 211 |
| 795 | iso_pu_bacteria | 2721755556 | 2723027656 | 211 |
| 796 | iso_pu_bacteria | 2721755684 | 2723561284 | 211 |
| 797 | iso_pu_bacteria | 2721755685 | 2723567907 | 211 |
| 798 | iso_pu_bacteria | 2721755809 | 2724039118 | 211 |
| 799 | iso_pu_bacteria | 2721755810 | 2724045463 | 211 |
| 800 | iso_pu_bacteria | 2721755819 | 2724090664 | 211 |
| 801 | iso_pu_bacteria | 2721755822 | 2724105172 | 211 |
| 802 | iso_pu_bacteria | 2721755823 | 2724111000 | 211 |
| 803 | iso_pu_bacteria | 2724679232 | 2725951405 | 211 |
| 804 | iso_pu_bacteria | 2728369352 | 2730108592 | 211 |
| 805 | iso_pu_bacteria | 2728369365 | 2730165225 | 211 |
| 806 | iso_pu_bacteria | 2728369397 | 2730299164 | 211 |
| 807 | iso_pu_bacteria | 2738541293 | 2738800285 | 211 |
| 808 | iso_pu_bacteria | 2738541333 | 2739033030 | 211 |
| 809 | iso_pu_bacteria | 2765235942 | 2766066074 | 211 |
| 810 | iso_pu_bacteria | 2791355256 | 2793294240 | 211 |
| 811 | iso_pu_bacteria | 2791355259 | 2793315897 | 211 |
| 812 | iso_pu_bacteria | 2791355260 | 2793319371 | 211 |
| 813 | iso_pu_bacteria | 2791355261 | 2793328456 | 211 |
| 814 | iso_pu_bacteria | 2791355262 | 2793335416 | 211 |
| 815 | iso_pu_bacteria | 2791355263 | 2793339467 | 211 |
| 816 | iso_pu_bacteria | 2791355264 | 2793347056 | 211 |
| 817 | iso_pu_bacteria | 2791355265 | 2793351648 | 211 |
| 818 | iso_pu_bacteria | 2791355266 | 2793361944 | 211 |
| 819 | iso_pu_bacteria | 2791355267 | 2793367701 | 211 |
| 820 | iso_pu_bacteria | 2802429605 | 2805926879 | 211 |
| 821 | iso_pu_bacteria | 2802429606 | 2805932794 | 211 |
| 822 | iso_pu_bacteria | 2802429633 | 2806045169 | 211 |
| 823 | iso_pu_bacteria | 2802429634 | 2806050036 | 211 |
| 824 | iso_pu_bacteria | 2802429635 | 2806056874 | 211 |
| 825 | iso_pu_bacteria | 2802429636 | 2806064255 | 211 |
| 826 | iso_pu_bacteria | 2802429637 | 2806071523 | 211 |
| 827 | iso_pu_bacteria | 2821123053 | 2821125695 | 211 |
| 828 | iso_pu_bacteria | 2838016132 | 2838021645 | 211 |
| 829 | iso_pu_bacteria | 2838022645 | 2838023659 | 211 |
| 830 | iso_pu_bacteria | 2838035591 | 2838038672 | 211 |
| 831 | iso_pu_bacteria | 2838042994 | 2838045161 | 211 |
| 832 | iso_pu_bacteria | 2838048938 | 2838053360 | 211 |
| 833 | iso_pu_bacteria | 2838061910 | 2838065480 | 211 |
| 834 | iso_pu_bacteria | 2838068647 | 2838069959 | 211 |
| 835 | iso_pu_bacteria | 2838661181 | 2838661406 | 211 |
| 836 | iso_pu_bacteria | 2838668709 | 2838670553 | 211 |
| 837 | iso_pu_bacteria | 2838680041 | 2838683257 | 211 |
| 838 | iso_pu_bacteria | 2838686498 | 2838686853 | 211 |
| 839 | iso_pu_bacteria | 2838694306 | 2838697799 | 211 |
| 840 | iso_pu_bacteria | 2838701080 | 2838702924 | 211 |
| 841 | iso_pu_bacteria | 2838707686 | 2838710914 | 211 |
| 842 | iso_pu_bacteria | 2838729681 | 2838730189 | 211 |
| 843 | iso_pu_bacteria | 2838736955 | 2838737854 | 211 |
| 844 | iso_pu_bacteria | 2838742623 | 2838742796 | 211 |
| 845 | iso_pu_bacteria | 2841840854 | 2841841777 | 211 |
| 846 | iso_pu_bacteria | 2841851746 | 2841852299 | 211 |
| 847 | iso_pu_bacteria | 2841864319 | 2841867150 | 211 |
| 848 | iso_pu_bacteria | 2842077413 | 2842079088 | 211 |
| 849 | iso_pu_bacteria | 2842110456 | 2842113065 | 211 |
| 850 | iso_pu_bacteria | 2842118031 | 2842118402 | 211 |
| 851 | iso_pu_bacteria | 2842140634 | 2842141555 | 211 |
| 852 | iso_pu_bacteria | 2842146304 | 2842147818 | 211 |
| 853 | iso_pu_bacteria | 2842156927 | 2842158243 | 211 |
| 854 | iso_pu_bacteria | 2842163707 | 2842168598 | 211 |
| 855 | iso_pu_bacteria | 2842180545 | 2842181863 | 211 |
| 856 | iso_pu_bacteria | 2842192696 | 2842195866 | 211 |
| 857 | iso_pu_bacteria | 2842198810 | 2842199173 | 211 |
| 858 | iso_pu_bacteria | 2842205361 | 2842209622 | 211 |
| 859 | iso_pu_bacteria | 2842217011 | 2842218142 | 211 |
| 860 | iso_pu_bacteria | 2842229732 | 2842230086 | 211 |
| 861 | iso_pu_bacteria | 2842237096 | 2842240314 | 211 |
| 862 | iso_pu_bacteria | 2842243621 | 2842243975 | 211 |
| 863 | iso_pu_bacteria | 2842250916 | 2842252884 | 211 |
| 864 | iso_pu_bacteria | 2842257432 | 2842257940 | 211 |
| 865 | iso_pu_bacteria | 2842264693 | 2842269476 | 211 |
| 866 | iso_pu_bacteria | 2842271015 | 2842271609 | 211 |
| 867 | iso_pu_bacteria | 2842278818 | 2842283076 | 211 |
| 868 | iso_pu_bacteria | 2842285085 | 2842285412 | 211 |
| 869 | iso_pu_bacteria | 2842291075 | 2842292750 | 211 |
| 870 | iso_pu_bacteria | 2842304105 | 2842305240 | 211 |
| 871 | iso_pu_bacteria | 2842311132 | 2842314030 | 211 |
| 872 | iso_pu_bacteria | 2842317721 | 2842319731 | 211 |
| 873 | iso_pu_bacteria | 2842341865 | 2842347324 | 211 |
| 874 | iso_pu_bacteria | 2842363717 | 2842370232 | 211 |
| 875 | iso_pu_bacteria | 2842370503 | 2842373888 | 211 |
| 876 | iso_pu_bacteria | 2842377471 | 2842379147 | 211 |
| 877 | iso_pu_bacteria | 2842384541 | 2842384912 | 211 |
| 878 | iso_pu_bacteria | 2842395702 | 2842400152 | 211 |
| 879 | iso_pu_bacteria | 2842402390 | 2842402772 | 211 |
| 880 | iso_pu_bacteria | 2842409023 | 2842409857 | 211 |
| 881 | iso_pu_bacteria | 2842415677 | 2842416506 | 211 |
| 882 | iso_pu_bacteria | 2842422224 | 2842423573 | 211 |
| 883 | iso_pu_bacteria | 2842428310 | 2842430522 | 211 |
| 884 | iso_pu_bacteria | 2842434925 | 2842436666 | 211 |
| 885 | iso_pu_bacteria | 2842441272 | 2842443492 | 211 |
| 886 | iso_pu_bacteria | 2842447887 | 2842449362 | 211 |
| 887 | iso_pu_bacteria | 2842462802 | 2842466776 | 211 |
| 888 | iso_pu_bacteria | 2842469257 | 2842471464 | 211 |
| 889 | iso_pu_bacteria | 2842489311 | 2842492261 | 211 |
| 890 | iso_pu_bacteria | 2842495871 | 2842497879 | 211 |
| 891 | iso_pu_bacteria | 2844454524 | 2844458150 | 211 |
| 892 | iso_pu_bacteria | 2857516855 | 2857517224 | 211 |
| 893 | iso_pu_bacteria | 2857531043 | 2857532256 | 211 |
| 894 | iso_pu_bacteria | 2919100787 | 2919106265 | 211 |
| 895 | iso_pu_bacteria | 2919166419 | 2919169472 | 211 |
| 896 | iso_pu_bacteria | 2923556063 | 2923559297 | 211 |
| 897 | iso_pu_bacteria | 2933016740 | 2933020856 | 211 |
| 898 | iso_pu_bacteria | 2933570622 | 2933571047 | 211 |
| 899 | iso_pu_bacteria | 2933586486 | 2933588878 | 211 |
| 900 | iso_pu_bacteria | 2933599457 | 2933600765 | 211 |
| 901 | iso_pu_bacteria | 2935894831 | 2935896816 | 211 |
| 902 | iso_pu_bacteria | 2935901341 | 2935901760 | 211 |
| 903 | iso_pu_bacteria | 2936367885 | 2936371842 | 211 |
| 904 | iso_pu_bacteria | 2936375103 | 2936379676 | 211 |
| 905 | iso_pu_bacteria | 2936381700 | 2936387847 | 211 |
| 906 | iso_pu_bacteria | 2996887358 | 2996892847 | 211 |
| 907 | iso_pu_bacteria | 2996893221 | 2996894948 | 211 |
| 908 | iso_pu_bacteria | 3005409236 | 3005414373 | 211 |
| 909 | iso_pu_bacteria | 3005445848 | 3005448644 | 211 |
| 910 | iso_pu_bacteria | 639633055 | 639649372 | 211 |
| 911 | iso_pu_bacteria | 8005258706 | 8005259386 | 211 |
| 912 | iso_pu_bacteria | 8005275841 | 8005281407 | 211 |
| 913 | iso_pu_bacteria | 8005282627 | 8005284624 | 211 |
| 914 | iso_pu_bacteria | 8005289223 | 8005295709 | 211 |
| 915 | iso_pu_bacteria | 8005301065 | 8005303322 | 211 |
| 916 | iso_pu_bacteria | 8005307578 | 8005309587 | 211 |
| 917 | iso_pu_bacteria | 8005321885 | 8005327374 | 211 |
| 918 | iso_pu_bacteria | 8005376324 | 8005381126 | 211 |
| 919 | iso_pu_bacteria | 8005382845 | 8005388924 | 211 |
| 920 | iso_pu_bacteria | 8005395548 | 8005395906 | 211 |
| 921 | iso_pu_bacteria | 8005430974 | 8005437475 | 211 |
| 922 | iso_pu_bacteria | 8005460587 | 8005463938 | 211 |
| 923 | iso_pu_bacteria | 8005497431 | 8005501088 | 211 |
| 924 | iso_pu_bacteria | 8005542996 | 8005545886 | 211 |
| 925 | iso_pu_bacteria | 8005556819 | 8005556825 | 211 |
| 926 | iso_pu_bacteria | 8005563573 | 8005568193 | 211 |
| 927 | iso_pu_bacteria | 8005570704 | 8005573268 | 211 |
| 928 | iso_pu_bacteria | 8005619151 | 8005622455 | 211 |
| 929 | iso_pu_bacteria | 8005626139 | 8005629956 | 211 |
| 930 | iso_pu_bacteria | 8005668836 | 8005672505 | 211 |
| 931 | iso_pu_bacteria | 8005688590 | 8005691906 | 211 |
| 932 | iso_pu_bacteria | 8005695170 | 8005697603 | 211 |
| 933 | iso_pu_bacteria | 8018127388 | 8018128009 | 211 |
| 934 | iso_pu_bacteria | 8018163183 | 8018164376 | 211 |
| 935 | iso_pu_bacteria | 8018176218 | 8018176859 | 211 |
| 936 | iso_pu_bacteria | 8023680758 | 8023682973 | 211 |
| 937 | iso_pu_bacteria | 8024479707 | 8024482667 | 211 |
| 938 | iso_pu_bacteria | 8024501048 | 8024504628 | 211 |
| 939 | iso_pu_bacteria | 8056375014 | 8056378334 | 211 |
| 940 | iso_pu_bacteria | 8056382006 | 8056384225 | 211 |
| 941 | iso_pu_bacteria | 8057874678 | 8057878515 | 211 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ktg-assembly2.cif.gz_B | crystal structure of a c. elegans ap4a hydrolase binary complex | 0.867 | 52 | 162 |
| 2pig-assembly1.cif.gz_A | crystal structure of ydck from salmonella cholerae at 2.38 a resolution. northeast structural genomics target scr6 | 0.8486 | 170 | 187 |
| 5cfi-assembly4.cif.gz_D | structural and functional attributes of malaria parasite ap4a hydrolase | 0.8365 | 49 | 159 |
| 5cfi-assembly3.cif.gz_C | structural and functional attributes of malaria parasite ap4a hydrolase | 0.8291 | 51 | 159 |
| 5t3p-assembly1.cif.gz_A | crystal structure of human peroxisomal coenzyme a diphosphatase nudt7 | 0.8159 | 10 | 206 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P43337_8_187_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9559 | 47 | 207 | 3.90.79.10 |
| af_A0A1D8PU14_38_158_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8987 | 53 | 152 | 3.90.79.10 |
| af_Q9VY79_60_241_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8828 | 46 | 207 | 3.90.79.10 |
| af_Q8LET2_2_201_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8811 | 50 | 206 | 3.90.79.10 |
| af_Q92350_85_273_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8589 | 46 | 207 | 3.90.79.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-B5ZY77-F1-model_v4 | deleted | 0.9972 | 1 | 211 |
|
| AF-A0A0Q6FB61-F1-model_v4 | DNA mismatch repair protein MutT | 0.9956 | 5 | 211 |
GO:0010945
|
| AF-B5ZY77-F1-model_v4 | deleted | 0.9925 | 1 | 211 |
|
| AF-A0A7W6P2D5-F1-model_v4 | 8-oxo-dGTP pyrophosphatase MutT (NUDIX family) | 0.9908 | 1 | 211 |
GO:0010945
|
| AF-A0A537RS48-F1-model_v4 | CoA pyrophosphatase | 0.9886 | 47 | 207 |
GO:0010945
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar