F486237

General Info

Members Datasets Scaffolds Average Seq Length
937 533 600 467

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2728368933|2728532475
Length 557
Sequence KLHWTEPGHPAYGVPCSLPPDWKRVFTSACKNVKILIVSNFRDMQDFVNEVDLFSSGRTLLSLTKDGILILREMDFTQIQVQRVENQMAKQQIGVIGLAVMGKNLALNIESRGFTVSVYNRSPEKTHDLISEAEGKNLTGTFSIEEFVESLEVPRKILIMVQAGKATDATIEQLLPHLDQGDIIIDGGNAYFPDTVRRNKELEAKGFRFIGTGVSGGEEGALKGPSIMPGGQESAYKLVEPILTAISAKVNGEPCCTYIGPDGAGHYVKMVHNGIEYGDMQLIGEAYHLLKDVLGLDAKELHSIFADWNSGELDSYLIEITKDIFAEYDEETGKPMVDVILDAAGQKGTGKWTSQSSLDLGVPLSMITESVFSRFLSAMKEERVAASKVLSGPVTEPFRGDKAEFIENVRKALFASKIVSYAQGFAQLRVASEEYNWDLKYGNLAKIWRGGCIIRSRFLQNITDAYENNPELKNLLLDPFFKNIMDTYQAAWRQVVSAAVAQGVPVPGFSSALAYYDSYRTERLPANLLQAQRDYFGAHTFKRVDKEGVFHHNWLSE

Samples

Sample ID Description Type Environment
1 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
2 2506520008 Serratia plymuthica AS12 Isolate Unclassified
3 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
4 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
5 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
6 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
7 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
8 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
9 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
10 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
11 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
12 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
13 2547132181 Kosakonia sacchari SP1 Isolate Stem
14 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
15 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
16 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
17 2554235283 Bacillus safensis VK Isolate Rhizosphere
18 2561511199 Enterobacter sp. R4-368 Isolate Nodule
19 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
20 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
21 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
22 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
23 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
24 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
25 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
26 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
27 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
28 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
29 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
30 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
31 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
32 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
33 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
34 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
35 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
36 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
37 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
38 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
39 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
40 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
41 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
42 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
43 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
44 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
45 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
46 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
47 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
48 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
49 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
50 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
51 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
52 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
53 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
54 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
55 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
56 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
57 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
58 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
59 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
60 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
61 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
62 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
63 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
64 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
65 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
66 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
67 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
68 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
69 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
70 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
71 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
72 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
73 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
74 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
75 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
76 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
77 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
78 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
79 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
80 2636415599 Klebsiella variicola DX120E Isolate Unclassified
81 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
82 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
83 2643221735 Bacillus sp. Root920 Isolate Unclassified
84 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
85 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
86 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
87 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
88 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
89 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
90 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
91 2671180694 Paenibacillus sp. A3 Isolate Unclassified
92 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
93 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
94 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
95 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
96 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
97 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
98 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
99 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
100 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
101 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
102 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
103 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
104 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
105 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
106 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
107 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
108 2738543017 Bacillus sp. OV186 Isolate Unclassified
109 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
110 2751185917 Enterobacter sp. HK169 Isolate Unclassified
111 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
112 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
113 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
114 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
115 2775507074 Klebsiella sp. D5A Isolate Unclassified
116 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
117 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
118 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
119 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
120 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
121 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
122 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
123 2808606372 Agromyces sp. 23-23 Isolate Unclassified
124 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
125 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
126 2811994870 Bacillus sp. JB4 Isolate Unclassified
127 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
128 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
129 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
130 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
131 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
132 2818991441 Niallia circulans 3243 Isolate Rhizosphere
133 2818991459 Paenibacillus sp. 597 Isolate Unclassified
134 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
135 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
136 2821118458 Enterobacter asburiae 609 Isolate Unclassified
137 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
138 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
139 2831905167 Ammoniphilus oxalaticus RAOx-1 Isolate Rhizosphere
140 2842682962 Bacillus sp. R-72492 Isolate Unclassified
141 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
142 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
143 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
144 2847085930 Erwinia persicina B64 Isolate Bulb
145 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
146 2849139964 Bacillus sp. R-71875 Isolate Unclassified
147 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
148 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
149 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
150 2857472729 Cohnella sp. R-74144 Isolate Unclassified
151 2857581216 Bacillus sp. R-71922 Isolate Unclassified
152 2857586860 Bacillus sp. R-71935 Isolate Unclassified
153 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
154 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
155 2858438669 Leuconostoc mesenteroides YL48 Isolate Unclassified
156 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
157 2860837431 Bacillus sp. WR11 Isolate Unclassified
158 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
159 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
160 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
161 2865014394 Pantoea sp. R-71966 Isolate Unclassified
162 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
163 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
164 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
165 2876601092 Pantoea endophytica 596 Isolate Unclassified
166 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
167 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
168 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
169 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
170 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
171 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
172 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
173 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
174 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
175 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
176 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
177 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
178 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
179 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
180 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
181 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
182 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
183 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
184 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
185 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
186 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
187 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
188 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
189 2904504865 Serratia marcescens 1822 Isolate Unclassified
190 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
191 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
192 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
193 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
194 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
195 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
196 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
197 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
198 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
199 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
200 2919150387 Rahnella aceris 1817 Isolate Unclassified
201 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
202 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
203 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
204 2919726948 Bacillus pumilus 4489 Isolate Unclassified
205 2922554459 Rhodococcus sp. 66b Isolate Unclassified
206 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
207 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
208 2927143783 Rahnella sp. 2050 Isolate Unclassified
209 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
210 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
211 2928519762 Leuconostoc citreum 1377 Isolate Rhizosphere
212 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
213 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
214 2932406140 Serratia sp. 2723 Isolate Rhizosphere
215 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
216 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
217 2937539931 Pantoea sp. LS15 Isolate Unclassified
218 2937967321 Serratia sp. YC16 Isolate Unclassified
219 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
220 2938917290 Bacillus sp. CR71 Isolate Unclassified
221 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
222 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
223 2939577877 Serratia sp. 509 Isolate Rhizosphere
224 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
225 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
226 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
227 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
228 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
229 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
230 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
231 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
232 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
233 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
234 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
235 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
236 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
237 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
238 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
239 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
240 2965761152 Bacillus sp. COPE52 Isolate Unclassified
241 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
242 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
243 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
244 2969141011 Bacillus velezensis MH25 Isolate Unclassified
245 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
246 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
247 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
248 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
249 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
250 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
251 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
252 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
253 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
254 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
255 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
256 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
257 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
258 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
259 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
260 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
261 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
262 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
263 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
264 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
265 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
266 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
267 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
268 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
269 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
270 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
271 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
272 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
273 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
274 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
275 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
276 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
277 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
278 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
279 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
280 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
281 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
282 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
283 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
284 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
285 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
286 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
287 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
288 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
289 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
290 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
291 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
292 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
293 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
294 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
295 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
296 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
297 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
298 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
299 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
300 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
301 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
302 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
303 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
304 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
305 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
306 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
307 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
308 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
309 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
310 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
311 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
312 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
313 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
314 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
315 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
316 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
317 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
318 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
319 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
320 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
321 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
322 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
323 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
324 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
325 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
326 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
327 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
328 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
329 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
330 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
331 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
332 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
333 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
334 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
335 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
336 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
337 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
338 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
339 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
340 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
341 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
342 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
343 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
344 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
345 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
346 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
347 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
348 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
349 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
350 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
351 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
352 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
353 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
354 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
355 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
356 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
357 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
358 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
359 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
360 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
361 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
362 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
363 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
364 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
365 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
366 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
385 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
386 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
388 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
389 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
390 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
391 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
392 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
393 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
394 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
395 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
396 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
397 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
398 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
399 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
400 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
401 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
402 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
403 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
404 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
405 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
406 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
407 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
408 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
409 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
410 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
411 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
412 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
413 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
414 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
415 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
416 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
417 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
418 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
419 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
420 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
421 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
422 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
423 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
424 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
425 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
426 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
427 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
428 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
429 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
430 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
431 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
432 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
433 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
434 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
435 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
436 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
437 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
438 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
439 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
440 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
441 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
442 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
443 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
444 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
445 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
446 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
447 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
448 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
449 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
450 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
451 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
452 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
453 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
454 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
455 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
456 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
457 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
458 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
459 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
460 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
461 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
462 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
463 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
464 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
465 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
466 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
467 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
468 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
469 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
473 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
474 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
475 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
476 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
477 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
478 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
479 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
480 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
481 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
482 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
483 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
484 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
485 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
486 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
487 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
488 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
489 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
490 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
491 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
492 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
493 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
494 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
495 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
496 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
497 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
498 640753048 Serratia proteamaculans 568 Isolate Endosphere
499 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
500 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
501 8004592986 Serratia sp. S119 Isolate Unclassified
502 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified
503 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
504 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
505 8018221730 Enterobacter sp. CM29 Isolate Unclassified
506 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
507 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
508 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
509 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
510 8022653035 Bacillus sp. Rc4 Isolate Unclassified
511 8022792930 Bacillus sp. Xin Isolate Rhizosphere
512 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
513 8023438354 Bacillus sp. BH2 Isolate Unclassified
514 8023444577 Bacillus sp. BH32 Isolate Unclassified
515 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
516 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
517 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
518 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
519 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
520 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
521 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
522 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
523 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
524 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
525 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
526 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
527 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
528 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
529 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere
530 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
531 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
532 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
533 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 62.75
Metatranscriptomes 1.28
Isolates 35.97

Biome Distribution

Category Percentage (%)
Aerial Root 0.64
Bulb 0.11
Endosphere 7.15
Nodule 2.35
Rhizoplane 7.04
Rhizosphere 52.93
Stem 0.11
Stem Tuber 0.53
Unclassified 29.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000274 3300001989 Bacteria 17327
2 JGI24744J21845_10014432 3300002077 Bacteria 1586
3 JGI25162J39368_1000019 3300002737 Bacteria 262053
4 JGI25162J39368_1001119 3300002737 Bacteria 16153
5 JGI25163J39215_1000121 3300002771 Bacteria 32543
6 JGI25164J39214_1000011 3300002772 Bacteria 262057
7 JGI25152J39213_1000139 3300002773 Bacteria 49588
8 JGI25151J46595_10000158 3300003187 Bacteria 87889
9 JGI25151J46595_10003023 3300003187 Bacteria 9556
10 JGI25151J46595_10014500 3300003187 Bacteria 3507
11 JGI25151J46595_10015640 3300003187 Bacteria 3336
12 JGI25151J46595_10027687 3300003187 Bacteria 2267
13 Ga0006562J51391_1002186 3300003578 Bacteria 1580
14 Ga0006562J51391_1006751 3300003578 Bacteria 7620
15 Ga0006562J51391_1016265 3300003578 Bacteria 1888
16 Ga0055538_1000021 3300003751 Bacteria 262057
17 Ga0055538_1000316 3300003751 Bacteria 22997
18 Ga0055539_1000026 3300003752 Bacteria 262057
19 Ga0055533_1000035 3300003756 Bacteria 262057
20 Ga0055532_1000233 3300003758 Bacteria 41111
21 Ga0055525_1000045 3300003759 Bacteria 262057
22 Ga0055535_1002935 3300003761 Bacteria 5291
23 Ga0055531_10000234 3300003794 Bacteria 60772
24 Ga0055541_1000020 3300003841 Bacteria 262057
25 Ga0055541_1000831 3300003841 Bacteria 7590
26 Ga0055541_1005311 3300003841 Bacteria 2257
27 Ga0058692_1000099 3300003856 Bacteria 57042
28 Ga0058692_1000261 3300003856 Bacteria 28622
29 Ga0058692_1000354 3300003856 Bacteria 22335
30 Ga0058692_1000393 3300003856 Bacteria 20974
31 Ga0058692_1000468 3300003856 Bacteria 18161
32 Ga0058692_1001738 3300003856 Bacteria 7757
33 Ga0058692_1004623 3300003856 Bacteria 4052
34 Ga0058692_1007067 3300003856 Bacteria 3014
35 Ga0058692_1009103 3300003856 Bacteria 2524
36 Ga0065703_1019809 3300005272 Bacteria 2385
37 Ga0065704_10000261 3300005289 Bacteria 53884
38 Ga0065704_10000708 3300005289 Bacteria 46350
39 Ga0065704_10070603 3300005289 Bacteria 19322
40 Ga0065704_10070657 3300005289 Bacteria 18234
41 Ga0065704_10112895 3300005289 Bacteria 1922
42 Ga0070658_10000763 3300005327 Bacteria 27616
43 Ga0070658_10013013 3300005327 Bacteria 6678
44 Ga0070690_100075534 3300005330 Bacteria 2197
45 Ga0068868_100003167 3300005338 Bacteria 11453
46 Ga0070660_100016489 3300005339 Bacteria 5362
47 Ga0070671_100002544 3300005355 Bacteria 14132
48 Ga0070708_100034203 3300005445 Bacteria 4421
49 Ga0070708_100069342 3300005445 Bacteria 3170
50 Ga0070706_100000084 3300005467 Bacteria 109077
51 Ga0070706_100000277 3300005467 Bacteria 62380
52 Ga0070706_100000858 3300005467 Bacteria 33483
53 Ga0070706_100025427 3300005467 Bacteria 5449
54 Ga0070706_100031538 3300005467 Bacteria 4886
55 Ga0070707_100000029 3300005468 Bacteria 123116
56 Ga0070707_100002389 3300005468 Bacteria 17929
57 Ga0070707_100008844 3300005468 Bacteria 9340
58 Ga0070707_100025604 3300005468 Bacteria 5599
59 Ga0070698_100000166 3300005471 Bacteria 60815
60 Ga0070698_100000793 3300005471 Bacteria 34351
61 Ga0070698_100005108 3300005471 Bacteria 14369
62 Ga0070698_100008670 3300005471 Bacteria 10957
63 Ga0070698_100014576 3300005471 Bacteria 8301
64 Ga0070698_100016460 3300005471 Bacteria 7801
65 Ga0070698_100107780 3300005471 Bacteria 2753
66 Ga0070698_100110789 3300005471 Bacteria 2710
67 Ga0070699_100000171 3300005518 Bacteria 62282
68 Ga0070699_100000395 3300005518 Bacteria 42275
69 Ga0070699_100006492 3300005518 Bacteria 10184
70 Ga0070699_100018451 3300005518 Bacteria 5993
71 Ga0070699_100072515 3300005518 Bacteria 2995
72 Ga0070684_100000077 3300005535 Bacteria 64172
73 Ga0070697_100000003 3300005536 Bacteria 322584
74 Ga0070697_100000806 3300005536 Bacteria 23524
75 Ga0070697_100000866 3300005536 Bacteria 22778
76 Ga0070697_100039204 3300005536 Bacteria 3830
77 Ga0070665_100000464 3300005548 Bacteria 58895
78 Ga0070665_100094141 3300005548 Bacteria 3001
79 Ga0068857_100000207 3300005577 Bacteria 38345
80 Ga0068859_100005482 3300005617 Bacteria 12917
81 Ga0068858_100220246 3300005842 Bacteria 1797
82 Ga0081455_10032838 3300005937 Bacteria 4671
83 Ga0081538_10022116 3300005981 Bacteria 4619
84 Ga0070717_10001202 3300006028 Bacteria 17535
85 Ga0070717_10004253 3300006028 Bacteria 10324
86 Ga0070717_10017018 3300006028 Bacteria 5647
87 Ga0075364_10003469 3300006051 Bacteria 8974
88 Ga0075364_10038878 3300006051 Bacteria 3083
89 Ga0075364_10094540 3300006051 Bacteria 1986
90 Ga0070716_100038075 3300006173 Bacteria 2661
91 Ga0075366_10002650 3300006195 Bacteria 9220
92 Ga0097620_100005480 3300006931 Bacteria 12917
93 Ga0079104_1000018 3300006946 Bacteria 271088
94 Ga0079104_1000163 3300006946 Bacteria 94189
95 Ga0079104_1000282 3300006946 Bacteria 65218
96 Ga0079104_1000384 3300006946 Bacteria 51458
97 Ga0079104_1000391 3300006946 Bacteria 50839
98 Ga0079104_1001061 3300006946 Bacteria 20757
99 Ga0079104_1001257 3300006946 Bacteria 17623
100 Ga0079104_1003314 3300006946 Bacteria 7635
101 Ga0079104_1006480 3300006946 Bacteria 4419
102 Ga0105251_10001421 3300009011 Bacteria 20627
103 Ga0105251_10001888 3300009011 Bacteria 17191
104 Ga0105251_10003233 3300009011 Bacteria 12002
105 Ga0105251_10003985 3300009011 Bacteria 10450
106 Ga0105251_10007214 3300009011 Bacteria 6900
107 Ga0105251_10014434 3300009011 Bacteria 4366
108 Ga0105251_10041405 3300009011 Bacteria 2242
109 Ga0105244_10000009 3300009036 Bacteria 286143
110 Ga0105244_10000347 3300009036 Bacteria 43582
111 Ga0105244_10000635 3300009036 Bacteria 31015
112 Ga0105244_10000636 3300009036 Bacteria 30959
113 Ga0105244_10000667 3300009036 Bacteria 30108
114 Ga0105244_10000818 3300009036 Bacteria 26304
115 Ga0105244_10000999 3300009036 Bacteria 23680
116 Ga0105244_10001459 3300009036 Bacteria 19110
117 Ga0105244_10003403 3300009036 Bacteria 11355
118 Ga0105244_10003888 3300009036 Bacteria 10508
119 Ga0105244_10007217 3300009036 Bacteria 7085
120 Ga0105244_10013124 3300009036 Bacteria 4856
121 Ga0105250_10000002 3300009092 Bacteria 566949
122 Ga0105250_10000101 3300009092 Bacteria 76942
123 Ga0105250_10000594 3300009092 Bacteria 23692
124 Ga0105250_10000614 3300009092 Bacteria 23253
125 Ga0105250_10001153 3300009092 Bacteria 14845
126 Ga0105250_10001182 3300009092 Bacteria 14657
127 Ga0105250_10004678 3300009092 Bacteria 6254
128 Ga0105250_10006179 3300009092 Bacteria 5262
129 Ga0105250_10011526 3300009092 Bacteria 3665
130 Ga0105240_10193625 3300009093 Bacteria 2389
131 Ga0105245_10010945 3300009098 Bacteria 7893
132 Ga0105245_10141483 3300009098 Bacteria 2266
133 Ga0105247_10000025 3300009101 Bacteria 208459
134 Ga0105243_10032193 3300009148 Bacteria 4050
135 Ga0105241_10000005 3300009174 Bacteria 384203
136 Ga0105248_10004273 3300009177 Bacteria 15809
137 Ga0105237_10000060 3300009545 Bacteria 146242
138 Ga0105238_10133244 3300009551 Bacteria 2463
139 Ga0105239_10027102 3300010375 Bacteria 6308
140 Ga0105246_10005098 3300011119 Bacteria 7993
141 Ga0105246_10005700 3300011119 Bacteria 7600
142 Ga0105246_10053878 3300011119 Bacteria 2770
143 Ga0157373_10000110 3300013100 Bacteria 64710
144 Ga0157373_10001965 3300013100 Bacteria 15579
145 Ga0157373_10017913 3300013100 Bacteria 5157
146 Ga0157373_10028353 3300013100 Bacteria 4038
147 Ga0157371_10000098 3300013102 Bacteria 134017
148 Ga0157371_10000528 3300013102 Bacteria 45611
149 Ga0157371_10000663 3300013102 Bacteria 40884
150 Ga0157371_10000673 3300013102 Bacteria 40561
151 Ga0157371_10000911 3300013102 Bacteria 33321
152 Ga0157371_10004595 3300013102 Bacteria 11988
153 Ga0157371_10025820 3300013102 Bacteria 4276
154 Ga0157370_10000683 3300013104 Bacteria 42237
155 Ga0157370_10001362 3300013104 Bacteria 30264
156 Ga0157370_10030269 3300013104 Bacteria 5304
157 Ga0157370_10086395 3300013104 Bacteria 2947
158 Ga0157369_10000589 3300013105 Bacteria 47375
159 Ga0157369_10000988 3300013105 Bacteria 35979
160 Ga0157369_10005106 3300013105 Bacteria 15365
161 Ga0157369_10012721 3300013105 Bacteria 9544
162 Ga0157369_10042245 3300013105 Bacteria 4974
163 Ga0157374_10008966 3300013296 Bacteria 8574
164 Ga0157374_10084100 3300013296 Bacteria 3024
165 Ga0163162_10007001 3300013306 Bacteria 10938
166 Ga0157372_10005333 3300013307 Bacteria 13654
167 Ga0157372_10012243 3300013307 Bacteria 9136
168 Ga0157375_10000052 3300013308 Bacteria 130032
169 Ga0157376_10000214 3300014969 Bacteria 40007
170 Ga0182006_1000018 3300015261 Bacteria 299376
171 Ga0183366_1001 3300015679 Bacteria 2743932
172 Ga0183370_1001 3300015680 Bacteria 2743932
173 Ga0183369_1001 3300015685 Bacteria 2743932
174 Ga0183368_1001 3300015687 Bacteria 2743932
175 Ga0163161_10000001 3300017792 Bacteria 2041488
176 Ga0213876_10000034 3300021384 Bacteria 202967
177 Ga0209760_100004 3300025207 Bacteria 254650
178 Ga0209784_100001 3300025224 Bacteria 3600592
179 Ga0209784_100183 3300025224 Bacteria 50174
180 Ga0209566_100001 3300025225 Bacteria 3600765
181 Ga0209566_100054 3300025225 Bacteria 221422
182 Ga0209566_100058 3300025225 Bacteria 201317
183 Ga0209566_100072 3300025225 Bacteria 167764
184 Ga0209566_100115 3300025225 Bacteria 107765
185 Ga0209566_100574 3300025225 Bacteria 23768
186 Ga0209566_100703 3300025225 Bacteria 19289
187 Ga0209566_101096 3300025225 Bacteria 10509
188 Ga0209674_100002 3300025226 Bacteria 3600592
189 Ga0209147_100088 3300025229 Bacteria 179728
190 Ga0209563_100002 3300025230 Bacteria 2045675
191 Ga0207427_100012 3300025231 Bacteria 585657
192 Ga0209437_100001 3300025233 Bacteria 2045675
193 Ga0209437_100238 3300025233 Bacteria 90380
194 Ga0209437_100302 3300025233 Bacteria 68690
195 Ga0209437_100909 3300025233 Bacteria 11539
196 Ga0209258_103608 3300025242 Bacteria 3264
197 Ga0209258_104781 3300025242 Bacteria 2465
198 Ga0209677_100002 3300025253 Bacteria 2045675
199 Ga0209129_1000077 3300025258 Bacteria 193474
200 Ga0209233_1004169 3300025261 Bacteria 4969
201 Ga0209130_1000320 3300025284 Bacteria 56333
202 Ga0209676_1001699 3300025292 Bacteria 19044
203 Ga0209025_1000001 3300025294 Bacteria 1888151
204 Ga0209025_1000368 3300025294 Bacteria 95103
205 Ga0209025_1003105 3300025294 Bacteria 16286
206 Ga0209025_1008379 3300025294 Bacteria 7450
207 Ga0209025_1008947 3300025294 Bacteria 7083
208 Ga0209025_1009924 3300025294 Bacteria 6543
209 Ga0209025_1013065 3300025294 Bacteria 5250
210 Ga0209025_1022408 3300025294 Bacteria 3351
211 Ga0209025_1033559 3300025294 Bacteria 2368
212 Ga0209051_1000025 3300025303 Bacteria 415397
213 Ga0209257_1000039 3300025304 Bacteria 591694
214 Ga0209257_1017430 3300025304 Bacteria 2828
215 Ga0207696_1000001 3300025711 Bacteria 2579611
216 Ga0207696_1000013 3300025711 Bacteria 524881
217 Ga0207696_1000021 3300025711 Bacteria 432606
218 Ga0207696_1000053 3300025711 Bacteria 268590
219 Ga0207696_1000058 3300025711 Bacteria 248495
220 Ga0207696_1000620 3300025711 Bacteria 26106
221 Ga0207696_1000622 3300025711 Bacteria 26024
222 Ga0207696_1001212 3300025711 Bacteria 14657
223 Ga0207696_1001317 3300025711 Bacteria 13720
224 Ga0207696_1001388 3300025711 Bacteria 13239
225 Ga0207696_1003318 3300025711 Bacteria 7404
226 Ga0207655_1000002 3300025728 Bacteria 1148694
227 Ga0207655_1000004 3300025728 Bacteria 1021221
228 Ga0207655_1000007 3300025728 Bacteria 773492
229 Ga0207655_1000036 3300025728 Bacteria 356747
230 Ga0207655_1000447 3300025728 Bacteria 54492
231 Ga0207655_1000604 3300025728 Bacteria 43480
232 Ga0207655_1000642 3300025728 Bacteria 41825
233 Ga0207655_1000733 3300025728 Bacteria 37019
234 Ga0207655_1000829 3300025728 Bacteria 33362
235 Ga0207655_1001670 3300025728 Bacteria 19607
236 Ga0207655_1002030 3300025728 Bacteria 17117
237 Ga0207655_1005626 3300025728 Bacteria 8482
238 Ga0207655_1021087 3300025728 Bacteria 3320
239 Ga0207713_1000001 3300025735 Bacteria 2295391
240 Ga0207713_1000012 3300025735 Bacteria 501860
241 Ga0207713_1000047 3300025735 Bacteria 229463
242 Ga0207713_1000132 3300025735 Bacteria 113216
243 Ga0207713_1000383 3300025735 Bacteria 47969
244 Ga0207713_1001567 3300025735 Bacteria 17940
245 Ga0207713_1002227 3300025735 Bacteria 14371
246 Ga0207713_1002776 3300025735 Bacteria 12377
247 Ga0207713_1005688 3300025735 Bacteria 7738
248 Ga0207713_1012704 3300025735 Bacteria 4483
249 Ga0207713_1049410 3300025735 Bacteria 1686
250 Ga0207710_10000150 3300025900 Bacteria 79270
251 Ga0207705_10002539 3300025909 Bacteria 14057
252 Ga0207705_10005126 3300025909 Bacteria 9824
253 Ga0207684_10000002 3300025910 Bacteria 1042751
254 Ga0207684_10000008 3300025910 Bacteria 601602
255 Ga0207684_10000040 3300025910 Bacteria 262703
256 Ga0207684_10017137 3300025910 Bacteria 6218
257 Ga0207654_10000007 3300025911 Bacteria 384211
258 Ga0207671_10000062 3300025914 Bacteria 172081
259 Ga0207657_10041612 3300025919 Bacteria 4062
260 Ga0207646_10000142 3300025922 Bacteria 98159
261 Ga0207646_10000333 3300025922 Bacteria 63824
262 Ga0207646_10000613 3300025922 Bacteria 46430
263 Ga0207646_10002050 3300025922 Bacteria 24191
264 Ga0207646_10003431 3300025922 Bacteria 17898
265 Ga0207646_10003981 3300025922 Bacteria 16377
266 Ga0207646_10009446 3300025922 Bacteria 9641
267 Ga0207646_10011676 3300025922 Bacteria 8493
268 Ga0207646_10012410 3300025922 Bacteria 8189
269 Ga0207687_10005575 3300025927 Bacteria 8316
270 Ga0207664_10161207 3300025929 Bacteria 1913
271 Ga0207709_10016891 3300025935 Bacteria 4066
272 Ga0207711_10021152 3300025941 Bacteria 5434
273 Ga0207661_10000015 3300025944 Bacteria 318960
274 Ga0207668_10018611 3300025972 Bacteria 4375
275 Ga0207677_10000048 3300026023 Bacteria 101555
276 Ga0207674_10002163 3300026116 Bacteria 24860
277 Ga0207674_10071284 3300026116 Bacteria 3492
278 Ga0209281_1000004 3300027111 Bacteria 1253949
279 Ga0209281_1000006 3300027111 Bacteria 1170244
280 Ga0209281_1000014 3300027111 Bacteria 643021
281 Ga0209281_1000064 3300027111 Bacteria 287876
282 Ga0209281_1000071 3300027111 Bacteria 274050
283 Ga0209281_1000257 3300027111 Bacteria 103090
284 Ga0209281_1000370 3300027111 Bacteria 72879
285 Ga0209281_1000714 3300027111 Bacteria 33175
286 Ga0209281_1000926 3300027111 Bacteria 24167
287 Ga0209281_1001332 3300027111 Bacteria 15526
288 Ga0209281_1001392 3300027111 Bacteria 14777
289 Ga0209371_1000001 3300027312 Bacteria 2771503
290 Ga0209371_1000002 3300027312 Bacteria 1551985
291 Ga0209371_1000005 3300027312 Bacteria 1061740
292 Ga0209371_1000015 3300027312 Bacteria 659640
293 Ga0209371_1000099 3300027312 Bacteria 154918
294 Ga0209371_1000100 3300027312 Bacteria 154467
295 Ga0209371_1000120 3300027312 Bacteria 132938
296 Ga0209371_1000466 3300027312 Bacteria 39817
297 Ga0209371_1000778 3300027312 Bacteria 26405
298 Ga0209371_1000832 3300027312 Bacteria 25391
299 Ga0209371_1000964 3300027312 Bacteria 22330
300 Ga0209371_1001051 3300027312 Bacteria 20781
301 Ga0209371_1006561 3300027312 Bacteria 4277
302 Ga0209371_1006984 3300027312 Bacteria 4047
303 Ga0209371_1008478 3300027312 Bacteria 3410
304 Ga0209371_1017486 3300027312 Bacteria 1856
305 Ga0268266_10000286 3300028379 Bacteria 83269
306 Ga0268266_10032002 3300028379 Bacteria 4469
307 Ga0237817_10010 3300030083 Bacteria 78285
308 Ga0268256_1000001 3300030500 Bacteria 2771065
309 Ga0268256_1000002 3300030500 Bacteria 1535763
310 Ga0268256_1000006 3300030500 Bacteria 1063991
311 Ga0268256_1000018 3300030500 Bacteria 594572
312 Ga0268256_1000035 3300030500 Bacteria 384794
313 Ga0268256_1000089 3300030500 Bacteria 154491
314 Ga0268256_1000423 3300030500 Bacteria 38191
315 Ga0268256_1000714 3300030500 Bacteria 24660
316 Ga0268256_1000815 3300030500 Bacteria 22341
317 Ga0268256_1001088 3300030500 Bacteria 17848
318 Ga0268256_1001187 3300030500 Bacteria 16663
319 Ga0268256_1001261 3300030500 Bacteria 15768
320 Ga0268256_1001364 3300030500 Bacteria 14847
321 Ga0268256_1004173 3300030500 Bacteria 6117
322 Ga0268256_1007114 3300030500 Bacteria 4047
323 Ga0268256_1010729 3300030500 Bacteria 2950
324 Ga0268256_1019486 3300030500 Bacteria 1856
325 Ga0265330_10006907 3300031235 Bacteria 5577
326 Ga0265330_10059295 3300031235 Bacteria 1667
327 Ga0265325_10008619 3300031241 Bacteria 6007
328 Ga0265339_10002811 3300031249 Bacteria 12365
329 Ga0265331_10052169 3300031250 Bacteria 1955
330 Ga0265316_10014201 3300031344 Bacteria 7026
331 Ga0307408_100121385 3300031548 Bacteria 2025
332 Ga0265314_10030356 3300031711 Bacteria 4002
333 Ga0265314_10057905 3300031711 Bacteria 2658
334 Ga0265342_10004166 3300031712 Bacteria 11508
335 Ga0316578_10026048 3300031728 Bacteria 3295
336 Ga0316578_10033102 3300031728 Bacteria 2958
337 Ga0307413_10033108 3300031824 Bacteria 2938
338 Ga0307410_10006702 3300031852 Bacteria 6240
339 Ga0307406_10024886 3300031901 Bacteria 3580
340 Ga0307510_10087683 3300033180 Bacteria 2976
341 Ga0316574_0076742 3300035398 Bacteria 2117
342 Ga0316582_0011868 3300036647 Bacteria 4838
343 Ga0316582_0067878 3300036647 Bacteria 2301
344 Ga0316584_0043456 3300036712 Bacteria 3350
345 Ga0373925_0087083 3300037068 Bacteria 2384
346 Ga0395900_0223228 3300037418 Bacteria 1898
347 Ga0237819_02091 3300038705 Bacteria 4335
348 Ga0400488_52971 3300038741 Bacteria 12949
349 Ga0400489_11819 3300039093 Bacteria 9617
350 Ga0436365_0965775 3300039437 Bacteria 470291
351 Ga0439436_0015324 3300041404 Bacteria 2306
352 Ga0439438_000002 3300041405 Bacteria 618223
353 Ga0439439_0002184 3300041406 Bacteria 4108
354 Ga0439466_0000001 3300041411 Bacteria 647258
355 Ga0439466_0000450 3300041411 Bacteria 15663
356 Ga0451853_3168715 3300041512 Bacteria 3791
357 Ga0439432_000295 3300042006 Bacteria 17930
358 Ga0439449_0000010 3300042007 Bacteria 58004
359 Ga0439452_000001 3300042010 Bacteria 1725439
360 Ga0439452_000002 3300042010 Bacteria 1377577
361 Ga0439452_000020 3300042010 Bacteria 309345
362 Ga0439452_000031 3300042010 Bacteria 196691
363 Ga0439452_000032 3300042010 Bacteria 184797
364 Ga0439462_0024401 3300042015 Bacteria 1588
365 Ga0451577_0007660 3300042876 Bacteria 10588
366 Ga0466969_0000115 3300044656 Bacteria 42292
367 Ga0466981_0000003 3300044669 Bacteria 248458
368 Ga0453684_0002622 3300044712 Bacteria 42982
369 Ga0451576_0042243 3300045051 Bacteria 4814
370 Ga0466967_0006590 3300045976 Bacteria 8246
371 Ga0495627_000018 3300046453 Bacteria 315125
372 Ga0495591_000001 3300046458 Bacteria 503087
373 Ga0495591_000050 3300046458 Bacteria 137772
374 Ga0495591_001001 3300046458 Bacteria 19212
375 Ga0495638_0039389 3300046460 Bacteria 3000
376 Ga0495650_0000031 3300046471 Bacteria 433811
377 Ga0495650_0000047 3300046471 Bacteria 335136
378 Ga0495650_0000182 3300046471 Bacteria 137031
379 Ga0495607_0071972 3300046501 Bacteria 1926
380 Ga0495606_0003900 3300046507 Bacteria 15370
381 Ga0495606_0015548 3300046507 Bacteria 5856
382 Ga0495648_0001866 3300046524 Bacteria 20143
383 Ga0495654_0000009 3300046530 Bacteria 381872
384 Ga0495654_0000068 3300046530 Bacteria 125533
385 Ga0495654_0000596 3300046530 Bacteria 28899
386 Ga0495654_0016346 3300046530 Bacteria 3926
387 Ga0495597_0002098 3300046542 Bacteria 13248
388 Ga0495622_0007079 3300046557 Bacteria 5212
389 Ga0495633_0000002 3300046558 Bacteria 488754
390 Ga0495656_0061371 3300046615 Bacteria 1642
391 Ga0495649_0000504 3300046694 Bacteria 33380
392 Ga0495649_0000543 3300046694 Bacteria 31982
393 Ga0495589_0000002 3300046794 Bacteria 758846
394 Ga0495660_0000004 3300046810 Bacteria 1003183
395 Ga0495660_0000015 3300046810 Bacteria 324892
396 Ga0495660_0001493 3300046810 Bacteria 15817
397 Ga0495672_0000001 3300047320 Bacteria 1458820
398 Ga0495672_0000009 3300047320 Bacteria 557755
399 Ga0495672_0000015 3300047320 Bacteria 502855
400 Ga0495683_0006239 3300047323 Bacteria 6522
401 Ga0495679_000309 3300047446 Bacteria 39033
402 Ga0495679_015728 3300047446 Bacteria 2758
403 Ga0495673_0000007 3300047469 Bacteria 796722
404 Ga0495673_0000019 3300047469 Bacteria 554389
405 Ga0495681_0034070 3300047470 Bacteria 2541
406 Ga0496101_0000157 3300048904 Bacteria 57989
407 Ga0496102_0057081 3300048905 Bacteria 3563
408 Ga0496102_0074750 3300048905 Bacteria 3115
409 Ga0496103_0018887 3300048906 Bacteria 4140
410 Ga0496104_0000100 3300048907 Bacteria 83437
411 Ga0496108_0101917 3300048911 Bacteria 2449
412 Ga0496108_0116454 3300048911 Bacteria 2289
413 Ga0496110_0000084 3300048913 Bacteria 49140
414 Ga0496111_0001174 3300048914 Bacteria 14587
415 Ga0496116_0000023 3300048919 Bacteria 475792
416 Ga0496116_0000094 3300048919 Bacteria 205588
417 Ga0496116_0000110 3300048919 Bacteria 185668
418 Ga0496116_0000140 3300048919 Bacteria 151165
419 Ga0496116_0000625 3300048919 Bacteria 46424
420 Ga0496116_0001704 3300048919 Bacteria 24089
421 Ga0496116_0001737 3300048919 Bacteria 23762
422 Ga0496116_0002154 3300048919 Bacteria 20968
423 Ga0496116_0003742 3300048919 Bacteria 14874
424 Ga0496116_0003924 3300048919 Bacteria 14491
425 Ga0496116_0004165 3300048919 Bacteria 13923
426 Ga0496116_0005211 3300048919 Bacteria 12176
427 Ga0496116_0008976 3300048919 Bacteria 8595
428 Ga0496116_0029920 3300048919 Bacteria 3918
429 Ga0496116_0033684 3300048919 Bacteria 3630
430 Ga0496116_0052606 3300048919 Bacteria 2696
431 Ga0496117_0000009 3300048920 Bacteria 613759
432 Ga0496117_0000138 3300048920 Bacteria 159456
433 Ga0496117_0000154 3300048920 Bacteria 146606
434 Ga0496117_0000380 3300048920 Bacteria 76671
435 Ga0496117_0000835 3300048920 Bacteria 47629
436 Ga0496117_0002117 3300048920 Bacteria 26059
437 Ga0496117_0002120 3300048920 Bacteria 26005
438 Ga0496117_0002436 3300048920 Bacteria 23465
439 Ga0496117_0003978 3300048920 Bacteria 16704
440 Ga0496117_0004061 3300048920 Bacteria 16439
441 Ga0496117_0008017 3300048920 Bacteria 10127
442 Ga0496117_0018285 3300048920 Bacteria 5813
443 Ga0496117_0019093 3300048920 Bacteria 5645
444 Ga0496117_0019839 3300048920 Bacteria 5504
445 Ga0496117_0024460 3300048920 Bacteria 4777
446 Ga0496117_0066848 3300048920 Bacteria 2436
447 Ga0496118_0000017 3300048921 Bacteria 549445
448 Ga0496118_0000150 3300048921 Bacteria 123251
449 Ga0496118_0000158 3300048921 Bacteria 121361
450 Ga0496118_0000894 3300048921 Bacteria 46807
451 Ga0496118_0001286 3300048921 Bacteria 38322
452 Ga0496118_0001914 3300048921 Bacteria 29615
453 Ga0496118_0003457 3300048921 Bacteria 19860
454 Ga0496118_0005328 3300048921 Bacteria 14648
455 Ga0496118_0038280 3300048921 Bacteria 3846
456 Ga0496118_0062714 3300048921 Bacteria 2740
457 Ga0496119_0000012 3300048922 Bacteria 411917
458 Ga0496119_0000027 3300048922 Bacteria 249124
459 Ga0496119_0000049 3300048922 Bacteria 185482
460 Ga0496119_0000166 3300048922 Bacteria 92117
461 Ga0496119_0000352 3300048922 Bacteria 64461
462 Ga0496119_0000468 3300048922 Bacteria 55018
463 Ga0496119_0001574 3300048922 Bacteria 27136
464 Ga0496119_0001730 3300048922 Bacteria 25447
465 Ga0496119_0002241 3300048922 Bacteria 21509
466 Ga0496119_0002860 3300048922 Bacteria 18410
467 Ga0496119_0004253 3300048922 Bacteria 14348
468 Ga0496119_0007695 3300048922 Bacteria 9641
469 Ga0496119_0057325 3300048922 Bacteria 2354
470 Ga0496120_0000004 3300048923 Bacteria 534793
471 Ga0496120_0000022 3300048923 Bacteria 249124
472 Ga0496120_0000048 3300048923 Bacteria 187988
473 Ga0496120_0000052 3300048923 Bacteria 186071
474 Ga0496120_0000057 3300048923 Bacteria 177460
475 Ga0496120_0000137 3300048923 Bacteria 123518
476 Ga0496120_0000207 3300048923 Bacteria 101327
477 Ga0496120_0000406 3300048923 Bacteria 69216
478 Ga0496120_0000673 3300048923 Bacteria 50130
479 Ga0496120_0000711 3300048923 Bacteria 48821
480 Ga0496120_0001027 3300048923 Bacteria 37319
481 Ga0496120_0001489 3300048923 Bacteria 27770
482 Ga0496120_0002104 3300048923 Bacteria 21311
483 Ga0496120_0002703 3300048923 Bacteria 17378
484 Ga0496120_0002884 3300048923 Bacteria 16472
485 Ga0496121_0000389 3300048924 Bacteria 89759
486 Ga0496121_0001226 3300048924 Bacteria 44634
487 Ga0496121_0001655 3300048924 Bacteria 36766
488 Ga0496121_0002208 3300048924 Bacteria 30406
489 Ga0496121_0003017 3300048924 Bacteria 24448
490 Ga0496121_0003296 3300048924 Bacteria 23186
491 Ga0496121_0004821 3300048924 Bacteria 17759
492 Ga0496121_0005634 3300048924 Bacteria 15936
493 Ga0496121_0008356 3300048924 Bacteria 12216
494 Ga0496121_0011405 3300048924 Bacteria 9874
495 Ga0496121_0058635 3300048924 Bacteria 3180
496 Ga0496122_0000003 3300048925 Bacteria 645810
497 Ga0496122_0000007 3300048925 Bacteria 606493
498 Ga0496122_0000088 3300048925 Bacteria 207600
499 Ga0496122_0001843 3300048925 Bacteria 32310
500 Ga0496122_0002182 3300048925 Bacteria 28670
501 Ga0496122_0002922 3300048925 Bacteria 23306
502 Ga0496122_0003024 3300048925 Bacteria 22811
503 Ga0496122_0003212 3300048925 Bacteria 21739
504 Ga0496122_0003434 3300048925 Bacteria 20839
505 Ga0496122_0003484 3300048925 Bacteria 20689
506 Ga0496122_0004956 3300048925 Bacteria 16133
507 Ga0496122_0005161 3300048925 Bacteria 15734
508 Ga0496122_0023005 3300048925 Bacteria 5515
509 Ga0496122_0074389 3300048925 Bacteria 2404
510 Ga0496122_0082854 3300048925 Bacteria 2226
511 Ga0496123_0000004 3300048926 Bacteria 777230
512 Ga0496123_0000012 3300048926 Bacteria 458760
513 Ga0496123_0000139 3300048926 Bacteria 151469
514 Ga0496123_0001504 3300048926 Bacteria 32310
515 Ga0496123_0001770 3300048926 Bacteria 28492
516 Ga0496123_0002717 3300048926 Bacteria 21261
517 Ga0496123_0003304 3300048926 Bacteria 18279
518 Ga0496123_0003928 3300048926 Bacteria 16133
519 Ga0496123_0006718 3300048926 Bacteria 11073
520 Ga0496123_0014520 3300048926 Bacteria 6521
521 Ga0496123_0069160 3300048926 Bacteria 2219
522 Ga0496124_0000017 3300048927 Bacteria 444389
523 Ga0496124_0000025 3300048927 Bacteria 405471
524 Ga0496124_0000045 3300048927 Bacteria 287396
525 Ga0496124_0000368 3300048927 Bacteria 82338
526 Ga0496124_0000484 3300048927 Bacteria 68281
527 Ga0496124_0000620 3300048927 Bacteria 59508
528 Ga0496124_0001484 3300048927 Bacteria 34470
529 Ga0496124_0001931 3300048927 Bacteria 28393
530 Ga0496124_0004039 3300048927 Bacteria 17427
531 Ga0496124_0004060 3300048927 Bacteria 17353
532 Ga0496124_0005302 3300048927 Bacteria 14569
533 Ga0496124_0006843 3300048927 Bacteria 12281
534 Ga0496124_0008449 3300048927 Bacteria 10765
535 Ga0496124_0009313 3300048927 Bacteria 10123
536 Ga0496124_0034182 3300048927 Bacteria 4465
537 Ga0496124_0079461 3300048927 Bacteria 2701
538 Ga0496125_0000013 3300048928 Bacteria 628761
539 Ga0496125_0000065 3300048928 Bacteria 249830
540 Ga0496125_0000728 3300048928 Bacteria 54555
541 Ga0496125_0001229 3300048928 Bacteria 38359
542 Ga0496125_0001911 3300048928 Bacteria 28512
543 Ga0496125_0001991 3300048928 Bacteria 27713
544 Ga0496125_0004865 3300048928 Bacteria 15247
545 Ga0496125_0007236 3300048928 Bacteria 11823
546 Ga0496125_0022076 3300048928 Bacteria 5917
547 Ga0496125_0070815 3300048928 Bacteria 2728
548 Ga0496125_0113723 3300048928 Bacteria 1952
549 Ga0496126_0000865 3300048929 Bacteria 53248
550 Ga0496126_0001727 3300048929 Bacteria 32416
551 Ga0496126_0002119 3300048929 Bacteria 27745
552 Ga0496126_0002405 3300048929 Bacteria 25405
553 Ga0496126_0004050 3300048929 Bacteria 17821
554 Ga0496126_0005402 3300048929 Bacteria 14587
555 Ga0496126_0013484 3300048929 Bacteria 8306
556 Ga0496126_0013750 3300048929 Bacteria 8208
557 Ga0496126_0042116 3300048929 Bacteria 4219
558 Ga0496126_0096786 3300048929 Bacteria 2587
559 Ga0496126_0100424 3300048929 Bacteria 2532
560 Ga0501306_000570 3300049127 Bacteria 2923
561 Ga0501309_000677 3300049129 Bacteria 2943
562 Ga0501305_003117 3300049161 Bacteria 1856
563 Ga0495678_000777 3300049459 Bacteria 28686
564 Ga0495682_0000001 3300049460 Bacteria 1559116
565 Ga0501312_002553 3300049528 Bacteria 1975
566 Ga0501312_006488 3300049528 Bacteria 1461
567 Ga0501316_002315 3300049532 Bacteria 1751
568 Ga0501335_002418 3300049551 Bacteria 1514
569 Ga0501031_0037347 3300049568 Bacteria 3170
570 Ga0501033_0010131 3300049570 Bacteria 7235
571 Ga0501034_0002371 3300049571 Bacteria 22883
572 Ga0501034_0065414 3300049571 Bacteria 3648
573 Ga0501034_0191312 3300049571 Bacteria 2008
574 Ga0501036_0006154 3300049572 Bacteria 9735
575 Ga0501036_0018299 3300049572 Bacteria 5866
576 Ga0501038_0009093 3300049574 Bacteria 9117
577 Ga0501040_0003798 3300049576 Bacteria 9794
578 Ga0501042_0004170 3300049578 Bacteria 9185
579 Ga0501042_0012426 3300049578 Bacteria 5769
580 Ga0501043_0001906 3300049579 Bacteria 17879
581 Ga0501047_0004030 3300049581 Bacteria 13813
582 Ga0501048_0021270 3300049582 Bacteria 4750
583 Ga0501048_0099152 3300049582 Bacteria 2055
584 Ga0501071_0015764 3300049587 Bacteria 5191
585 Ga0501072_0029589 3300049588 Bacteria 4280
586 Ga0501074_0000975 3300049590 Bacteria 18524
587 Ga0501074_0002363 3300049590 Bacteria 13134
588 Ga0501075_0135783 3300049591 Bacteria 1874
589 Ga0501077_0084641 3300049593 Bacteria 2010
590 Ga0501208_007007 3300049655 Bacteria 1462
591 Ga0501217_002322 3300049661 Bacteria 3728
592 Ga0501081_0076057 3300049743 Bacteria 2344
593 Ga0501083_0036383 3300049744 Bacteria 3358
594 nmdc:mga00v17_27254_c1 3300050491 Bacteria 3335
595 nmdc:mga0yw44_46769_c1 3300050492 Bacteria 2600
596 Ga0500621_000002 3300053126 Bacteria 849473
597 Ga0501084_0041452 3300054114 Bacteria 3851
598 Ga0587070_000683 3300059491 Bacteria 3035
599 Ga0587079_004153 3300059647 Bacteria 1947
600 Ga0501082_0015040 3300060353 Bacteria 6668

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049591 Ga0501075_0135783 Ga0501075_0135783_623_1816 388
2 3300047446 Ga0495679_015728 Ga0495679_015728_1552_2742 396
3 3300041512 Ga0451853_3168715 Ga0451853_3168715_25_1263 403
4 3300031901 Ga0307406_10024886 Ga0307406_100248863 427
5 3300003794 Ga0055531_10000234 Ga0055531_100002344 440
6 3300025303 Ga0209051_1000025 Ga0209051_1000025132 440
7 3300025304 Ga0209257_1000039 Ga0209257_1000039476 440
8 3300031548 Ga0307408_100121385 Ga0307408_1001213852 445
9 3300049582 Ga0501048_0099152 Ga0501048_0099152_256_1674 446
10 3300049593 Ga0501077_0084641 Ga0501077_0084641_330_1748 446
11 3300049743 Ga0501081_0076057 Ga0501081_0076057_681_2099 446
12 3300037068 Ga0373925_0087083 Ga0373925_0087083_89_1528 447
13 3300042010 Ga0439452_000031 Ga0439452_000031_195304_196680 449
14 3300048922 Ga0496119_0057325 Ga0496119_0057325_67_1443 449
15 iso_pu_bacteria 2547132416 2548649647 449
16 3300050492 nmdc:mga0yw44_46769_c1 nmdc:mga0yw44_46769_c1_892_2301 450
17 iso_pu_bacteria 2945991243 2945991613 451
18 3300009545 Ga0105237_10000060 Ga0105237_1000006025 454
19 3300009551 Ga0105238_10133244 Ga0105238_101332442 454
20 3300013104 Ga0157370_10086395 Ga0157370_100863953 454
21 3300045051 Ga0451576_0042243 Ga0451576_0042243_494_1867 454
22 3300009092 Ga0105250_10000002 Ga0105250_10000002268 455
23 3300013296 Ga0157374_10008966 Ga0157374_100089664 455
24 3300013296 Ga0157374_10084100 Ga0157374_100841002 455
25 3300025225 Ga0209566_101096 Ga0209566_1010966 455
26 3300025711 Ga0207696_1000021 Ga0207696_1000021239 455
27 3300025909 Ga0207705_10002539 Ga0207705_100025392 455
28 3300048911 Ga0496108_0101917 Ga0496108_0101917_27_1400 455
29 3300048914 Ga0496111_0001174 Ga0496111_0001174_13197_14570 455
30 3300048922 Ga0496119_0000352 Ga0496119_0000352_36524_37930 455
31 3300048923 Ga0496120_0000673 Ga0496120_0000673_24696_26102 455
32 3300005330 Ga0070690_100075534 Ga0070690_1000755343 457
33 3300009036 Ga0105244_10000667 Ga0105244_1000066724 457
34 3300013104 Ga0157370_10000683 Ga0157370_1000068310 457
35 3300025728 Ga0207655_1000733 Ga0207655_10007334 457
36 3300009093 Ga0105240_10193625 Ga0105240_101936252 458
37 3300048925 Ga0496122_0000088 Ga0496122_0000088_21132_22538 458
38 3300048926 Ga0496123_0000139 Ga0496123_0000139_128933_130339 458
39 iso_pu_bacteria 2523533629 2524006727 458
40 iso_pu_bacteria 2588254257 2590611802 458
41 3300002737 JGI25162J39368_1000019 JGI25162J39368_1000019171 459
42 3300002771 JGI25163J39215_1000121 JGI25163J39215_100012117 459
43 3300002772 JGI25164J39214_1000011 JGI25164J39214_1000011103 459
44 3300003751 Ga0055538_1000021 Ga0055538_1000021103 459
45 3300003752 Ga0055539_1000026 Ga0055539_1000026171 459
46 3300003756 Ga0055533_1000035 Ga0055533_1000035103 459
47 3300003759 Ga0055525_1000045 Ga0055525_1000045103 459
48 3300003841 Ga0055541_1000020 Ga0055541_1000020103 459
49 3300003856 Ga0058692_1000261 Ga0058692_100026115 459
50 3300003856 Ga0058692_1004623 Ga0058692_10046231 459
51 3300005272 Ga0065703_1019809 Ga0065703_10198091 459
52 3300005289 Ga0065704_10000261 Ga0065704_1000026132 459
53 3300005289 Ga0065704_10000708 Ga0065704_1000070834 459
54 3300005289 Ga0065704_10112895 Ga0065704_101128951 459
55 3300005577 Ga0068857_100000207 Ga0068857_10000020716 459
56 3300006051 Ga0075364_10038878 Ga0075364_100388782 459
57 3300006195 Ga0075366_10002650 Ga0075366_100026506 459
58 3300006946 Ga0079104_1000384 Ga0079104_100038437 459
59 3300006946 Ga0079104_1003314 Ga0079104_10033148 459
60 3300006946 Ga0079104_1006480 Ga0079104_10064804 459
61 3300009011 Ga0105251_10003233 Ga0105251_100032337 459
62 3300009011 Ga0105251_10041405 Ga0105251_100414051 459
63 3300009036 Ga0105244_10000636 Ga0105244_1000063612 459
64 3300009036 Ga0105244_10000818 Ga0105244_1000081824 459
65 3300009092 Ga0105250_10004678 Ga0105250_100046782 459
66 3300009101 Ga0105247_10000025 Ga0105247_1000002599 459
67 3300009174 Ga0105241_10000005 Ga0105241_1000000513 459
68 3300013100 Ga0157373_10028353 Ga0157373_100283532 459
69 3300013102 Ga0157371_10000098 Ga0157371_10000098110 459
70 3300013102 Ga0157371_10000911 Ga0157371_100009117 459
71 3300013104 Ga0157370_10001362 Ga0157370_1000136211 459
72 3300013104 Ga0157370_10030269 Ga0157370_100302693 459
73 3300013105 Ga0157369_10012721 Ga0157369_100127215 459
74 3300013308 Ga0157375_10000052 Ga0157375_1000005225 459
75 3300015261 Ga0182006_1000018 Ga0182006_100001891 459
76 3300025207 Ga0209760_100004 Ga0209760_100004101 459
77 3300025224 Ga0209784_100001 Ga0209784_1000012488 459
78 3300025225 Ga0209566_100001 Ga0209566_1000012488 459
79 3300025226 Ga0209674_100002 Ga0209674_1000022488 459
80 3300025230 Ga0209563_100002 Ga0209563_1000021023 459
81 3300025231 Ga0207427_100012 Ga0207427_100012328 459
82 3300025233 Ga0209437_100001 Ga0209437_1000011023 459
83 3300025253 Ga0209677_100002 Ga0209677_1000021023 459
84 3300025261 Ga0209233_1004169 Ga0209233_10041695 459
85 3300025711 Ga0207696_1000001 Ga0207696_1000001427 459
86 3300025711 Ga0207696_1003318 Ga0207696_10033188 459
87 3300025728 Ga0207655_1000604 Ga0207655_100060421 459
88 3300025728 Ga0207655_1000829 Ga0207655_100082925 459
89 3300025735 Ga0207713_1000012 Ga0207713_1000012211 459
90 3300025735 Ga0207713_1000383 Ga0207713_100038322 459
91 3300025735 Ga0207713_1001567 Ga0207713_10015677 459
92 3300025735 Ga0207713_1002227 Ga0207713_10022272 459
93 3300025735 Ga0207713_1002776 Ga0207713_100277612 459
94 3300025735 Ga0207713_1049410 Ga0207713_10494101 459
95 3300025900 Ga0207710_10000150 Ga0207710_1000015013 459
96 3300025911 Ga0207654_10000007 Ga0207654_10000007380 459
97 3300026116 Ga0207674_10002163 Ga0207674_1000216316 459
98 3300027111 Ga0209281_1000006 Ga0209281_1000006189 459
99 3300027111 Ga0209281_1000071 Ga0209281_100007156 459
100 3300027111 Ga0209281_1001332 Ga0209281_100133216 459
101 3300027111 Ga0209281_1001392 Ga0209281_10013922 459
102 3300027312 Ga0209371_1000001 Ga0209371_10000012147 459
103 3300027312 Ga0209371_1000466 Ga0209371_100046613 459
104 3300030500 Ga0268256_1000001 Ga0268256_1000001493 459
105 3300030500 Ga0268256_1000423 Ga0268256_100042324 459
106 3300042010 Ga0439452_000002 Ga0439452_000002_464266_465672 459
107 3300042010 Ga0439452_000032 Ga0439452_000032_171051_172457 459
108 3300046453 Ga0495627_000018 Ga0495627_000018_176150_177556 459
109 3300046471 Ga0495650_0000047 Ga0495650_0000047_300166_301572 459
110 3300046471 Ga0495650_0000182 Ga0495650_0000182_42015_43424 459
111 3300046507 Ga0495606_0015548 Ga0495606_0015548_1020_2456 459
112 3300046530 Ga0495654_0000596 Ga0495654_0000596_13175_14581 459
113 3300046558 Ga0495633_0000002 Ga0495633_0000002_382704_384134 459
114 3300046615 Ga0495656_0061371 Ga0495656_0061371_31_1479 459
115 3300046794 Ga0495589_0000002 Ga0495589_0000002_222413_223819 459
116 3300046810 Ga0495660_0000004 Ga0495660_0000004_882914_884323 459
117 3300048919 Ga0496116_0000023 Ga0496116_0000023_331023_332429 459
118 3300048919 Ga0496116_0000094 Ga0496116_0000094_108327_109736 459
119 3300048919 Ga0496116_0000625 Ga0496116_0000625_34199_35605 459
120 3300048919 Ga0496116_0001704 Ga0496116_0001704_4066_5472 459
121 3300048919 Ga0496116_0001737 Ga0496116_0001737_12868_14274 459
122 3300048919 Ga0496116_0002154 Ga0496116_0002154_195_1601 459
123 3300048920 Ga0496117_0000835 Ga0496117_0000835_38742_40148 459
124 3300048920 Ga0496117_0002120 Ga0496117_0002120_7499_8905 459
125 3300048920 Ga0496117_0002436 Ga0496117_0002436_7876_9282 459
126 3300048920 Ga0496117_0003978 Ga0496117_0003978_11845_13254 459
127 3300048920 Ga0496117_0018285 Ga0496117_0018285_4075_5481 459
128 3300048920 Ga0496117_0019093 Ga0496117_0019093_1559_2965 459
129 3300048921 Ga0496118_0000158 Ga0496118_0000158_18245_19654 459
130 3300048921 Ga0496118_0001914 Ga0496118_0001914_2378_3784 459
131 3300048921 Ga0496118_0003457 Ga0496118_0003457_3495_4901 459
132 3300048921 Ga0496118_0005328 Ga0496118_0005328_11884_13293 459
133 3300048922 Ga0496119_0000468 Ga0496119_0000468_7098_8504 459
134 3300048922 Ga0496119_0001574 Ga0496119_0001574_7015_8421 459
135 3300048922 Ga0496119_0001730 Ga0496119_0001730_19705_21111 459
136 3300048922 Ga0496119_0002241 Ga0496119_0002241_4341_5747 459
137 3300048922 Ga0496119_0002860 Ga0496119_0002860_6758_8164 459
138 3300048923 Ga0496120_0000052 Ga0496120_0000052_48573_49979 459
139 3300048923 Ga0496120_0000137 Ga0496120_0000137_101556_102962 459
140 3300048923 Ga0496120_0001027 Ga0496120_0001027_18959_20365 459
141 3300048923 Ga0496120_0002104 Ga0496120_0002104_4101_5507 459
142 3300048923 Ga0496120_0002703 Ga0496120_0002703_11844_13253 459
143 3300048923 Ga0496120_0002884 Ga0496120_0002884_13891_15297 459
144 3300048924 Ga0496121_0001226 Ga0496121_0001226_13053_14459 459
145 3300048924 Ga0496121_0001655 Ga0496121_0001655_27227_28633 459
146 3300048924 Ga0496121_0003017 Ga0496121_0003017_14410_15816 459
147 3300048924 Ga0496121_0003296 Ga0496121_0003296_9759_11165 459
148 3300048924 Ga0496121_0004821 Ga0496121_0004821_10550_11956 459
149 3300048925 Ga0496122_0000007 Ga0496122_0000007_274057_275466 459
150 3300048925 Ga0496122_0001843 Ga0496122_0001843_10560_11966 459
151 3300048925 Ga0496122_0002182 Ga0496122_0002182_7897_9303 459
152 3300048925 Ga0496122_0002922 Ga0496122_0002922_17891_19297 459
153 3300048925 Ga0496122_0003024 Ga0496122_0003024_15068_16474 459
154 3300048926 Ga0496123_0000004 Ga0496123_0000004_501764_503173 459
155 3300048926 Ga0496123_0001504 Ga0496123_0001504_10560_11966 459
156 3300048926 Ga0496123_0001770 Ga0496123_0001770_20827_22233 459
157 3300048927 Ga0496124_0000017 Ga0496124_0000017_127459_128865 459
158 3300048927 Ga0496124_0000025 Ga0496124_0000025_207171_208580 459
159 3300048927 Ga0496124_0001484 Ga0496124_0001484_17936_19342 459
160 3300048927 Ga0496124_0001931 Ga0496124_0001931_7804_9210 459
161 3300048927 Ga0496124_0004060 Ga0496124_0004060_967_2373 459
162 3300048928 Ga0496125_0000013 Ga0496125_0000013_304715_306124 459
163 3300048928 Ga0496125_0001229 Ga0496125_0001229_18336_19742 459
164 3300048928 Ga0496125_0001911 Ga0496125_0001911_15394_16800 459
165 3300048928 Ga0496125_0001991 Ga0496125_0001991_17105_18511 459
166 3300048928 Ga0496125_0004865 Ga0496125_0004865_13466_14872 459
167 3300048929 Ga0496126_0002405 Ga0496126_0002405_8879_10285 459
168 3300048929 Ga0496126_0004050 Ga0496126_0004050_246_1655 459
169 3300048929 Ga0496126_0013484 Ga0496126_0013484_1633_3039 459
170 3300048929 Ga0496126_0042116 Ga0496126_0042116_12_1418 459
171 3300049571 Ga0501034_0065414 Ga0501034_0065414_364_1821 459
172 3300050491 nmdc:mga00v17_27254_c1 nmdc:mga00v17_27254_c1_949_2355 459
173 3300009177 Ga0105248_10004273 Ga0105248_100042732 460
174 3300017792 Ga0163161_10000001 Ga0163161_10000001350 460
175 3300021384 Ga0213876_10000034 Ga0213876_1000003443 460
176 3300025941 Ga0207711_10021152 Ga0207711_100211525 460
177 3300028379 Ga0268266_10032002 Ga0268266_100320024 460
178 3300039437 Ga0436365_0965775 Ga0436365_0965775_322808_324214 460
179 3300044669 Ga0466981_0000003 Ga0466981_0000003_72806_74212 460
180 3300048907 Ga0496104_0000100 Ga0496104_0000100_74586_75992 460
181 3300048925 Ga0496122_0004956 Ga0496122_0004956_10939_12345 460
182 3300048926 Ga0496123_0003928 Ga0496123_0003928_3789_5195 460
183 3300048929 Ga0496126_0000865 Ga0496126_0000865_27991_29397 460
184 3300048929 Ga0496126_0002119 Ga0496126_0002119_17776_19182 460
185 3300049568 Ga0501031_0037347 Ga0501031_0037347_1162_2580 460
186 iso_pu_bacteria 2808606372 2808901384 460
187 3300009092 Ga0105250_10000594 Ga0105250_1000059420 461
188 3300015679 Ga0183366_1001 Ga0183366_10012195 461
189 3300015680 Ga0183370_1001 Ga0183370_10012195 461
190 3300015685 Ga0183369_1001 Ga0183369_10012196 461
191 3300015687 Ga0183368_1001 Ga0183368_10012195 461
192 3300025711 Ga0207696_1000620 Ga0207696_10006204 461
193 3300037418 Ga0395900_0223228 Ga0395900_0223228_273_1706 461
194 3300046460 Ga0495638_0039389 Ga0495638_0039389_1122_2585 461
195 3300046542 Ga0495597_0002098 Ga0495597_0002098_10526_11935 461
196 3300047320 Ga0495672_0000009 Ga0495672_0000009_455217_456626 461
197 3300049570 Ga0501033_0010131 Ga0501033_0010131_3580_5043 461
198 3300049744 Ga0501083_0036383 Ga0501083_0036383_178_1614 461
199 3300009036 Ga0105244_10000999 Ga0105244_1000099917 462
200 3300025728 Ga0207655_1000007 Ga0207655_1000007451 462
201 3300044712 Ga0453684_0002622 Ga0453684_0002622_2633_4048 462
202 iso_pu_bacteria 2831905167 2831908025 462
203 3300005468 Ga0070707_100008844 Ga0070707_1000088446 463
204 3300005471 Ga0070698_100016460 Ga0070698_1000164606 463
205 3300005518 Ga0070699_100006492 Ga0070699_1000064928 463
206 3300006028 Ga0070717_10004253 Ga0070717_1000425310 463
207 3300006946 Ga0079104_1001061 Ga0079104_100106120 463
208 3300009036 Ga0105244_10000635 Ga0105244_1000063518 463
209 3300009036 Ga0105244_10003403 Ga0105244_100034038 463
210 3300025728 Ga0207655_1000002 Ga0207655_1000002467 463
211 3300025728 Ga0207655_1000642 Ga0207655_100064221 463
212 3300025922 Ga0207646_10000333 Ga0207646_1000033345 463
213 3300025929 Ga0207664_10161207 Ga0207664_101612072 463
214 3300027111 Ga0209281_1000370 Ga0209281_100037037 463
215 3300046530 Ga0495654_0016346 Ga0495654_0016346_753_2162 463
216 3300047446 Ga0495679_000309 Ga0495679_000309_37156_38565 463
217 3300047470 Ga0495681_0034070 Ga0495681_0034070_107_1516 463
218 iso_pu_bacteria 2593339131 2595088022 463
219 iso_pu_bacteria 2721755693 2723604845 463
220 iso_pu_bacteria 2728369359 2730135482 463
221 iso_pu_bacteria 2738543017 2739267941 463
222 iso_pu_bacteria 2751185905 2753809715 463
223 iso_pu_bacteria 2757320391 2757566000 463
224 iso_pu_bacteria 2775507177 2777762229 463
225 iso_pu_bacteria 2802428803 2802437100 463
226 iso_pu_bacteria 2857586860 2857587168 463
227 iso_pu_bacteria 2857609550 2857610874 463
228 iso_pu_bacteria 2889276214 2889280756 463
229 iso_pu_bacteria 2904595352 2904598452 463
230 iso_pu_bacteria 2936340661 2936341867 463
231 iso_pu_bacteria 2938917290 2938917510 463
232 iso_pu_bacteria 2939702853 2939706696 463
233 iso_pu_bacteria 2956897341 2956899071 463
234 iso_pu_bacteria 2956897341 2956900368 463
235 iso_pu_bacteria 2965761152 2965766869 463
236 iso_pu_bacteria 648028048 648170887 463
237 iso_pu_bacteria 8007371054 8007373238 463
238 iso_pu_bacteria 8022792930 8022796402 463
239 iso_pu_bacteria 8023438354 8023439654 463
240 iso_pu_bacteria 8023444577 8023447532 463
241 iso_pu_bacteria 8057582654 8057587574 463
242 3300006946 Ga0079104_1000163 Ga0079104_100016343 464
243 3300009098 Ga0105245_10141483 Ga0105245_101414833 464
244 3300013105 Ga0157369_10042245 Ga0157369_100422453 464
245 3300027111 Ga0209281_1000064 Ga0209281_1000064227 464
246 3300049571 Ga0501034_0191312 Ga0501034_0191312_299_1723 464
247 3300049572 Ga0501036_0006154 Ga0501036_0006154_260_1684 464
248 3300049578 Ga0501042_0004170 Ga0501042_0004170_6263_7687 464
249 3300049579 Ga0501043_0001906 Ga0501043_0001906_12852_14276 464
250 3300049581 Ga0501047_0004030 Ga0501047_0004030_8101_9525 464
251 3300049582 Ga0501048_0021270 Ga0501048_0021270_219_1643 464
252 3300049590 Ga0501074_0000975 Ga0501074_0000975_12600_14024 464
253 iso_pu_bacteria 2506520007 2506577637 464
254 iso_pu_bacteria 2506520008 2506582775 464
255 iso_pu_bacteria 2508501071 2508851572 464
256 iso_pu_bacteria 2511231119 2511700177 464
257 iso_pu_bacteria 2524023129 2524186486 464
258 iso_pu_bacteria 2524023129 2524190970 464
259 iso_pu_bacteria 2537561728 2538427431 464
260 iso_pu_bacteria 2540341094 2540607322 464
261 iso_pu_bacteria 2545555800 2545556859 464
262 iso_pu_bacteria 2547132181 2547697174 464
263 iso_pu_bacteria 2548877040 2550900507 464
264 iso_pu_bacteria 2554235234 2555261286 464
265 iso_pu_bacteria 2554235283 2555467569 464
266 iso_pu_bacteria 2561511199 2562463330 464
267 iso_pu_bacteria 2563366752 2563927045 464
268 iso_pu_bacteria 2563366752 2563929288 464
269 iso_pu_bacteria 2571042143 2571533549 464
270 iso_pu_bacteria 2571042588 2573038021 464
271 iso_pu_bacteria 2576861599 2578931110 464
272 iso_pu_bacteria 2579778775 2580930488 464
273 iso_pu_bacteria 2585428059 2587743737 464
274 iso_pu_bacteria 2593339198 2595316615 464
275 iso_pu_bacteria 2599185169 2599411442 464
276 iso_pu_bacteria 2600255254 2601524439 464
277 iso_pu_bacteria 2600255255 2601529593 464
278 iso_pu_bacteria 2600255256 2601534814 464
279 iso_pu_bacteria 2600255257 2601539557 464
280 iso_pu_bacteria 2600255280 2601616427 464
281 iso_pu_bacteria 2600255281 2601621149 464
282 iso_pu_bacteria 2600255286 2601638668 464
283 iso_pu_bacteria 2600255287 2601641862 464
284 iso_pu_bacteria 2600255288 2601649546 464
285 iso_pu_bacteria 2600255289 2601654473 464
286 iso_pu_bacteria 2600255290 2601659895 464
287 iso_pu_bacteria 2600255291 2601665920 464
288 iso_pu_bacteria 2600255298 2601698777 464
289 iso_pu_bacteria 2600255299 2601701605 464
290 iso_pu_bacteria 2600255300 2601707217 464
291 iso_pu_bacteria 2600255301 2601711831 464
292 iso_pu_bacteria 2600255302 2601717734 464
293 iso_pu_bacteria 2600255303 2601719669 464
294 iso_pu_bacteria 2600255304 2601727662 464
295 iso_pu_bacteria 2600255305 2601732273 464
296 iso_pu_bacteria 2600255306 2601739496 464
297 iso_pu_bacteria 2600255307 2601741492 464
298 iso_pu_bacteria 2600255309 2601752254 464
299 iso_pu_bacteria 2600255310 2601757907 464
300 iso_pu_bacteria 2600255311 2601764265 464
301 iso_pu_bacteria 2600255392 2602019095 464
302 iso_pu_bacteria 2602042046 2603637081 464
303 iso_pu_bacteria 2602042047 2603645036 464
304 iso_pu_bacteria 2602042052 2603661361 464
305 iso_pu_bacteria 2602042053 2603664315 464
306 iso_pu_bacteria 2602042066 2603699160 464
307 iso_pu_bacteria 2602042067 2603705175 464
308 iso_pu_bacteria 2602042103 2603840088 464
309 iso_pu_bacteria 2602042104 2603845165 464
310 iso_pu_bacteria 2602042105 2603849830 464
311 iso_pu_bacteria 2602042106 2603855306 464
312 iso_pu_bacteria 2602042109 2603868774 464
313 iso_pu_bacteria 2602042110 2603872887 464
314 iso_pu_bacteria 2602042111 2603876658 464
315 iso_pu_bacteria 2603880178 2606049656 464
316 iso_pu_bacteria 2603880184 2606068745 464
317 iso_pu_bacteria 2603880202 2606147750 464
318 iso_pu_bacteria 2603880211 2606177545 464
319 iso_pu_bacteria 2609459761 2609909853 464
320 iso_pu_bacteria 2619619294 2621274931 464
321 iso_pu_bacteria 2630968484 2631984442 464
322 iso_pu_bacteria 2636415599 2637224263 464
323 iso_pu_bacteria 2643221543 2643735519 464
324 iso_pu_bacteria 2643221735 2644740738 464
325 iso_pu_bacteria 2648501850 2651531945 464
326 iso_pu_bacteria 2654587920 2656278681 464
327 iso_pu_bacteria 2667528172 2671101324 464
328 iso_pu_bacteria 2671180694 2673820885 464
329 iso_pu_bacteria 2671180844 2674419014 464
330 iso_pu_bacteria 2675903046 2676405668 464
331 iso_pu_bacteria 2681812866 2681996411 464
332 iso_pu_bacteria 2681812869 2682006240 464
333 iso_pu_bacteria 2684623153 2686997393 464
334 iso_pu_bacteria 2687453109 2687498703 464
335 iso_pu_bacteria 2687453601 2689444127 464
336 iso_pu_bacteria 2695420354 2695628154 464
337 iso_pu_bacteria 2716884898 2717916138 464
338 iso_pu_bacteria 2751185917 2753856726 464
339 iso_pu_bacteria 2765235842 2765589820 464
340 iso_pu_bacteria 2772190666 2772438155 464
341 iso_pu_bacteria 2775506706 2775539755 464
342 iso_pu_bacteria 2775507074 2777020765 464
343 iso_pu_bacteria 2791355010 2792310359 464
344 iso_pu_bacteria 2791355222 2793184584 464
345 iso_pu_bacteria 2791355275 2793404935 464
346 iso_pu_bacteria 2806310673 2807176500 464
347 iso_pu_bacteria 2808606399 2809055998 464
348 iso_pu_bacteria 2811994870 2812316586 464
349 iso_pu_bacteria 2814123068 2814695643 464
350 iso_pu_bacteria 2816332186 2816862686 464
351 iso_pu_bacteria 2816332295 2817480676 464
352 iso_pu_bacteria 2818991441 2819569166 464
353 iso_pu_bacteria 2818991459 2819673610 464
354 iso_pu_bacteria 2818991468 2819723650 464
355 iso_pu_bacteria 2821111986 2821112011 464
356 iso_pu_bacteria 2821111986 2821114592 464
357 iso_pu_bacteria 2821118458 2821120840 464
358 iso_pu_bacteria 2823373977 2823375474 464
359 iso_pu_bacteria 2823526263 2823528569 464
360 iso_pu_bacteria 2842682962 2842684391 464
361 iso_pu_bacteria 2842888712 2842891766 464
362 iso_pu_bacteria 2846540461 2846542110 464
363 iso_pu_bacteria 2847085930 2847086786 464
364 iso_pu_bacteria 2849139964 2849144358 464
365 iso_pu_bacteria 2855195626 2855199390 464
366 iso_pu_bacteria 2857453340 2857454566 464
367 iso_pu_bacteria 2857453340 2857457147 464
368 iso_pu_bacteria 2857472729 2857473139 464
369 iso_pu_bacteria 2857581216 2857582421 464
370 iso_pu_bacteria 2857604169 2857608584 464
371 iso_pu_bacteria 2857609550 2857610251 464
372 iso_pu_bacteria 2858438669 2858439760 464
373 iso_pu_bacteria 2858466076 2858470187 464
374 iso_pu_bacteria 2860837431 2860840009 464
375 iso_pu_bacteria 2864733723 2864737936 464
376 iso_pu_bacteria 2864733723 2864739032 464
377 iso_pu_bacteria 2864997549 2865000148 464
378 iso_pu_bacteria 2865002811 2865004176 464
379 iso_pu_bacteria 2869551831 2869553486 464
380 iso_pu_bacteria 2871272651 2871275380 464
381 iso_pu_bacteria 2871282230 2871286594 464
382 iso_pu_bacteria 2877768649 2877771058 464
383 iso_pu_bacteria 2880169592 2880171923 464
384 iso_pu_bacteria 2881636855 2881641109 464
385 iso_pu_bacteria 2884086401 2884088137 464
386 iso_pu_bacteria 2885526491 2885527642 464
387 iso_pu_bacteria 2888366609 2888368174 464
388 iso_pu_bacteria 2888373701 2888374215 464
389 iso_pu_bacteria 2888578766 2888582713 464
390 iso_pu_bacteria 2888578766 2888583106 464
391 iso_pu_bacteria 2889042446 2889046247 464
392 iso_pu_bacteria 2889042446 2889046738 464
393 iso_pu_bacteria 2889049205 2889055081 464
394 iso_pu_bacteria 2889295896 2889296271 464
395 iso_pu_bacteria 2897109615 2897112133 464
396 iso_pu_bacteria 2900051742 2900055667 464
397 iso_pu_bacteria 2904113452 2904114865 464
398 iso_pu_bacteria 2904162308 2904163295 464
399 iso_pu_bacteria 2904162308 2904163725 464
400 iso_pu_bacteria 2904479285 2904481536 464
401 iso_pu_bacteria 2904490793 2904493150 464
402 iso_pu_bacteria 2904490793 2904493559 464
403 iso_pu_bacteria 2904513164 2904515581 464
404 iso_pu_bacteria 2904560550 2904562013 464
405 iso_pu_bacteria 2904755435 2904760218 464
406 iso_pu_bacteria 2907202186 2907205711 464
407 iso_pu_bacteria 2907202186 2907206273 464
408 iso_pu_bacteria 2908665501 2908668227 464
409 iso_pu_bacteria 2908669403 2908672271 464
410 iso_pu_bacteria 2919093281 2919095996 464
411 iso_pu_bacteria 2919108558 2919111256 464
412 iso_pu_bacteria 2919160200 2919162439 464
413 iso_pu_bacteria 2919160200 2919162724 464
414 iso_pu_bacteria 2919414237 2919417298 464
415 iso_pu_bacteria 2919425241 2919426985 464
416 iso_pu_bacteria 2919425241 2919427274 464
417 iso_pu_bacteria 2919726948 2919728285 464
418 iso_pu_bacteria 2923634449 2923635641 464
419 iso_pu_bacteria 2925326138 2925332481 464
420 iso_pu_bacteria 2927833300 2927833391 464
421 iso_pu_bacteria 2928510474 2928512210 464
422 iso_pu_bacteria 2928510474 2928513585 464
423 iso_pu_bacteria 2928519762 2928519851 464
424 iso_pu_bacteria 2929206907 2929210490 464
425 iso_pu_bacteria 2931384279 2931389696 464
426 iso_pu_bacteria 2931384279 2931390186 464
427 iso_pu_bacteria 2932406140 2932408394 464
428 iso_pu_bacteria 2935625433 2935625963 464
429 iso_pu_bacteria 2937539931 2937542644 464
430 iso_pu_bacteria 2937967321 2937969900 464
431 iso_pu_bacteria 2938649242 2938649829 464
432 iso_pu_bacteria 2939568625 2939569842 464
433 iso_pu_bacteria 2939573065 2939577858 464
434 iso_pu_bacteria 2939577877 2939580055 464
435 iso_pu_bacteria 2939607340 2939608879 464
436 iso_pu_bacteria 2939617950 2939618282 464
437 iso_pu_bacteria 2939642701 2939643154 464
438 iso_pu_bacteria 2939679117 2939679792 464
439 iso_pu_bacteria 2939679117 2939680887 464
440 iso_pu_bacteria 2945874760 2945877060 464
441 iso_pu_bacteria 2945991243 2945997585 464
442 iso_pu_bacteria 2946053406 2946053799 464
443 iso_pu_bacteria 2946053406 2946054325 464
444 iso_pu_bacteria 2954773129 2954773913 464
445 iso_pu_bacteria 2962290636 2962293282 464
446 iso_pu_bacteria 2964326757 2964328820 464
447 iso_pu_bacteria 2964375228 2964378490 464
448 iso_pu_bacteria 2968558590 2968561215 464
449 iso_pu_bacteria 2969079654 2969081303 464
450 iso_pu_bacteria 2969136845 2969139294 464
451 iso_pu_bacteria 2969141011 2969143506 464
452 iso_pu_bacteria 2969765954 2969767261 464
453 iso_pu_bacteria 2969770375 2969773427 464
454 iso_pu_bacteria 2971403814 2971405724 464
455 iso_pu_bacteria 2971410472 2971416285 464
456 iso_pu_bacteria 2971511577 2971515626 464
457 iso_pu_bacteria 2971820967 2971822727 464
458 iso_pu_bacteria 2971893375 2971895705 464
459 iso_pu_bacteria 2974310843 2974311311 464
460 iso_pu_bacteria 2974435778 2974439071 464
461 iso_pu_bacteria 2980125574 2980125673 464
462 iso_pu_bacteria 2980176882 2980180129 464
463 iso_pu_bacteria 2980182181 2980184531 464
464 iso_pu_bacteria 2980492589 2980495048 464
465 iso_pu_bacteria 2981284811 2981288015 464
466 iso_pu_bacteria 2981289755 2981292271 464
467 iso_pu_bacteria 2981980479 2981983634 464
468 iso_pu_bacteria 2981985349 2981988328 464
469 iso_pu_bacteria 2984527788 2984530281 464
470 iso_pu_bacteria 2984532647 2984536390 464
471 iso_pu_bacteria 2984559226 2984563766 464
472 iso_pu_bacteria 2984595703 2984596499 464
473 iso_pu_bacteria 2988225383 2988229393 464
474 iso_pu_bacteria 2996632988 2996639012 464
475 iso_pu_bacteria 3000376612 3000378585 464
476 iso_pu_bacteria 3001892409 3001895335 464
477 iso_pu_bacteria 3006826541 3006831361 464
478 iso_pu_bacteria 3006858327 3006861022 464
479 iso_pu_bacteria 3006879489 3006881518 464
480 iso_pu_bacteria 3006978542 3006981674 464
481 iso_pu_bacteria 640753048 640937140 464
482 iso_pu_bacteria 8002317523 8002322259 464
483 iso_pu_bacteria 8004592986 8004597530 464
484 iso_pu_bacteria 8015394850 8015397720 464
485 iso_pu_bacteria 8018221730 8018223944 464
486 iso_pu_bacteria 8018405270 8018409449 464
487 iso_pu_bacteria 8019499862 8019501302 464
488 iso_pu_bacteria 8019504834 8019505381 464
489 iso_pu_bacteria 8022630665 8022631799 464
490 iso_pu_bacteria 8022653035 8022654174 464
491 iso_pu_bacteria 8022948649 8022954057 464
492 iso_pu_bacteria 8046991243 8046997710 464
493 iso_pu_bacteria 8051952484 8051955369 464
494 iso_pu_bacteria 8052174270 8052178137 464
495 iso_pu_bacteria 8054280661 8054281346 464
496 iso_pu_bacteria 8054795415 8054795793 464
497 iso_pu_bacteria 8055087960 8055088011 464
498 iso_pu_bacteria 8055092621 8055095297 464
499 iso_pu_bacteria 8055097453 8055098406 464
500 iso_pu_bacteria 8055632911 8055635060 464
501 iso_pu_bacteria 8056533031 8056540378 464
502 iso_pu_bacteria 8057304971 8057307005 464
503 iso_pu_bacteria 8057473075 8057473813 464
504 iso_pu_bacteria 8057473075 8057476263 464
505 iso_pu_bacteria 8057733483 8057737687 464
506 iso_pu_bacteria 8057977335 8057980395 464
507 3300005445 Ga0070708_100034203 Ga0070708_1000342034 465
508 3300005468 Ga0070707_100002389 Ga0070707_1000023895 465
509 3300005471 Ga0070698_100014576 Ga0070698_1000145764 465
510 3300005518 Ga0070699_100072515 Ga0070699_1000725152 465
511 3300025922 Ga0207646_10003431 Ga0207646_100034314 465
512 3300036647 Ga0316582_0011868 Ga0316582_0011868_3375_4781 465
513 3300049588 Ga0501072_0029589 Ga0501072_0029589_1283_2881 465
514 iso_pu_bacteria 2511231025 2511379904 465
515 iso_pu_bacteria 2511231035 2511434759 465
516 iso_pu_bacteria 2585427591 2585829855 465
517 iso_pu_bacteria 2585427592 2585835015 465
518 iso_pu_bacteria 2599185299 2599926354 465
519 iso_pu_bacteria 2608642108 2608669894 465
520 iso_pu_bacteria 2648501693 2650897101 465
521 iso_pu_bacteria 2667528173 2671108739 465
522 iso_pu_bacteria 2671180115 2671585545 465
523 iso_pu_bacteria 2684622997 2686354009 465
524 iso_pu_bacteria 2711768156 2712469423 465
525 iso_pu_bacteria 2791354903 2791922023 465
526 iso_pu_bacteria 2808606414 2809125562 465
527 iso_pu_bacteria 2811995292 2813728091 465
528 iso_pu_bacteria 2818991440 2819565263 465
529 iso_pu_bacteria 2844528606 2844528987 465
530 iso_pu_bacteria 2847797336 2847799135 465
531 iso_pu_bacteria 2852103415 2852107593 465
532 iso_pu_bacteria 2865014394 2865017437 465
533 iso_pu_bacteria 2876601092 2876602919 465
534 iso_pu_bacteria 2881609920 2881610213 465
535 iso_pu_bacteria 2891670763 2891672151 465
536 iso_pu_bacteria 2904463128 2904466933 465
537 iso_pu_bacteria 2904474040 2904475565 465
538 iso_pu_bacteria 2904504865 2904507966 465
539 iso_pu_bacteria 2919150387 2919151734 465
540 iso_pu_bacteria 2927143783 2927144403 465
541 iso_pu_bacteria 2939602548 2939606954 465
542 iso_pu_bacteria 2945951305 2945952369 465
543 iso_pu_bacteria 2978975091 2978978856 465
544 iso_pu_bacteria 2984494565 2984497370 465
545 iso_pu_bacteria 2990261002 2990261321 465
546 iso_pu_bacteria 8016733728 8016735218 465
547 iso_pu_bacteria 8054844752 8054846431 465
548 iso_pu_bacteria 8054849141 8054851753 465
549 iso_pu_bacteria 8055693939 8055696694 465
550 3300005327 Ga0070658_10000763 Ga0070658_100007635 466
551 3300005338 Ga0068868_100003167 Ga0068868_1000031678 466
552 3300005445 Ga0070708_100069342 Ga0070708_1000693421 466
553 3300005467 Ga0070706_100000277 Ga0070706_10000027765 466
554 3300005467 Ga0070706_100031538 Ga0070706_1000315384 466
555 3300005468 Ga0070707_100000029 Ga0070707_100000029119 466
556 3300005471 Ga0070698_100000166 Ga0070698_1000001664 466
557 3300005471 Ga0070698_100000793 Ga0070698_1000007938 466
558 3300005471 Ga0070698_100005108 Ga0070698_1000051083 466
559 3300005471 Ga0070698_100107780 Ga0070698_1001077804 466
560 3300005471 Ga0070698_100110789 Ga0070698_1001107893 466
561 3300005518 Ga0070699_100000171 Ga0070699_10000017164 466
562 3300005518 Ga0070699_100018451 Ga0070699_1000184514 466
563 3300005535 Ga0070684_100000077 Ga0070684_10000007741 466
564 3300005536 Ga0070697_100000003 Ga0070697_10000000322 466
565 3300005536 Ga0070697_100000806 Ga0070697_10000080614 466
566 3300005536 Ga0070697_100000866 Ga0070697_10000086619 466
567 3300005937 Ga0081455_10032838 Ga0081455_100328384 466
568 3300006028 Ga0070717_10017018 Ga0070717_100170184 466
569 3300006173 Ga0070716_100038075 Ga0070716_1000380752 466
570 3300009098 Ga0105245_10010945 Ga0105245_100109456 466
571 3300010375 Ga0105239_10027102 Ga0105239_100271026 466
572 3300013102 Ga0157371_10004595 Ga0157371_100045959 466
573 3300013105 Ga0157369_10000589 Ga0157369_1000058925 466
574 3300014969 Ga0157376_10000214 Ga0157376_1000021420 466
575 3300025909 Ga0207705_10005126 Ga0207705_100051265 466
576 3300025910 Ga0207684_10000008 Ga0207684_10000008485 466
577 3300025910 Ga0207684_10017137 Ga0207684_100171376 466
578 3300025922 Ga0207646_10000142 Ga0207646_100001426 466
579 3300025922 Ga0207646_10002050 Ga0207646_1000205015 466
580 3300025922 Ga0207646_10003981 Ga0207646_1000398110 466
581 3300025922 Ga0207646_10009446 Ga0207646_100094466 466
582 3300025922 Ga0207646_10011676 Ga0207646_100116764 466
583 3300025927 Ga0207687_10005575 Ga0207687_100055754 466
584 3300025944 Ga0207661_10000015 Ga0207661_1000001544 466
585 3300026023 Ga0207677_10000048 Ga0207677_1000004817 466
586 3300031241 Ga0265325_10008619 Ga0265325_100086193 466
587 3300031249 Ga0265339_10002811 Ga0265339_100028114 466
588 3300031344 Ga0265316_10014201 Ga0265316_100142015 466
589 3300031711 Ga0265314_10030356 Ga0265314_100303563 466
590 3300031711 Ga0265314_10057905 Ga0265314_100579053 466
591 3300031728 Ga0316578_10033102 Ga0316578_100331022 466
592 3300038741 Ga0400488_52971 Ga0400488_52971_4229_5677 466
593 3300039093 Ga0400489_11819 Ga0400489_11819_6105_7547 466
594 3300049572 Ga0501036_0018299 Ga0501036_0018299_4236_5672 466
595 3300049574 Ga0501038_0009093 Ga0501038_0009093_963_2399 466
596 3300049576 Ga0501040_0003798 Ga0501040_0003798_1508_2944 466
597 3300049578 Ga0501042_0012426 Ga0501042_0012426_4122_5558 466
598 3300049587 Ga0501071_0015764 Ga0501071_0015764_3424_4860 466
599 3300049590 Ga0501074_0002363 Ga0501074_0002363_11660_13096 466
600 3300054114 Ga0501084_0041452 Ga0501084_0041452_1080_2516 466
601 3300060353 Ga0501082_0015040 Ga0501082_0015040_4893_6329 466
602 iso_pu_bacteria 2671180330 2672336854 466
603 3300002077 JGI24744J21845_10014432 JGI24744J21845_100144321 467
604 3300003187 JGI25151J46595_10000158 JGI25151J46595_1000015862 467
605 3300003187 JGI25151J46595_10003023 JGI25151J46595_100030235 467
606 3300003187 JGI25151J46595_10014500 JGI25151J46595_100145004 467
607 3300003578 Ga0006562J51391_1002186 Ga0006562J51391_10021861 467
608 3300003758 Ga0055532_1000233 Ga0055532_100023312 467
609 3300005355 Ga0070671_100002544 Ga0070671_1000025449 467
610 3300005981 Ga0081538_10022116 Ga0081538_100221162 467
611 3300006051 Ga0075364_10003469 Ga0075364_100034696 467
612 3300025229 Ga0209147_100088 Ga0209147_10008814 467
613 3300025284 Ga0209130_1000320 Ga0209130_10003205 467
614 3300025292 Ga0209676_1001699 Ga0209676_100169910 467
615 3300025294 Ga0209025_1000368 Ga0209025_100036814 467
616 3300025294 Ga0209025_1003105 Ga0209025_10031055 467
617 3300025294 Ga0209025_1009924 Ga0209025_10099246 467
618 3300025914 Ga0207671_10000062 Ga0207671_10000062120 467
619 3300030083 Ga0237817_10010 Ga0237817_1001010 467
620 3300031235 Ga0265330_10059295 Ga0265330_100592951 467
621 3300031250 Ga0265331_10052169 Ga0265331_100521691 467
622 3300031824 Ga0307413_10033108 Ga0307413_100331082 467
623 3300031852 Ga0307410_10006702 Ga0307410_100067024 467
624 3300033180 Ga0307510_10087683 Ga0307510_100876832 467
625 3300038705 Ga0237819_02091 Ga0237819_02091_1462_2871 467
626 3300045976 Ga0466967_0006590 Ga0466967_0006590_4988_6445 467
627 3300048905 Ga0496102_0074750 Ga0496102_0074750_711_2117 467
628 3300048906 Ga0496103_0018887 Ga0496103_0018887_1751_3157 467
629 3300048919 Ga0496116_0052606 Ga0496116_0052606_773_2179 467
630 3300048920 Ga0496117_0008017 Ga0496117_0008017_4156_5562 467
631 3300048920 Ga0496117_0019839 Ga0496117_0019839_2128_3546 467
632 3300048921 Ga0496118_0038280 Ga0496118_0038280_1506_2912 467
633 3300048922 Ga0496119_0000166 Ga0496119_0000166_83118_84536 467
634 3300048922 Ga0496119_0007695 Ga0496119_0007695_292_1698 467
635 3300048923 Ga0496120_0000406 Ga0496120_0000406_8766_10184 467
636 3300048925 Ga0496122_0082854 Ga0496122_0082854_345_1763 467
637 3300048926 Ga0496123_0069160 Ga0496123_0069160_278_1684 467
638 3300048927 Ga0496124_0000368 Ga0496124_0000368_22460_23878 467
639 3300048928 Ga0496125_0000728 Ga0496125_0000728_2879_4285 467
640 3300048929 Ga0496126_0013750 Ga0496126_0013750_877_2295 467
641 3300048929 Ga0496126_0096786 Ga0496126_0096786_773_2179 467
642 3300048929 Ga0496126_0100424 Ga0496126_0100424_361_1779 467
643 3300049571 Ga0501034_0002371 Ga0501034_0002371_4647_6116 467
644 iso_pu_bacteria 2585428059 2587737934 467
645 iso_pu_bacteria 2643221676 2644422972 467
646 iso_pu_bacteria 2818991459 2819670353 467
647 iso_pu_bacteria 2971410472 2971417189 467
648 iso_pu_bacteria 8056533031 8056539896 467
649 3300002773 JGI25152J39213_1000139 JGI25152J39213_100013925 468
650 3300003187 JGI25151J46595_10015640 JGI25151J46595_100156401 468
651 3300003187 JGI25151J46595_10027687 JGI25151J46595_100276872 468
652 3300003578 Ga0006562J51391_1006751 Ga0006562J51391_10067518 468
653 3300003578 Ga0006562J51391_1016265 Ga0006562J51391_10162652 468
654 3300003751 Ga0055538_1000316 Ga0055538_100031615 468
655 3300003761 Ga0055535_1002935 Ga0055535_10029353 468
656 3300003841 Ga0055541_1000831 Ga0055541_10008312 468
657 3300003841 Ga0055541_1005311 Ga0055541_10053112 468
658 3300003856 Ga0058692_1000468 Ga0058692_100046812 468
659 3300003856 Ga0058692_1007067 Ga0058692_10070672 468
660 3300005289 Ga0065704_10070603 Ga0065704_1007060315 468
661 3300005289 Ga0065704_10070657 Ga0065704_1007065713 468
662 3300005327 Ga0070658_10013013 Ga0070658_100130132 468
663 3300005339 Ga0070660_100016489 Ga0070660_1000164892 468
664 3300005467 Ga0070706_100000084 Ga0070706_10000008427 468
665 3300005467 Ga0070706_100000858 Ga0070706_10000085825 468
666 3300005467 Ga0070706_100025427 Ga0070706_1000254273 468
667 3300005468 Ga0070707_100025604 Ga0070707_1000256042 468
668 3300005471 Ga0070698_100008670 Ga0070698_10000867010 468
669 3300005518 Ga0070699_100000395 Ga0070699_1000003957 468
670 3300005536 Ga0070697_100039204 Ga0070697_1000392043 468
671 3300005548 Ga0070665_100000464 Ga0070665_10000046426 468
672 3300005617 Ga0068859_100005482 Ga0068859_10000548211 468
673 3300005842 Ga0068858_100220246 Ga0068858_1002202461 468
674 3300006028 Ga0070717_10001202 Ga0070717_1000120215 468
675 3300006051 Ga0075364_10094540 Ga0075364_100945401 468
676 3300006931 Ga0097620_100005480 Ga0097620_10000548011 468
677 3300006946 Ga0079104_1000018 Ga0079104_100001817 468
678 3300006946 Ga0079104_1000282 Ga0079104_100028245 468
679 3300006946 Ga0079104_1000391 Ga0079104_100039119 468
680 3300006946 Ga0079104_1001257 Ga0079104_10012572 468
681 3300009036 Ga0105244_10000009 Ga0105244_1000000932 468
682 3300009036 Ga0105244_10000347 Ga0105244_1000034711 468
683 3300009036 Ga0105244_10007217 Ga0105244_100072176 468
684 3300009092 Ga0105250_10000101 Ga0105250_1000010150 468
685 3300009092 Ga0105250_10000614 Ga0105250_1000061417 468
686 3300009092 Ga0105250_10006179 Ga0105250_100061791 468
687 3300009148 Ga0105243_10032193 Ga0105243_100321934 468
688 3300011119 Ga0105246_10053878 Ga0105246_100538783 468
689 3300013102 Ga0157371_10025820 Ga0157371_100258201 468
690 3300013105 Ga0157369_10000988 Ga0157369_1000098823 468
691 3300013307 Ga0157372_10012243 Ga0157372_100122438 468
692 3300025224 Ga0209784_100183 Ga0209784_10018317 468
693 3300025225 Ga0209566_100054 Ga0209566_10005461 468
694 3300025225 Ga0209566_100058 Ga0209566_100058177 468
695 3300025225 Ga0209566_100072 Ga0209566_10007290 468
696 3300025225 Ga0209566_100115 Ga0209566_10011553 468
697 3300025225 Ga0209566_100574 Ga0209566_1005743 468
698 3300025225 Ga0209566_100703 Ga0209566_10070318 468
699 3300025233 Ga0209437_100302 Ga0209437_10030253 468
700 3300025233 Ga0209437_100909 Ga0209437_1009097 468
701 3300025242 Ga0209258_103608 Ga0209258_1036083 468
702 3300025242 Ga0209258_104781 Ga0209258_1047812 468
703 3300025258 Ga0209129_1000077 Ga0209129_100007775 468
704 3300025294 Ga0209025_1000001 Ga0209025_1000001709 468
705 3300025294 Ga0209025_1008379 Ga0209025_10083797 468
706 3300025294 Ga0209025_1008947 Ga0209025_10089472 468
707 3300025294 Ga0209025_1013065 Ga0209025_10130654 468
708 3300025294 Ga0209025_1022408 Ga0209025_10224081 468
709 3300025294 Ga0209025_1033559 Ga0209025_10335593 468
710 3300025711 Ga0207696_1000013 Ga0207696_1000013135 468
711 3300025711 Ga0207696_1000053 Ga0207696_100005375 468
712 3300025711 Ga0207696_1000622 Ga0207696_100062218 468
713 3300025711 Ga0207696_1001317 Ga0207696_10013172 468
714 3300025728 Ga0207655_1000004 Ga0207655_1000004469 468
715 3300025728 Ga0207655_1000036 Ga0207655_1000036155 468
716 3300025728 Ga0207655_1000447 Ga0207655_100044741 468
717 3300025735 Ga0207713_1000047 Ga0207713_10000475 468
718 3300025735 Ga0207713_1000132 Ga0207713_100013226 468
719 3300025910 Ga0207684_10000002 Ga0207684_10000002667 468
720 3300025910 Ga0207684_10000040 Ga0207684_10000040204 468
721 3300025919 Ga0207657_10041612 Ga0207657_100416123 468
722 3300025922 Ga0207646_10000613 Ga0207646_1000061319 468
723 3300025922 Ga0207646_10012410 Ga0207646_100124106 468
724 3300025935 Ga0207709_10016891 Ga0207709_100168912 468
725 3300026116 Ga0207674_10071284 Ga0207674_100712842 468
726 3300027111 Ga0209281_1000004 Ga0209281_1000004446 468
727 3300027111 Ga0209281_1000014 Ga0209281_1000014605 468
728 3300027111 Ga0209281_1000257 Ga0209281_100025729 468
729 3300027111 Ga0209281_1000714 Ga0209281_100071414 468
730 3300027111 Ga0209281_1000926 Ga0209281_100092610 468
731 3300027312 Ga0209371_1000002 Ga0209371_10000021310 468
732 3300027312 Ga0209371_1000015 Ga0209371_100001594 468
733 3300027312 Ga0209371_1006561 Ga0209371_10065612 468
734 3300027312 Ga0209371_1006984 Ga0209371_10069843 468
735 3300027312 Ga0209371_1008478 Ga0209371_10084782 468
736 3300027312 Ga0209371_1017486 Ga0209371_10174862 468
737 3300028379 Ga0268266_10000286 Ga0268266_1000028649 468
738 3300030500 Ga0268256_1000002 Ga0268256_1000002152 468
739 3300030500 Ga0268256_1000018 Ga0268256_1000018531 468
740 3300030500 Ga0268256_1004173 Ga0268256_10041733 468
741 3300030500 Ga0268256_1007114 Ga0268256_10071142 468
742 3300030500 Ga0268256_1010729 Ga0268256_10107292 468
743 3300030500 Ga0268256_1019486 Ga0268256_10194861 468
744 3300031235 Ga0265330_10006907 Ga0265330_100069072 468
745 3300031712 Ga0265342_10004166 Ga0265342_100041661 468
746 3300031728 Ga0316578_10026048 Ga0316578_100260482 468
747 3300035398 Ga0316574_0076742 Ga0316574_0076742_317_1765 468
748 3300036647 Ga0316582_0067878 Ga0316582_0067878_10_1458 468
749 3300036712 Ga0316584_0043456 Ga0316584_0043456_349_1797 468
750 3300041404 Ga0439436_0015324 Ga0439436_0015324_768_2180 468
751 3300041406 Ga0439439_0002184 Ga0439439_0002184_1325_2737 468
752 3300042007 Ga0439449_0000010 Ga0439449_0000010_5397_6809 468
753 3300042010 Ga0439452_000020 Ga0439452_000020_267399_268805 468
754 3300042015 Ga0439462_0024401 Ga0439462_0024401_139_1569 468
755 3300042876 Ga0451577_0007660 Ga0451577_0007660_7668_9083 468
756 3300044656 Ga0466969_0000115 Ga0466969_0000115_25180_26592 468
757 3300046458 Ga0495591_000050 Ga0495591_000050_119647_121053 468
758 3300046458 Ga0495591_001001 Ga0495591_001001_4349_5755 468
759 3300046471 Ga0495650_0000031 Ga0495650_0000031_363599_365005 468
760 3300046501 Ga0495607_0071972 Ga0495607_0071972_217_1623 468
761 3300046507 Ga0495606_0003900 Ga0495606_0003900_2502_3908 468
762 3300046524 Ga0495648_0001866 Ga0495648_0001866_9723_11129 468
763 3300046530 Ga0495654_0000009 Ga0495654_0000009_103489_104895 468
764 3300046530 Ga0495654_0000068 Ga0495654_0000068_41469_42875 468
765 3300046557 Ga0495622_0007079 Ga0495622_0007079_455_1864 468
766 3300046694 Ga0495649_0000504 Ga0495649_0000504_29437_30843 468
767 3300046694 Ga0495649_0000543 Ga0495649_0000543_28040_29446 468
768 3300046810 Ga0495660_0000015 Ga0495660_0000015_119927_121333 468
769 3300047320 Ga0495672_0000001 Ga0495672_0000001_915706_917112 468
770 3300047320 Ga0495672_0000015 Ga0495672_0000015_456184_457590 468
771 3300047323 Ga0495683_0006239 Ga0495683_0006239_1537_2943 468
772 3300047469 Ga0495673_0000007 Ga0495673_0000007_39361_40767 468
773 3300047469 Ga0495673_0000019 Ga0495673_0000019_20701_22107 468
774 3300048911 Ga0496108_0116454 Ga0496108_0116454_716_2173 468
775 3300048913 Ga0496110_0000084 Ga0496110_0000084_22208_23620 468
776 3300048919 Ga0496116_0000140 Ga0496116_0000140_71191_72597 468
777 3300048919 Ga0496116_0003742 Ga0496116_0003742_437_1843 468
778 3300048919 Ga0496116_0003924 Ga0496116_0003924_2510_3937 468
779 3300048919 Ga0496116_0004165 Ga0496116_0004165_2235_3641 468
780 3300048919 Ga0496116_0005211 Ga0496116_0005211_10093_11514 468
781 3300048919 Ga0496116_0008976 Ga0496116_0008976_4680_6092 468
782 3300048919 Ga0496116_0029920 Ga0496116_0029920_848_2266 468
783 3300048920 Ga0496117_0000380 Ga0496117_0000380_61691_63097 468
784 3300048920 Ga0496117_0002117 Ga0496117_0002117_16406_17812 468
785 3300048920 Ga0496117_0004061 Ga0496117_0004061_11749_13155 468
786 3300048920 Ga0496117_0024460 Ga0496117_0024460_2412_3818 468
787 3300048920 Ga0496117_0066848 Ga0496117_0066848_476_1882 468
788 3300048921 Ga0496118_0001286 Ga0496118_0001286_21355_22761 468
789 3300048921 Ga0496118_0062714 Ga0496118_0062714_375_1781 468
790 3300048922 Ga0496119_0000012 Ga0496119_0000012_82980_84386 468
791 3300048922 Ga0496119_0000049 Ga0496119_0000049_11932_13338 468
792 3300048923 Ga0496120_0000004 Ga0496120_0000004_327532_328938 468
793 3300048923 Ga0496120_0000048 Ga0496120_0000048_56889_58295 468
794 3300048923 Ga0496120_0001489 Ga0496120_0001489_3274_4680 468
795 3300048924 Ga0496121_0002208 Ga0496121_0002208_23088_24494 468
796 3300048924 Ga0496121_0005634 Ga0496121_0005634_227_1633 468
797 3300048924 Ga0496121_0008356 Ga0496121_0008356_5710_7116 468
798 3300048924 Ga0496121_0011405 Ga0496121_0011405_50_1456 468
799 3300048924 Ga0496121_0058635 Ga0496121_0058635_593_1999 468
800 3300048925 Ga0496122_0000003 Ga0496122_0000003_266522_267928 468
801 3300048925 Ga0496122_0003434 Ga0496122_0003434_15428_16834 468
802 3300048925 Ga0496122_0005161 Ga0496122_0005161_8052_9458 468
803 3300048925 Ga0496122_0023005 Ga0496122_0023005_2637_4055 468
804 3300048925 Ga0496122_0074389 Ga0496122_0074389_47_1468 468
805 3300048926 Ga0496123_0000012 Ga0496123_0000012_21705_23111 468
806 3300048926 Ga0496123_0002717 Ga0496123_0002717_2749_4161 468
807 3300048926 Ga0496123_0006718 Ga0496123_0006718_5398_6804 468
808 3300048926 Ga0496123_0014520 Ga0496123_0014520_837_2243 468
809 3300048927 Ga0496124_0000045 Ga0496124_0000045_204319_205725 468
810 3300048927 Ga0496124_0000484 Ga0496124_0000484_50965_52371 468
811 3300048927 Ga0496124_0000620 Ga0496124_0000620_8601_10013 468
812 3300048927 Ga0496124_0004039 Ga0496124_0004039_746_2152 468
813 3300048927 Ga0496124_0034182 Ga0496124_0034182_1484_2905 468
814 3300048927 Ga0496124_0079461 Ga0496124_0079461_1241_2668 468
815 3300048928 Ga0496125_0000065 Ga0496125_0000065_73421_74827 468
816 3300048928 Ga0496125_0007236 Ga0496125_0007236_4810_6231 468
817 3300048928 Ga0496125_0022076 Ga0496125_0022076_2751_4163 468
818 3300048928 Ga0496125_0070815 Ga0496125_0070815_949_2406 468
819 3300048928 Ga0496125_0113723 Ga0496125_0113723_481_1890 468
820 3300048929 Ga0496126_0001727 Ga0496126_0001727_21588_22994 468
821 3300048929 Ga0496126_0005402 Ga0496126_0005402_2005_3411 468
822 3300049127 Ga0501306_000570 Ga0501306_000570_421_1833 468
823 3300049129 Ga0501309_000677 Ga0501309_000677_1105_2517 468
824 3300049161 Ga0501305_003117 Ga0501305_003117_31_1443 468
825 3300049459 Ga0495678_000777 Ga0495678_000777_23020_24426 468
826 3300049460 Ga0495682_0000001 Ga0495682_0000001_215082_216488 468
827 3300049528 Ga0501312_002553 Ga0501312_002553_348_1760 468
828 3300049528 Ga0501312_006488 Ga0501312_006488_22_1434 468
829 3300049532 Ga0501316_002315 Ga0501316_002315_281_1693 468
830 3300049551 Ga0501335_002418 Ga0501335_002418_76_1488 468
831 3300049655 Ga0501208_007007 Ga0501208_007007_40_1452 468
832 3300049661 Ga0501217_002322 Ga0501217_002322_551_1963 468
833 3300053126 Ga0500621_000002 Ga0500621_000002_211264_212670 468
834 3300059491 Ga0587070_000683 Ga0587070_000683_630_2051 468
835 3300059647 Ga0587079_004153 Ga0587079_004153_398_1882 468
836 iso_pu_bacteria 2512564039 2512734762 468
837 iso_pu_bacteria 2565956761 2566993980 468
838 iso_pu_bacteria 2643221543 2643738110 468
839 iso_pu_bacteria 2728368933 2728532475 468
840 iso_pu_bacteria 2738541308 2738890151 468
841 iso_pu_bacteria 2738543011 2739239501 468
842 iso_pu_bacteria 2889300758 2889301920 468
843 iso_pu_bacteria 2904535858 2904539480 468
844 iso_pu_bacteria 2922554459 2922555442 468
845 iso_pu_bacteria 2939743619 2939747071 468
846 iso_pu_bacteria 8054465665 8054467901 468
847 3300001989 JGI24739J22299_10000274 JGI24739J22299_1000027414 469
848 3300002737 JGI25162J39368_1001119 JGI25162J39368_10011192 469
849 3300003856 Ga0058692_1000099 Ga0058692_100009931 469
850 3300003856 Ga0058692_1000354 Ga0058692_100035414 469
851 3300003856 Ga0058692_1000393 Ga0058692_10003937 469
852 3300003856 Ga0058692_1001738 Ga0058692_10017383 469
853 3300003856 Ga0058692_1009103 Ga0058692_10091032 469
854 3300005548 Ga0070665_100094141 Ga0070665_1000941412 469
855 3300009011 Ga0105251_10001421 Ga0105251_1000142113 469
856 3300009011 Ga0105251_10001888 Ga0105251_1000188811 469
857 3300009011 Ga0105251_10003985 Ga0105251_100039854 469
858 3300009011 Ga0105251_10007214 Ga0105251_100072144 469
859 3300009011 Ga0105251_10014434 Ga0105251_100144343 469
860 3300009036 Ga0105244_10001459 Ga0105244_1000145911 469
861 3300009036 Ga0105244_10003888 Ga0105244_100038883 469
862 3300009036 Ga0105244_10013124 Ga0105244_100131243 469
863 3300009092 Ga0105250_10001153 Ga0105250_1000115312 469
864 3300009092 Ga0105250_10001182 Ga0105250_1000118211 469
865 3300009092 Ga0105250_10011526 Ga0105250_100115263 469
866 3300011119 Ga0105246_10005098 Ga0105246_100050986 469
867 3300011119 Ga0105246_10005700 Ga0105246_100057004 469
868 3300013100 Ga0157373_10000110 Ga0157373_1000011047 469
869 3300013100 Ga0157373_10001965 Ga0157373_1000196512 469
870 3300013100 Ga0157373_10017913 Ga0157373_100179135 469
871 3300013102 Ga0157371_10000528 Ga0157371_100005287 469
872 3300013102 Ga0157371_10000663 Ga0157371_1000066311 469
873 3300013102 Ga0157371_10000673 Ga0157371_1000067317 469
874 3300013105 Ga0157369_10005106 Ga0157369_100051062 469
875 3300013306 Ga0163162_10007001 Ga0163162_100070016 469
876 3300013307 Ga0157372_10005333 Ga0157372_100053333 469
877 3300025233 Ga0209437_100238 Ga0209437_10023837 469
878 3300025304 Ga0209257_1017430 Ga0209257_10174303 469
879 3300025711 Ga0207696_1000058 Ga0207696_100005870 469
880 3300025711 Ga0207696_1001212 Ga0207696_10012124 469
881 3300025711 Ga0207696_1001388 Ga0207696_10013882 469
882 3300025728 Ga0207655_1001670 Ga0207655_100167011 469
883 3300025728 Ga0207655_1002030 Ga0207655_10020305 469
884 3300025728 Ga0207655_1005626 Ga0207655_10056269 469
885 3300025728 Ga0207655_1021087 Ga0207655_10210873 469
886 3300025735 Ga0207713_1000001 Ga0207713_10000011693 469
887 3300025735 Ga0207713_1005688 Ga0207713_10056886 469
888 3300025735 Ga0207713_1012704 Ga0207713_10127042 469
889 3300025972 Ga0207668_10018611 Ga0207668_100186114 469
890 3300027312 Ga0209371_1000005 Ga0209371_1000005767 469
891 3300027312 Ga0209371_1000099 Ga0209371_100009958 469
892 3300027312 Ga0209371_1000100 Ga0209371_100010033 469
893 3300027312 Ga0209371_1000120 Ga0209371_100012067 469
894 3300027312 Ga0209371_1000778 Ga0209371_100077811 469
895 3300027312 Ga0209371_1000832 Ga0209371_100083219 469
896 3300027312 Ga0209371_1000964 Ga0209371_100096414 469
897 3300027312 Ga0209371_1001051 Ga0209371_100105111 469
898 3300030500 Ga0268256_1000006 Ga0268256_1000006290 469
899 3300030500 Ga0268256_1000035 Ga0268256_1000035137 469
900 3300030500 Ga0268256_1000089 Ga0268256_1000089103 469
901 3300030500 Ga0268256_1000714 Ga0268256_100071413 469
902 3300030500 Ga0268256_1000815 Ga0268256_100081516 469
903 3300030500 Ga0268256_1001088 Ga0268256_100108816 469
904 3300030500 Ga0268256_1001187 Ga0268256_10011875 469
905 3300030500 Ga0268256_1001261 Ga0268256_10012618 469
906 3300030500 Ga0268256_1001364 Ga0268256_10013646 469
907 3300041405 Ga0439438_000002 Ga0439438_000002_160979_162388 469
908 3300041411 Ga0439466_0000001 Ga0439466_0000001_198923_200332 469
909 3300041411 Ga0439466_0000450 Ga0439466_0000450_13863_15272 469
910 3300042006 Ga0439432_000295 Ga0439432_000295_1734_3143 469
911 3300042010 Ga0439452_000001 Ga0439452_000001_1551984_1553393 469
912 3300046458 Ga0495591_000001 Ga0495591_000001_491435_492844 469
913 3300046810 Ga0495660_0001493 Ga0495660_0001493_12753_14162 469
914 3300048904 Ga0496101_0000157 Ga0496101_0000157_43216_44625 469
915 3300048905 Ga0496102_0057081 Ga0496102_0057081_1391_2800 469
916 3300048919 Ga0496116_0000110 Ga0496116_0000110_16831_18240 469
917 3300048919 Ga0496116_0033684 Ga0496116_0033684_1242_2651 469
918 3300048920 Ga0496117_0000009 Ga0496117_0000009_299367_300776 469
919 3300048920 Ga0496117_0000138 Ga0496117_0000138_56209_57618 469
920 3300048920 Ga0496117_0000154 Ga0496117_0000154_79823_81232 469
921 3300048921 Ga0496118_0000017 Ga0496118_0000017_235053_236462 469
922 3300048921 Ga0496118_0000150 Ga0496118_0000150_79823_81232 469
923 3300048921 Ga0496118_0000894 Ga0496118_0000894_9052_10461 469
924 3300048922 Ga0496119_0000027 Ga0496119_0000027_178380_179789 469
925 3300048922 Ga0496119_0004253 Ga0496119_0004253_3665_5074 469
926 3300048923 Ga0496120_0000022 Ga0496120_0000022_178380_179789 469
927 3300048923 Ga0496120_0000057 Ga0496120_0000057_157040_158449 469
928 3300048923 Ga0496120_0000207 Ga0496120_0000207_91301_92716 469
929 3300048923 Ga0496120_0000711 Ga0496120_0000711_38073_39482 469
930 3300048924 Ga0496121_0000389 Ga0496121_0000389_74642_76051 469
931 3300048925 Ga0496122_0003212 Ga0496122_0003212_1394_2803 469
932 3300048925 Ga0496122_0003484 Ga0496122_0003484_6977_8392 469
933 3300048926 Ga0496123_0003304 Ga0496123_0003304_5852_7267 469
934 3300048927 Ga0496124_0005302 Ga0496124_0005302_9872_11281 469
935 3300048927 Ga0496124_0006843 Ga0496124_0006843_10771_12180 469
936 3300048927 Ga0496124_0008449 Ga0496124_0008449_8417_9826 469
937 3300048927 Ga0496124_0009313 Ga0496124_0009313_8418_9827 469

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

265

554

1

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

92

260

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fwn-assembly1.cif.gz_B dimeric 6-phosphogluconate dehydrogenase complexed with 6-phosphogluconate and 2'-monophosphoadenosine-5'-diphosphate 0.9919 2 469
2zya-assembly1.cif.gz_B dimeric 6-phosphogluconate dehydrogenase complexed with 6-phosphogluconate 0.9918 2 468
3fwn-assembly1.cif.gz_B dimeric 6-phosphogluconate dehydrogenase complexed with 6-phosphogluconate and 2'-monophosphoadenosine-5'-diphosphate 0.9898 2 469
2zya-assembly1.cif.gz_B dimeric 6-phosphogluconate dehydrogenase complexed with 6-phosphogluconate 0.9897 2 468
7cb2-assembly1.cif.gz_A the 6-phosphogluconate dehydrogenase (nadp-bound) from staphylococcus aureus 0.9846 3 468
ID Description Score Start End Superfamily
2w8zA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.994 2 180 3.40.50.720
af_Q4D0X5_1_185_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.99 5 183 3.40.50.720
af_P41572_182_434_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9895 182 434 1.10.1040.10
1pgpA02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.989 182 434 1.10.1040.10
2w8zA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9885 2 180 3.40.50.720
ID Description Score Start End GO Terms
AF-Q79DY2-F1-model_v4 Gnd(745) gene encoding 6-phosphogluconate dehydrogenase, 5' end 1.004 1 124 GO:0004616
GO:0050661
AF-Q93CH7-F1-model_v4 6-phosphogluconate dehydrogenase 1.004 1 84 GO:0004616
GO:0050661
AF-A0A484ZTS4-F1-model_v4 6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44) 1.001 2 132 GO:0004616
GO:0016020
GO:0050661
AF-E1J879-F1-model_v4 deleted 0.9986 1 154
AF-A0A447V0C9-F1-model_v4 6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44) 0.9971 1 469 GO:0004616
GO:0006098
GO:0016054
GO:0019521
GO:0050661

Feature Viewer

pLDDT pTM Quality
96.19 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map