F486261

General Info

Members Datasets Scaffolds Average Seq Length
938 346 857 299

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0115166|Ga0495606_0115166_414_1397
Length 327
Sequence MPRILPHPRAFLNEGFPQPAFVPAEGTLKAPMRFDLVDLQLFLHVVEAGSITGGATRAYLSLASASERIHGMEDSLGVPLLLRARRGVTPTPAGEALVRHARLVFQQLQRMRAELGEHAQGLKGTVRLLCNTAALSEYLPDALAGFLARHPNVDVALEERTSHEVAKAVREGAADVGILSDAVDLSQLERFPFRPDRLVAVATPELAQLLAPAGGPVDFVRLLAFDHVGLAGDSALFNYLELQARRLGRSLHARVRVRGFDAICRMVEAGVGIGIVPEPAARRCAQTMGIAAMEVADGWALRQLSICVRSFDALPKHAQQLVDALRA

Samples

Sample ID Description Type Environment
1 2511231024 Pseudomonas sp. GM84 Isolate Nodule
2 2519103095 Burkholderia sp. KJ006 Isolate Nodule
3 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
4 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
5 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
6 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
7 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
8 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
9 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
10 2643221556 Massilia sp. Root1485 Isolate Unclassified
11 2643221609 Acidovorax sp. Root217 Isolate Unclassified
12 2643221611 Acidovorax sp. Root219 Isolate Unclassified
13 2643221684 Massilia sp. Root133 Isolate Unclassified
14 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
15 2738541297 Duganella sp. GV083 Isolate Unclassified
16 2738541357 Duganella sp. GV053 Isolate Unclassified
17 2738543003 Duganella sp. GV066 Isolate Unclassified
18 2738543012 Acidovorax sp. CF301 Isolate Unclassified
19 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
20 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
21 2738543026 Duganella sp. GV089 Isolate Unclassified
22 2738543029 Duganella sp. GV039 Isolate Unclassified
23 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
24 2765235841 Pseudomonas putida AA7 Isolate Unclassified
25 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
26 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
27 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
28 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
29 2816332133 Acidovorax radicis 2721A Isolate Unclassified
30 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
31 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
32 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
33 2818991452 Burkholderia cepacia 561 Isolate Unclassified
34 2821131069 Duganella sp. 1224 Isolate Unclassified
35 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
36 2842711865 Duganella sp. R-73148 Isolate Unclassified
37 2842733646 Variovorax sp. R-72446 Isolate Unclassified
38 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
39 2857553236 Duganella sp. R-74557 Isolate Unclassified
40 2857558681 Duganella sp. R-74565 Isolate Unclassified
41 2857564685 Duganella sp. R-74599 Isolate Unclassified
42 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
43 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
44 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
45 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
46 2904424332 Duganella sp. 1411 Isolate Rhizosphere
47 2904564687 Burkholderia sp. 571 Isolate Unclassified
48 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
49 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
50 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
51 2919476304 Duganella sp. 3397 Isolate Unclassified
52 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
53 2928163908 Burkholderia sp. 567 Isolate Unclassified
54 2928170801 Burkholderia sp. 572 Isolate Unclassified
55 2928536128 Burkholderia sola 565 Isolate Unclassified
56 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
57 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
58 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
59 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
60 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
61 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
62 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
63 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
64 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
65 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
66 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
67 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
68 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
69 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
70 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
71 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
72 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
73 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
74 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
75 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
76 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
77 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
78 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
79 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
80 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
81 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
82 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
83 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
84 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
85 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
86 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
87 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
88 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
89 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
90 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
91 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
92 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
93 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
97 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
98 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
99 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
100 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
101 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
102 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
103 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
104 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
120 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
121 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
122 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
131 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
132 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
133 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
142 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
163 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
165 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
166 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
167 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
168 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
169 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
170 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
171 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
172 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
182 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
183 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
184 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
185 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
186 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
187 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
188 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
189 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
190 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
191 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
192 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
193 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
194 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
195 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
196 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
197 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
198 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
199 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
200 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
201 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
202 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
203 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
204 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
205 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
206 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
207 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
208 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
209 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
210 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
211 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
212 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
219 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
220 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
221 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
222 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
223 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
224 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
225 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
226 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
227 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
228 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
229 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
230 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
231 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
232 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
233 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
234 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
235 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
236 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
237 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
238 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
239 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
240 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
241 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
242 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
243 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
244 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
245 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
246 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
247 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
248 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
249 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
250 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
251 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
252 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
253 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
254 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
255 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
256 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
257 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
258 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
259 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
260 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
261 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
262 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
263 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
264 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
265 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
266 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
267 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
268 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
269 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
270 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
271 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
272 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
273 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
274 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
275 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
276 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
277 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
278 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
279 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
280 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
281 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
282 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
283 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
284 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
285 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
286 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
287 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
288 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
289 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
290 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
291 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
292 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
293 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
294 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
295 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
296 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
297 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
298 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
299 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
300 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
301 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
302 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
303 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
304 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
305 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
306 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
307 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
308 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
309 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
310 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
311 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
312 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
313 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
314 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
315 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
318 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
320 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
321 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
322 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
323 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
324 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
325 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
326 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
327 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
328 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
329 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
330 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
331 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
332 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
333 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
334 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
335 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
336 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
337 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
338 8052494512 Pseudomonas putida LD6 Isolate Unclassified
339 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
340 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
341 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
342 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
343 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
344 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
345 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
346 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.36
Metatranscriptomes 0
Isolates 8.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.57
Nodule 0.75
Rhizoplane 4.26
Rhizosphere 73.88
Stem 0
Stem Tuber 0
Unclassified 13.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10004445 3300001989 Bacteria 5371
2 JGI24739J22299_10016364 3300001989 Bacteria 2684
3 JGI24739J22299_10022427 3300001989 Bacteria 2240
4 JGI25150J39212_1012329 3300002774 Bacteria 1517
5 rootL2_10032663 3300003322 Bacteria 4336
6 rootL2_10034981 3300003322 Bacteria 2683
7 rootL2_10066887 3300003322 Bacteria 1927
8 rootL2_10207153 3300003322 Bacteria 1006
9 rootL2_10332452 3300003322 Bacteria 3612
10 rootH1_10137222 3300003323 Bacteria 3466
11 Ga0055532_1000682 3300003758 Bacteria 12805
12 Ga0055532_1000754 3300003758 Bacteria 11614
13 Ga0055532_1001348 3300003758 Bacteria 7017
14 Ga0055525_1000009 3300003759 Bacteria 596899
15 Ga0055527_1000578 3300003760 Bacteria 11977
16 Ga0055527_1000930 3300003760 Bacteria 7225
17 Ga0055535_1001502 3300003761 Bacteria 11614
18 Ga0055535_1001505 3300003761 Bacteria 11588
19 Ga0055542_1001468 3300003762 Bacteria 11603
20 Ga0055542_1004495 3300003762 Bacteria 3374
21 Ga0055529_1000181 3300003763 Bacteria 86692
22 Ga0055529_1000392 3300003763 Bacteria 46822
23 Ga0055529_1001827 3300003763 Bacteria 5061
24 Ga0055526_1000074 3300003771 Bacteria 92854
25 Ga0055526_1000092 3300003771 Bacteria 82076
26 Ga0055526_1000729 3300003771 Bacteria 24835
27 Ga0055537_1000078 3300003773 Bacteria 70140
28 Ga0055524_1000053 3300003775 Bacteria 144892
29 Ga0055524_1005701 3300003775 Bacteria 5519
30 Ga0055534_1000070 3300003784 Bacteria 80000
31 Ga0055534_1000105 3300003784 Bacteria 64494
32 Ga0055528_1000224 3300003790 Bacteria 47488
33 Ga0055528_1001957 3300003790 Bacteria 11644
34 Ga0055541_1009217 3300003841 Bacteria 1537
35 Ga0065165_1000677 3300005262 Bacteria 49085
36 Ga0065165_1033071 3300005262 Bacteria 1613
37 Ga0065704_10072806 3300005289 Bacteria 7981
38 Ga0065704_10075896 3300005289 Bacteria 5364
39 Ga0070658_10040332 3300005327 Bacteria 3766
40 Ga0070670_100001744 3300005331 Bacteria 17710
41 Ga0070666_10182737 3300005335 Bacteria 1471
42 Ga0070660_100000013 3300005339 Bacteria 116814
43 Ga0070660_100161357 3300005339 Bacteria 1806
44 Ga0070671_100209294 3300005355 Bacteria 1654
45 Ga0070659_100000028 3300005366 Bacteria 140665
46 Ga0070667_100034706 3300005367 Bacteria 4222
47 Ga0070667_100321030 3300005367 Bacteria 1397
48 Ga0070663_100040363 3300005455 Bacteria 3267
49 Ga0070678_100023362 3300005456 Bacteria 4119
50 Ga0068853_100126047 3300005539 Bacteria 2287
51 Ga0070672_100463714 3300005543 Bacteria 1092
52 Ga0068855_100057985 3300005563 Bacteria 4537
53 Ga0068855_100203278 3300005563 Bacteria 2229
54 Ga0070664_100062125 3300005564 Bacteria 3184
55 Ga0068852_100067926 3300005616 Bacteria 3118
56 Ga0068852_100621619 3300005616 Bacteria 1086
57 Ga0068858_100059624 3300005842 Bacteria 3527
58 Ga0068860_100173343 3300005843 Bacteria 2084
59 Ga0075364_10013194 3300006051 Bacteria 5072
60 Ga0075362_10085390 3300006177 Bacteria 1459
61 Ga0075369_10078426 3300006186 Bacteria 1462
62 Ga0099823_1000188 3300006944 Bacteria 34181
63 Ga0079104_1003296 3300006946 Bacteria 7681
64 Ga0099826_10000006 3300006948 Bacteria 432260
65 Ga0105251_10000623 3300009011 Bacteria 32586
66 Ga0105251_10001933 3300009011 Bacteria 16960
67 Ga0105251_10007562 3300009011 Bacteria 6671
68 Ga0105251_10026669 3300009011 Bacteria 2940
69 Ga0105251_10048315 3300009011 Bacteria 2040
70 Ga0105244_10001306 3300009036 Bacteria 20398
71 Ga0105244_10001737 3300009036 Bacteria 17153
72 Ga0105244_10002830 3300009036 Bacteria 12874
73 Ga0105244_10004135 3300009036 Bacteria 10107
74 Ga0105244_10007475 3300009036 Bacteria 6940
75 Ga0105244_10022995 3300009036 Bacteria 3425
76 Ga0105244_10046885 3300009036 Bacteria 2218
77 Ga0105244_10065908 3300009036 Bacteria 1814
78 Ga0105250_10000222 3300009092 Bacteria 47479
79 Ga0105250_10042939 3300009092 Bacteria 1812
80 Ga0105250_10108438 3300009092 Bacteria 1136
81 Ga0105240_10000393 3300009093 Bacteria 81664
82 Ga0105243_10007339 3300009148 Bacteria 8474
83 Ga0105243_10041517 3300009148 Bacteria 3598
84 Ga0105241_10004855 3300009174 Bacteria 9915
85 Ga0105242_10028696 3300009176 Bacteria 4432
86 Ga0105237_10005816 3300009545 Bacteria 13833
87 Ga0105237_10311635 3300009545 Bacteria 1577
88 Ga0105238_10018213 3300009551 Bacteria 7143
89 Ga0105238_10486992 3300009551 Bacteria 1233
90 Ga0105239_10003889 3300010375 Bacteria 18095
91 Ga0157373_10008160 3300013100 Bacteria 7785
92 Ga0157373_10122558 3300013100 Bacteria 1827
93 Ga0157370_10124572 3300013104 Bacteria 2406
94 Ga0157369_10027361 3300013105 Bacteria 6321
95 Ga0157369_10346696 3300013105 Bacteria 1543
96 Ga0163162_10044544 3300013306 Bacteria 4444
97 Ga0157372_10475911 3300013307 Bacteria 1456
98 Ga0157375_10217409 3300013308 Bacteria 2069
99 Ga0157375_10514023 3300013308 Bacteria 1361
100 Ga0182008_10002217 3300014497 Bacteria 12310
101 Ga0182008_10028309 3300014497 Bacteria 2834
102 Ga0182006_1000026 3300015261 Bacteria 253543
103 Ga0182006_1000511 3300015261 Bacteria 29588
104 Ga0182006_1004027 3300015261 Bacteria 7334
105 Ga0182006_1041261 3300015261 Bacteria 1813
106 Ga0182007_10000037 3300015262 Bacteria 123677
107 Ga0182007_10000918 3300015262 Bacteria 16302
108 Ga0182007_10002310 3300015262 Bacteria 9578
109 Ga0182007_10003199 3300015262 Bacteria 7815
110 Ga0182007_10044032 3300015262 Bacteria 1482
111 Ga0182005_1000007 3300015265 Bacteria 490994
112 Ga0182005_1000021 3300015265 Bacteria 272185
113 Ga0182005_1010923 3300015265 Bacteria 2602
114 Ga0183362_10001 3300015683 Bacteria 2046624
115 Ga0163161_10031248 3300017792 Bacteria 3793
116 Ga0163161_10044365 3300017792 Bacteria 3202
117 Ga0163161_10062850 3300017792 Bacteria 2705
118 Ga0163161_10065978 3300017792 Bacteria 2642
119 Ga0209566_100293 3300025225 Bacteria 45453
120 Ga0209674_101016 3300025226 Bacteria 8597
121 Ga0209672_100067 3300025228 Bacteria 180819
122 Ga0209672_100079 3300025228 Bacteria 156875
123 Ga0209147_100012 3300025229 Bacteria 681990
124 Ga0209147_100061 3300025229 Bacteria 248809
125 Ga0209147_100107 3300025229 Bacteria 156875
126 Ga0209563_100015 3300025230 Bacteria 879901
127 Ga0209258_100030 3300025242 Bacteria 470208
128 Ga0209258_100340 3300025242 Bacteria 69044
129 Ga0207425_1000192 3300025245 Bacteria 49765
130 Ga0209646_1000010 3300025246 Bacteria 573803
131 Ga0209026_1004971 3300025250 Bacteria 3730
132 Ga0209148_1000022 3300025254 Bacteria 681990
133 Ga0209148_1000439 3300025254 Bacteria 45709
134 Ga0209148_1000957 3300025254 Bacteria 18874
135 Ga0209565_1000035 3300025263 Bacteria 298125
136 Ga0209565_1004074 3300025263 Bacteria 4553
137 Ga0209565_1008777 3300025263 Bacteria 2617
138 Ga0209455_1000024 3300025272 Bacteria 676133
139 Ga0209455_1000037 3300025272 Bacteria 464097
140 Ga0209455_1000243 3300025272 Bacteria 67283
141 Ga0209673_1000006 3300025273 Bacteria 650600
142 Ga0209673_1000021 3300025273 Bacteria 422978
143 Ga0209675_1000005 3300025291 Bacteria 849192
144 Ga0209676_1000805 3300025292 Bacteria 41142
145 Ga0209025_1009132 3300025294 Bacteria 6972
146 Ga0209564_1000009 3300025295 Bacteria 950196
147 Ga0209564_1000033 3300025295 Bacteria 446200
148 Ga0209564_1000083 3300025295 Bacteria 259272
149 Ga0209564_1022670 3300025295 Bacteria 2209
150 Ga0209758_1000227 3300025297 Bacteria 120073
151 Ga0209256_1000035 3300025299 Bacteria 386754
152 Ga0209256_1000322 3300025299 Bacteria 82681
153 Ga0207696_1000022 3300025711 Bacteria 427529
154 Ga0207696_1000265 3300025711 Bacteria 66603
155 Ga0207696_1026989 3300025711 Bacteria 1774
156 Ga0207696_1054074 3300025711 Bacteria 1142
157 Ga0207655_1000162 3300025728 Bacteria 122768
158 Ga0207655_1000383 3300025728 Bacteria 61839
159 Ga0207655_1002794 3300025728 Bacteria 13559
160 Ga0207655_1003043 3300025728 Bacteria 12801
161 Ga0207655_1040598 3300025728 Bacteria 2005
162 Ga0207713_1000238 3300025735 Bacteria 73507
163 Ga0207713_1000481 3300025735 Bacteria 41406
164 Ga0207713_1003042 3300025735 Bacteria 11684
165 Ga0207713_1003804 3300025735 Bacteria 10108
166 Ga0207713_1072423 3300025735 Bacteria 1268
167 Ga0207647_10005613 3300025904 Bacteria 9165
168 Ga0207705_10003154 3300025909 Bacteria 12544
169 Ga0207695_10000255 3300025913 Bacteria 136470
170 Ga0207671_10037053 3300025914 Bacteria 3616
171 Ga0207657_10000017 3300025919 Bacteria 173373
172 Ga0207649_10210127 3300025920 Bacteria 1380
173 Ga0207694_10045738 3300025924 Bacteria 3381
174 Ga0207694_10302920 3300025924 Bacteria 1316
175 Ga0207694_10322750 3300025924 Bacteria 1274
176 Ga0207650_10000276 3300025925 Bacteria 53717
177 Ga0207690_10000009 3300025932 Bacteria 366044
178 Ga0207690_10027008 3300025932 Bacteria 3623
179 Ga0207686_10027759 3300025934 Bacteria 3318
180 Ga0207709_10013448 3300025935 Bacteria 4516
181 Ga0207709_10063090 3300025935 Bacteria 2322
182 Ga0207691_10084306 3300025940 Bacteria 2853
183 Ga0207691_10458002 3300025940 Bacteria 1085
184 Ga0207658_10013681 3300025986 Bacteria 5549
185 Ga0207658_10222442 3300025986 Bacteria 1589
186 Ga0207703_10052595 3300026035 Bacteria 3308
187 Ga0207678_10011303 3300026067 Bacteria 7836
188 Ga0207674_10107181 3300026116 Bacteria 2771
189 Ga0209389_1000002 3300027296 Bacteria 333932
190 Ga0209371_1000128 3300027312 Bacteria 124861
191 Ga0209371_1000409 3300027312 Bacteria 44442
192 Ga0209282_1000003 3300027666 Bacteria 856377
193 Ga0307515_10003602 3300028794 Bacteria 32529
194 Ga0265324_10037821 3300029957 Bacteria 1676
195 Ga0268256_1000152 3300030500 Bacteria 92565
196 Ga0268256_1000350 3300030500 Bacteria 44442
197 Ga0307512_10098188 3300030522 Bacteria 2000
198 Ga0265327_10000777 3300031251 Bacteria 49259
199 Ga0307513_10014794 3300031456 Bacteria 9490
200 Ga0307514_10000408 3300031649 Bacteria 95961
201 Ga0307518_10030063 3300031838 Bacteria 3933
202 Ga0307414_10051354 3300032004 Bacteria 2862
203 Ga0373939_0048876 3300035114 Bacteria 1305
204 Ga0395899_0003015 3300037312 Bacteria 13443
205 Ga0395899_0011765 3300037312 Bacteria 6697
206 Ga0395899_0125179 3300037312 Bacteria 1838
207 Ga0395899_0141345 3300037312 Bacteria 1712
208 Ga0395899_0153461 3300037312 Bacteria 1631
209 Ga0395900_0004698 3300037418 Bacteria 14397
210 Ga0395900_0054726 3300037418 Bacteria 4108
211 Ga0395900_0056356 3300037418 Bacteria 4045
212 Ga0395900_0057570 3300037418 Bacteria 4001
213 Ga0395900_0116179 3300037418 Bacteria 2745
214 Ga0395900_0321488 3300037418 Bacteria 1527
215 Ga0395900_0513843 3300037418 Bacteria 1147
216 Ga0395898_0200862 3300037466 Bacteria 1903
217 Ga0395905_0000666 3300037471 Bacteria 45623
218 Ga0395905_0125394 3300037471 Bacteria 2414
219 Ga0395905_0358154 3300037471 Bacteria 1351
220 Ga0395901_0000084 3300038443 Bacteria 127737
221 Ga0395901_0182133 3300038443 Bacteria 2203
222 Ga0395901_0182267 3300038443 Bacteria 2202
223 Ga0436365_1246322 3300039437 Bacteria 2313
224 Ga0439436_0001618 3300041404 Bacteria 6553
225 Ga0439439_0016478 3300041406 Bacteria 1810
226 Ga0439447_007586 3300041407 Bacteria 3425
227 Ga0439461_0005413 3300041410 Bacteria 2173
228 Ga0439466_0018680 3300041411 Bacteria 2486
229 Ga0439433_0010314 3300041999 Bacteria 2039
230 Ga0439448_0002114 3300042005 Bacteria 5347
231 Ga0439432_002855 3300042006 Bacteria 6441
232 Ga0439432_006062 3300042006 Bacteria 4336
233 Ga0439449_0010235 3300042007 Bacteria 3542
234 Ga0439449_0033170 3300042007 Bacteria 1924
235 Ga0439450_037288 3300042008 Bacteria 1116
236 Ga0439452_009145 3300042010 Bacteria 2935
237 Ga0439455_0007580 3300042012 Bacteria 2299
238 Ga0439456_000013 3300042013 Bacteria 72544
239 Ga0439463_000115 3300042016 Bacteria 19848
240 Ga0450911_000128 3300042115 Bacteria 30127
241 Ga0450923_000481 3300042125 Bacteria 4380
242 Ga0450902_003715 3300042137 Bacteria 2246
243 Ga0450905_000328 3300042142 Bacteria 5690
244 Ga0450905_000588 3300042142 Bacteria 4499
245 Ga0450907_014675 3300042146 Bacteria 1308
246 Ga0439446_0019725 3300042156 Bacteria 1896
247 Ga0439458_0004763 3300042157 Bacteria 3085
248 Ga0450908_014599 3300042184 Bacteria 1410
249 Ga0439434_0027885 3300042435 Bacteria 1709
250 Ga0450901_000315 3300042533 Bacteria 5923
251 Ga0466972_0057135 3300044658 Bacteria 1874
252 Ga0466972_0184859 3300044658 Bacteria 977
253 Ga0466965_0006059 3300044683 Bacteria 5465
254 Ga0466965_0009849 3300044683 Bacteria 4443
255 Ga0466965_0018929 3300044683 Bacteria 3304
256 Ga0466965_0050036 3300044683 Bacteria 2071
257 Ga0466965_0204187 3300044683 Bacteria 1049
258 Ga0466966_0002542 3300044684 Bacteria 11953
259 Ga0466966_0049221 3300044684 Bacteria 2684
260 Ga0466966_0184921 3300044684 Bacteria 1263
261 Ga0466961_0060004 3300044693 Bacteria 2418
262 Ga0466961_0074359 3300044693 Bacteria 2154
263 Ga0466961_0128358 3300044693 Bacteria 1589
264 Ga0466963_0023995 3300044694 Bacteria 3879
265 Ga0466964_0000831 3300044706 Bacteria 10096
266 Ga0466964_0001625 3300044706 Bacteria 7761
267 Ga0466964_0029511 3300044706 Bacteria 2166
268 Ga0466964_0045087 3300044706 Bacteria 1793
269 Ga0466964_0136943 3300044706 Bacteria 1121
270 Ga0466968_0005562 3300044735 Bacteria 4720
271 Ga0466970_0015384 3300044765 Bacteria 3933
272 Ga0466970_0071724 3300044765 Bacteria 1863
273 Ga0466970_0108495 3300044765 Bacteria 1515
274 Ga0466970_0119307 3300044765 Bacteria 1444
275 Ga0466957_0009190 3300044842 Bacteria 5638
276 Ga0466957_0020696 3300044842 Bacteria 3872
277 Ga0466957_0089845 3300044842 Bacteria 1923
278 Ga0466960_0032635 3300044901 Unclassified 2413
279 Ga0466959_0013616 3300045049 Bacteria 5898
280 Ga0466959_0040982 3300045049 Bacteria 3420
281 Ga0466959_0099079 3300045049 Bacteria 2087
282 Ga0466958_0130257 3300045836 Bacteria 1579
283 Ga0466958_0233552 3300045836 Bacteria 1174
284 Ga0466967_0108414 3300045976 Bacteria 2548
285 Ga0466967_0152776 3300045976 Bacteria 2159
286 Ga0495617_000002 3300046452 Bacteria 710121
287 Ga0495617_000037 3300046452 Bacteria 134553
288 Ga0495617_007530 3300046452 Bacteria 3776
289 Ga0495627_000007 3300046453 Bacteria 575915
290 Ga0495627_000373 3300046453 Bacteria 41470
291 Ga0495627_002596 3300046453 Bacteria 8532
292 Ga0495627_023921 3300046453 Bacteria 1996
293 Ga0495627_046028 3300046453 Bacteria 1327
294 Ga0495603_0003904 3300046455 Bacteria 8879
295 Ga0495603_0033289 3300046455 Bacteria 3101
296 Ga0495590_0031597 3300046457 Bacteria 1853
297 Ga0495590_0104002 3300046457 Bacteria 1010
298 Ga0495591_000640 3300046458 Bacteria 25873
299 Ga0495591_000907 3300046458 Bacteria 20617
300 Ga0495591_001426 3300046458 Bacteria 14882
301 Ga0495591_002894 3300046458 Bacteria 9209
302 Ga0495591_004334 3300046458 Bacteria 6988
303 Ga0495638_0000184 3300046460 Bacteria 95341
304 Ga0495638_0073465 3300046460 Bacteria 2087
305 Ga0495638_0116509 3300046460 Bacteria 1582
306 Ga0495653_0000002 3300046463 Bacteria 507262
307 Ga0495650_0000166 3300046471 Bacteria 146047
308 Ga0495650_0000442 3300046471 Bacteria 66640
309 Ga0495650_0001380 3300046471 Bacteria 23944
310 Ga0495650_0003807 3300046471 Bacteria 10736
311 Ga0495650_0005435 3300046471 Bacteria 8275
312 Ga0495650_0006785 3300046471 Bacteria 7067
313 Ga0495650_0026847 3300046471 Bacteria 2670
314 Ga0495650_0027956 3300046471 Bacteria 2597
315 Ga0495650_0051431 3300046471 Bacteria 1697
316 Ga0495605_0000087 3300046474 Bacteria 120256
317 Ga0495605_0000367 3300046474 Bacteria 42879
318 Ga0495605_0000890 3300046474 Bacteria 20558
319 Ga0495605_0002562 3300046474 Bacteria 11177
320 Ga0495605_0002755 3300046474 Bacteria 10731
321 Ga0495605_0009952 3300046474 Bacteria 5328
322 Ga0495605_0015662 3300046474 Bacteria 4120
323 Ga0495605_0016867 3300046474 Bacteria 3945
324 Ga0495605_0019249 3300046474 Bacteria 3651
325 Ga0495605_0021524 3300046474 Bacteria 3414
326 Ga0495605_0055290 3300046474 Bacteria 1918
327 Ga0495639_0008939 3300046475 Bacteria 4292
328 Ga0495639_0054578 3300046475 Bacteria 1821
329 Ga0495584_0000813 3300046491 Bacteria 20549
330 Ga0495584_0003990 3300046491 Bacteria 7963
331 Ga0495584_0006470 3300046491 Bacteria 6128
332 Ga0495584_0008070 3300046491 Bacteria 5472
333 Ga0495584_0009304 3300046491 Bacteria 5062
334 Ga0495584_0025716 3300046491 Bacteria 2984
335 Ga0495584_0069803 3300046491 Bacteria 1765
336 Ga0495585_0002212 3300046492 Bacteria 14101
337 Ga0495585_0007671 3300046492 Bacteria 6581
338 Ga0495585_0009643 3300046492 Bacteria 5781
339 Ga0495585_0012937 3300046492 Bacteria 4903
340 Ga0495585_0013686 3300046492 Bacteria 4742
341 Ga0495585_0023082 3300046492 Bacteria 3570
342 Ga0495585_0042498 3300046492 Bacteria 2545
343 Ga0495585_0084259 3300046492 Bacteria 1719
344 Ga0495594_0033420 3300046499 Bacteria 2796
345 Ga0495594_0079676 3300046499 Bacteria 1828
346 Ga0495594_0123118 3300046499 Bacteria 1466
347 Ga0495596_0003236 3300046500 Bacteria 8337
348 Ga0495596_0009635 3300046500 Bacteria 4244
349 Ga0495596_0009703 3300046500 Bacteria 4225
350 Ga0495596_0011050 3300046500 Bacteria 3908
351 Ga0495596_0018395 3300046500 Bacteria 2880
352 Ga0495596_0022437 3300046500 Bacteria 2570
353 Ga0495596_0023437 3300046500 Bacteria 2504
354 Ga0495596_0044175 3300046500 Bacteria 1754
355 Ga0495607_0000424 3300046501 Bacteria 42978
356 Ga0495607_0001898 3300046501 Bacteria 17719
357 Ga0495607_0006062 3300046501 Bacteria 8561
358 Ga0495607_0006478 3300046501 Bacteria 8235
359 Ga0495607_0008162 3300046501 Bacteria 7177
360 Ga0495607_0011677 3300046501 Bacteria 5833
361 Ga0495607_0013881 3300046501 Bacteria 5264
362 Ga0495607_0014028 3300046501 Bacteria 5231
363 Ga0495607_0014483 3300046501 Bacteria 5127
364 Ga0495607_0018956 3300046501 Bacteria 4375
365 Ga0495607_0025339 3300046501 Bacteria 3690
366 Ga0495607_0047224 3300046501 Bacteria 2524
367 Ga0495607_0080931 3300046501 Bacteria 1784
368 Ga0495583_0000119 3300046506 Bacteria 133447
369 Ga0495583_0001037 3300046506 Bacteria 31392
370 Ga0495583_0001346 3300046506 Bacteria 25457
371 Ga0495583_0001911 3300046506 Bacteria 19262
372 Ga0495583_0004301 3300046506 Bacteria 10295
373 Ga0495583_0004613 3300046506 Bacteria 9744
374 Ga0495583_0005862 3300046506 Bacteria 8188
375 Ga0495583_0006437 3300046506 Bacteria 7680
376 Ga0495583_0007028 3300046506 Bacteria 7198
377 Ga0495583_0010347 3300046506 Bacteria 5446
378 Ga0495583_0016846 3300046506 Bacteria 3906
379 Ga0495583_0030615 3300046506 Bacteria 2618
380 Ga0495583_0037187 3300046506 Bacteria 2309
381 Ga0495583_0053960 3300046506 Bacteria 1822
382 Ga0495606_0000064 3300046507 Bacteria 183631
383 Ga0495606_0000156 3300046507 Bacteria 118821
384 Ga0495606_0000500 3300046507 Bacteria 63908
385 Ga0495606_0000924 3300046507 Bacteria 43266
386 Ga0495606_0001158 3300046507 Bacteria 37308
387 Ga0495606_0001576 3300046507 Bacteria 29890
388 Ga0495606_0001948 3300046507 Bacteria 25504
389 Ga0495606_0005955 3300046507 Bacteria 11442
390 Ga0495606_0043260 3300046507 Bacteria 3005
391 Ga0495606_0062724 3300046507 Bacteria 2371
392 Ga0495606_0115166 3300046507 Bacteria 1616
393 Ga0495606_0171348 3300046507 Bacteria 1259
394 Ga0495610_0000003 3300046512 Bacteria 1203910
395 Ga0495610_0000798 3300046512 Bacteria 29546
396 Ga0495610_0003717 3300046512 Bacteria 11679
397 Ga0495610_0008898 3300046512 Bacteria 6428
398 Ga0495610_0014886 3300046512 Bacteria 4548
399 Ga0495610_0017344 3300046512 Bacteria 4108
400 Ga0495610_0020972 3300046512 Bacteria 3606
401 Ga0495610_0034419 3300046512 Bacteria 2609
402 Ga0495610_0037766 3300046512 Bacteria 2455
403 Ga0495610_0045222 3300046512 Bacteria 2179
404 Ga0495610_0124398 3300046512 Bacteria 1126
405 Ga0495616_0005612 3300046513 Bacteria 7678
406 Ga0495616_0009688 3300046513 Bacteria 5616
407 Ga0495616_0011654 3300046513 Bacteria 5029
408 Ga0495616_0015292 3300046513 Bacteria 4268
409 Ga0495616_0034391 3300046513 Bacteria 2632
410 Ga0495616_0038572 3300046513 Bacteria 2452
411 Ga0495616_0042851 3300046513 Bacteria 2301
412 Ga0495616_0053968 3300046513 Bacteria 1995
413 Ga0495616_0072843 3300046513 Bacteria 1658
414 Ga0495616_0091211 3300046513 Bacteria 1442
415 Ga0495616_0163251 3300046513 Bacteria 1000
416 Ga0495620_0000052 3300046515 Bacteria 103693
417 Ga0495620_0001435 3300046515 Bacteria 14263
418 Ga0495620_0002464 3300046515 Bacteria 10728
419 Ga0495620_0016129 3300046515 Bacteria 3758
420 Ga0495620_0093520 3300046515 Bacteria 1204
421 Ga0495631_0001768 3300046518 Bacteria 12802
422 Ga0495631_0006939 3300046518 Bacteria 5803
423 Ga0495631_0009335 3300046518 Bacteria 4901
424 Ga0495631_0009951 3300046518 Bacteria 4728
425 Ga0495631_0018957 3300046518 Bacteria 3232
426 Ga0495631_0022959 3300046518 Bacteria 2896
427 Ga0495631_0026427 3300046518 Bacteria 2666
428 Ga0495631_0040688 3300046518 Bacteria 2058
429 Ga0495632_0000040 3300046519 Bacteria 149644
430 Ga0495632_0000540 3300046519 Bacteria 35597
431 Ga0495632_0001781 3300046519 Bacteria 17374
432 Ga0495632_0002113 3300046519 Bacteria 15523
433 Ga0495632_0003013 3300046519 Bacteria 12294
434 Ga0495632_0004754 3300046519 Bacteria 9153
435 Ga0495632_0009283 3300046519 Bacteria 5941
436 Ga0495632_0013510 3300046519 Bacteria 4657
437 Ga0495632_0046813 3300046519 Bacteria 2147
438 Ga0495637_0000006 3300046520 Bacteria 435763
439 Ga0495637_0000346 3300046520 Bacteria 35690
440 Ga0495637_0010752 3300046520 Bacteria 4414
441 Ga0495637_0011359 3300046520 Bacteria 4281
442 Ga0495637_0013284 3300046520 Bacteria 3912
443 Ga0495637_0025972 3300046520 Bacteria 2635
444 Ga0495637_0026217 3300046520 Bacteria 2619
445 Ga0495643_0000282 3300046522 Bacteria 72496
446 Ga0495643_0001593 3300046522 Bacteria 20127
447 Ga0495643_0001686 3300046522 Bacteria 19265
448 Ga0495643_0001974 3300046522 Bacteria 17209
449 Ga0495643_0002102 3300046522 Bacteria 16487
450 Ga0495643_0002637 3300046522 Bacteria 13917
451 Ga0495643_0006661 3300046522 Bacteria 7571
452 Ga0495643_0008756 3300046522 Bacteria 6379
453 Ga0495643_0016451 3300046522 Bacteria 4343
454 Ga0495643_0056561 3300046522 Bacteria 2093
455 Ga0495644_0001218 3300046523 Bacteria 10523
456 Ga0495644_0005269 3300046523 Bacteria 5053
457 Ga0495644_0011094 3300046523 Bacteria 3473
458 Ga0495644_0012232 3300046523 Bacteria 3299
459 Ga0495644_0055915 3300046523 Bacteria 1482
460 Ga0495648_0000001 3300046524 Bacteria 696872
461 Ga0495648_0000611 3300046524 Bacteria 38272
462 Ga0495648_0003910 3300046524 Bacteria 12908
463 Ga0495648_0008953 3300046524 Bacteria 7821
464 Ga0495648_0011629 3300046524 Bacteria 6612
465 Ga0495648_0014218 3300046524 Bacteria 5837
466 Ga0495648_0030301 3300046524 Bacteria 3579
467 Ga0495648_0042160 3300046524 Bacteria 2873
468 Ga0495648_0058903 3300046524 Bacteria 2294
469 Ga0495648_0064887 3300046524 Bacteria 2149
470 Ga0495648_0089725 3300046524 Bacteria 1724
471 Ga0495648_0184944 3300046524 Bacteria 1056
472 Ga0495666_0002189 3300046526 Bacteria 9736
473 Ga0495642_0000710 3300046528 Bacteria 16583
474 Ga0495642_0004317 3300046528 Bacteria 5521
475 Ga0495642_0005367 3300046528 Bacteria 4917
476 Ga0495642_0006326 3300046528 Bacteria 4540
477 Ga0495642_0007109 3300046528 Bacteria 4292
478 Ga0495642_0008224 3300046528 Bacteria 3990
479 Ga0495642_0020914 3300046528 Bacteria 2572
480 Ga0495642_0030059 3300046528 Bacteria 2172
481 Ga0495642_0036727 3300046528 Bacteria 1980
482 Ga0495642_0053658 3300046528 Bacteria 1661
483 Ga0495654_0003846 3300046530 Bacteria 9067
484 Ga0495654_0008721 3300046530 Bacteria 5585
485 Ga0495654_0011039 3300046530 Bacteria 4905
486 Ga0495654_0027659 3300046530 Bacteria 2905
487 Ga0495654_0029439 3300046530 Bacteria 2800
488 Ga0495654_0032023 3300046530 Bacteria 2666
489 Ga0495654_0040385 3300046530 Bacteria 2325
490 Ga0495654_0041430 3300046530 Bacteria 2290
491 Ga0495665_0178464 3300046531 Bacteria 1104
492 Ga0495586_0090024 3300046535 Bacteria 1694
493 Ga0495586_0103417 3300046535 Bacteria 1582
494 Ga0495609_0000096 3300046538 Bacteria 104135
495 Ga0495609_0000106 3300046538 Bacteria 98302
496 Ga0495609_0000164 3300046538 Bacteria 69576
497 Ga0495609_0000401 3300046538 Bacteria 36473
498 Ga0495609_0000783 3300046538 Bacteria 23759
499 Ga0495609_0006196 3300046538 Bacteria 6150
500 Ga0495609_0012497 3300046538 Bacteria 4027
501 Ga0495609_0017746 3300046538 Bacteria 3302
502 Ga0495609_0018943 3300046538 Bacteria 3188
503 Ga0495609_0057557 3300046538 Bacteria 1720
504 Ga0495609_0076875 3300046538 Bacteria 1462
505 Ga0495609_0077675 3300046538 Bacteria 1453
506 Ga0495621_0019608 3300046539 Bacteria 2210
507 Ga0495597_0000726 3300046542 Bacteria 26335
508 Ga0495597_0001884 3300046542 Bacteria 14308
509 Ga0495597_0004773 3300046542 Bacteria 7329
510 Ga0495597_0007749 3300046542 Bacteria 5426
511 Ga0495597_0035118 3300046542 Bacteria 2262
512 Ga0495597_0054866 3300046542 Bacteria 1749
513 Ga0495597_0080369 3300046542 Bacteria 1395
514 Ga0495597_0122875 3300046542 Bacteria 1081
515 Ga0495645_0032588 3300046543 Bacteria 3802
516 Ga0495645_0175708 3300046543 Bacteria 1471
517 Ga0495622_0000087 3300046557 Bacteria 82912
518 Ga0495622_0002777 3300046557 Bacteria 8362
519 Ga0495622_0021426 3300046557 Bacteria 3008
520 Ga0495633_0000171 3300046558 Bacteria 86031
521 Ga0495633_0000188 3300046558 Bacteria 80806
522 Ga0495633_0001420 3300046558 Bacteria 18628
523 Ga0495633_0003725 3300046558 Bacteria 10039
524 Ga0495633_0007930 3300046558 Bacteria 6053
525 Ga0495633_0009859 3300046558 Bacteria 5250
526 Ga0495633_0011990 3300046558 Bacteria 4633
527 Ga0495633_0012148 3300046558 Bacteria 4594
528 Ga0495633_0013787 3300046558 Bacteria 4246
529 Ga0495633_0020207 3300046558 Bacteria 3353
530 Ga0495633_0035964 3300046558 Bacteria 2375
531 Ga0495633_0102999 3300046558 Bacteria 1325
532 Ga0495656_0006134 3300046615 Bacteria 4197
533 Ga0495656_0038760 3300046615 Bacteria 1976
534 Ga0495668_0000185 3300046616 Bacteria 92731
535 Ga0495668_0000363 3300046616 Bacteria 60009
536 Ga0495668_0001751 3300046616 Bacteria 19890
537 Ga0495668_0003117 3300046616 Bacteria 12810
538 Ga0495668_0003629 3300046616 Bacteria 11430
539 Ga0495668_0007464 3300046616 Bacteria 6986
540 Ga0495668_0010202 3300046616 Bacteria 5707
541 Ga0495668_0014738 3300046616 Bacteria 4577
542 Ga0495668_0018078 3300046616 Bacteria 4079
543 Ga0495668_0045422 3300046616 Bacteria 2442
544 Ga0495668_0047075 3300046616 Bacteria 2394
545 Ga0495668_0076908 3300046616 Bacteria 1832
546 Ga0495668_0086579 3300046616 Bacteria 1718
547 Ga0495611_0000526 3300046648 Bacteria 22757
548 Ga0495611_0002775 3300046648 Bacteria 7857
549 Ga0495611_0003272 3300046648 Bacteria 7159
550 Ga0495611_0019963 3300046648 Bacteria 2881
551 Ga0495611_0030761 3300046648 Bacteria 2361
552 Ga0495611_0045229 3300046648 Bacteria 1971
553 Ga0495611_0057585 3300046648 Bacteria 1761
554 Ga0495611_0079017 3300046648 Bacteria 1510
555 Ga0495625_0000050 3300046660 Bacteria 197065
556 Ga0495625_0000164 3300046660 Bacteria 103037
557 Ga0495625_0000372 3300046660 Bacteria 68695
558 Ga0495625_0043244 3300046660 Bacteria 3268
559 Ga0495625_0057367 3300046660 Bacteria 2769
560 Ga0495625_0072838 3300046660 Bacteria 2409
561 Ga0495625_0093704 3300046660 Bacteria 2073
562 Ga0495625_0094147 3300046660 Bacteria 2067
563 Ga0495625_0151063 3300046660 Bacteria 1561
564 Ga0495625_0164871 3300046660 Bacteria 1482
565 Ga0495625_0167763 3300046660 Bacteria 1467
566 Ga0495635_0005894 3300046663 Bacteria 8543
567 Ga0495659_0013305 3300046664 Bacteria 2679
568 Ga0495661_0000164 3300046665 Bacteria 78742
569 Ga0495661_0000309 3300046665 Bacteria 55308
570 Ga0495661_0000614 3300046665 Bacteria 36352
571 Ga0495661_0002216 3300046665 Bacteria 15128
572 Ga0495661_0002296 3300046665 Bacteria 14763
573 Ga0495661_0010755 3300046665 Bacteria 6230
574 Ga0495661_0011758 3300046665 Bacteria 5929
575 Ga0495661_0022220 3300046665 Bacteria 4127
576 Ga0495661_0040413 3300046665 Bacteria 2892
577 Ga0495661_0043635 3300046665 Bacteria 2755
578 Ga0495661_0080843 3300046665 Bacteria 1874
579 Ga0495661_0106905 3300046665 Bacteria 1565
580 Ga0495661_0113293 3300046665 Bacteria 1508
581 Ga0495661_0116795 3300046665 Bacteria 1479
582 Ga0495661_0187070 3300046665 Bacteria 1093
583 Ga0495661_0201940 3300046665 Bacteria 1040
584 Ga0495588_0000070 3300046674 Bacteria 227611
585 Ga0495588_0039682 3300046674 Bacteria 2399
586 Ga0495588_0137390 3300046674 Bacteria 1290
587 Ga0495669_0000098 3300046684 Bacteria 54514
588 Ga0495669_0003738 3300046684 Bacteria 6259
589 Ga0495669_0004576 3300046684 Bacteria 5725
590 Ga0495669_0005091 3300046684 Bacteria 5471
591 Ga0495669_0016763 3300046684 Bacteria 3141
592 Ga0495669_0029797 3300046684 Bacteria 2394
593 Ga0495669_0134013 3300046684 Bacteria 1167
594 Ga0495669_0135256 3300046684 Bacteria 1162
595 Ga0495613_0117145 3300046689 Bacteria 1915
596 Ga0495670_0005657 3300046691 Bacteria 6127
597 Ga0495670_0013792 3300046691 Bacteria 3974
598 Ga0495670_0041694 3300046691 Bacteria 2290
599 Ga0495670_0044741 3300046691 Bacteria 2210
600 Ga0495670_0051685 3300046691 Bacteria 2057
601 Ga0495670_0128413 3300046691 Bacteria 1320
602 Ga0495671_0000001 3300046692 Bacteria 1169494
603 Ga0495671_0005249 3300046692 Bacteria 7607
604 Ga0495671_0010836 3300046692 Bacteria 5039
605 Ga0495671_0025089 3300046692 Bacteria 3100
606 Ga0495671_0037701 3300046692 Bacteria 2443
607 Ga0495671_0092472 3300046692 Bacteria 1480
608 Ga0495649_0001815 3300046694 Bacteria 15676
609 Ga0495649_0002551 3300046694 Bacteria 12760
610 Ga0495649_0002569 3300046694 Bacteria 12714
611 Ga0495649_0009456 3300046694 Bacteria 5793
612 Ga0495649_0013356 3300046694 Bacteria 4738
613 Ga0495649_0034656 3300046694 Bacteria 2777
614 Ga0495649_0040018 3300046694 Bacteria 2568
615 Ga0495649_0043028 3300046694 Bacteria 2466
616 Ga0495649_0046819 3300046694 Bacteria 2354
617 Ga0495649_0065045 3300046694 Bacteria 1957
618 Ga0495649_0065269 3300046694 Bacteria 1954
619 Ga0495649_0066415 3300046694 Bacteria 1936
620 Ga0495649_0122810 3300046694 Bacteria 1372
621 Ga0495649_0166040 3300046694 Bacteria 1156
622 Ga0495589_0000036 3300046794 Bacteria 153299
623 Ga0495589_0000092 3300046794 Bacteria 85372
624 Ga0495589_0004004 3300046794 Bacteria 7901
625 Ga0495589_0005614 3300046794 Bacteria 6615
626 Ga0495589_0008837 3300046794 Bacteria 5240
627 Ga0495589_0038033 3300046794 Bacteria 2410
628 Ga0495589_0038115 3300046794 Bacteria 2407
629 Ga0495589_0062376 3300046794 Bacteria 1828
630 Ga0495660_0000117 3300046810 Bacteria 85237
631 Ga0495660_0000215 3300046810 Bacteria 58954
632 Ga0495660_0002403 3300046810 Bacteria 11946
633 Ga0495660_0009049 3300046810 Bacteria 5815
634 Ga0495660_0014900 3300046810 Bacteria 4496
635 Ga0495660_0015540 3300046810 Bacteria 4396
636 Ga0495660_0015664 3300046810 Bacteria 4378
637 Ga0495660_0015865 3300046810 Bacteria 4347
638 Ga0495660_0018174 3300046810 Bacteria 4042
639 Ga0495660_0044048 3300046810 Bacteria 2457
640 Ga0495660_0088433 3300046810 Bacteria 1614
641 Ga0495660_0137782 3300046810 Bacteria 1217
642 Ga0495660_0204384 3300046810 Bacteria 941
643 Ga0495581_0032837 3300047315 Bacteria 3004
644 Ga0495636_0082485 3300047318 Bacteria 1386
645 Ga0495672_0000086 3300047320 Bacteria 155010
646 Ga0495672_0000187 3300047320 Bacteria 89789
647 Ga0495672_0002132 3300047320 Bacteria 18542
648 Ga0495672_0003870 3300047320 Bacteria 12583
649 Ga0495672_0004394 3300047320 Bacteria 11565
650 Ga0495672_0051155 3300047320 Bacteria 2435
651 Ga0495672_0103501 3300047320 Bacteria 1540
652 Ga0495672_0110252 3300047320 Bacteria 1478
653 Ga0495676_0000035 3300047321 Bacteria 120519
654 Ga0495676_0000377 3300047321 Bacteria 36426
655 Ga0495676_0017698 3300047321 Bacteria 6293
656 Ga0495680_0080561 3300047322 Bacteria 2460
657 Ga0495683_0000080 3300047323 Bacteria 95388
658 Ga0495683_0007215 3300047323 Bacteria 6032
659 Ga0495683_0011985 3300047323 Bacteria 4555
660 Ga0495683_0063128 3300047323 Bacteria 1830
661 Ga0495683_0141247 3300047323 Bacteria 1128
662 Ga0495683_0163446 3300047323 Bacteria 1028
663 Ga0495687_000074 3300047443 Bacteria 153464
664 Ga0495687_000154 3300047443 Bacteria 104740
665 Ga0495687_001753 3300047443 Bacteria 19181
666 Ga0495687_002544 3300047443 Bacteria 14438
667 Ga0495687_002568 3300047443 Bacteria 14327
668 Ga0495687_006358 3300047443 Bacteria 7262
669 Ga0495675_0022159 3300047444 Bacteria 4048
670 Ga0495677_0000037 3300047445 Bacteria 78595
671 Ga0495677_0002039 3300047445 Bacteria 8056
672 Ga0495677_0003775 3300047445 Bacteria 5857
673 Ga0495677_0004085 3300047445 Bacteria 5636
674 Ga0495677_0037715 3300047445 Bacteria 1765
675 Ga0495679_000299 3300047446 Bacteria 39909
676 Ga0495679_002040 3300047446 Bacteria 10669
677 Ga0495679_003539 3300047446 Bacteria 7464
678 Ga0495679_007583 3300047446 Bacteria 4510
679 Ga0495685_002172 3300047447 Bacteria 6095
680 Ga0495685_025478 3300047447 Bacteria 2034
681 Ga0495685_037677 3300047447 Bacteria 1657
682 Ga0495673_0000003 3300047469 Bacteria 1491337
683 Ga0495673_0000097 3300047469 Bacteria 182247
684 Ga0495673_0000100 3300047469 Bacteria 173962
685 Ga0495673_0000395 3300047469 Bacteria 51238
686 Ga0495673_0000396 3300047469 Bacteria 51189
687 Ga0495673_0006224 3300047469 Bacteria 7059
688 Ga0495673_0006451 3300047469 Bacteria 6889
689 Ga0495681_0002173 3300047470 Bacteria 14206
690 Ga0495681_0007151 3300047470 Bacteria 7181
691 Ga0495681_0008429 3300047470 Bacteria 6468
692 Ga0495681_0010334 3300047470 Bacteria 5651
693 Ga0495681_0011942 3300047470 Bacteria 5132
694 Ga0495681_0012679 3300047470 Bacteria 4939
695 Ga0495681_0012695 3300047470 Bacteria 4934
696 Ga0495681_0031686 3300047470 Bacteria 2672
697 Ga0495681_0037048 3300047470 Bacteria 2406
698 Ga0495681_0041881 3300047470 Bacteria 2220
699 Ga0495681_0067139 3300047470 Bacteria 1635
700 Ga0495681_0110414 3300047470 Bacteria 1191
701 Ga0495681_0121841 3300047470 Bacteria 1118
702 Ga0495686_0000054 3300047472 Bacteria 259400
703 Ga0495686_0000987 3300047472 Bacteria 34762
704 Ga0495686_0001906 3300047472 Bacteria 20827
705 Ga0495686_0008973 3300047472 Bacteria 7258
706 Ga0495686_0010237 3300047472 Bacteria 6679
707 Ga0495686_0033660 3300047472 Bacteria 3307
708 Ga0495686_0045075 3300047472 Bacteria 2791
709 Ga0495686_0062495 3300047472 Bacteria 2309
710 Ga0495593_0011137 3300047673 Bacteria 5174
711 Ga0495614_0003662 3300048089 Bacteria 6892
712 Ga0495614_0033016 3300048089 Bacteria 2227
713 Ga0495626_0000006 3300048091 Bacteria 284977
714 Ga0495626_0000600 3300048091 Bacteria 35252
715 Ga0495626_0004120 3300048091 Bacteria 9030
716 Ga0495626_0007465 3300048091 Bacteria 6084
717 Ga0495626_0014843 3300048091 Bacteria 4004
718 Ga0495626_0017504 3300048091 Bacteria 3615
719 Ga0495626_0048741 3300048091 Bacteria 1964
720 Ga0495626_0064012 3300048091 Bacteria 1666
721 Ga0495626_0087447 3300048091 Bacteria 1375
722 Ga0495626_0142073 3300048091 Bacteria 1017
723 Ga0496100_0006427 3300048903 Bacteria 6406
724 Ga0496100_0022301 3300048903 Bacteria 3831
725 Ga0496100_0089620 3300048903 Bacteria 2096
726 Ga0496101_0015959 3300048904 Bacteria 5067
727 Ga0496101_0257198 3300048904 Bacteria 1361
728 Ga0496102_0000152 3300048905 Bacteria 94042
729 Ga0496102_0001102 3300048905 Bacteria 24871
730 Ga0496102_0015513 3300048905 Bacteria 6636
731 Ga0496102_0506840 3300048905 Bacteria 1129
732 Ga0496103_0002518 3300048906 Bacteria 11480
733 Ga0496103_0070892 3300048906 Bacteria 2180
734 Ga0496103_0218562 3300048906 Bacteria 1226
735 Ga0496104_0142955 3300048907 Bacteria 2299
736 Ga0496104_0522943 3300048907 Bacteria 1097
737 Ga0496105_0119217 3300048908 Bacteria 2177
738 Ga0496106_0069488 3300048909 Bacteria 2688
739 Ga0496106_0338308 3300048909 Bacteria 1208
740 Ga0496107_0017162 3300048910 Bacteria 5092
741 Ga0496107_0128885 3300048910 Bacteria 1867
742 Ga0496108_0082384 3300048911 Bacteria 2728
743 Ga0496108_0128925 3300048911 Bacteria 2174
744 Ga0496109_0056995 3300048912 Bacteria 3565
745 Ga0496109_0158650 3300048912 Bacteria 2119
746 Ga0496109_0255555 3300048912 Bacteria 1650
747 Ga0496110_0081513 3300048913 Bacteria 2884
748 Ga0496110_0083667 3300048913 Bacteria 2847
749 Ga0496110_0334110 3300048913 Bacteria 1380
750 Ga0496111_0015421 3300048914 Bacteria 5245
751 Ga0496112_0622091 3300048915 Bacteria 1011
752 Ga0496113_0094541 3300048916 Bacteria 2309
753 Ga0496114_0001680 3300048917 Bacteria 16792
754 Ga0496114_0003874 3300048917 Bacteria 11531
755 Ga0496114_0172339 3300048917 Bacteria 1886
756 Ga0496114_0287696 3300048917 Bacteria 1450
757 Ga0496116_0003215 3300048919 Bacteria 16308
758 Ga0496116_0024112 3300048919 Bacteria 4509
759 Ga0496116_0038067 3300048919 Bacteria 3345
760 Ga0496116_0038438 3300048919 Bacteria 3323
761 Ga0496117_0000056 3300048920 Bacteria 271417
762 Ga0496117_0001733 3300048920 Bacteria 30190
763 Ga0496117_0001893 3300048920 Bacteria 28078
764 Ga0496117_0003106 3300048920 Bacteria 19860
765 Ga0496117_0054998 3300048920 Bacteria 2784
766 Ga0496118_0000047 3300048921 Bacteria 271417
767 Ga0496118_0002944 3300048921 Bacteria 22125
768 Ga0496118_0005238 3300048921 Bacteria 14828
769 Ga0496118_0038630 3300048921 Bacteria 3822
770 Ga0496118_0039107 3300048921 Bacteria 3790
771 Ga0496118_0166426 3300048921 Bacteria 1354
772 Ga0496119_0000199 3300048922 Bacteria 84539
773 Ga0496119_0045772 3300048922 Bacteria 2740
774 Ga0496120_0000840 3300048923 Bacteria 43691
775 Ga0496121_0001906 3300048924 Bacteria 33394
776 Ga0496121_0003376 3300048924 Bacteria 22880
777 Ga0496121_0009023 3300048924 Bacteria 11554
778 Ga0496121_0016973 3300048924 Bacteria 7476
779 Ga0496121_0021646 3300048924 Bacteria 6287
780 Ga0496121_0023195 3300048924 Bacteria 5988
781 Ga0496121_0033480 3300048924 Bacteria 4649
782 Ga0496121_0091303 3300048924 Bacteria 2378
783 Ga0496121_0113056 3300048924 Bacteria 2067
784 Ga0496121_0128826 3300048924 Bacteria 1898
785 Ga0496121_0146500 3300048924 Bacteria 1744
786 Ga0496122_0000298 3300048925 Bacteria 109839
787 Ga0496122_0001315 3300048925 Bacteria 40732
788 Ga0496122_0006167 3300048925 Bacteria 13940
789 Ga0496122_0019287 3300048925 Bacteria 6239
790 Ga0496122_0030520 3300048925 Bacteria 4514
791 Ga0496122_0031942 3300048925 Bacteria 4365
792 Ga0496122_0032248 3300048925 Bacteria 4337
793 Ga0496122_0062963 3300048925 Bacteria 2712
794 Ga0496122_0125750 3300048925 Bacteria 1641
795 Ga0496123_0000080 3300048926 Bacteria 190247
796 Ga0496123_0000851 3300048926 Bacteria 48703
797 Ga0496123_0001824 3300048926 Bacteria 27989
798 Ga0496123_0015045 3300048926 Bacteria 6371
799 Ga0496123_0018392 3300048926 Bacteria 5562
800 Ga0496123_0019006 3300048926 Bacteria 5429
801 Ga0496123_0028518 3300048926 Bacteria 4130
802 Ga0496123_0067313 3300048926 Bacteria 2263
803 Ga0496123_0106297 3300048926 Bacteria 1617
804 Ga0496124_0000004 3300048927 Bacteria 976131
805 Ga0496124_0001065 3300048927 Bacteria 43363
806 Ga0496124_0006805 3300048927 Bacteria 12341
807 Ga0496124_0022612 3300048927 Bacteria 5758
808 Ga0496124_0026320 3300048927 Bacteria 5246
809 Ga0496124_0028685 3300048927 Bacteria 4975
810 Ga0496124_0047187 3300048927 Bacteria 3686
811 Ga0496124_0061207 3300048927 Bacteria 3156
812 Ga0496124_0062130 3300048927 Bacteria 3127
813 Ga0496124_0062912 3300048927 Bacteria 3103
814 Ga0496124_0115756 3300048927 Bacteria 2150
815 Ga0496124_0145268 3300048927 Bacteria 1867
816 Ga0496124_0151010 3300048927 Bacteria 1822
817 Ga0496125_0000240 3300048928 Bacteria 112092
818 Ga0496125_0000826 3300048928 Bacteria 49960
819 Ga0496125_0010518 3300048928 Bacteria 9356
820 Ga0496125_0024295 3300048928 Bacteria 5576
821 Ga0496125_0026908 3300048928 Bacteria 5224
822 Ga0496125_0071692 3300048928 Bacteria 2705
823 Ga0496125_0092889 3300048928 Bacteria 2254
824 Ga0496125_0102010 3300048928 Bacteria 2109
825 Ga0496126_0025933 3300048929 Bacteria 5628
826 Ga0495678_000004 3300049459 Bacteria 532920
827 Ga0495678_000226 3300049459 Bacteria 65083
828 Ga0495678_001072 3300049459 Bacteria 23117
829 Ga0495678_003443 3300049459 Bacteria 9805
830 Ga0495678_003543 3300049459 Bacteria 9574
831 Ga0495678_003967 3300049459 Bacteria 8848
832 Ga0495678_005143 3300049459 Bacteria 7335
833 Ga0495678_009918 3300049459 Bacteria 4669
834 Ga0495678_028661 3300049459 Bacteria 2347
835 Ga0495678_030309 3300049459 Bacteria 2264
836 Ga0495678_038882 3300049459 Bacteria 1921
837 Ga0495678_084503 3300049459 Bacteria 1132
838 Ga0495682_0000501 3300049460 Bacteria 27136
839 Ga0495682_0002360 3300049460 Bacteria 8972
840 Ga0495682_0003356 3300049460 Bacteria 7146
841 Ga0495682_0009849 3300049460 Bacteria 3719
842 Ga0495682_0038006 3300049460 Bacteria 1769
843 Ga0501034_0000330 3300049571 Bacteria 82994
844 Ga0501037_0262536 3300049573 Bacteria 1206
845 Ga0501269_000023 3300049766 Bacteria 53029
846 Ga0501035_0003423 3300049822 Bacteria 15171
847 Ga0501044_0579939 3300049823 Bacteria 1016
848 nmdc:mga00v17_90164_c1 3300050491 Bacteria 1924
849 Ga0500594_0004979 3300053118 Bacteria 2937
850 Ga0500618_001435 3300053125 Bacteria 10601
851 Ga0500618_002592 3300053125 Bacteria 6672
852 Ga0500659_0001851 3300053135 Bacteria 13161
853 Ga0500586_000036 3300053145 Bacteria 23841
854 Ga0500586_000610 3300053145 Bacteria 7269
855 Ga0500586_073843 3300053145 Bacteria 1195
856 Ga0500634_0072763 3300053161 Unclassified 1793
857 Ga0466962_0008940 3300061719 Bacteria 4799

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047469 Ga0495673_0000097 Ga0495673_0000097_69248_70141 253
2 3300046457 Ga0495590_0104002 Ga0495590_0104002_36_830 255
3 3300046665 Ga0495661_0043635 Ga0495661_0043635_35_829 255
4 3300048913 Ga0496110_0334110 Ga0496110_0334110_583_1359 256
5 3300042008 Ga0439450_037288 Ga0439450_037288_22_825 261
6 3300048908 Ga0496105_0119217 Ga0496105_0119217_1346_2146 261
7 3300049823 Ga0501044_0579939 Ga0501044_0579939_62_868 262
8 3300047472 Ga0495686_0001906 Ga0495686_0001906_8177_9163 274
9 3300049573 Ga0501037_0262536 Ga0501037_0262536_364_1191 275
10 3300044684 Ga0466966_0002542 Ga0466966_0002542_9700_10620 278
11 3300044693 Ga0466961_0074359 Ga0466961_0074359_923_1843 278
12 3300044694 Ga0466963_0023995 Ga0466963_0023995_699_1619 278
13 3300044706 Ga0466964_0045087 Ga0466964_0045087_430_1350 278
14 3300044765 Ga0466970_0119307 Ga0466970_0119307_102_1022 278
15 3300044842 Ga0466957_0020696 Ga0466957_0020696_129_1049 278
16 3300045049 Ga0466959_0013616 Ga0466959_0013616_1301_2221 278
17 3300045836 Ga0466958_0233552 Ga0466958_0233552_192_1112 278
18 3300061719 Ga0466962_0008940 Ga0466962_0008940_572_1492 278
19 3300042115 Ga0450911_000128 Ga0450911_000128_7728_8666 279
20 3300031838 Ga0307518_10030063 Ga0307518_100300634 280
21 3300042157 Ga0439458_0004763 Ga0439458_0004763_1853_2746 282
22 3300015262 Ga0182007_10003199 Ga0182007_100031999 284
23 3300046665 Ga0495661_0187070 Ga0495661_0187070_13_882 284
24 3300048091 Ga0495626_0142073 Ga0495626_0142073_10_879 284
25 3300048905 Ga0496102_0506840 Ga0496102_0506840_245_1114 284
26 3300046453 Ga0495627_023921 Ga0495627_023921_59_949 286
27 3300046492 Ga0495585_0009643 Ga0495585_0009643_4134_5024 286
28 3300046499 Ga0495594_0033420 Ga0495594_0033420_329_1219 286
29 3300046500 Ga0495596_0009703 Ga0495596_0009703_118_1008 286
30 3300046648 Ga0495611_0003272 Ga0495611_0003272_4077_4967 286
31 3300046684 Ga0495669_0003738 Ga0495669_0003738_2413_3303 286
32 3300047470 Ga0495681_0067139 Ga0495681_0067139_20_910 286
33 3300048091 Ga0495626_0007465 Ga0495626_0007465_4207_5097 286
34 iso_pu_bacteria 2738541297 2738829335 286
35 iso_pu_bacteria 2738541357 2739153131 286
36 iso_pu_bacteria 2738543003 2739195051 286
37 iso_pu_bacteria 2738543026 2739321527 286
38 iso_pu_bacteria 2738543029 2739339917 286
39 iso_pu_bacteria 2821131069 2821131484 286
40 iso_pu_bacteria 2857564685 2857564857 286
41 3300047320 Ga0495672_0103501 Ga0495672_0103501_373_1260 287
42 iso_pu_bacteria 2600255292 2601671882 287
43 iso_pu_bacteria 2857547612 2857552244 287
44 iso_pu_bacteria 2885080285 2885086522 287
45 iso_pu_bacteria 2932410948 2932415072 287
46 iso_pu_bacteria 2932416698 2932421280 287
47 iso_pu_bacteria 8047673197 8047679050 287
48 iso_pu_bacteria 2834028612 2834034306 288
49 iso_pu_bacteria 2842711865 2842714162 288
50 iso_pu_bacteria 2857558681 2857559975 288
51 iso_pu_bacteria 2904424332 2904426140 288
52 iso_pu_bacteria 3007803356 3007807128 288
53 iso_pu_bacteria 8052494512 8052495435 288
54 iso_pu_bacteria 8055817908 8055823199 288
55 3300005367 Ga0070667_100321030 Ga0070667_1003210301 289
56 3300005843 Ga0068860_100173343 Ga0068860_1001733432 289
57 3300025986 Ga0207658_10222442 Ga0207658_102224422 289
58 3300048924 Ga0496121_0033480 Ga0496121_0033480_2730_3611 289
59 3300048928 Ga0496125_0092889 Ga0496125_0092889_505_1386 289
60 iso_pu_bacteria 2511231024 2511375170 289
61 iso_pu_bacteria 2554235231 2555245637 289
62 iso_pu_bacteria 2738543020 2739285929 289
63 iso_pu_bacteria 2738543021 2739291242 289
64 iso_pu_bacteria 2765235841 2765585995 289
65 iso_pu_bacteria 2857553236 2857554372 289
66 iso_pu_bacteria 2919476304 2919478521 289
67 iso_pu_bacteria 8054929484 8054932792 289
68 iso_pu_bacteria 8056115690 8056116982 289
69 3300002774 JGI25150J39212_1012329 JGI25150J39212_10123291 290
70 3300003322 rootL2_10032663 rootL2_100326632 290
71 3300003322 rootL2_10034981 rootL2_100349812 290
72 3300003323 rootH1_10137222 rootH1_101372225 290
73 3300003763 Ga0055529_1000392 Ga0055529_100039217 290
74 3300003771 Ga0055526_1000074 Ga0055526_10000745 290
75 3300009036 Ga0105244_10001737 Ga0105244_100017375 290
76 3300025245 Ga0207425_1000192 Ga0207425_100019248 290
77 3300025272 Ga0209455_1000037 Ga0209455_1000037170 290
78 3300025294 Ga0209025_1009132 Ga0209025_10091322 290
79 3300025295 Ga0209564_1000009 Ga0209564_1000009294 290
80 3300025297 Ga0209758_1000227 Ga0209758_100022736 290
81 3300025728 Ga0207655_1040598 Ga0207655_10405982 290
82 3300035114 Ga0373939_0048876 Ga0373939_0048876_220_1110 290
83 3300041407 Ga0439447_007586 Ga0439447_007586_1666_2586 290
84 3300046452 Ga0495617_000037 Ga0495617_000037_78750_79634 290
85 3300046463 Ga0495653_0000002 Ga0495653_0000002_34158_35048 290
86 3300046471 Ga0495650_0000166 Ga0495650_0000166_83206_84096 290
87 3300046471 Ga0495650_0000442 Ga0495650_0000442_26985_27872 290
88 3300046471 Ga0495650_0003807 Ga0495650_0003807_9477_10367 290
89 3300046492 Ga0495585_0002212 Ga0495585_0002212_3700_4593 290
90 3300046507 Ga0495606_0000064 Ga0495606_0000064_113837_114727 290
91 3300046507 Ga0495606_0000156 Ga0495606_0000156_53440_54330 290
92 3300046507 Ga0495606_0171348 Ga0495606_0171348_228_1118 290
93 3300046512 Ga0495610_0000003 Ga0495610_0000003_491107_491991 290
94 3300046524 Ga0495648_0008953 Ga0495648_0008953_4617_5507 290
95 3300046524 Ga0495648_0030301 Ga0495648_0030301_2209_3099 290
96 3300046530 Ga0495654_0027659 Ga0495654_0027659_332_1222 290
97 3300046558 Ga0495633_0020207 Ga0495633_0020207_1537_2430 290
98 3300046616 Ga0495668_0000185 Ga0495668_0000185_49977_50867 290
99 3300046616 Ga0495668_0000363 Ga0495668_0000363_9242_10132 290
100 3300046616 Ga0495668_0003629 Ga0495668_0003629_5101_5991 290
101 3300046660 Ga0495625_0000372 Ga0495625_0000372_18604_19491 290
102 3300046665 Ga0495661_0040413 Ga0495661_0040413_170_1060 290
103 3300046692 Ga0495671_0000001 Ga0495671_0000001_179732_180622 290
104 3300046692 Ga0495671_0025089 Ga0495671_0025089_204_1097 290
105 3300046694 Ga0495649_0066415 Ga0495649_0066415_983_1873 290
106 3300047469 Ga0495673_0000003 Ga0495673_0000003_1419381_1420280 290
107 3300047469 Ga0495673_0000100 Ga0495673_0000100_93177_94070 290
108 3300047472 Ga0495686_0010237 Ga0495686_0010237_706_1596 290
109 3300048910 Ga0496107_0128885 Ga0496107_0128885_281_1171 290
110 3300048924 Ga0496121_0016973 Ga0496121_0016973_2628_3518 290
111 3300048925 Ga0496122_0062963 Ga0496122_0062963_1602_2495 290
112 3300048926 Ga0496123_0019006 Ga0496123_0019006_855_1745 290
113 3300048927 Ga0496124_0028685 Ga0496124_0028685_2507_3418 290
114 3300053125 Ga0500618_002592 Ga0500618_002592_849_1739 290
115 3300053145 Ga0500586_000610 Ga0500586_000610_2598_3491 290
116 iso_pu_bacteria 2738543012 2739246582 290
117 iso_pu_bacteria 2806310737 2807410309 290
118 iso_pu_bacteria 2806310745 2807458657 290
119 iso_pu_bacteria 2816332133 2816476113 290
120 iso_pu_bacteria 2912963787 2912964445 290
121 iso_pu_bacteria 2919155634 2919156505 290
122 iso_pu_bacteria 2939651529 2939651953 290
123 iso_pu_bacteria 8055878733 8055882037 290
124 iso_pu_bacteria 8056120720 8056121454 290
125 iso_pu_bacteria 8056131705 8056136612 290
126 3300003322 rootL2_10066887 rootL2_100668873 291
127 3300003759 Ga0055525_1000009 Ga0055525_1000009357 291
128 3300005262 Ga0065165_1000677 Ga0065165_10006776 291
129 3300005262 Ga0065165_1033071 Ga0065165_10330711 291
130 3300005327 Ga0070658_10040332 Ga0070658_100403322 291
131 3300005339 Ga0070660_100161357 Ga0070660_1001613573 291
132 3300005539 Ga0068853_100126047 Ga0068853_1001260471 291
133 3300005563 Ga0068855_100057985 Ga0068855_1000579853 291
134 3300009036 Ga0105244_10046885 Ga0105244_100468852 291
135 3300009148 Ga0105243_10041517 Ga0105243_100415172 291
136 3300009174 Ga0105241_10004855 Ga0105241_100048552 291
137 3300009176 Ga0105242_10028696 Ga0105242_100286963 291
138 3300009545 Ga0105237_10311635 Ga0105237_103116352 291
139 3300013105 Ga0157369_10346696 Ga0157369_103466962 291
140 3300013307 Ga0157372_10475911 Ga0157372_104759112 291
141 3300014497 Ga0182008_10002217 Ga0182008_100022172 291
142 3300015261 Ga0182006_1000511 Ga0182006_100051112 291
143 3300015262 Ga0182007_10000037 Ga0182007_1000003796 291
144 3300015262 Ga0182007_10044032 Ga0182007_100440322 291
145 3300015265 Ga0182005_1000021 Ga0182005_1000021242 291
146 3300017792 Ga0163161_10044365 Ga0163161_100443652 291
147 3300017792 Ga0163161_10065978 Ga0163161_100659782 291
148 3300025230 Ga0209563_100015 Ga0209563_100015472 291
149 3300025254 Ga0209148_1000957 Ga0209148_10009575 291
150 3300025909 Ga0207705_10003154 Ga0207705_100031544 291
151 3300025924 Ga0207694_10302920 Ga0207694_103029202 291
152 3300025932 Ga0207690_10027008 Ga0207690_100270083 291
153 3300025934 Ga0207686_10027759 Ga0207686_100277593 291
154 3300025935 Ga0207709_10063090 Ga0207709_100630903 291
155 3300026116 Ga0207674_10107181 Ga0207674_101071813 291
156 3300037312 Ga0395899_0003015 Ga0395899_0003015_4344_5237 291
157 3300037312 Ga0395899_0011765 Ga0395899_0011765_3762_4655 291
158 3300037312 Ga0395899_0125179 Ga0395899_0125179_268_1161 291
159 3300037312 Ga0395899_0141345 Ga0395899_0141345_78_974 291
160 3300037312 Ga0395899_0153461 Ga0395899_0153461_306_1196 291
161 3300037418 Ga0395900_0004698 Ga0395900_0004698_2474_3367 291
162 3300037418 Ga0395900_0054726 Ga0395900_0054726_1064_1957 291
163 3300037418 Ga0395900_0056356 Ga0395900_0056356_698_1591 291
164 3300037418 Ga0395900_0057570 Ga0395900_0057570_698_1591 291
165 3300037418 Ga0395900_0116179 Ga0395900_0116179_1166_2062 291
166 3300037418 Ga0395900_0321488 Ga0395900_0321488_333_1226 291
167 3300037418 Ga0395900_0513843 Ga0395900_0513843_209_1102 291
168 3300037466 Ga0395898_0200862 Ga0395898_0200862_737_1630 291
169 3300037471 Ga0395905_0000666 Ga0395905_0000666_23557_24450 291
170 3300037471 Ga0395905_0125394 Ga0395905_0125394_1029_1919 291
171 3300037471 Ga0395905_0358154 Ga0395905_0358154_173_1066 291
172 3300038443 Ga0395901_0000084 Ga0395901_0000084_112771_113664 291
173 3300038443 Ga0395901_0182133 Ga0395901_0182133_861_1754 291
174 3300038443 Ga0395901_0182267 Ga0395901_0182267_321_1214 291
175 3300042005 Ga0439448_0002114 Ga0439448_0002114_2516_3409 291
176 3300042007 Ga0439449_0033170 Ga0439449_0033170_98_991 291
177 3300042012 Ga0439455_0007580 Ga0439455_0007580_937_1830 291
178 3300044658 Ga0466972_0057135 Ga0466972_0057135_796_1689 291
179 3300044658 Ga0466972_0184859 Ga0466972_0184859_49_945 291
180 3300044683 Ga0466965_0009849 Ga0466965_0009849_2488_3381 291
181 3300044683 Ga0466965_0018929 Ga0466965_0018929_1537_2430 291
182 3300044683 Ga0466965_0050036 Ga0466965_0050036_327_1232 291
183 3300044684 Ga0466966_0049221 Ga0466966_0049221_715_1608 291
184 3300044684 Ga0466966_0184921 Ga0466966_0184921_55_948 291
185 3300044693 Ga0466961_0060004 Ga0466961_0060004_776_1672 291
186 3300044693 Ga0466961_0128358 Ga0466961_0128358_437_1342 291
187 3300044706 Ga0466964_0000831 Ga0466964_0000831_2492_3385 291
188 3300044706 Ga0466964_0001625 Ga0466964_0001625_4902_5795 291
189 3300044706 Ga0466964_0029511 Ga0466964_0029511_868_1761 291
190 3300044706 Ga0466964_0136943 Ga0466964_0136943_199_1092 291
191 3300044735 Ga0466968_0005562 Ga0466968_0005562_2663_3556 291
192 3300044765 Ga0466970_0071724 Ga0466970_0071724_205_1098 291
193 3300044765 Ga0466970_0108495 Ga0466970_0108495_342_1235 291
194 3300044842 Ga0466957_0009190 Ga0466957_0009190_2175_3068 291
195 3300044842 Ga0466957_0089845 Ga0466957_0089845_816_1709 291
196 3300045049 Ga0466959_0040982 Ga0466959_0040982_464_1369 291
197 3300045049 Ga0466959_0099079 Ga0466959_0099079_370_1263 291
198 3300045836 Ga0466958_0130257 Ga0466958_0130257_413_1306 291
199 3300045976 Ga0466967_0108414 Ga0466967_0108414_419_1312 291
200 3300045976 Ga0466967_0152776 Ga0466967_0152776_203_1096 291
201 3300046452 Ga0495617_000002 Ga0495617_000002_194006_194938 291
202 3300046453 Ga0495627_002596 Ga0495627_002596_5009_5941 291
203 3300046455 Ga0495603_0003904 Ga0495603_0003904_250_1140 291
204 3300046457 Ga0495590_0031597 Ga0495590_0031597_130_1020 291
205 3300046458 Ga0495591_002894 Ga0495591_002894_5737_6627 291
206 3300046458 Ga0495591_004334 Ga0495591_004334_2322_3212 291
207 3300046460 Ga0495638_0073465 Ga0495638_0073465_510_1400 291
208 3300046460 Ga0495638_0116509 Ga0495638_0116509_319_1209 291
209 3300046471 Ga0495650_0026847 Ga0495650_0026847_1018_1908 291
210 3300046471 Ga0495650_0027956 Ga0495650_0027956_1106_1996 291
211 3300046471 Ga0495650_0051431 Ga0495650_0051431_703_1593 291
212 3300046474 Ga0495605_0000087 Ga0495605_0000087_108318_109211 291
213 3300046474 Ga0495605_0002562 Ga0495605_0002562_7738_8670 291
214 3300046474 Ga0495605_0015662 Ga0495605_0015662_2251_3141 291
215 3300046474 Ga0495605_0016867 Ga0495605_0016867_2239_3132 291
216 3300046474 Ga0495605_0019249 Ga0495605_0019249_2496_3434 291
217 3300046474 Ga0495605_0021524 Ga0495605_0021524_331_1230 291
218 3300046474 Ga0495605_0055290 Ga0495605_0055290_338_1228 291
219 3300046491 Ga0495584_0000813 Ga0495584_0000813_8523_9416 291
220 3300046491 Ga0495584_0003990 Ga0495584_0003990_2510_3400 291
221 3300046491 Ga0495584_0006470 Ga0495584_0006470_3020_3958 291
222 3300046491 Ga0495584_0009304 Ga0495584_0009304_470_1360 291
223 3300046491 Ga0495584_0025716 Ga0495584_0025716_2001_2894 291
224 3300046491 Ga0495584_0069803 Ga0495584_0069803_494_1384 291
225 3300046492 Ga0495585_0007671 Ga0495585_0007671_676_1566 291
226 3300046492 Ga0495585_0012937 Ga0495585_0012937_644_1534 291
227 3300046492 Ga0495585_0013686 Ga0495585_0013686_27_917 291
228 3300046492 Ga0495585_0023082 Ga0495585_0023082_34_924 291
229 3300046492 Ga0495585_0042498 Ga0495585_0042498_764_1654 291
230 3300046492 Ga0495585_0084259 Ga0495585_0084259_72_962 291
231 3300046499 Ga0495594_0079676 Ga0495594_0079676_924_1814 291
232 3300046499 Ga0495594_0123118 Ga0495594_0123118_404_1294 291
233 3300046500 Ga0495596_0003236 Ga0495596_0003236_5235_6125 291
234 3300046500 Ga0495596_0009635 Ga0495596_0009635_1175_2065 291
235 3300046500 Ga0495596_0018395 Ga0495596_0018395_812_1702 291
236 3300046500 Ga0495596_0022437 Ga0495596_0022437_85_975 291
237 3300046500 Ga0495596_0023437 Ga0495596_0023437_148_1038 291
238 3300046500 Ga0495596_0044175 Ga0495596_0044175_626_1516 291
239 3300046501 Ga0495607_0001898 Ga0495607_0001898_4985_5923 291
240 3300046501 Ga0495607_0006478 Ga0495607_0006478_4818_5750 291
241 3300046501 Ga0495607_0008162 Ga0495607_0008162_1988_2878 291
242 3300046501 Ga0495607_0011677 Ga0495607_0011677_3927_4817 291
243 3300046501 Ga0495607_0013881 Ga0495607_0013881_1745_2638 291
244 3300046501 Ga0495607_0018956 Ga0495607_0018956_2557_3450 291
245 3300046501 Ga0495607_0025339 Ga0495607_0025339_626_1519 291
246 3300046501 Ga0495607_0047224 Ga0495607_0047224_840_1730 291
247 3300046506 Ga0495583_0005862 Ga0495583_0005862_2469_3359 291
248 3300046506 Ga0495583_0006437 Ga0495583_0006437_2119_3249 291
249 3300046506 Ga0495583_0007028 Ga0495583_0007028_4238_5128 291
250 3300046506 Ga0495583_0010347 Ga0495583_0010347_3429_4319 291
251 3300046506 Ga0495583_0016846 Ga0495583_0016846_2002_2892 291
252 3300046506 Ga0495583_0030615 Ga0495583_0030615_293_1183 291
253 3300046506 Ga0495583_0037187 Ga0495583_0037187_375_1265 291
254 3300046506 Ga0495583_0053960 Ga0495583_0053960_486_1376 291
255 3300046507 Ga0495606_0001948 Ga0495606_0001948_4104_4997 291
256 3300046507 Ga0495606_0115166 Ga0495606_0115166_414_1397 291
257 3300046512 Ga0495610_0000798 Ga0495610_0000798_11265_12155 291
258 3300046512 Ga0495610_0124398 Ga0495610_0124398_175_1065 291
259 3300046513 Ga0495616_0005612 Ga0495616_0005612_1124_2014 291
260 3300046513 Ga0495616_0009688 Ga0495616_0009688_416_1306 291
261 3300046513 Ga0495616_0011654 Ga0495616_0011654_3851_4783 291
262 3300046513 Ga0495616_0015292 Ga0495616_0015292_144_1034 291
263 3300046513 Ga0495616_0034391 Ga0495616_0034391_712_1602 291
264 3300046513 Ga0495616_0038572 Ga0495616_0038572_751_1656 291
265 3300046513 Ga0495616_0042851 Ga0495616_0042851_1043_1933 291
266 3300046513 Ga0495616_0072843 Ga0495616_0072843_369_1259 291
267 3300046513 Ga0495616_0091211 Ga0495616_0091211_182_1072 291
268 3300046513 Ga0495616_0163251 Ga0495616_0163251_15_905 291
269 3300046518 Ga0495631_0001768 Ga0495631_0001768_7653_8543 291
270 3300046518 Ga0495631_0006939 Ga0495631_0006939_873_2003 291
271 3300046518 Ga0495631_0009335 Ga0495631_0009335_2128_3018 291
272 3300046518 Ga0495631_0009951 Ga0495631_0009951_2033_2965 291
273 3300046518 Ga0495631_0018957 Ga0495631_0018957_600_1490 291
274 3300046518 Ga0495631_0022959 Ga0495631_0022959_828_1718 291
275 3300046518 Ga0495631_0026427 Ga0495631_0026427_856_1746 291
276 3300046519 Ga0495632_0000040 Ga0495632_0000040_15654_16544 291
277 3300046519 Ga0495632_0001781 Ga0495632_0001781_13978_14868 291
278 3300046519 Ga0495632_0002113 Ga0495632_0002113_10040_10930 291
279 3300046519 Ga0495632_0004754 Ga0495632_0004754_3602_4492 291
280 3300046519 Ga0495632_0013510 Ga0495632_0013510_943_1881 291
281 3300046520 Ga0495637_0000006 Ga0495637_0000006_223018_223908 291
282 3300046520 Ga0495637_0025972 Ga0495637_0025972_1105_1995 291
283 3300046520 Ga0495637_0026217 Ga0495637_0026217_543_1433 291
284 3300046522 Ga0495643_0006661 Ga0495643_0006661_2557_3450 291
285 3300046522 Ga0495643_0008756 Ga0495643_0008756_1181_2071 291
286 3300046522 Ga0495643_0016451 Ga0495643_0016451_2036_3166 291
287 3300046522 Ga0495643_0056561 Ga0495643_0056561_569_1459 291
288 3300046523 Ga0495644_0001218 Ga0495644_0001218_7325_8257 291
289 3300046523 Ga0495644_0005269 Ga0495644_0005269_3389_4279 291
290 3300046523 Ga0495644_0011094 Ga0495644_0011094_2158_3048 291
291 3300046523 Ga0495644_0012232 Ga0495644_0012232_363_1301 291
292 3300046523 Ga0495644_0055915 Ga0495644_0055915_383_1273 291
293 3300046524 Ga0495648_0003910 Ga0495648_0003910_835_1728 291
294 3300046524 Ga0495648_0011629 Ga0495648_0011629_1135_2067 291
295 3300046524 Ga0495648_0042160 Ga0495648_0042160_861_1751 291
296 3300046524 Ga0495648_0058903 Ga0495648_0058903_471_1361 291
297 3300046524 Ga0495648_0064887 Ga0495648_0064887_354_1244 291
298 3300046524 Ga0495648_0089725 Ga0495648_0089725_56_946 291
299 3300046526 Ga0495666_0002189 Ga0495666_0002189_2891_3781 291
300 3300046528 Ga0495642_0000710 Ga0495642_0000710_7300_8232 291
301 3300046528 Ga0495642_0004317 Ga0495642_0004317_3751_4641 291
302 3300046528 Ga0495642_0005367 Ga0495642_0005367_3848_4738 291
303 3300046528 Ga0495642_0006326 Ga0495642_0006326_493_1431 291
304 3300046528 Ga0495642_0007109 Ga0495642_0007109_1337_2254 291
305 3300046528 Ga0495642_0020914 Ga0495642_0020914_1638_2528 291
306 3300046528 Ga0495642_0030059 Ga0495642_0030059_1016_1909 291
307 3300046528 Ga0495642_0036727 Ga0495642_0036727_721_1611 291
308 3300046528 Ga0495642_0053658 Ga0495642_0053658_128_1018 291
309 3300046530 Ga0495654_0008721 Ga0495654_0008721_4360_5292 291
310 3300046530 Ga0495654_0011039 Ga0495654_0011039_3233_4123 291
311 3300046530 Ga0495654_0029439 Ga0495654_0029439_768_1658 291
312 3300046530 Ga0495654_0041430 Ga0495654_0041430_487_1377 291
313 3300046531 Ga0495665_0178464 Ga0495665_0178464_170_1060 291
314 3300046535 Ga0495586_0090024 Ga0495586_0090024_13_903 291
315 3300046535 Ga0495586_0103417 Ga0495586_0103417_98_988 291
316 3300046538 Ga0495609_0000096 Ga0495609_0000096_88479_89372 291
317 3300046538 Ga0495609_0006196 Ga0495609_0006196_206_1096 291
318 3300046538 Ga0495609_0057557 Ga0495609_0057557_600_1490 291
319 3300046538 Ga0495609_0076875 Ga0495609_0076875_264_1154 291
320 3300046538 Ga0495609_0077675 Ga0495609_0077675_360_1250 291
321 3300046542 Ga0495597_0004773 Ga0495597_0004773_1265_2155 291
322 3300046542 Ga0495597_0007749 Ga0495597_0007749_209_1099 291
323 3300046542 Ga0495597_0080369 Ga0495597_0080369_74_964 291
324 3300046542 Ga0495597_0122875 Ga0495597_0122875_168_1058 291
325 3300046543 Ga0495645_0175708 Ga0495645_0175708_467_1390 291
326 3300046557 Ga0495622_0021426 Ga0495622_0021426_2088_2978 291
327 3300046558 Ga0495633_0001420 Ga0495633_0001420_8689_9603 291
328 3300046558 Ga0495633_0007930 Ga0495633_0007930_5116_6006 291
329 3300046558 Ga0495633_0009859 Ga0495633_0009859_210_1100 291
330 3300046558 Ga0495633_0011990 Ga0495633_0011990_15_905 291
331 3300046558 Ga0495633_0012148 Ga0495633_0012148_2471_3409 291
332 3300046558 Ga0495633_0102999 Ga0495633_0102999_405_1295 291
333 3300046615 Ga0495656_0038760 Ga0495656_0038760_527_1417 291
334 3300046616 Ga0495668_0001751 Ga0495668_0001751_4699_5589 291
335 3300046616 Ga0495668_0003117 Ga0495668_0003117_4670_5602 291
336 3300046616 Ga0495668_0007464 Ga0495668_0007464_1266_2156 291
337 3300046616 Ga0495668_0018078 Ga0495668_0018078_236_1126 291
338 3300046616 Ga0495668_0045422 Ga0495668_0045422_642_1532 291
339 3300046616 Ga0495668_0047075 Ga0495668_0047075_1365_2255 291
340 3300046616 Ga0495668_0076908 Ga0495668_0076908_51_941 291
341 3300046648 Ga0495611_0002775 Ga0495611_0002775_4396_5286 291
342 3300046648 Ga0495611_0019963 Ga0495611_0019963_873_1811 291
343 3300046648 Ga0495611_0030761 Ga0495611_0030761_868_1758 291
344 3300046648 Ga0495611_0045229 Ga0495611_0045229_888_1820 291
345 3300046648 Ga0495611_0057585 Ga0495611_0057585_140_1030 291
346 3300046648 Ga0495611_0079017 Ga0495611_0079017_516_1406 291
347 3300046660 Ga0495625_0057367 Ga0495625_0057367_893_1783 291
348 3300046660 Ga0495625_0072838 Ga0495625_0072838_1506_2396 291
349 3300046660 Ga0495625_0093704 Ga0495625_0093704_938_1828 291
350 3300046660 Ga0495625_0164871 Ga0495625_0164871_173_1063 291
351 3300046660 Ga0495625_0167763 Ga0495625_0167763_317_1207 291
352 3300046663 Ga0495635_0005894 Ga0495635_0005894_4598_5488 291
353 3300046664 Ga0495659_0013305 Ga0495659_0013305_826_1719 291
354 3300046665 Ga0495661_0000164 Ga0495661_0000164_65497_66390 291
355 3300046665 Ga0495661_0002296 Ga0495661_0002296_13093_13986 291
356 3300046665 Ga0495661_0010755 Ga0495661_0010755_4259_5149 291
357 3300046665 Ga0495661_0011758 Ga0495661_0011758_238_1128 291
358 3300046665 Ga0495661_0022220 Ga0495661_0022220_116_1006 291
359 3300046665 Ga0495661_0080843 Ga0495661_0080843_409_1302 291
360 3300046665 Ga0495661_0106905 Ga0495661_0106905_177_1067 291
361 3300046665 Ga0495661_0113293 Ga0495661_0113293_212_1150 291
362 3300046665 Ga0495661_0116795 Ga0495661_0116795_153_1043 291
363 3300046665 Ga0495661_0201940 Ga0495661_0201940_31_921 291
364 3300046674 Ga0495588_0000070 Ga0495588_0000070_27014_27907 291
365 3300046674 Ga0495588_0039682 Ga0495588_0039682_1441_2331 291
366 3300046674 Ga0495588_0137390 Ga0495588_0137390_190_1080 291
367 3300046684 Ga0495669_0000098 Ga0495669_0000098_16881_17771 291
368 3300046684 Ga0495669_0004576 Ga0495669_0004576_2467_3357 291
369 3300046684 Ga0495669_0005091 Ga0495669_0005091_4254_5186 291
370 3300046684 Ga0495669_0029797 Ga0495669_0029797_657_1547 291
371 3300046684 Ga0495669_0134013 Ga0495669_0134013_150_1040 291
372 3300046689 Ga0495613_0117145 Ga0495613_0117145_454_1344 291
373 3300046691 Ga0495670_0005657 Ga0495670_0005657_47_937 291
374 3300046691 Ga0495670_0013792 Ga0495670_0013792_2043_2933 291
375 3300046691 Ga0495670_0044741 Ga0495670_0044741_698_1588 291
376 3300046691 Ga0495670_0128413 Ga0495670_0128413_172_1062 291
377 3300046692 Ga0495671_0005249 Ga0495671_0005249_4204_5136 291
378 3300046692 Ga0495671_0010836 Ga0495671_0010836_276_1166 291
379 3300046692 Ga0495671_0037701 Ga0495671_0037701_1279_2169 291
380 3300046692 Ga0495671_0092472 Ga0495671_0092472_300_1190 291
381 3300046694 Ga0495649_0002569 Ga0495649_0002569_9243_10133 291
382 3300046694 Ga0495649_0009456 Ga0495649_0009456_3722_4852 291
383 3300046694 Ga0495649_0034656 Ga0495649_0034656_1642_2532 291
384 3300046694 Ga0495649_0043028 Ga0495649_0043028_15_905 291
385 3300046694 Ga0495649_0065269 Ga0495649_0065269_892_1785 291
386 3300046694 Ga0495649_0122810 Ga0495649_0122810_64_954 291
387 3300046794 Ga0495589_0000036 Ga0495589_0000036_12263_13156 291
388 3300046794 Ga0495589_0000092 Ga0495589_0000092_57165_58058 291
389 3300046794 Ga0495589_0004004 Ga0495589_0004004_2429_3361 291
390 3300046794 Ga0495589_0005614 Ga0495589_0005614_1112_2002 291
391 3300046794 Ga0495589_0008837 Ga0495589_0008837_3703_4593 291
392 3300046794 Ga0495589_0038033 Ga0495589_0038033_941_1831 291
393 3300046794 Ga0495589_0038115 Ga0495589_0038115_273_1211 291
394 3300046794 Ga0495589_0062376 Ga0495589_0062376_557_1447 291
395 3300046810 Ga0495660_0000117 Ga0495660_0000117_13248_14141 291
396 3300046810 Ga0495660_0009049 Ga0495660_0009049_129_1112 291
397 3300046810 Ga0495660_0014900 Ga0495660_0014900_2591_3481 291
398 3300046810 Ga0495660_0015540 Ga0495660_0015540_484_1374 291
399 3300046810 Ga0495660_0015664 Ga0495660_0015664_2302_3192 291
400 3300046810 Ga0495660_0015865 Ga0495660_0015865_3146_4084 291
401 3300046810 Ga0495660_0137782 Ga0495660_0137782_110_1000 291
402 3300046810 Ga0495660_0204384 Ga0495660_0204384_23_913 291
403 3300047315 Ga0495581_0032837 Ga0495581_0032837_1791_2681 291
404 3300047318 Ga0495636_0082485 Ga0495636_0082485_121_1011 291
405 3300047320 Ga0495672_0000086 Ga0495672_0000086_136945_137835 291
406 3300047320 Ga0495672_0002132 Ga0495672_0002132_2155_3045 291
407 3300047320 Ga0495672_0003870 Ga0495672_0003870_24_917 291
408 3300047320 Ga0495672_0004394 Ga0495672_0004394_9155_10045 291
409 3300047320 Ga0495672_0051155 Ga0495672_0051155_146_1036 291
410 3300047320 Ga0495672_0110252 Ga0495672_0110252_174_1112 291
411 3300047321 Ga0495676_0000035 Ga0495676_0000035_17307_18197 291
412 3300047322 Ga0495680_0080561 Ga0495680_0080561_1028_1918 291
413 3300047323 Ga0495683_0000080 Ga0495683_0000080_78837_79727 291
414 3300047323 Ga0495683_0007215 Ga0495683_0007215_3117_4055 291
415 3300047323 Ga0495683_0011985 Ga0495683_0011985_351_1241 291
416 3300047323 Ga0495683_0063128 Ga0495683_0063128_467_1357 291
417 3300047323 Ga0495683_0141247 Ga0495683_0141247_91_984 291
418 3300047323 Ga0495683_0163446 Ga0495683_0163446_28_921 291
419 3300047443 Ga0495687_000074 Ga0495687_000074_12402_13295 291
420 3300047443 Ga0495687_000154 Ga0495687_000154_91214_92104 291
421 3300047443 Ga0495687_001753 Ga0495687_001753_5976_6866 291
422 3300047443 Ga0495687_002544 Ga0495687_002544_2700_3593 291
423 3300047443 Ga0495687_002568 Ga0495687_002568_10943_11836 291
424 3300047443 Ga0495687_006358 Ga0495687_006358_3924_4814 291
425 3300047444 Ga0495675_0022159 Ga0495675_0022159_2856_3746 291
426 3300047445 Ga0495677_0000037 Ga0495677_0000037_65544_66437 291
427 3300047445 Ga0495677_0002039 Ga0495677_0002039_4703_5593 291
428 3300047445 Ga0495677_0003775 Ga0495677_0003775_4558_5451 291
429 3300047445 Ga0495677_0004085 Ga0495677_0004085_4362_5294 291
430 3300047445 Ga0495677_0037715 Ga0495677_0037715_328_1218 291
431 3300047446 Ga0495679_002040 Ga0495679_002040_1405_2343 291
432 3300047446 Ga0495679_003539 Ga0495679_003539_2183_3073 291
433 3300047447 Ga0495685_002172 Ga0495685_002172_1168_2058 291
434 3300047447 Ga0495685_037677 Ga0495685_037677_253_1143 291
435 3300047470 Ga0495681_0007151 Ga0495681_0007151_2073_2963 291
436 3300047470 Ga0495681_0008429 Ga0495681_0008429_4441_5331 291
437 3300047470 Ga0495681_0010334 Ga0495681_0010334_3918_4808 291
438 3300047470 Ga0495681_0012695 Ga0495681_0012695_3822_4712 291
439 3300047470 Ga0495681_0037048 Ga0495681_0037048_286_1176 291
440 3300047470 Ga0495681_0041881 Ga0495681_0041881_407_1345 291
441 3300047470 Ga0495681_0110414 Ga0495681_0110414_187_1077 291
442 3300047470 Ga0495681_0121841 Ga0495681_0121841_68_958 291
443 3300047472 Ga0495686_0000054 Ga0495686_0000054_187925_188839 291
444 3300047472 Ga0495686_0000987 Ga0495686_0000987_29065_29955 291
445 3300047472 Ga0495686_0033660 Ga0495686_0033660_596_1489 291
446 3300047472 Ga0495686_0045075 Ga0495686_0045075_1072_2004 291
447 3300047673 Ga0495593_0011137 Ga0495593_0011137_1286_2176 291
448 3300048089 Ga0495614_0003662 Ga0495614_0003662_1090_1980 291
449 3300048091 Ga0495626_0000006 Ga0495626_0000006_134996_135889 291
450 3300048091 Ga0495626_0004120 Ga0495626_0004120_5734_6627 291
451 3300048091 Ga0495626_0014843 Ga0495626_0014843_844_1827 291
452 3300048091 Ga0495626_0017504 Ga0495626_0017504_647_1546 291
453 3300048091 Ga0495626_0048741 Ga0495626_0048741_82_972 291
454 3300048091 Ga0495626_0064012 Ga0495626_0064012_404_1342 291
455 3300048091 Ga0495626_0087447 Ga0495626_0087447_338_1228 291
456 3300048903 Ga0496100_0006427 Ga0496100_0006427_4622_5512 291
457 3300048903 Ga0496100_0089620 Ga0496100_0089620_726_1619 291
458 3300048905 Ga0496102_0000152 Ga0496102_0000152_5168_6058 291
459 3300048905 Ga0496102_0015513 Ga0496102_0015513_1552_2448 291
460 3300048906 Ga0496103_0070892 Ga0496103_0070892_255_1145 291
461 3300048906 Ga0496103_0218562 Ga0496103_0218562_140_1033 291
462 3300048907 Ga0496104_0142955 Ga0496104_0142955_528_1421 291
463 3300048909 Ga0496106_0069488 Ga0496106_0069488_1229_2122 291
464 3300048911 Ga0496108_0128925 Ga0496108_0128925_105_1085 291
465 3300048912 Ga0496109_0056995 Ga0496109_0056995_778_1668 291
466 3300048912 Ga0496109_0158650 Ga0496109_0158650_742_1632 291
467 3300048914 Ga0496111_0015421 Ga0496111_0015421_3049_3942 291
468 3300048916 Ga0496113_0094541 Ga0496113_0094541_1138_2028 291
469 3300048917 Ga0496114_0287696 Ga0496114_0287696_308_1201 291
470 3300048919 Ga0496116_0038067 Ga0496116_0038067_2172_3065 291
471 3300048920 Ga0496117_0000056 Ga0496117_0000056_250876_251769 291
472 3300048921 Ga0496118_0000047 Ga0496118_0000047_19649_20542 291
473 3300048924 Ga0496121_0021646 Ga0496121_0021646_3652_4545 291
474 3300048924 Ga0496121_0023195 Ga0496121_0023195_1449_2342 291
475 3300048925 Ga0496122_0001315 Ga0496122_0001315_31688_32578 291
476 3300048925 Ga0496122_0019287 Ga0496122_0019287_3532_4425 291
477 3300048925 Ga0496122_0031942 Ga0496122_0031942_1583_2479 291
478 3300048925 Ga0496122_0125750 Ga0496122_0125750_684_1577 291
479 3300048926 Ga0496123_0000851 Ga0496123_0000851_32428_33318 291
480 3300048926 Ga0496123_0015045 Ga0496123_0015045_5063_5956 291
481 3300048926 Ga0496123_0028518 Ga0496123_0028518_749_1642 291
482 3300048926 Ga0496123_0067313 Ga0496123_0067313_1345_2235 291
483 3300048926 Ga0496123_0106297 Ga0496123_0106297_181_1077 291
484 3300048927 Ga0496124_0047187 Ga0496124_0047187_1720_2613 291
485 3300048927 Ga0496124_0061207 Ga0496124_0061207_264_1160 291
486 3300048927 Ga0496124_0145268 Ga0496124_0145268_538_1428 291
487 3300048928 Ga0496125_0010518 Ga0496125_0010518_7288_8178 291
488 3300048928 Ga0496125_0071692 Ga0496125_0071692_1329_2225 291
489 3300048928 Ga0496125_0102010 Ga0496125_0102010_792_1706 291
490 3300049459 Ga0495678_001072 Ga0495678_001072_7753_8643 291
491 3300049459 Ga0495678_003443 Ga0495678_003443_4231_5121 291
492 3300049459 Ga0495678_005143 Ga0495678_005143_2210_3100 291
493 3300049459 Ga0495678_009918 Ga0495678_009918_950_1888 291
494 3300049459 Ga0495678_030309 Ga0495678_030309_957_1847 291
495 3300049460 Ga0495682_0002360 Ga0495682_0002360_5448_6362 291
496 3300049460 Ga0495682_0003356 Ga0495682_0003356_2065_2955 291
497 3300049460 Ga0495682_0009849 Ga0495682_0009849_2084_2974 291
498 3300049460 Ga0495682_0038006 Ga0495682_0038006_474_1364 291
499 3300049822 Ga0501035_0003423 Ga0501035_0003423_11940_12833 291
500 3300050491 nmdc:mga00v17_90164_c1 nmdc:mga00v17_90164_c1_933_1823 291
501 iso_pu_bacteria 2643221556 2643797745 291
502 iso_pu_bacteria 2643221684 2644470473 291
503 iso_pu_bacteria 8056137416 8056142302 291
504 3300003771 Ga0055526_1000092 Ga0055526_100009271 292
505 3300005289 Ga0065704_10072806 Ga0065704_100728066 292
506 3300006944 Ga0099823_1000188 Ga0099823_100018831 292
507 3300009036 Ga0105244_10001306 Ga0105244_1000130610 292
508 3300009036 Ga0105244_10002830 Ga0105244_100028307 292
509 3300009036 Ga0105244_10004135 Ga0105244_1000413510 292
510 3300009036 Ga0105244_10022995 Ga0105244_100229954 292
511 3300009092 Ga0105250_10000222 Ga0105250_1000022213 292
512 3300009148 Ga0105243_10007339 Ga0105243_1000733910 292
513 3300013100 Ga0157373_10008160 Ga0157373_100081608 292
514 3300013105 Ga0157369_10027361 Ga0157369_100273617 292
515 3300015262 Ga0182007_10002310 Ga0182007_100023107 292
516 3300025246 Ga0209646_1000010 Ga0209646_1000010153 292
517 3300025292 Ga0209676_1000805 Ga0209676_100080537 292
518 3300025295 Ga0209564_1000033 Ga0209564_1000033331 292
519 3300025711 Ga0207696_1000022 Ga0207696_1000022370 292
520 3300025711 Ga0207696_1000265 Ga0207696_100026545 292
521 3300025711 Ga0207696_1026989 Ga0207696_10269892 292
522 3300025728 Ga0207655_1000162 Ga0207655_1000162112 292
523 3300025728 Ga0207655_1000383 Ga0207655_100038316 292
524 3300025728 Ga0207655_1002794 Ga0207655_10027943 292
525 3300025728 Ga0207655_1003043 Ga0207655_10030434 292
526 3300025935 Ga0207709_10013448 Ga0207709_100134483 292
527 3300027296 Ga0209389_1000002 Ga0209389_100000214 292
528 3300042006 Ga0439432_002855 Ga0439432_002855_779_1660 292
529 3300042142 Ga0450905_000588 Ga0450905_000588_158_1039 292
530 3300044683 Ga0466965_0006059 Ga0466965_0006059_1336_2256 292
531 3300044901 Ga0466960_0032635 Ga0466960_0032635_557_1477 292
532 3300046452 Ga0495617_007530 Ga0495617_007530_2267_3163 292
533 3300046460 Ga0495638_0000184 Ga0495638_0000184_9318_10220 292
534 3300046471 Ga0495650_0005435 Ga0495650_0005435_4043_4945 292
535 3300046475 Ga0495639_0008939 Ga0495639_0008939_3166_4068 292
536 3300046506 Ga0495583_0000119 Ga0495583_0000119_85054_85956 292
537 3300046507 Ga0495606_0000500 Ga0495606_0000500_42718_43614 292
538 3300046507 Ga0495606_0062724 Ga0495606_0062724_1137_2033 292
539 3300046512 Ga0495610_0003717 Ga0495610_0003717_4949_5845 292
540 3300046512 Ga0495610_0014886 Ga0495610_0014886_2778_3674 292
541 3300046512 Ga0495610_0020972 Ga0495610_0020972_2098_2994 292
542 3300046512 Ga0495610_0034419 Ga0495610_0034419_1042_1950 292
543 3300046512 Ga0495610_0037766 Ga0495610_0037766_43_933 292
544 3300046512 Ga0495610_0045222 Ga0495610_0045222_230_1138 292
545 3300046515 Ga0495620_0000052 Ga0495620_0000052_22193_23092 292
546 3300046519 Ga0495632_0000540 Ga0495632_0000540_17969_18868 292
547 3300046520 Ga0495637_0013284 Ga0495637_0013284_1678_2574 292
548 3300046522 Ga0495643_0000282 Ga0495643_0000282_67791_68687 292
549 3300046522 Ga0495643_0001593 Ga0495643_0001593_7121_8002 292
550 3300046522 Ga0495643_0001686 Ga0495643_0001686_6340_7239 292
551 3300046522 Ga0495643_0002102 Ga0495643_0002102_9630_10532 292
552 3300046524 Ga0495648_0000001 Ga0495648_0000001_94362_95264 292
553 3300046524 Ga0495648_0000611 Ga0495648_0000611_15192_16091 292
554 3300046524 Ga0495648_0014218 Ga0495648_0014218_2670_3566 292
555 3300046530 Ga0495654_0040385 Ga0495654_0040385_1151_2041 292
556 3300046538 Ga0495609_0012497 Ga0495609_0012497_513_1415 292
557 3300046538 Ga0495609_0018943 Ga0495609_0018943_191_1087 292
558 3300046542 Ga0495597_0000726 Ga0495597_0000726_16801_17703 292
559 3300046542 Ga0495597_0001884 Ga0495597_0001884_8391_9287 292
560 3300046557 Ga0495622_0000087 Ga0495622_0000087_55810_56712 292
561 3300046558 Ga0495633_0000171 Ga0495633_0000171_20997_21899 292
562 3300046558 Ga0495633_0000188 Ga0495633_0000188_17194_18099 292
563 3300046558 Ga0495633_0003725 Ga0495633_0003725_3014_3910 292
564 3300046558 Ga0495633_0013787 Ga0495633_0013787_1810_2742 292
565 3300046558 Ga0495633_0035964 Ga0495633_0035964_1320_2216 292
566 3300046660 Ga0495625_0000164 Ga0495625_0000164_5977_6879 292
567 3300046660 Ga0495625_0043244 Ga0495625_0043244_177_1073 292
568 3300046660 Ga0495625_0151063 Ga0495625_0151063_477_1373 292
569 3300046694 Ga0495649_0002551 Ga0495649_0002551_8923_9819 292
570 3300046694 Ga0495649_0046819 Ga0495649_0046819_1414_2310 292
571 3300046810 Ga0495660_0044048 Ga0495660_0044048_578_1480 292
572 3300047320 Ga0495672_0000187 Ga0495672_0000187_69130_70026 292
573 3300048906 Ga0496103_0002518 Ga0496103_0002518_2874_3770 292
574 3300048917 Ga0496114_0001680 Ga0496114_0001680_3580_4461 292
575 3300048919 Ga0496116_0003215 Ga0496116_0003215_5459_6358 292
576 3300048920 Ga0496117_0001893 Ga0496117_0001893_22202_23101 292
577 3300048920 Ga0496117_0003106 Ga0496117_0003106_11972_12853 292
578 3300048920 Ga0496117_0054998 Ga0496117_0054998_168_1058 292
579 3300048921 Ga0496118_0005238 Ga0496118_0005238_9299_10180 292
580 3300048921 Ga0496118_0038630 Ga0496118_0038630_818_1708 292
581 3300048924 Ga0496121_0113056 Ga0496121_0113056_368_1249 292
582 3300048924 Ga0496121_0146500 Ga0496121_0146500_487_1368 292
583 3300048925 Ga0496122_0006167 Ga0496122_0006167_4053_4934 292
584 3300048926 Ga0496123_0001824 Ga0496123_0001824_23056_23937 292
585 3300048927 Ga0496124_0006805 Ga0496124_0006805_8496_9377 292
586 3300049459 Ga0495678_000226 Ga0495678_000226_51193_52089 292
587 3300049459 Ga0495678_003543 Ga0495678_003543_6353_7231 292
588 3300049459 Ga0495678_003967 Ga0495678_003967_5596_6498 292
589 3300049571 Ga0501034_0000330 Ga0501034_0000330_65894_66775 292
590 3300049766 Ga0501269_000023 Ga0501269_000023_18997_19905 292
591 3300053118 Ga0500594_0004979 Ga0500594_0004979_979_1875 292
592 3300053135 Ga0500659_0001851 Ga0500659_0001851_9342_10223 292
593 3300053145 Ga0500586_000036 Ga0500586_000036_19247_20143 292
594 iso_pu_bacteria 2842733646 2842736145 292
595 iso_pu_bacteria 2929199973 2929203765 292
596 iso_pu_bacteria 8055909800 8055915937 292
597 3300009011 Ga0105251_10026669 Ga0105251_100266693 293
598 3300015261 Ga0182006_1000026 Ga0182006_1000026139 293
599 3300015261 Ga0182006_1004027 Ga0182006_10040274 293
600 3300015265 Ga0182005_1000007 Ga0182005_1000007240 293
601 3300042137 Ga0450902_003715 Ga0450902_003715_970_1854 293
602 3300042142 Ga0450905_000328 Ga0450905_000328_228_1112 293
603 3300042533 Ga0450901_000315 Ga0450901_000315_732_1616 293
604 3300046453 Ga0495627_000007 Ga0495627_000007_530970_531896 293
605 3300046455 Ga0495603_0033289 Ga0495603_0033289_1846_2730 293
606 3300046507 Ga0495606_0001158 Ga0495606_0001158_20736_21620 293
607 3300046522 Ga0495643_0001974 Ga0495643_0001974_11044_11928 293
608 3300046522 Ga0495643_0002637 Ga0495643_0002637_8484_9368 293
609 3300046538 Ga0495609_0000783 Ga0495609_0000783_2787_3713 293
610 3300046660 Ga0495625_0094147 Ga0495625_0094147_10_894 293
611 3300046694 Ga0495649_0001815 Ga0495649_0001815_3780_4664 293
612 3300046694 Ga0495649_0040018 Ga0495649_0040018_1652_2536 293
613 3300046694 Ga0495649_0065045 Ga0495649_0065045_33_917 293
614 3300046810 Ga0495660_0000215 Ga0495660_0000215_31986_32912 293
615 3300046810 Ga0495660_0002403 Ga0495660_0002403_2971_3885 293
616 3300046810 Ga0495660_0018174 Ga0495660_0018174_2244_3128 293
617 3300047321 Ga0495676_0017698 Ga0495676_0017698_1210_2094 293
618 3300047469 Ga0495673_0000395 Ga0495673_0000395_6659_7549 293
619 3300047470 Ga0495681_0011942 Ga0495681_0011942_3150_4064 293
620 3300047470 Ga0495681_0031686 Ga0495681_0031686_1162_2067 293
621 3300048913 Ga0496110_0081513 Ga0496110_0081513_490_1374 293
622 3300048917 Ga0496114_0003874 Ga0496114_0003874_9804_10688 293
623 3300048919 Ga0496116_0024112 Ga0496116_0024112_2550_3476 293
624 3300048925 Ga0496122_0030520 Ga0496122_0030520_2457_3341 293
625 3300048926 Ga0496123_0018392 Ga0496123_0018392_3156_4040 293
626 3300048927 Ga0496124_0022612 Ga0496124_0022612_3297_4181 293
627 3300048927 Ga0496124_0062130 Ga0496124_0062130_639_1523 293
628 3300048927 Ga0496124_0151010 Ga0496124_0151010_45_959 293
629 3300048928 Ga0496125_0024295 Ga0496125_0024295_64_948 293
630 3300048929 Ga0496126_0025933 Ga0496126_0025933_22_906 293
631 3300049459 Ga0495678_000004 Ga0495678_000004_476345_477259 293
632 3300049459 Ga0495678_028661 Ga0495678_028661_1003_1887 293
633 3300053125 Ga0500618_001435 Ga0500618_001435_2278_3162 293
634 3300053145 Ga0500586_073843 Ga0500586_073843_13_897 293
635 iso_pu_bacteria 2599185307 2599974342 293
636 iso_pu_bacteria 2643221611 2644074302 293
637 3300003322 rootL2_10207153 rootL2_102071531 294
638 3300005331 Ga0070670_100001744 Ga0070670_10000174415 294
639 3300005355 Ga0070671_100209294 Ga0070671_1002092941 294
640 3300006051 Ga0075364_10013194 Ga0075364_100131945 294
641 3300025250 Ga0209026_1004971 Ga0209026_10049713 294
642 3300025735 Ga0207713_1000238 Ga0207713_100023851 294
643 3300025925 Ga0207650_10000276 Ga0207650_1000027626 294
644 3300027312 Ga0209371_1000409 Ga0209371_100040933 294
645 3300030500 Ga0268256_1000350 Ga0268256_100035012 294
646 3300032004 Ga0307414_10051354 Ga0307414_100513543 294
647 3300042013 Ga0439456_000013 Ga0439456_000013_23516_24448 294
648 3300046507 Ga0495606_0043260 Ga0495606_0043260_1776_2672 294
649 3300046542 Ga0495597_0035118 Ga0495597_0035118_1022_1918 294
650 3300048922 Ga0496119_0000199 Ga0496119_0000199_18166_19053 294
651 3300048923 Ga0496120_0000840 Ga0496120_0000840_38046_38933 294
652 3300048927 Ga0496124_0062912 Ga0496124_0062912_1965_2852 294
653 iso_pu_bacteria 2519103095 2519461377 294
654 iso_pu_bacteria 2582581311 2585290843 294
655 iso_pu_bacteria 2599185239 2599734638 294
656 iso_pu_bacteria 2599185240 2599745541 294
657 iso_pu_bacteria 2599185355 2600207448 294
658 iso_pu_bacteria 2643221609 2644062997 294
659 iso_pu_bacteria 2675903129 2676741264 294
660 iso_pu_bacteria 2739367655 2739613104 294
661 iso_pu_bacteria 2808606384 2808969327 294
662 iso_pu_bacteria 2808606390 2809004158 294
663 iso_pu_bacteria 2816332253 2817258282 294
664 iso_pu_bacteria 2816332256 2817281304 294
665 iso_pu_bacteria 2816332286 2817452008 294
666 iso_pu_bacteria 2818991452 2819634437 294
667 iso_pu_bacteria 2863421361 2863426751 294
668 iso_pu_bacteria 2870068957 2870075226 294
669 iso_pu_bacteria 2887375801 2887376014 294
670 iso_pu_bacteria 2904564687 2904570651 294
671 iso_pu_bacteria 2904571731 2904577828 294
672 iso_pu_bacteria 2928157003 2928159003 294
673 iso_pu_bacteria 2928163908 2928167826 294
674 iso_pu_bacteria 2928170801 2928178098 294
675 iso_pu_bacteria 2928536128 2928537983 294
676 iso_pu_bacteria 2981990288 2981992380 294
677 iso_pu_bacteria 641736154 642419967 294
678 iso_pu_bacteria 8018845410 8018846602 294
679 iso_pu_bacteria 8020807995 8020810333 294
680 iso_pu_bacteria 8020938398 8020941768 294
681 iso_pu_bacteria 8020945358 8020945666 294
682 iso_pu_bacteria 8020953355 8020958757 294
683 iso_pu_bacteria 8021120328 8021121668 294
684 iso_pu_bacteria 8039098773 8039103854 294
685 iso_pu_bacteria 8040167225 8040167376 294
686 iso_pu_bacteria 8040173305 8040175387 294
687 3300003771 Ga0055526_1000729 Ga0055526_100072918 295
688 3300003773 Ga0055537_1000078 Ga0055537_10000789 295
689 3300003775 Ga0055524_1000053 Ga0055524_100005346 295
690 3300003775 Ga0055524_1005701 Ga0055524_10057013 295
691 3300003784 Ga0055534_1000070 Ga0055534_10000702 295
692 3300003784 Ga0055534_1000105 Ga0055534_100010548 295
693 3300003790 Ga0055528_1000224 Ga0055528_100022437 295
694 3300006177 Ga0075362_10085390 Ga0075362_100853902 295
695 3300006186 Ga0075369_10078426 Ga0075369_100784262 295
696 3300006948 Ga0099826_10000006 Ga0099826_1000000687 295
697 3300013308 Ga0157375_10217409 Ga0157375_102174092 295
698 3300025263 Ga0209565_1000035 Ga0209565_1000035235 295
699 3300025263 Ga0209565_1008777 Ga0209565_10087772 295
700 3300025273 Ga0209673_1000006 Ga0209673_1000006325 295
701 3300025291 Ga0209675_1000005 Ga0209675_1000005447 295
702 3300025295 Ga0209564_1000083 Ga0209564_1000083189 295
703 3300025295 Ga0209564_1022670 Ga0209564_10226702 295
704 3300025299 Ga0209256_1000035 Ga0209256_1000035320 295
705 3300025299 Ga0209256_1000322 Ga0209256_100032252 295
706 3300027666 Ga0209282_1000003 Ga0209282_1000003285 295
707 3300029957 Ga0265324_10037821 Ga0265324_100378212 295
708 3300041404 Ga0439436_0001618 Ga0439436_0001618_1103_1990 295
709 3300041406 Ga0439439_0016478 Ga0439439_0016478_261_1148 295
710 3300041410 Ga0439461_0005413 Ga0439461_0005413_822_1709 295
711 3300041411 Ga0439466_0018680 Ga0439466_0018680_1178_2065 295
712 3300041999 Ga0439433_0010314 Ga0439433_0010314_1004_1891 295
713 3300042006 Ga0439432_006062 Ga0439432_006062_2265_3152 295
714 3300042007 Ga0439449_0010235 Ga0439449_0010235_412_1299 295
715 3300042010 Ga0439452_009145 Ga0439452_009145_437_1324 295
716 3300042125 Ga0450923_000481 Ga0450923_000481_688_1575 295
717 3300042146 Ga0450907_014675 Ga0450907_014675_336_1223 295
718 3300042156 Ga0439446_0019725 Ga0439446_0019725_681_1568 295
719 3300042184 Ga0450908_014599 Ga0450908_014599_43_930 295
720 3300042435 Ga0439434_0027885 Ga0439434_0027885_505_1392 295
721 3300044683 Ga0466965_0204187 Ga0466965_0204187_85_984 295
722 3300044765 Ga0466970_0015384 Ga0466970_0015384_1570_2469 295
723 3300046501 Ga0495607_0080931 Ga0495607_0080931_263_1177 295
724 3300046506 Ga0495583_0004613 Ga0495583_0004613_5582_6496 295
725 3300046513 Ga0495616_0053968 Ga0495616_0053968_625_1539 295
726 3300046524 Ga0495648_0184944 Ga0495648_0184944_14_928 295
727 3300046530 Ga0495654_0032023 Ga0495654_0032023_1722_2645 295
728 3300046538 Ga0495609_0000164 Ga0495609_0000164_23487_24401 295
729 3300046542 Ga0495597_0054866 Ga0495597_0054866_378_1292 295
730 3300046616 Ga0495668_0086579 Ga0495668_0086579_642_1556 295
731 3300046684 Ga0495669_0016763 Ga0495669_0016763_1378_2292 295
732 3300046694 Ga0495649_0166040 Ga0495649_0166040_31_945 295
733 3300046810 Ga0495660_0088433 Ga0495660_0088433_451_1365 295
734 3300047446 Ga0495679_007583 Ga0495679_007583_2382_3296 295
735 3300047447 Ga0495685_025478 Ga0495685_025478_698_1612 295
736 3300047470 Ga0495681_0012679 Ga0495681_0012679_152_1066 295
737 3300047472 Ga0495686_0008973 Ga0495686_0008973_1188_2087 295
738 3300048924 Ga0496121_0003376 Ga0496121_0003376_16194_17123 295
739 3300048928 Ga0496125_0000826 Ga0496125_0000826_27052_27981 295
740 3300048928 Ga0496125_0026908 Ga0496125_0026908_1498_2427 295
741 3300049459 Ga0495678_084503 Ga0495678_084503_119_1033 295
742 3300053161 Ga0500634_0072763 Ga0500634_0072763_523_1452 295
743 3300005289 Ga0065704_10075896 Ga0065704_100758964 296
744 3300005335 Ga0070666_10182737 Ga0070666_101827371 296
745 3300005367 Ga0070667_100034706 Ga0070667_1000347063 296
746 3300005456 Ga0070678_100023362 Ga0070678_1000233624 296
747 3300005543 Ga0070672_100463714 Ga0070672_1004637141 296
748 3300005616 Ga0068852_100621619 Ga0068852_1006216192 296
749 3300009036 Ga0105244_10007475 Ga0105244_100074753 296
750 3300009092 Ga0105250_10108438 Ga0105250_101084382 296
751 3300009551 Ga0105238_10486992 Ga0105238_104869921 296
752 3300013306 Ga0163162_10044544 Ga0163162_100445445 296
753 3300013308 Ga0157375_10514023 Ga0157375_105140232 296
754 3300014497 Ga0182008_10028309 Ga0182008_100283092 296
755 3300015261 Ga0182006_1041261 Ga0182006_10412612 296
756 3300015262 Ga0182007_10000918 Ga0182007_100009183 296
757 3300015683 Ga0183362_10001 Ga0183362_10001935 296
758 3300017792 Ga0163161_10031248 Ga0163161_100312485 296
759 3300017792 Ga0163161_10062850 Ga0163161_100628502 296
760 3300025711 Ga0207696_1054074 Ga0207696_10540742 296
761 3300025924 Ga0207694_10322750 Ga0207694_103227502 296
762 3300025940 Ga0207691_10084306 Ga0207691_100843064 296
763 3300025940 Ga0207691_10458002 Ga0207691_104580021 296
764 3300025986 Ga0207658_10013681 Ga0207658_100136815 296
765 3300028794 Ga0307515_10003602 Ga0307515_1000360229 296
766 3300030522 Ga0307512_10098188 Ga0307512_100981882 296
767 3300031251 Ga0265327_10000777 Ga0265327_1000077731 296
768 3300031456 Ga0307513_10014794 Ga0307513_100147944 296
769 3300031649 Ga0307514_10000408 Ga0307514_1000040854 296
770 3300046475 Ga0495639_0054578 Ga0495639_0054578_878_1771 296
771 3300046528 Ga0495642_0008224 Ga0495642_0008224_2511_3407 296
772 3300046539 Ga0495621_0019608 Ga0495621_0019608_316_1221 296
773 3300046543 Ga0495645_0032588 Ga0495645_0032588_456_1349 296
774 3300046615 Ga0495656_0006134 Ga0495656_0006134_1970_2875 296
775 3300046684 Ga0495669_0135256 Ga0495669_0135256_130_1026 296
776 3300046691 Ga0495670_0051685 Ga0495670_0051685_904_1809 296
777 3300048089 Ga0495614_0033016 Ga0495614_0033016_65_958 296
778 3300048903 Ga0496100_0022301 Ga0496100_0022301_1592_2485 296
779 3300048904 Ga0496101_0015959 Ga0496101_0015959_4031_4924 296
780 3300048905 Ga0496102_0001102 Ga0496102_0001102_7977_8870 296
781 3300048907 Ga0496104_0522943 Ga0496104_0522943_105_1001 296
782 3300048909 Ga0496106_0338308 Ga0496106_0338308_160_1053 296
783 3300048910 Ga0496107_0017162 Ga0496107_0017162_2746_3639 296
784 3300048911 Ga0496108_0082384 Ga0496108_0082384_1018_1914 296
785 3300048912 Ga0496109_0255555 Ga0496109_0255555_658_1554 296
786 3300048915 Ga0496112_0622091 Ga0496112_0622091_40_936 296
787 3300048917 Ga0496114_0172339 Ga0496114_0172339_90_983 296
788 3300048920 Ga0496117_0001733 Ga0496117_0001733_4887_5798 296
789 3300048921 Ga0496118_0002944 Ga0496118_0002944_10073_10984 296
790 3300048922 Ga0496119_0045772 Ga0496119_0045772_1483_2394 296
791 3300048924 Ga0496121_0091303 Ga0496121_0091303_1045_1956 296
792 3300048924 Ga0496121_0128826 Ga0496121_0128826_510_1403 296
793 3300048927 Ga0496124_0000004 Ga0496124_0000004_871911_872804 296
794 3300048927 Ga0496124_0115756 Ga0496124_0115756_58_969 296
795 3300048928 Ga0496125_0000240 Ga0496125_0000240_88083_88994 296
796 3300009011 Ga0105251_10000623 Ga0105251_1000062319 297
797 3300009011 Ga0105251_10001933 Ga0105251_1000193311 297
798 3300009011 Ga0105251_10007562 Ga0105251_100075623 297
799 3300009011 Ga0105251_10048315 Ga0105251_100483151 297
800 3300009036 Ga0105244_10065908 Ga0105244_100659081 297
801 3300009092 Ga0105250_10042939 Ga0105250_100429392 297
802 3300015265 Ga0182005_1010923 Ga0182005_10109232 297
803 3300025735 Ga0207713_1000481 Ga0207713_100048119 297
804 3300025735 Ga0207713_1003042 Ga0207713_10030424 297
805 3300025735 Ga0207713_1003804 Ga0207713_10038044 297
806 3300025735 Ga0207713_1072423 Ga0207713_10724232 297
807 3300042016 Ga0439463_000115 Ga0439463_000115_10832_11755 297
808 3300046453 Ga0495627_000373 Ga0495627_000373_17881_18843 297
809 3300046453 Ga0495627_046028 Ga0495627_046028_62_985 297
810 3300046458 Ga0495591_000640 Ga0495591_000640_15924_16847 297
811 3300046458 Ga0495591_000907 Ga0495591_000907_7240_8163 297
812 3300046458 Ga0495591_001426 Ga0495591_001426_7483_8406 297
813 3300046471 Ga0495650_0001380 Ga0495650_0001380_362_1285 297
814 3300046471 Ga0495650_0006785 Ga0495650_0006785_4288_5211 297
815 3300046474 Ga0495605_0000367 Ga0495605_0000367_3628_4551 297
816 3300046474 Ga0495605_0000890 Ga0495605_0000890_8196_9119 297
817 3300046474 Ga0495605_0009952 Ga0495605_0009952_57_980 297
818 3300046491 Ga0495584_0008070 Ga0495584_0008070_2223_3146 297
819 3300046500 Ga0495596_0011050 Ga0495596_0011050_2958_3881 297
820 3300046501 Ga0495607_0000424 Ga0495607_0000424_10119_11042 297
821 3300046501 Ga0495607_0014028 Ga0495607_0014028_663_1586 297
822 3300046506 Ga0495583_0001037 Ga0495583_0001037_10136_11059 297
823 3300046506 Ga0495583_0001346 Ga0495583_0001346_4220_5143 297
824 3300046506 Ga0495583_0001911 Ga0495583_0001911_11076_12044 297
825 3300046506 Ga0495583_0004301 Ga0495583_0004301_1229_2152 297
826 3300046507 Ga0495606_0000924 Ga0495606_0000924_10565_11488 297
827 3300046507 Ga0495606_0001576 Ga0495606_0001576_9323_10246 297
828 3300046512 Ga0495610_0008898 Ga0495610_0008898_4736_5659 297
829 3300046512 Ga0495610_0017344 Ga0495610_0017344_3067_3990 297
830 3300046515 Ga0495620_0001435 Ga0495620_0001435_11068_11991 297
831 3300046515 Ga0495620_0002464 Ga0495620_0002464_9661_10584 297
832 3300046515 Ga0495620_0016129 Ga0495620_0016129_959_1882 297
833 3300046518 Ga0495631_0040688 Ga0495631_0040688_490_1413 297
834 3300046519 Ga0495632_0003013 Ga0495632_0003013_5138_6061 297
835 3300046519 Ga0495632_0009283 Ga0495632_0009283_502_1425 297
836 3300046519 Ga0495632_0046813 Ga0495632_0046813_479_1402 297
837 3300046520 Ga0495637_0000346 Ga0495637_0000346_9439_10362 297
838 3300046520 Ga0495637_0010752 Ga0495637_0010752_3276_4199 297
839 3300046520 Ga0495637_0011359 Ga0495637_0011359_1891_2814 297
840 3300046530 Ga0495654_0003846 Ga0495654_0003846_24_947 297
841 3300046538 Ga0495609_0000106 Ga0495609_0000106_25852_26775 297
842 3300046538 Ga0495609_0000401 Ga0495609_0000401_10328_11251 297
843 3300046538 Ga0495609_0017746 Ga0495609_0017746_996_1919 297
844 3300046557 Ga0495622_0002777 Ga0495622_0002777_1533_2456 297
845 3300046616 Ga0495668_0010202 Ga0495668_0010202_4315_5238 297
846 3300046616 Ga0495668_0014738 Ga0495668_0014738_1055_1978 297
847 3300046648 Ga0495611_0000526 Ga0495611_0000526_14422_15345 297
848 3300046660 Ga0495625_0000050 Ga0495625_0000050_25198_26121 297
849 3300046665 Ga0495661_0000309 Ga0495661_0000309_46235_47158 297
850 3300046665 Ga0495661_0000614 Ga0495661_0000614_25193_26116 297
851 3300046665 Ga0495661_0002216 Ga0495661_0002216_4731_5654 297
852 3300046691 Ga0495670_0041694 Ga0495670_0041694_186_1109 297
853 3300046694 Ga0495649_0013356 Ga0495649_0013356_3669_4592 297
854 3300047321 Ga0495676_0000377 Ga0495676_0000377_25167_26090 297
855 3300047446 Ga0495679_000299 Ga0495679_000299_25023_25946 297
856 3300047469 Ga0495673_0000396 Ga0495673_0000396_10753_11676 297
857 3300047469 Ga0495673_0006224 Ga0495673_0006224_1313_2236 297
858 3300047469 Ga0495673_0006451 Ga0495673_0006451_1508_2431 297
859 3300047470 Ga0495681_0002173 Ga0495681_0002173_5006_5929 297
860 3300047472 Ga0495686_0062495 Ga0495686_0062495_518_1441 297
861 3300048091 Ga0495626_0000600 Ga0495626_0000600_25106_26029 297
862 3300048904 Ga0496101_0257198 Ga0496101_0257198_115_1038 297
863 3300048913 Ga0496110_0083667 Ga0496110_0083667_1862_2785 297
864 3300048921 Ga0496118_0039107 Ga0496118_0039107_2404_3327 297
865 3300048924 Ga0496121_0001906 Ga0496121_0001906_21813_22736 297
866 3300048924 Ga0496121_0009023 Ga0496121_0009023_5163_6086 297
867 3300048925 Ga0496122_0000298 Ga0496122_0000298_81346_82269 297
868 3300048925 Ga0496122_0032248 Ga0496122_0032248_1471_2394 297
869 3300048926 Ga0496123_0000080 Ga0496123_0000080_161713_162636 297
870 3300048927 Ga0496124_0001065 Ga0496124_0001065_31893_32816 297
871 3300048927 Ga0496124_0026320 Ga0496124_0026320_1383_2306 297
872 3300049459 Ga0495678_038882 Ga0495678_038882_54_977 297
873 3300049460 Ga0495682_0000501 Ga0495682_0000501_10273_11196 297
874 3300001989 JGI24739J22299_10004445 JGI24739J22299_100044455 298
875 3300001989 JGI24739J22299_10016364 JGI24739J22299_100163643 298
876 3300001989 JGI24739J22299_10022427 JGI24739J22299_100224272 298
877 3300003322 rootL2_10332452 rootL2_103324523 298
878 3300003758 Ga0055532_1000682 Ga0055532_10006822 298
879 3300003758 Ga0055532_1000754 Ga0055532_10007548 298
880 3300003758 Ga0055532_1001348 Ga0055532_10013484 298
881 3300003760 Ga0055527_1000578 Ga0055527_10005788 298
882 3300003760 Ga0055527_1000930 Ga0055527_10009303 298
883 3300003761 Ga0055535_1001502 Ga0055535_10015028 298
884 3300003761 Ga0055535_1001505 Ga0055535_10015058 298
885 3300003762 Ga0055542_1001468 Ga0055542_10014688 298
886 3300003762 Ga0055542_1004495 Ga0055542_10044953 298
887 3300003763 Ga0055529_1000181 Ga0055529_10001819 298
888 3300003763 Ga0055529_1001827 Ga0055529_10018273 298
889 3300003790 Ga0055528_1001957 Ga0055528_10019575 298
890 3300003841 Ga0055541_1009217 Ga0055541_10092171 298
891 3300005339 Ga0070660_100000013 Ga0070660_10000001333 298
892 3300005366 Ga0070659_100000028 Ga0070659_10000002866 298
893 3300005455 Ga0070663_100040363 Ga0070663_1000403632 298
894 3300005563 Ga0068855_100203278 Ga0068855_1002032783 298
895 3300005564 Ga0070664_100062125 Ga0070664_1000621253 298
896 3300005616 Ga0068852_100067926 Ga0068852_1000679263 298
897 3300005842 Ga0068858_100059624 Ga0068858_1000596244 298
898 3300006946 Ga0079104_1003296 Ga0079104_10032963 298
899 3300009093 Ga0105240_10000393 Ga0105240_1000039312 298
900 3300009545 Ga0105237_10005816 Ga0105237_100058169 298
901 3300009551 Ga0105238_10018213 Ga0105238_100182139 298
902 3300010375 Ga0105239_10003889 Ga0105239_100038893 298
903 3300013100 Ga0157373_10122558 Ga0157373_101225582 298
904 3300013104 Ga0157370_10124572 Ga0157370_101245723 298
905 3300025225 Ga0209566_100293 Ga0209566_10029326 298
906 3300025226 Ga0209674_101016 Ga0209674_1010168 298
907 3300025228 Ga0209672_100067 Ga0209672_100067100 298
908 3300025228 Ga0209672_100079 Ga0209672_10007953 298
909 3300025229 Ga0209147_100012 Ga0209147_100012427 298
910 3300025229 Ga0209147_100061 Ga0209147_10006137 298
911 3300025229 Ga0209147_100107 Ga0209147_10010753 298
912 3300025242 Ga0209258_100030 Ga0209258_100030424 298
913 3300025242 Ga0209258_100340 Ga0209258_10034052 298
914 3300025254 Ga0209148_1000022 Ga0209148_1000022200 298
915 3300025254 Ga0209148_1000439 Ga0209148_100043934 298
916 3300025263 Ga0209565_1004074 Ga0209565_10040742 298
917 3300025272 Ga0209455_1000024 Ga0209455_1000024423 298
918 3300025272 Ga0209455_1000243 Ga0209455_100024353 298
919 3300025273 Ga0209673_1000021 Ga0209673_1000021154 298
920 3300025904 Ga0207647_10005613 Ga0207647_100056139 298
921 3300025913 Ga0207695_10000255 Ga0207695_1000025574 298
922 3300025914 Ga0207671_10037053 Ga0207671_100370534 298
923 3300025919 Ga0207657_10000017 Ga0207657_10000017124 298
924 3300025920 Ga0207649_10210127 Ga0207649_102101272 298
925 3300025924 Ga0207694_10045738 Ga0207694_100457384 298
926 3300025932 Ga0207690_10000009 Ga0207690_10000009217 298
927 3300026035 Ga0207703_10052595 Ga0207703_100525954 298
928 3300026067 Ga0207678_10011303 Ga0207678_100113037 298
929 3300027312 Ga0209371_1000128 Ga0209371_100012819 298
930 3300030500 Ga0268256_1000152 Ga0268256_100015265 298
931 3300039437 Ga0436365_1246322 Ga0436365_1246322_648_1544 298
932 3300046474 Ga0495605_0002755 Ga0495605_0002755_6607_7545 298
933 3300046501 Ga0495607_0006062 Ga0495607_0006062_5501_6439 298
934 3300046501 Ga0495607_0014483 Ga0495607_0014483_2769_3707 298
935 3300046507 Ga0495606_0005955 Ga0495606_0005955_269_1207 298
936 3300046515 Ga0495620_0093520 Ga0495620_0093520_71_1009 298
937 3300048919 Ga0496116_0038438 Ga0496116_0038438_720_1616 298
938 3300048921 Ga0496118_0166426 Ga0496118_0166426_72_968 298

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

36

95

0.97

PF03466

LysR_substrate

LysR substrate binding domain

119

327

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.9454 3 89
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.9436 3 89
4iht-assembly2.cif.gz_C crystal structure of benm_dbd/bena site 1 dna complex 0.9368 3 87
4ihs-assembly1.cif.gz_B crystal structure of benm_dbd/catb site 1 dna complex 0.9306 3 90
4iht-assembly1.cif.gz_A crystal structure of benm_dbd/bena site 1 dna complex 0.9256 3 90
ID Description Score Start End Superfamily
af_Q2G0C6_1_82_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9813 3 83 1.10.10.10
af_Q2G1Q6_4_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.972 3 87 1.10.10.10
af_P0ACQ7_8_93_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9713 4 87 1.10.10.10
af_Q57748_4_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9672 4 87 1.10.10.10
af_P05827_1_83_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9648 3 84 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A379ZR92-F1-model_v4 CysJI operon transcriptional activator 0.9335 89 292 GO:0005829
GO:0006355
AF-A0A379ZR92-F1-model_v4 CysJI operon transcriptional activator 0.8997 89 292 GO:0005829
GO:0006355
AF-A0A529FJL8-F1-model_v4 LysR family transcriptional regulator 0.8908 164 267 GO:0005829
GO:0006355
AF-A0A6L4A263-F1-model_v4 LysR family transcriptional regulator 0.8781 166 262 GO:0000976
GO:0006355
AF-A0A1N6KIL4-F1-model_v4 deleted 0.8724 169 262

Feature Viewer

pLDDT pTM Quality
90.33 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map