F486174

General Info

Members Datasets Scaffolds Average Seq Length
935 755 370 359

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0000953|Ga0496125_0000953_44261_45346
Length 361
Sequence MLTSDFDFDLPDDCIALRPAEPRDSARLLVVKDGVLDDRIIRDLPDFLQPGDALVFNDTRVIPARLSGVRQRIGPEGETLTVEVEATLHHRDAPDVWSAFMKPGKRIKXXXRIHFGRNNAGACELGHLDATVEAKDEDGLITLRFDLAGPALDDAIRDVGVMPLPPYIAARRPEDDRDLKDYQTVFATYDGSVAAPTAGLHFTPELLDAIRARGVSTHAVTLHVGAGTFLPVKADDTTDHKMHSEWGEVSPETAAALNAVRAAGGRIVCVGTTSLRLLESATTEDGMVQPFHGDTAIFITPGYRFRACDVLMTNFHLPKSTLFMLVSAFAGLETMRAAYAHAIDSGYRFYSYGDGSLLFRR

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
8 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
9 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
10 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
11 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
12 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
13 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
14 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
15 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
16 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
17 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
18 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
19 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
20 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
21 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
22 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
23 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
24 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
25 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
26 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
27 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
28 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
29 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
30 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
31 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
32 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
33 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
34 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
35 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
36 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
37 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
38 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
39 2516143018 Ensifer sp. BR816 Isolate Nodule
40 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
41 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
42 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
43 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
44 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
45 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
46 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
47 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
48 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
49 2534681786 Brucella suis 92/29 Isolate Unclassified
50 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
51 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
52 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
53 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
54 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
55 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
56 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
57 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
58 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
59 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
60 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
61 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
62 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
63 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
64 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
65 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
66 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
67 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
68 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
69 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
70 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
71 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
72 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
73 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
74 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
75 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
76 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
77 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
78 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
79 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
80 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
81 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
82 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
83 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
84 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
85 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
86 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
87 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
88 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
89 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
90 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
91 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
92 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
93 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
94 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
95 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
96 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
97 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
98 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
99 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
100 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
101 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
102 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
103 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
104 2643221557 Ensifer sp. Root558 Isolate Unclassified
105 2643221558 Rhizobium sp. Root149 Isolate Unclassified
106 2643221568 Rhizobium sp. Root564 Isolate Unclassified
107 2643221582 Rhizobium sp. Root651 Isolate Unclassified
108 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
109 2643221599 Rhizobium sp. Root708 Isolate Unclassified
110 2643221607 Rhizobium sp. Root73 Isolate Unclassified
111 2643221610 Ensifer sp. Root74 Isolate Unclassified
112 2643221618 Ensifer sp. Root231 Isolate Unclassified
113 2643221626 Ensifer sp. Root31 Isolate Unclassified
114 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
115 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
116 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
117 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
118 2643221655 Ensifer sp. Root1252 Isolate Unclassified
119 2643221659 Ensifer sp. Root127 Isolate Unclassified
120 2643221668 Ensifer sp. Root423 Isolate Unclassified
121 2643221675 Ensifer sp. Root1298 Isolate Unclassified
122 2643221680 Ensifer sp. Root1312 Isolate Unclassified
123 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
124 2643221688 Rhizobium sp. Root482 Isolate Unclassified
125 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
126 2643221693 Rhizobium sp. Root491 Isolate Unclassified
127 2643221698 Ensifer sp. Root142 Isolate Unclassified
128 2643221712 Ensifer sp. Root258 Isolate Unclassified
129 2643221718 Rhizobium sp. Root268 Isolate Unclassified
130 2643221719 Rhizobium sp. Root274 Isolate Unclassified
131 2643221723 Ensifer sp. Root278 Isolate Unclassified
132 2643221726 Ensifer sp. Root954 Isolate Unclassified
133 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
134 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
135 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
136 2718217882 Rhizobium sp. N741 Isolate Nodule
137 2718217927 Rhizobium sp. N324 Isolate Nodule
138 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
139 2718218009 Rhizobium sp. N561 Isolate Nodule
140 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
141 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
142 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
143 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
144 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
145 2718218363 Rhizobium sp. N113 Isolate Nodule
146 2718218365 Rhizobium sp. N731 Isolate Nodule
147 2718218366 Rhizobium sp. N621 Isolate Nodule
148 2718218423 Rhizobium sp. N941 Isolate Nodule
149 2721755514 Rhizobium sp. N6212 Isolate Nodule
150 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
151 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
152 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
153 2721755809 Rhizobium sp. N541 Isolate Nodule
154 2721755810 Rhizobium sp. N871 Isolate Nodule
155 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
156 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
157 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
158 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
159 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
160 2728369365 Rhizobium sp. N1341 Isolate Nodule
161 2728369397 Rhizobium sp. N1314 Isolate Nodule
162 2738541293 Rhizobium sp. GV031 Isolate Unclassified
163 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
164 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
165 2738543024 Aminobacter sp. AP02 Isolate Unclassified
166 2751185800 Brucella pituitosa AA2 Isolate Unclassified
167 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
168 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
169 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
170 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
171 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
172 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
173 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
174 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
175 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
176 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
177 2791355256 Rhizobium sp. M10 Isolate Nodule
178 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
179 2791355260 Rhizobium sp. L9 Isolate Nodule
180 2791355261 Rhizobium sp. J15 Isolate Nodule
181 2791355262 Rhizobium sp. M1 Isolate Nodule
182 2791355263 Rhizobium chutanense C5 Isolate Nodule
183 2791355264 Rhizobium sp. S9 Isolate Nodule
184 2791355265 Rhizobium sp. H4 Isolate Nodule
185 2791355266 Rhizobium sp. L43 Isolate Nodule
186 2791355267 Rhizobium sp. L18 Isolate Nodule
187 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
188 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
189 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
190 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
191 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
192 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
193 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
194 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
195 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
196 2802429633 Rhizobium anhuiense J3 Isolate Nodule
197 2802429634 Rhizobium anhuiense S10 Isolate Nodule
198 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
199 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
200 2802429637 Rhizobium anhuiense C15 Isolate Nodule
201 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
202 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
203 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
204 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
205 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
206 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
207 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
208 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
209 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
210 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
211 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
212 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
213 2838048938 Rhizobium pisi 27/80 Isolate Nodule
214 2838061910 Rhizobium phaseoli L15 Isolate Nodule
215 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
216 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
217 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
218 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
219 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
220 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
221 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
222 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
223 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
224 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
225 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
226 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
227 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
228 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
229 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
230 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
231 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
232 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
233 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
234 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
235 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
236 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
237 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
238 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
239 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
240 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
241 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
242 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
243 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
244 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
245 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
246 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
247 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
248 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
249 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
250 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
251 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
252 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
253 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
254 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
255 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
256 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
257 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
258 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
259 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
260 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
261 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
262 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
263 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
264 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
265 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
266 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
267 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
268 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
269 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
270 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
271 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
272 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
273 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
274 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
275 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
276 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
277 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
278 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
279 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
280 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
281 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
282 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
283 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
284 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
285 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
286 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
287 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
288 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
289 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
290 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
291 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
292 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
293 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
294 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
295 2844163670 Ensifer sp. 1H6 Isolate Unclassified
296 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
297 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
298 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
299 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
300 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
301 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
302 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
303 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
304 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
305 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
306 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
307 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
308 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
309 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
310 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
311 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
312 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
313 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
314 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
315 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
316 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
317 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
318 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
319 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
320 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
321 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
322 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
323 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
324 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
325 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
326 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
327 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
328 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
329 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
330 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
331 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
332 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
333 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
334 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
335 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
336 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
337 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
338 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
339 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
340 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
341 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
342 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
343 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
344 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
345 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
346 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
347 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
348 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
349 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
350 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
351 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
352 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
353 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
354 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
355 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
356 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
357 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
358 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
359 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
360 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
361 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
362 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
363 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
364 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
365 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
366 2933599457 Rhizobium phaseoli M3 Isolate Nodule
367 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
368 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
369 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
370 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
371 2936381700 Rhizobium chutanense C16 Isolate Unclassified
372 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
373 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
374 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
375 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
376 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
377 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
378 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
379 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
380 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
381 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
382 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
383 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
384 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
385 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
386 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
387 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
388 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
389 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
390 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
391 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
392 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
393 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
394 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
395 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
396 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
397 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
398 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
399 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
400 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
401 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
402 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
403 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
404 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
405 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
406 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
407 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
408 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
409 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
410 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
411 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
412 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
413 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
414 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
415 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
416 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
417 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
418 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
419 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
420 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
421 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
422 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
423 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
424 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
425 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
426 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
427 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
428 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
429 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
430 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
431 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
432 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
433 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
434 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
435 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
436 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
437 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
438 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
439 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
440 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
441 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
442 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
443 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
444 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
445 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
446 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
447 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
448 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
449 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
450 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
451 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
452 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
453 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
454 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
455 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
456 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
457 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
458 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
459 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
460 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
461 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
462 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
463 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
464 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
465 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
466 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
467 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
468 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
469 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
470 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
471 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
472 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
473 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
474 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
475 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
476 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
477 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
478 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
479 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
480 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
481 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
482 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
483 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
484 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
485 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
486 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
487 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
488 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
489 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
490 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
491 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
492 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
493 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
494 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
495 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
496 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
497 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
498 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
499 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
500 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
501 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
502 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
503 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
504 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
505 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
506 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
507 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
508 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
509 2996887358 Rhizobium sp. R711 Isolate Nodule
510 2996893221 Rhizobium sp. R635 Isolate Nodule
511 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
512 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
513 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
514 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
515 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
516 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
517 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
518 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
519 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
520 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
521 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
522 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
523 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
524 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
525 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
526 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
527 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
528 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
529 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
530 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
531 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
532 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
533 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
534 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
535 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
536 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
537 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
538 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
539 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
540 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
541 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
542 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
543 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
544 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
545 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
546 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
547 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
548 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
549 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
550 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
551 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
552 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
553 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
554 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
555 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
556 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
557 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
558 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
559 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
560 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
561 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
562 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
563 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
564 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
565 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
566 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
567 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
568 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
569 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
570 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
571 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
572 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
573 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
574 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
575 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
576 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
577 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
578 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
579 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
580 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
581 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
582 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
583 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
584 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
585 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
586 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
587 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
588 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
589 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
590 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
591 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
592 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
593 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
594 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
595 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
596 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
597 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
598 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
599 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
600 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
601 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
602 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
603 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
604 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
605 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
606 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
607 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
608 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
609 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
610 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
611 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
612 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
613 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
614 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
615 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
616 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
617 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
618 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
619 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
620 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
621 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
622 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
623 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
624 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
625 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
626 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
627 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
628 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
629 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
630 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
631 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
632 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
633 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
634 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
635 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
636 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
637 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
638 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
639 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
640 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
641 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
642 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
643 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
644 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
645 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
646 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
647 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
648 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
649 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
650 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
651 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
652 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
653 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
654 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
655 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
656 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
657 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
658 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
659 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
660 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
661 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
662 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
663 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
664 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
665 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
666 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
667 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
668 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
669 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
670 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
671 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
672 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
673 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
674 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
675 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
676 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
677 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
678 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
679 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
680 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
681 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
682 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
683 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
684 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
685 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
686 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
687 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
688 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
689 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
690 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
691 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
692 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
693 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
694 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
695 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
696 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
697 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
698 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
699 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
700 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
701 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
702 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
703 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
704 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
705 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
706 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
707 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
708 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
709 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
710 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
711 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
712 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
713 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
714 8005258706 Rhizobium sp. R693 Isolate Nodule
715 8005275841 Rhizobium sp. N4311 Isolate Nodule
716 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
717 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
718 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
719 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
720 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
721 8005321885 Rhizobium sp. R72 Isolate Nodule
722 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
723 8005382845 Rhizobium sp. R634 Isolate Nodule
724 8005395548 Rhizobium sp. R339 Isolate Nodule
725 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
726 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
727 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
728 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
729 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
730 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
731 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
732 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
733 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
734 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
735 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
736 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
737 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
738 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
739 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
740 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
741 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
742 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
743 8018176218 Rhizobium sp. N122 Isolate Nodule
744 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
745 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
746 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
747 8024501048 Rhizobium sp. H4 Isolate Nodule
748 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
749 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
750 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
751 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
752 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
753 8056382006 Rhizobium croatiense 13T Isolate Nodule
754 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
755 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 39.25
Metatranscriptomes 0.32
Isolates 60.43

Biome Distribution

Category Percentage (%)
Aerial Root 0.53
Bulb 0
Endosphere 16.9
Nodule 45.99
Rhizoplane 1.28
Rhizosphere 17.01
Stem 0
Stem Tuber 0
Unclassified 18.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001389 3300001979 Bacteria 11052
2 JGI25155J39150_1000011 3300002704 Bacteria 207685
3 JGI25156J39149_1000030 3300002705 Bacteria 126029
4 JGI25154J39366_1000289 3300002738 Bacteria 30213
5 JGI25158J39367_1000167 3300002739 Bacteria 15671
6 JGI25157J39369_1000010 3300002741 Bacteria 207685
7 JGI25152J39213_1008181 3300002773 Bacteria 2621
8 JGI25159J45721_1000029 3300002987 Bacteria 105868
9 JGI25159J45721_1001125 3300002987 Bacteria 11424
10 JGI25159J45721_1001806 3300002987 Bacteria 8584
11 JGI25151J46595_10003454 3300003187 Bacteria 8727
12 JGI25151J46595_10004048 3300003187 Bacteria 7862
13 JGI25151J46595_10005052 3300003187 Bacteria 6869
14 JGI25151J46595_10005103 3300003187 Bacteria 6822
15 JGI25165J46597_1006781 3300003214 Bacteria 1987
16 JGI25153J46596_10004316 3300003215 Bacteria 7687
17 JGI25153J46596_10011346 3300003215 Bacteria 3943
18 JGI25160J50197_1000004 3300003354 Bacteria 419797
19 JGI25160J50197_1000011 3300003354 Bacteria 275577
20 JGI25160J50197_1000593 3300003354 Bacteria 20289
21 JGI25161J50226_1000003 3300003374 Bacteria 413345
22 JGI25161J50226_1001956 3300003374 Bacteria 5662
23 JGI25161J50226_1002628 3300003374 Bacteria 4505
24 Ga0006562J51391_1060468 3300003578 Bacteria 3100
25 Ga0055526_1001995 3300003771 Bacteria 14058
26 Ga0055526_1003733 3300003771 Bacteria 9506
27 Ga0055526_1006958 3300003771 Bacteria 6004
28 Ga0055526_1010214 3300003771 Bacteria 4395
29 Ga0055526_1010394 3300003771 Bacteria 4335
30 Ga0055526_1021566 3300003771 Bacteria 2234
31 Ga0055524_1003862 3300003775 Bacteria 7107
32 Ga0055524_1013014 3300003775 Bacteria 3162
33 Ga0055524_1020480 3300003775 Bacteria 2226
34 Ga0055524_1028237 3300003775 Bacteria 1685
35 Ga0055536_1000356 3300003781 Bacteria 34069
36 Ga0055528_1001267 3300003790 Bacteria 15948
37 Ga0055528_1001601 3300003790 Bacteria 13382
38 Ga0055528_1005825 3300003790 Bacteria 5664
39 Ga0055528_1013134 3300003790 Bacteria 3162
40 Ga0055528_1015466 3300003790 Bacteria 2754
41 Ga0055540_1000177 3300003792 Bacteria 62976
42 Ga0055531_10003828 3300003794 Bacteria 9428
43 Ga0055531_10003846 3300003794 Bacteria 9402
44 Ga0058692_1002330 3300003856 Bacteria 6416
45 Ga0055543_1000001 3300004625 Bacteria 419949
46 Ga0055543_1000097 3300004625 Bacteria 75364
47 Ga0055543_1000255 3300004625 Bacteria 40071
48 Ga0055543_1001144 3300004625 Bacteria 11331
49 Ga0065165_1000018 3300005262 Bacteria 275082
50 Ga0065165_1023781 3300005262 Bacteria 2070
51 Ga0070658_10212360 3300005327 Bacteria 1635
52 Ga0070670_100000535 3300005331 Bacteria 30434
53 Ga0070670_100065176 3300005331 Bacteria 3126
54 Ga0070671_100033264 3300005355 Bacteria 4263
55 Ga0070665_100107355 3300005548 Bacteria 2794
56 Ga0068855_100109341 3300005563 Bacteria 3175
57 Ga0068856_100032523 3300005614 Bacteria 5106
58 Ga0075365_10005053 3300006038 Bacteria 7078
59 Ga0075365_10012329 3300006038 Bacteria 5071
60 Ga0075368_10002095 3300006042 Bacteria 6447
61 Ga0075364_10000043 3300006051 Bacteria 44079
62 Ga0075364_10129542 3300006051 Bacteria 1693
63 Ga0075362_10011839 3300006177 Bacteria 3446
64 Ga0075362_10012116 3300006177 Bacteria 3416
65 Ga0075367_10032147 3300006178 Bacteria 3017
66 Ga0075369_10009230 3300006186 Bacteria 3825
67 Ga0075366_10021694 3300006195 Bacteria 3734
68 Ga0075370_10001750 3300006353 Bacteria 9672
69 Ga0079104_1000022 3300006946 Bacteria 223522
70 Ga0079104_1001402 3300006946 Bacteria 16290
71 Ga0099826_10000090 3300006948 Bacteria 44830
72 Ga0099826_10004510 3300006948 Bacteria 9777
73 Ga0105251_10020317 3300009011 Bacteria 3491
74 Ga0105240_10000005 3300009093 Bacteria 702630
75 Ga0105243_10089667 3300009148 Bacteria 2529
76 Ga0105237_10000773 3300009545 Bacteria 43739
77 Ga0123341_1000049 3300009765 Bacteria 49561
78 Ga0105239_10004008 3300010375 Bacteria 17836
79 Ga0157373_10002285 3300013100 Bacteria 14521
80 Ga0157373_10131447 3300013100 Bacteria 1760
81 Ga0157371_10000015 3300013102 Bacteria 339838
82 Ga0157371_10005986 3300013102 Bacteria 10143
83 Ga0157370_10000992 3300013104 Bacteria 35815
84 Ga0157370_10003013 3300013104 Bacteria 20000
85 Ga0157370_10017734 3300013104 Bacteria 7177
86 Ga0157369_10050141 3300013105 Bacteria 4522
87 Ga0157369_10145335 3300013105 Bacteria 2508
88 Ga0171463_1008 3300013249 Bacteria 299022
89 Ga0182007_10000618 3300015262 Bacteria 20687
90 Ga0182005_1018412 3300015265 Bacteria 1930
91 Ga0183363_1281 3300015690 Bacteria 7689
92 Ga0214544_1000129 3300021320 Bacteria 108948
93 Ga0214542_1000828 3300021321 Bacteria 59640
94 Ga0214542_1027439 3300021321 Bacteria 2608
95 Ga0214543_1000010 3300021327 Bacteria 364844
96 Ga0214543_1000134 3300021327 Bacteria 102056
97 Ga0213872_10022695 3300021361 Bacteria 2888
98 Ga0228711_1002680 3300022739 Bacteria 27471
99 Ga0228710_1002851 3300022740 Bacteria 27471
100 Ga0209435_100022 3300025206 Bacteria 207766
101 Ga0209436_100507 3300025208 Bacteria 17013
102 Ga0209437_100122 3300025233 Bacteria 201364
103 Ga0209437_100160 3300025233 Bacteria 149451
104 Ga0207425_1008820 3300025245 Bacteria 2549
105 Ga0207425_1009643 3300025245 Bacteria 2391
106 Ga0209646_1000078 3300025246 Bacteria 207766
107 Ga0209646_1003812 3300025246 Bacteria 2878
108 Ga0209026_1000065 3300025250 Bacteria 207766
109 Ga0209759_1000055 3300025256 Bacteria 207766
110 Ga0209129_1000127 3300025258 Bacteria 133263
111 Ga0209129_1001042 3300025258 Bacteria 16374
112 Ga0209129_1001442 3300025258 Bacteria 13289
113 Ga0209129_1002372 3300025258 Bacteria 9286
114 Ga0209129_1012798 3300025258 Bacteria 1892
115 Ga0209129_1012818 3300025258 Bacteria 1889
116 Ga0209233_1000168 3300025261 Bacteria 149312
117 Ga0209233_1000170 3300025261 Bacteria 147527
118 Ga0209233_1001127 3300025261 Bacteria 10903
119 Ga0209673_1000139 3300025273 Bacteria 157765
120 Ga0209673_1001327 3300025273 Bacteria 24841
121 Ga0209673_1002230 3300025273 Bacteria 14043
122 Ga0209673_1003846 3300025273 Bacteria 8482
123 Ga0209673_1004486 3300025273 Bacteria 7455
124 Ga0209673_1004582 3300025273 Bacteria 7327
125 Ga0209130_1000012 3300025284 Bacteria 421329
126 Ga0209130_1000029 3300025284 Bacteria 323399
127 Ga0209130_1000097 3300025284 Bacteria 143750
128 Ga0209130_1008169 3300025284 Bacteria 3122
129 Ga0209676_1000438 3300025292 Bacteria 71339
130 Ga0209676_1007877 3300025292 Bacteria 4893
131 Ga0209676_1016797 3300025292 Bacteria 2623
132 Ga0209025_1000033 3300025294 Bacteria 414511
133 Ga0209025_1000563 3300025294 Bacteria 68086
134 Ga0209025_1001678 3300025294 Bacteria 27100
135 Ga0209025_1001703 3300025294 Bacteria 26799
136 Ga0209025_1003459 3300025294 Bacteria 14911
137 Ga0209025_1010390 3300025294 Bacteria 6311
138 Ga0209564_1000105 3300025295 Bacteria 218124
139 Ga0209564_1000275 3300025295 Bacteria 107884
140 Ga0209564_1000986 3300025295 Bacteria 35645
141 Ga0209564_1001528 3300025295 Bacteria 22999
142 Ga0209564_1001611 3300025295 Bacteria 21903
143 Ga0209564_1022689 3300025295 Bacteria 2207
144 Ga0209758_1000505 3300025297 Bacteria 63185
145 Ga0209758_1000534 3300025297 Bacteria 60556
146 Ga0209758_1000805 3300025297 Bacteria 44274
147 Ga0209758_1001745 3300025297 Bacteria 24202
148 Ga0209758_1003872 3300025297 Bacteria 13105
149 Ga0209758_1007599 3300025297 Bacteria 7316
150 Ga0209758_1020108 3300025297 Bacteria 3178
151 Ga0209050_1000516 3300025298 Bacteria 64933
152 Ga0209050_1004356 3300025298 Bacteria 9613
153 Ga0209256_1001255 3300025299 Bacteria 27934
154 Ga0209256_1001768 3300025299 Bacteria 20511
155 Ga0209256_1002167 3300025299 Bacteria 16908
156 Ga0209256_1003073 3300025299 Bacteria 12267
157 Ga0209256_1008787 3300025299 Bacteria 4594
158 Ga0209256_1009219 3300025299 Bacteria 4372
159 Ga0209256_1042308 3300025299 Bacteria 1151
160 Ga0207426_1000003 3300025302 Bacteria 1063212
161 Ga0207426_1000010 3300025302 Bacteria 796003
162 Ga0207426_1000074 3300025302 Bacteria 323399
163 Ga0207426_1000290 3300025302 Bacteria 99519
164 Ga0207426_1000408 3300025302 Bacteria 72326
165 Ga0209051_1000125 3300025303 Bacteria 142863
166 Ga0209051_1003377 3300025303 Bacteria 10501
167 Ga0209051_1004697 3300025303 Bacteria 8308
168 Ga0209051_1036652 3300025303 Bacteria 1808
169 Ga0209051_1039840 3300025303 Bacteria 1691
170 Ga0209257_1009229 3300025304 Bacteria 5347
171 Ga0207695_10000011 3300025913 Bacteria 910221
172 Ga0207671_10004599 3300025914 Bacteria 13104
173 Ga0207650_10014417 3300025925 Bacteria 5494
174 Ga0207650_10118692 3300025925 Bacteria 2057
175 Ga0207678_10064346 3300026067 Bacteria 3151
176 Ga0207702_10009685 3300026078 Bacteria 8090
177 Ga0209281_1000036 3300027111 Bacteria 369415
178 Ga0209281_1000047 3300027111 Bacteria 326514
179 Ga0209281_1000508 3300027111 Bacteria 51432
180 Ga0209281_1004020 3300027111 Bacteria 4553
181 Ga0209371_1000178 3300027312 Bacteria 93894
182 Ga0209371_1000382 3300027312 Bacteria 47344
183 Ga0209282_1000116 3300027666 Bacteria 51432
184 Ga0209282_1000235 3300027666 Bacteria 28597
185 Ga0209282_1075229 3300027666 Bacteria 1823
186 Ga0268266_10059721 3300028379 Bacteria 3285
187 Ga0268266_10076615 3300028379 Bacteria 2907
188 Ga0268265_10077564 3300028380 Bacteria 2610
189 Ga0265318_10031724 3300028577 Bacteria 2048
190 Ga0307515_10000233 3300028794 Bacteria 137311
191 Ga0307515_10000569 3300028794 Bacteria 87068
192 Ga0307515_10013071 3300028794 Bacteria 15547
193 Ga0307515_10095379 3300028794 Bacteria 3662
194 Ga0268256_1000251 3300030500 Bacteria 56750
195 Ga0268256_1006569 3300030500 Bacteria 4299
196 Ga0265331_10001061 3300031250 Bacteria 21420
197 Ga0307513_10000588 3300031456 Bacteria 52189
198 Ga0307513_10021520 3300031456 Bacteria 7611
199 Ga0307408_100129754 3300031548 Bacteria 1965
200 Ga0265314_10091276 3300031711 Bacteria 1983
201 Ga0307405_10026000 3300031731 Bacteria 3370
202 Ga0307406_10006937 3300031901 Bacteria 6274
203 Ga0307412_10000449 3300031911 Bacteria 24913
204 Ga0315914_1002646 3300031967 Bacteria 27416
205 Ga0316593_10020427 3300032168 Bacteria 2059
206 Ga0315913_1001232 3300033430 Bacteria 27471
207 Ga0315915_1000058 3300033464 Bacteria 72461
208 Ga0373935_0084405 3300035692 Bacteria 2069
209 Ga0373927_0002488 3300035695 Bacteria 13446
210 Ga0316584_0168452 3300036712 Bacteria 1626
211 Ga0373925_0001826 3300037068 Bacteria 17766
212 Ga0395905_0000386 3300037471 Bacteria 62786
213 Ga0395905_0011890 3300037471 Bacteria 8400
214 Ga0436361_0388638 3300039447 Bacteria 3153
215 Ga0439436_0020716 3300041404 Bacteria 1957
216 Ga0439465_0002627 3300041413 Bacteria 5866
217 Ga0439465_0012232 3300041413 Bacteria 2686
218 Ga0451833_0326332 3300041491 Bacteria 2197
219 Ga0451839_0624369 3300041496 Bacteria 1354
220 Ga0451839_1171986 3300041496 Bacteria 5799
221 Ga0451845_0406102 3300041501 Bacteria 4920
222 Ga0451849_1391146 3300041505 Bacteria 4223
223 Ga0451851_0083156 3300041507 Bacteria 1585
224 Ga0451851_0085829 3300041507 Bacteria 2107
225 Ga0451851_1152225 3300041507 Bacteria 1972
226 Ga0451843_0892284 3300041509 Bacteria 2229
227 Ga0439442_022028 3300042002 Bacteria 1322
228 Ga0439449_0005586 3300042007 Bacteria 4813
229 Ga0439449_0041569 3300042007 Bacteria 1709
230 Ga0439462_0019440 3300042015 Bacteria 1768
231 Ga0466968_0033665 3300044735 Bacteria 2136
232 Ga0495638_0001886 3300046460 Bacteria 18129
233 Ga0495638_0034607 3300046460 Bacteria 3225
234 Ga0495662_0037834 3300046476 Bacteria 2331
235 Ga0495585_0066062 3300046492 Bacteria 1981
236 Ga0495585_0106093 3300046492 Bacteria 1498
237 Ga0495607_0127700 3300046501 Bacteria 1327
238 Ga0495583_0051972 3300046506 Bacteria 1866
239 Ga0495583_0076388 3300046506 Bacteria 1463
240 Ga0495606_0002073 3300046507 Bacteria 24490
241 Ga0495606_0029987 3300046507 Bacteria 3809
242 Ga0495620_0028632 3300046515 Bacteria 2588
243 Ga0495628_0059749 3300046516 Bacteria 2992
244 Ga0495631_0080968 3300046518 Bacteria 1401
245 Ga0495632_0050841 3300046519 Bacteria 2042
246 Ga0495643_0027844 3300046522 Bacteria 3172
247 Ga0495643_0078683 3300046522 Bacteria 1720
248 Ga0495654_0003690 3300046530 Bacteria 9293
249 Ga0495622_0046432 3300046557 Bacteria 2018
250 Ga0495633_0001025 3300046558 Bacteria 22844
251 Ga0495668_0006310 3300046616 Bacteria 7806
252 Ga0495611_0041726 3300046648 Bacteria 2047
253 Ga0495625_0038361 3300046660 Bacteria 3508
254 Ga0495625_0119427 3300046660 Bacteria 1795
255 Ga0495625_0185123 3300046660 Bacteria 1382
256 Ga0495635_0142511 3300046663 Bacteria 1632
257 Ga0495588_0020089 3300046674 Bacteria 3277
258 Ga0495658_0054226 3300046683 Bacteria 2280
259 Ga0495613_0003033 3300046689 Bacteria 12563
260 Ga0495649_0103253 3300046694 Bacteria 1514
261 Ga0495660_0071744 3300046810 Bacteria 1835
262 Ga0495604_0013679 3300047317 Bacteria 6471
263 Ga0495687_068952 3300047443 Bacteria 1426
264 Ga0495681_0077664 3300047470 Bacteria 1489
265 Ga0495686_0002178 3300047472 Bacteria 19063
266 Ga0495686_0005411 3300047472 Bacteria 10084
267 Ga0496106_0000478 3300048909 Bacteria 28406
268 Ga0496111_0003975 3300048914 Bacteria 9283
269 Ga0496114_0335013 3300048917 Bacteria 1338
270 Ga0496116_0000232 3300048919 Bacteria 103015
271 Ga0496116_0019844 3300048919 Bacteria 5131
272 Ga0496116_0083325 3300048919 Bacteria 1975
273 Ga0496116_0097864 3300048919 Bacteria 1762
274 Ga0496116_0101076 3300048919 Bacteria 1722
275 Ga0496117_0000002 3300048920 Bacteria 2483758
276 Ga0496117_0002298 3300048920 Bacteria 24600
277 Ga0496117_0011144 3300048920 Bacteria 8082
278 Ga0496118_0000460 3300048921 Bacteria 67445
279 Ga0496118_0003956 3300048921 Bacteria 18115
280 Ga0496118_0020559 3300048921 Bacteria 5850
281 Ga0496118_0071214 3300048921 Bacteria 2504
282 Ga0496118_0109262 3300048921 Bacteria 1841
283 Ga0496119_0012076 3300048922 Bacteria 7058
284 Ga0496119_0012145 3300048922 Bacteria 7030
285 Ga0496119_0023760 3300048922 Bacteria 4335
286 Ga0496119_0047784 3300048922 Bacteria 2659
287 Ga0496120_0000078 3300048923 Bacteria 162312
288 Ga0496120_0006355 3300048923 Bacteria 9088
289 Ga0496121_0000001 3300048924 Bacteria 1830318
290 Ga0496121_0002309 3300048924 Bacteria 29564
291 Ga0496121_0005949 3300048924 Bacteria 15422
292 Ga0496121_0009598 3300048924 Bacteria 11087
293 Ga0496121_0010507 3300048924 Bacteria 10428
294 Ga0496121_0081738 3300048924 Bacteria 2556
295 Ga0496121_0087328 3300048924 Bacteria 2448
296 Ga0496122_0000001 3300048925 Bacteria 1827766
297 Ga0496122_0006684 3300048925 Bacteria 13133
298 Ga0496122_0011586 3300048925 Bacteria 8900
299 Ga0496122_0012223 3300048925 Bacteria 8585
300 Ga0496122_0052212 3300048925 Bacteria 3097
301 Ga0496122_0100963 3300048925 Bacteria 1929
302 Ga0496122_0113931 3300048925 Bacteria 1765
303 Ga0496122_0118521 3300048925 Bacteria 1715
304 Ga0496122_0124634 3300048925 Bacteria 1652
305 Ga0496123_0000001 3300048926 Bacteria 1831497
306 Ga0496123_0000032 3300048926 Bacteria 285282
307 Ga0496123_0000512 3300048926 Bacteria 67458
308 Ga0496123_0005232 3300048926 Bacteria 13181
309 Ga0496123_0050289 3300048926 Bacteria 2786
310 Ga0496123_0076430 3300048926 Bacteria 2061
311 Ga0496123_0076538 3300048926 Bacteria 2059
312 Ga0496124_0000377 3300048927 Bacteria 81321
313 Ga0496124_0004853 3300048927 Bacteria 15467
314 Ga0496124_0014237 3300048927 Bacteria 7705
315 Ga0496124_0093699 3300048927 Bacteria 2444
316 Ga0496124_0127798 3300048927 Bacteria 2023
317 Ga0496124_0231886 3300048927 Bacteria 1379
318 Ga0496125_0000155 3300048928 Bacteria 151541
319 Ga0496125_0000953 3300048928 Bacteria 45480
320 Ga0496125_0053841 3300048928 Bacteria 3294
321 Ga0496126_0001369 3300048929 Bacteria 38538
322 Ga0496126_0052656 3300048929 Bacteria 3698
323 Ga0496126_0230043 3300048929 Bacteria 1553
324 Ga0501034_0254277 3300049571 Bacteria 1701
325 Ga0501036_0201895 3300049572 Bacteria 1672
326 Ga0501037_0154721 3300049573 Bacteria 1637
327 Ga0501070_0084565 3300049586 Bacteria 2626
328 Ga0501073_0017851 3300049589 Bacteria 5136
329 Ga0501035_0029163 3300049822 Bacteria 5032
330 Ga0501035_0208503 3300049822 Bacteria 1673
331 Ga0501035_0348446 3300049822 Bacteria 1240
332 nmdc:mga03683_3419_c1 3300050489 Bacteria 5117
333 nmdc:mga03n38_26274_c1 3300050490 Bacteria 2403
334 nmdc:mga00v17_203_c1 3300050491 Bacteria 35824
335 nmdc:mga00v17_3726_c1 3300050491 Bacteria 7867
336 nmdc:mga00v17_68969_c1 3300050491 Bacteria 2187
337 nmdc:mga0yw44_697_c1 3300050492 Bacteria 12311
338 nmdc:mga0yw44_95712_c1 3300050492 Bacteria 1884
339 nmdc:mga0k408_112515_c1 3300050493 Bacteria 1610
340 nmdc:mga0k408_25595_c1 3300050493 Bacteria 3342
341 nmdc:mga0sz30_14502_c1 3300050516 Bacteria 3104
342 nmdc:mga0sz30_16497_c1 3300050516 Bacteria 2935
343 nmdc:mga0sz30_4182_c1 3300050516 Bacteria 5200
344 Ga0500643_023318 3300053087 Bacteria 1978
345 Ga0500556_0081163 3300053104 Bacteria 1226
346 Ga0500560_001846 3300053107 Bacteria 3841
347 Ga0500572_000849 3300053111 Bacteria 9526
348 Ga0500572_003892 3300053111 Bacteria 3396
349 Ga0500618_002786 3300053125 Bacteria 6338
350 Ga0500618_009375 3300053125 Bacteria 2674
351 Ga0500618_018902 3300053125 Bacteria 1700
352 Ga0500658_0000485 3300053134 Bacteria 17014
353 Ga0500658_0012162 3300053134 Bacteria 3170
354 Ga0500559_0062107 3300053136 Bacteria 1667
355 Ga0500561_0002360 3300053137 Bacteria 3169
356 Ga0500568_0003249 3300053139 Bacteria 9186
357 Ga0500577_0078061 3300053142 Bacteria 1314
358 Ga0500616_0002587 3300053153 Bacteria 14874
359 Ga0500616_0011140 3300053153 Bacteria 5338
360 Ga0500622_0000378 3300053156 Bacteria 42912
361 Ga0500622_0000778 3300053156 Bacteria 27680
362 Ga0500622_0039798 3300053156 Bacteria 2451
363 Ga0500622_0124327 3300053156 Bacteria 1247
364 Ga0500624_001373 3300053157 Bacteria 4077
365 Ga0500634_0010832 3300053161 Bacteria 4674
366 Ga0500636_0000123 3300053177 Bacteria 40230
367 Ga0500636_0001081 3300053177 Bacteria 14582
368 Ga0500636_0059250 3300053177 Bacteria 2238
369 Ga0500645_000972 3300053730 Bacteria 16288
370 Ga0587090_000719 3300059510 Bacteria 2967

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028577 Ga0265318_10031724 Ga0265318_100317243 316
2 3300049822 Ga0501035_0348446 Ga0501035_0348446_39_1001 316
3 3300013102 Ga0157371_10005986 Ga0157371_100059868 322
4 3300031711 Ga0265314_10091276 Ga0265314_100912762 326
5 3300059510 Ga0587090_000719 Ga0587090_000719_23_1021 331
6 3300042007 Ga0439449_0041569 Ga0439449_0041569_678_1682 333
7 3300050516 nmdc:mga0sz30_14502_c1 nmdc:mga0sz30_14502_c1_434_1459 341
8 3300046558 Ga0495633_0001025 Ga0495633_0001025_12306_13391 343
9 3300053156 Ga0500622_0124327 Ga0500622_0124327_116_1198 343
10 3300053177 Ga0500636_0059250 Ga0500636_0059250_954_2027 343
11 3300003578 Ga0006562J51391_1060468 Ga0006562J51391_10604682 344
12 3300046689 Ga0495613_0003033 Ga0495613_0003033_10283_11365 344
13 3300013104 Ga0157370_10017734 Ga0157370_100177344 345
14 3300013105 Ga0157369_10145335 Ga0157369_101453352 345
15 3300048925 Ga0496122_0006684 Ga0496122_0006684_6418_7503 345
16 3300048926 Ga0496123_0000512 Ga0496123_0000512_35281_36426 345
17 3300031250 Ga0265331_10001061 Ga0265331_1000106124 346
18 3300053087 Ga0500643_023318 Ga0500643_023318_630_1709 346
19 3300053730 Ga0500645_000972 Ga0500645_000972_9148_10227 346
20 3300032168 Ga0316593_10020427 Ga0316593_100204272 348
21 3300036712 Ga0316584_0168452 Ga0316584_0168452_138_1211 348
22 3300037471 Ga0395905_0011890 Ga0395905_0011890_2748_3800 349
23 iso_pu_bacteria 2791355253 2793279680 349
24 iso_pu_bacteria 2643221598 2644001960 350
25 iso_pu_bacteria 2751185800 2753359426 350
26 iso_pu_bacteria 2758568016 2758641686 350
27 iso_pu_bacteria 2534681786 2535484818 351
28 iso_pu_bacteria 2718218235 2720631350 351
29 iso_pu_bacteria 2718218269 2720775077 351
30 iso_pu_bacteria 2721755685 2723566897 351
31 iso_pu_bacteria 2721755819 2724089684 351
32 iso_pu_bacteria 2721755822 2724104162 351
33 iso_pu_bacteria 2738543024 2739307891 351
34 iso_pu_bacteria 2842395702 2842397424 351
35 iso_pu_bacteria 2917554339 2917556789 351
36 iso_pu_bacteria 2937843397 2937845932 351
37 iso_pu_bacteria 8005382845 8005388120 351
38 iso_pu_bacteria 8005658619 8005659386 351
39 iso_pu_bacteria 8018176218 8018178010 351
40 3300003790 Ga0055528_1015466 Ga0055528_10154662 353
41 3300005331 Ga0070670_100065176 Ga0070670_1000651763 353
42 3300025925 Ga0207650_10118692 Ga0207650_101186921 353
43 3300028380 Ga0268265_10077564 Ga0268265_100775642 353
44 3300039447 Ga0436361_0388638 Ga0436361_0388638_1694_2767 354
45 3300048919 Ga0496116_0019844 Ga0496116_0019844_3721_4806 354
46 3300048922 Ga0496119_0012076 Ga0496119_0012076_2612_3685 354
47 3300048925 Ga0496122_0124634 Ga0496122_0124634_412_1491 354
48 3300048926 Ga0496123_0076538 Ga0496123_0076538_492_1565 354
49 3300048928 Ga0496125_0000953 Ga0496125_0000953_44261_45346 354
50 3300053125 Ga0500618_002786 Ga0500618_002786_4827_5912 354
51 iso_pu_bacteria 2599185156 2599336303 354
52 iso_pu_bacteria 2775507049 2776913375 354
53 iso_pu_bacteria 2791355092 2792626601 354
54 iso_pu_bacteria 2842922631 2842927724 354
55 iso_pu_bacteria 2899803654 2899808863 354
56 3300005327 Ga0070658_10212360 Ga0070658_102123602 355
57 3300005331 Ga0070670_100000535 Ga0070670_10000053518 355
58 3300021361 Ga0213872_10022695 Ga0213872_100226952 355
59 3300025925 Ga0207650_10014417 Ga0207650_100144178 355
60 3300028379 Ga0268266_10059721 Ga0268266_100597211 355
61 3300031456 Ga0307513_10000588 Ga0307513_100005889 355
62 3300046516 Ga0495628_0059749 Ga0495628_0059749_1034_2110 355
63 3300049586 Ga0501070_0084565 Ga0501070_0084565_328_1407 355
64 3300049589 Ga0501073_0017851 Ga0501073_0017851_2150_3232 355
65 3300049822 Ga0501035_0029163 Ga0501035_0029163_921_2000 355
66 3300053111 Ga0500572_000849 Ga0500572_000849_4260_5336 355
67 iso_pu_bacteria 2537561587 2537877784 355
68 iso_pu_bacteria 2554235003 2554247754 355
69 iso_pu_bacteria 2558860242 2559294887 355
70 iso_pu_bacteria 2558860983 2561466505 355
71 iso_pu_bacteria 2599185210 2599604148 355
72 iso_pu_bacteria 2600255279 2601608059 355
73 iso_pu_bacteria 2600255308 2601744834 355
74 iso_pu_bacteria 2643221568 2643857685 355
75 iso_pu_bacteria 2643221582 2643919378 355
76 iso_pu_bacteria 2643221693 2644522280 355
77 iso_pu_bacteria 2738541317 2738945592 355
78 iso_pu_bacteria 2808606387 2808985343 355
79 iso_pu_bacteria 2818991439 2819559776 355
80 iso_pu_bacteria 2838675328 2838676187 355
81 iso_pu_bacteria 2838714209 2838715069 355
82 iso_pu_bacteria 2838719591 2838721131 355
83 iso_pu_bacteria 2838724970 2838725828 355
84 iso_pu_bacteria 2841846520 2841848088 355
85 iso_pu_bacteria 2841859092 2841859361 355
86 iso_pu_bacteria 2842124991 2842125882 355
87 iso_pu_bacteria 2842130223 2842131081 355
88 iso_pu_bacteria 2842152218 2842153749 355
89 iso_pu_bacteria 2842170452 2842171312 355
90 iso_pu_bacteria 2842175837 2842177369 355
91 iso_pu_bacteria 2842187318 2842188177 355
92 iso_pu_bacteria 2842211629 2842212488 355
93 iso_pu_bacteria 2842224351 2842225893 355
94 iso_pu_bacteria 2842515876 2842516145 355
95 iso_pu_bacteria 2899792073 2899794165 355
96 iso_pu_bacteria 2899845264 2899846536 355
97 iso_pu_bacteria 2913308742 2913310301 355
98 iso_pu_bacteria 2919114240 2919115160 355
99 iso_pu_bacteria 2919166419 2919167865 355
100 iso_pu_bacteria 2926754445 2926756206 355
101 iso_pu_bacteria 2926760298 2926760437 355
102 iso_pu_bacteria 2933006813 2933008395 355
103 iso_pu_bacteria 2933011516 2933013211 355
104 iso_pu_bacteria 2933594066 2933597900 355
105 iso_pu_bacteria 2978969890 2978974317 355
106 iso_pu_bacteria 2979089926 2979094287 355
107 iso_pu_bacteria 2979095461 2979098332 355
108 iso_pu_bacteria 2979100975 2979103520 355
109 iso_pu_bacteria 2984509177 2984511911 355
110 iso_pu_bacteria 2984518228 2984521729 355
111 iso_pu_bacteria 2984537506 2984541026 355
112 iso_pu_bacteria 2984587000 2984589659 355
113 iso_pu_bacteria 2984601300 2984603307 355
114 iso_pu_bacteria 8003570095 8003571203 355
115 iso_pu_bacteria 8054460903 8054462278 355
116 iso_pu_bacteria 8055431914 8055435180 355
117 iso_pu_bacteria 2508501122 2509107650 356
118 iso_pu_bacteria 2509276019 2509375988 356
119 iso_pu_bacteria 2509276021 2509386920 356
120 iso_pu_bacteria 2509276033 2509442448 356
121 iso_pu_bacteria 2510065019 2510133052 356
122 iso_pu_bacteria 2510065057 2510308661 356
123 iso_pu_bacteria 2510461069 2510843005 356
124 iso_pu_bacteria 2510917022 2511134929 356
125 iso_pu_bacteria 2510917026 2511172608 356
126 iso_pu_bacteria 2510917028 2511183744 356
127 iso_pu_bacteria 2510917030 2511193389 356
128 iso_pu_bacteria 2511231052 2511501507 356
129 iso_pu_bacteria 2512047086 2512532933 356
130 iso_pu_bacteria 2512875026 2512971740 356
131 iso_pu_bacteria 2513237084 2513569867 356
132 iso_pu_bacteria 2513237085 2513575135 356
133 iso_pu_bacteria 2513237086 2513588110 356
134 iso_pu_bacteria 2513237088 2513594390 356
135 iso_pu_bacteria 2513237089 2513605270 356
136 iso_pu_bacteria 2513237091 2513618701 356
137 iso_pu_bacteria 2513237093 2513635602 356
138 iso_pu_bacteria 2513237103 2513713454 356
139 iso_pu_bacteria 2513237138 2513866995 356
140 iso_pu_bacteria 2513237140 2513886969 356
141 iso_pu_bacteria 2513237143 2513907204 356
142 iso_pu_bacteria 2513237144 2513909862 356
143 iso_pu_bacteria 2513237146 2513926641 356
144 iso_pu_bacteria 2513237156 2513987068 356
145 iso_pu_bacteria 2513237159 2513997346 356
146 iso_pu_bacteria 2513237160 2514005288 356
147 iso_pu_bacteria 2513237162 2514021856 356
148 iso_pu_bacteria 2515075009 2515112002 356
149 iso_pu_bacteria 2515154107 2515611352 356
150 iso_pu_bacteria 2515154134 2515738816 356
151 iso_pu_bacteria 2516653046 2516892825 356
152 iso_pu_bacteria 2516653077 2517035738 356
153 iso_pu_bacteria 2517093000 2517094906 356
154 iso_pu_bacteria 2517287029 2517406535 356
155 iso_pu_bacteria 2517487022 2517569600 356
156 iso_pu_bacteria 2524023207 2524453661 356
157 iso_pu_bacteria 2529292951 2530645302 356
158 iso_pu_bacteria 2534681796 2535516275 356
159 iso_pu_bacteria 2551306084 2551674252 356
160 iso_pu_bacteria 2551306084 2551680404 356
161 iso_pu_bacteria 2551306085 2551686544 356
162 iso_pu_bacteria 2551306086 2551691823 356
163 iso_pu_bacteria 2551306087 2551699773 356
164 iso_pu_bacteria 2551306089 2551711741 356
165 iso_pu_bacteria 2551306090 2551719508 356
166 iso_pu_bacteria 2551306091 2551729148 356
167 iso_pu_bacteria 2551306092 2551737098 356
168 iso_pu_bacteria 2551306093 2551742525 356
169 iso_pu_bacteria 2558860100 2558868261 356
170 iso_pu_bacteria 2582581283 2585168470 356
171 iso_pu_bacteria 2582581294 2585199960 356
172 iso_pu_bacteria 2582581298 2585225792 356
173 iso_pu_bacteria 2582581299 2585233553 356
174 iso_pu_bacteria 2582581304 2585254507 356
175 iso_pu_bacteria 2582581306 2585270044 356
176 iso_pu_bacteria 2582581307 2585270669 356
177 iso_pu_bacteria 2582581865 2585389749 356
178 iso_pu_bacteria 2582581866 2585393716 356
179 iso_pu_bacteria 2582581867 2585403453 356
180 iso_pu_bacteria 2585427529 2585546752 356
181 iso_pu_bacteria 2585427531 2585558372 356
182 iso_pu_bacteria 2585427590 2585819579 356
183 iso_pu_bacteria 2585427594 2585846561 356
184 iso_pu_bacteria 2585427608 2585897767 356
185 iso_pu_bacteria 2585427609 2585904639 356
186 iso_pu_bacteria 2585427633 2585995875 356
187 iso_pu_bacteria 2585427634 2586000440 356
188 iso_pu_bacteria 2585428125 2587980245 356
189 iso_pu_bacteria 2599185170 2599417930 356
190 iso_pu_bacteria 2599185236 2599721501 356
191 iso_pu_bacteria 2599185352 2600197125 356
192 iso_pu_bacteria 2600254933 2600375810 356
193 iso_pu_bacteria 2615840624 2616292685 356
194 iso_pu_bacteria 2643221557 2643808722 356
195 iso_pu_bacteria 2643221558 2643811901 356
196 iso_pu_bacteria 2643221607 2644049364 356
197 iso_pu_bacteria 2643221610 2644066256 356
198 iso_pu_bacteria 2643221618 2644107978 356
199 iso_pu_bacteria 2643221626 2644148350 356
200 iso_pu_bacteria 2643221634 2644192901 356
201 iso_pu_bacteria 2643221636 2644204297 356
202 iso_pu_bacteria 2643221637 2644210481 356
203 iso_pu_bacteria 2643221643 2644239387 356
204 iso_pu_bacteria 2643221655 2644309372 356
205 iso_pu_bacteria 2643221659 2644333198 356
206 iso_pu_bacteria 2643221668 2644377796 356
207 iso_pu_bacteria 2643221675 2644415531 356
208 iso_pu_bacteria 2643221680 2644450067 356
209 iso_pu_bacteria 2643221686 2644482398 356
210 iso_pu_bacteria 2643221688 2644494478 356
211 iso_pu_bacteria 2643221689 2644502051 356
212 iso_pu_bacteria 2643221698 2644545630 356
213 iso_pu_bacteria 2643221712 2644615314 356
214 iso_pu_bacteria 2643221718 2644654033 356
215 iso_pu_bacteria 2643221719 2644658693 356
216 iso_pu_bacteria 2643221723 2644673621 356
217 iso_pu_bacteria 2643221726 2644687624 356
218 iso_pu_bacteria 2690316117 2692316028 356
219 iso_pu_bacteria 2718217882 2719180960 356
220 iso_pu_bacteria 2718217927 2719385560 356
221 iso_pu_bacteria 2718217997 2719665382 356
222 iso_pu_bacteria 2718218009 2719731709 356
223 iso_pu_bacteria 2718218199 2720491802 356
224 iso_pu_bacteria 2718218232 2720613071 356
225 iso_pu_bacteria 2718218233 2720619924 356
226 iso_pu_bacteria 2718218363 2721147054 356
227 iso_pu_bacteria 2718218365 2721158582 356
228 iso_pu_bacteria 2718218366 2721163972 356
229 iso_pu_bacteria 2718218423 2721399308 356
230 iso_pu_bacteria 2721755514 2722840142 356
231 iso_pu_bacteria 2721755556 2723026714 356
232 iso_pu_bacteria 2721755684 2723560331 356
233 iso_pu_bacteria 2721755809 2724038121 356
234 iso_pu_bacteria 2721755810 2724044465 356
235 iso_pu_bacteria 2721755823 2724109971 356
236 iso_pu_bacteria 2728369352 2730107650 356
237 iso_pu_bacteria 2728369365 2730164197 356
238 iso_pu_bacteria 2728369397 2730298214 356
239 iso_pu_bacteria 2738541293 2738801925 356
240 iso_pu_bacteria 2765235942 2766062931 356
241 iso_pu_bacteria 2791355082 2792580744 356
242 iso_pu_bacteria 2791355091 2792619981 356
243 iso_pu_bacteria 2791355094 2792639537 356
244 iso_pu_bacteria 2791355256 2793298262 356
245 iso_pu_bacteria 2791355259 2793313743 356
246 iso_pu_bacteria 2791355260 2793324325 356
247 iso_pu_bacteria 2791355261 2793326463 356
248 iso_pu_bacteria 2791355262 2793337048 356
249 iso_pu_bacteria 2791355263 2793341299 356
250 iso_pu_bacteria 2791355264 2793347523 356
251 iso_pu_bacteria 2791355265 2793352412 356
252 iso_pu_bacteria 2791355266 2793361397 356
253 iso_pu_bacteria 2791355267 2793369668 356
254 iso_pu_bacteria 2802428858 2802718738 356
255 iso_pu_bacteria 2802428859 2802726350 356
256 iso_pu_bacteria 2802428860 2802732890 356
257 iso_pu_bacteria 2802428861 2802738245 356
258 iso_pu_bacteria 2802428862 2802744579 356
259 iso_pu_bacteria 2802428863 2802751215 356
260 iso_pu_bacteria 2802429605 2805927740 356
261 iso_pu_bacteria 2802429606 2805935646 356
262 iso_pu_bacteria 2818991272 2819241893 356
263 iso_pu_bacteria 2818991461 2819684693 356
264 iso_pu_bacteria 2821123053 2821127924 356
265 iso_pu_bacteria 2838016132 2838021143 356
266 iso_pu_bacteria 2838022645 2838025374 356
267 iso_pu_bacteria 2838035591 2838041556 356
268 iso_pu_bacteria 2838042994 2838043206 356
269 iso_pu_bacteria 2838048938 2838054200 356
270 iso_pu_bacteria 2838061910 2838067853 356
271 iso_pu_bacteria 2838068647 2838071483 356
272 iso_pu_bacteria 2838074704 2838078756 356
273 iso_pu_bacteria 2838661181 2838666301 356
274 iso_pu_bacteria 2838668709 2838670188 356
275 iso_pu_bacteria 2838680041 2838682462 356
276 iso_pu_bacteria 2838686498 2838689234 356
277 iso_pu_bacteria 2838694306 2838697033 356
278 iso_pu_bacteria 2838701080 2838702559 356
279 iso_pu_bacteria 2838707686 2838709726 356
280 iso_pu_bacteria 2838729681 2838730582 356
281 iso_pu_bacteria 2838736955 2838738348 356
282 iso_pu_bacteria 2838742623 2838743523 356
283 iso_pu_bacteria 2841840854 2841841282 356
284 iso_pu_bacteria 2841851746 2841854801 356
285 iso_pu_bacteria 2842077413 2842077900 356
286 iso_pu_bacteria 2842110456 2842110744 356
287 iso_pu_bacteria 2842118031 2842119592 356
288 iso_pu_bacteria 2842140634 2842141060 356
289 iso_pu_bacteria 2842146304 2842146896 356
290 iso_pu_bacteria 2842156927 2842157664 356
291 iso_pu_bacteria 2842163707 2842164861 356
292 iso_pu_bacteria 2842180545 2842180751 356
293 iso_pu_bacteria 2842192696 2842196879 356
294 iso_pu_bacteria 2842198810 2842200942 356
295 iso_pu_bacteria 2842205361 2842206277 356
296 iso_pu_bacteria 2842217011 2842222968 356
297 iso_pu_bacteria 2842229732 2842231191 356
298 iso_pu_bacteria 2842237096 2842239139 356
299 iso_pu_bacteria 2842243621 2842244702 356
300 iso_pu_bacteria 2842250916 2842251961 356
301 iso_pu_bacteria 2842257432 2842258515 356
302 iso_pu_bacteria 2842264693 2842268042 356
303 iso_pu_bacteria 2842271015 2842273254 356
304 iso_pu_bacteria 2842278818 2842279734 356
305 iso_pu_bacteria 2842285085 2842287379 356
306 iso_pu_bacteria 2842291075 2842291562 356
307 iso_pu_bacteria 2842304105 2842310084 356
308 iso_pu_bacteria 2842311132 2842313685 356
309 iso_pu_bacteria 2842317721 2842318145 356
310 iso_pu_bacteria 2842341865 2842347275 356
311 iso_pu_bacteria 2842363717 2842366540 356
312 iso_pu_bacteria 2842370503 2842373029 356
313 iso_pu_bacteria 2842377471 2842377958 356
314 iso_pu_bacteria 2842384541 2842386101 356
315 iso_pu_bacteria 2842402390 2842405091 356
316 iso_pu_bacteria 2842409023 2842411674 356
317 iso_pu_bacteria 2842415677 2842417876 356
318 iso_pu_bacteria 2842422224 2842424859 356
319 iso_pu_bacteria 2842428310 2842431739 356
320 iso_pu_bacteria 2842434925 2842438318 356
321 iso_pu_bacteria 2842441272 2842444949 356
322 iso_pu_bacteria 2842447887 2842452267 356
323 iso_pu_bacteria 2842462802 2842466093 356
324 iso_pu_bacteria 2842469257 2842472934 356
325 iso_pu_bacteria 2842489311 2842492890 356
326 iso_pu_bacteria 2842495871 2842496415 356
327 iso_pu_bacteria 2842521101 2842522409 356
328 iso_pu_bacteria 2844163670 2844167286 356
329 iso_pu_bacteria 2844454524 2844459411 356
330 iso_pu_bacteria 2847417321 2847418907 356
331 iso_pu_bacteria 2848992105 2848993944 356
332 iso_pu_bacteria 2850079185 2850081893 356
333 iso_pu_bacteria 2855825444 2855825602 356
334 iso_pu_bacteria 2855839649 2855840979 356
335 iso_pu_bacteria 2855872281 2855876577 356
336 iso_pu_bacteria 2857516855 2857518469 356
337 iso_pu_bacteria 2857531043 2857534335 356
338 iso_pu_bacteria 2858800743 2858801519 356
339 iso_pu_bacteria 2896384573 2896390625 356
340 iso_pu_bacteria 2913295892 2913301097 356
341 iso_pu_bacteria 2915980308 2915985346 356
342 iso_pu_bacteria 2915986958 2915987993 356
343 iso_pu_bacteria 2915993759 2915996321 356
344 iso_pu_bacteria 2916000859 2916001462 356
345 iso_pu_bacteria 2916007675 2916010351 356
346 iso_pu_bacteria 2916014648 2916017089 356
347 iso_pu_bacteria 2916021584 2916022488 356
348 iso_pu_bacteria 2916028427 2916029018 356
349 iso_pu_bacteria 2916035215 2916041674 356
350 iso_pu_bacteria 2916041962 2916047886 356
351 iso_pu_bacteria 2916048683 2916054114 356
352 iso_pu_bacteria 2916055098 2916061632 356
353 iso_pu_bacteria 2916061851 2916062311 356
354 iso_pu_bacteria 2916068649 2916071974 356
355 iso_pu_bacteria 2916076590 2916081967 356
356 iso_pu_bacteria 2919100787 2919107874 356
357 iso_pu_bacteria 2919171160 2919175093 356
358 iso_pu_bacteria 2920760137 2920765913 356
359 iso_pu_bacteria 2920822456 2920824445 356
360 iso_pu_bacteria 2921201388 2921201569 356
361 iso_pu_bacteria 2921208531 2921210265 356
362 iso_pu_bacteria 2921237296 2921239101 356
363 iso_pu_bacteria 2921244191 2921250407 356
364 iso_pu_bacteria 2921250672 2921253991 356
365 iso_pu_bacteria 2921257292 2921257377 356
366 iso_pu_bacteria 2921263974 2921264601 356
367 iso_pu_bacteria 2921282425 2921283378 356
368 iso_pu_bacteria 2921289301 2921293218 356
369 iso_pu_bacteria 2923556063 2923560808 356
370 iso_pu_bacteria 2924144063 2924147431 356
371 iso_pu_bacteria 2924150972 2924151676 356
372 iso_pu_bacteria 2924158325 2924159053 356
373 iso_pu_bacteria 2924165586 2924167818 356
374 iso_pu_bacteria 2924172951 2924176528 356
375 iso_pu_bacteria 2924186466 2924187599 356
376 iso_pu_bacteria 2924193448 2924200312 356
377 iso_pu_bacteria 2924200457 2924203858 356
378 iso_pu_bacteria 2924207177 2924213804 356
379 iso_pu_bacteria 2924214083 2924217102 356
380 iso_pu_bacteria 2924221636 2924224041 356
381 iso_pu_bacteria 2924228884 2924235069 356
382 iso_pu_bacteria 2929138655 2929140426 356
383 iso_pu_bacteria 2933586486 2933586770 356
384 iso_pu_bacteria 2933599457 2933602282 356
385 iso_pu_bacteria 2935894831 2935899101 356
386 iso_pu_bacteria 2935901341 2935904493 356
387 iso_pu_bacteria 2936367885 2936372985 356
388 iso_pu_bacteria 2936375103 2936381136 356
389 iso_pu_bacteria 2936381700 2936386055 356
390 iso_pu_bacteria 2936996657 2936998015 356
391 iso_pu_bacteria 2937002841 2937006150 356
392 iso_pu_bacteria 2937009748 2937012649 356
393 iso_pu_bacteria 2937016420 2937019724 356
394 iso_pu_bacteria 2937023124 2937029344 356
395 iso_pu_bacteria 2937029754 2937032701 356
396 iso_pu_bacteria 2937036028 2937042032 356
397 iso_pu_bacteria 2937042894 2937045847 356
398 iso_pu_bacteria 2937049772 2937051299 356
399 iso_pu_bacteria 2937056579 2937057708 356
400 iso_pu_bacteria 2937063883 2937070789 356
401 iso_pu_bacteria 2937071275 2937077581 356
402 iso_pu_bacteria 2937078374 2937082641 356
403 iso_pu_bacteria 2937084907 2937091439 356
404 iso_pu_bacteria 2937091812 2937095871 356
405 iso_pu_bacteria 2937098957 2937100127 356
406 iso_pu_bacteria 2937106411 2937111902 356
407 iso_pu_bacteria 2937113482 2937118407 356
408 iso_pu_bacteria 2937119839 2937125679 356
409 iso_pu_bacteria 2937126314 2937130342 356
410 iso_pu_bacteria 2941499720 2941505042 356
411 iso_pu_bacteria 2957375807 2957379424 356
412 iso_pu_bacteria 2957382221 2957386433 356
413 iso_pu_bacteria 2957388812 2957389831 356
414 iso_pu_bacteria 2957395598 2957399872 356
415 iso_pu_bacteria 2957402308 2957406755 356
416 iso_pu_bacteria 2957408893 2957410210 356
417 iso_pu_bacteria 2957415311 2957421728 356
418 iso_pu_bacteria 2957422303 2957426182 356
419 iso_pu_bacteria 2957430029 2957437168 356
420 iso_pu_bacteria 2957437181 2957441880 356
421 iso_pu_bacteria 2957443900 2957445461 356
422 iso_pu_bacteria 2957450854 2957453884 356
423 iso_pu_bacteria 2957457609 2957459745 356
424 iso_pu_bacteria 2957464669 2957465738 356
425 iso_pu_bacteria 2957471148 2957476555 356
426 iso_pu_bacteria 2957478035 2957478612 356
427 iso_pu_bacteria 2957484790 2957486136 356
428 iso_pu_bacteria 2957491536 2957498186 356
429 iso_pu_bacteria 2957498199 2957502580 356
430 iso_pu_bacteria 2957505466 2957506633 356
431 iso_pu_bacteria 2960584000 2960588929 356
432 iso_pu_bacteria 2960591022 2960596282 356
433 iso_pu_bacteria 2960603979 2960604485 356
434 iso_pu_bacteria 2960610863 2960616527 356
435 iso_pu_bacteria 2960617483 2960618877 356
436 iso_pu_bacteria 2960631154 2960632644 356
437 iso_pu_bacteria 2960637947 2960645194 356
438 iso_pu_bacteria 2960645483 2960646299 356
439 iso_pu_bacteria 2960652885 2960656287 356
440 iso_pu_bacteria 2960660292 2960664215 356
441 iso_pu_bacteria 2960667422 2960669594 356
442 iso_pu_bacteria 2960674078 2960676824 356
443 iso_pu_bacteria 2960680706 2960686977 356
444 iso_pu_bacteria 2960687367 2960688762 356
445 iso_pu_bacteria 2960693952 2960700136 356
446 iso_pu_bacteria 2964607997 2964609320 356
447 iso_pu_bacteria 2964615318 2964616150 356
448 iso_pu_bacteria 2964621998 2964622914 356
449 iso_pu_bacteria 2964628898 2964632098 356
450 iso_pu_bacteria 2964636051 2964639308 356
451 iso_pu_bacteria 2964643177 2964648889 356
452 iso_pu_bacteria 2964649959 2964652088 356
453 iso_pu_bacteria 2964656573 2964662790 356
454 iso_pu_bacteria 2964663802 2964666845 356
455 iso_pu_bacteria 2964670856 2964671280 356
456 iso_pu_bacteria 2964678106 2964681064 356
457 iso_pu_bacteria 2964685014 2964690095 356
458 iso_pu_bacteria 2964698721 2964699355 356
459 iso_pu_bacteria 2964705432 2964709017 356
460 iso_pu_bacteria 2964712639 2964716204 356
461 iso_pu_bacteria 2964719344 2964724373 356
462 iso_pu_bacteria 2967664464 2967667077 356
463 iso_pu_bacteria 2967671571 2967672801 356
464 iso_pu_bacteria 2967678726 2967683897 356
465 iso_pu_bacteria 2967686174 2967691232 356
466 iso_pu_bacteria 2967693043 2967693512 356
467 iso_pu_bacteria 2967699805 2967700730 356
468 iso_pu_bacteria 2967706974 2967711706 356
469 iso_pu_bacteria 2967714385 2967715650 356
470 iso_pu_bacteria 2967721400 2967726793 356
471 iso_pu_bacteria 2967728569 2967734419 356
472 iso_pu_bacteria 2967735183 2967736513 356
473 iso_pu_bacteria 2967742019 2967742392 356
474 iso_pu_bacteria 2967748971 2967750524 356
475 iso_pu_bacteria 2967755722 2967758257 356
476 iso_pu_bacteria 2967762386 2967765198 356
477 iso_pu_bacteria 2967769361 2967770678 356
478 iso_pu_bacteria 2967775926 2967776543 356
479 iso_pu_bacteria 2970019648 2970022529 356
480 iso_pu_bacteria 2970026789 2970032754 356
481 iso_pu_bacteria 2970033650 2970034408 356
482 iso_pu_bacteria 2970040964 2970041585 356
483 iso_pu_bacteria 2970047711 2970052525 356
484 iso_pu_bacteria 2970054988 2970061299 356
485 iso_pu_bacteria 2970061556 2970063075 356
486 iso_pu_bacteria 2970068827 2970074646 356
487 iso_pu_bacteria 2970076120 2970082408 356
488 iso_pu_bacteria 2970082768 2970088196 356
489 iso_pu_bacteria 2970088815 2970095691 356
490 iso_pu_bacteria 2970095765 2970102339 356
491 iso_pu_bacteria 2970102677 2970104188 356
492 iso_pu_bacteria 2970109326 2970114987 356
493 iso_pu_bacteria 2970116247 2970121468 356
494 iso_pu_bacteria 2970122695 2970126905 356
495 iso_pu_bacteria 2970129317 2970130211 356
496 iso_pu_bacteria 2970136068 2970138420 356
497 iso_pu_bacteria 2970143518 2970147726 356
498 iso_pu_bacteria 2970149975 2970154332 356
499 iso_pu_bacteria 2970156795 2970158078 356
500 iso_pu_bacteria 2970164137 2970170444 356
501 iso_pu_bacteria 2970170962 2970172112 356
502 iso_pu_bacteria 2970177841 2970178241 356
503 iso_pu_bacteria 2970184632 2970187248 356
504 iso_pu_bacteria 2970191845 2970193859 356
505 iso_pu_bacteria 2977516862 2977521180 356
506 iso_pu_bacteria 2977523885 2977526801 356
507 iso_pu_bacteria 2977530762 2977535700 356
508 iso_pu_bacteria 2977537788 2977541717 356
509 iso_pu_bacteria 2977544691 2977550762 356
510 iso_pu_bacteria 2977551784 2977554488 356
511 iso_pu_bacteria 2977558990 2977562630 356
512 iso_pu_bacteria 2977565890 2977572333 356
513 iso_pu_bacteria 2977572785 2977577383 356
514 iso_pu_bacteria 2977579622 2977583692 356
515 iso_pu_bacteria 2989771324 2989776117 356
516 iso_pu_bacteria 2989776772 2989778818 356
517 iso_pu_bacteria 2996887358 2996889911 356
518 iso_pu_bacteria 2996893221 2996898357 356
519 iso_pu_bacteria 3005409236 3005409571 356
520 iso_pu_bacteria 3005445848 3005447321 356
521 iso_pu_bacteria 639633055 639648287 356
522 iso_pu_bacteria 648276728 648740968 356
523 iso_pu_bacteria 8003992118 8003993472 356
524 iso_pu_bacteria 8003999396 8004000735 356
525 iso_pu_bacteria 8005246636 8005248368 356
526 iso_pu_bacteria 8005258706 8005261631 356
527 iso_pu_bacteria 8005275841 8005280334 356
528 iso_pu_bacteria 8005282627 8005288402 356
529 iso_pu_bacteria 8005289223 8005294911 356
530 iso_pu_bacteria 8005301065 8005306923 356
531 iso_pu_bacteria 8005307578 8005314280 356
532 iso_pu_bacteria 8005321885 8005324438 356
533 iso_pu_bacteria 8005376324 8005378936 356
534 iso_pu_bacteria 8005395548 8005396923 356
535 iso_pu_bacteria 8005430974 8005434618 356
536 iso_pu_bacteria 8005460587 8005462661 356
537 iso_pu_bacteria 8005497431 8005500026 356
538 iso_pu_bacteria 8005542996 8005544922 356
539 iso_pu_bacteria 8005619151 8005621394 356
540 iso_pu_bacteria 8005626139 8005631319 356
541 iso_pu_bacteria 8005668836 8005671443 356
542 iso_pu_bacteria 8005688590 8005694841 356
543 iso_pu_bacteria 8005695170 8005696018 356
544 iso_pu_bacteria 8018127388 8018129680 356
545 iso_pu_bacteria 8018150411 8018155441 356
546 iso_pu_bacteria 8023680758 8023681097 356
547 iso_pu_bacteria 8024479707 8024485890 356
548 iso_pu_bacteria 8024486573 8024492636 356
549 iso_pu_bacteria 8024501048 8024505352 356
550 iso_pu_bacteria 8049293176 8049294627 356
551 iso_pu_bacteria 8056375014 8056377186 356
552 iso_pu_bacteria 8056382006 8056388308 356
553 iso_pu_bacteria 2524023209 2524460459 357
554 iso_pu_bacteria 2582581308 2585277010 357
555 iso_pu_bacteria 2582581315 2585323984 357
556 iso_pu_bacteria 2582581316 2585333619 357
557 iso_pu_bacteria 2585427527 2585537020 357
558 iso_pu_bacteria 2585427530 2585551871 357
559 iso_pu_bacteria 2615840626 2616308384 357
560 iso_pu_bacteria 2615840698 2616556548 357
561 iso_pu_bacteria 2617270742 2617385873 357
562 iso_pu_bacteria 2643221599 2644005060 357
563 iso_pu_bacteria 2667528174 2671115785 357
564 iso_pu_bacteria 2775507266 2778176524 357
565 iso_pu_bacteria 2818991448 2819610359 357
566 iso_pu_bacteria 2818991453 2819638101 357
567 iso_pu_bacteria 2838029111 2838035091 357
568 iso_pu_bacteria 2842298080 2842301789 357
569 iso_pu_bacteria 2842357229 2842357292 357
570 iso_pu_bacteria 2842475841 2842481857 357
571 iso_pu_bacteria 2842482326 2842487085 357
572 iso_pu_bacteria 2842502639 2842508732 357
573 iso_pu_bacteria 2842509118 2842510258 357
574 iso_pu_bacteria 2852387548 2852389676 357
575 iso_pu_bacteria 2919408235 2919409839 357
576 iso_pu_bacteria 3005416602 3005420298 357
577 iso_pu_bacteria 3005452660 3005454082 357
578 iso_pu_bacteria 8005314921 8005317249 357
579 iso_pu_bacteria 8005484373 8005486690 357
580 iso_pu_bacteria 8005645114 8005646170 357
581 iso_pu_bacteria 8005682033 8005686300 357
582 iso_pu_bacteria 8046767195 8046773946 357
583 iso_pu_bacteria 8057575449 8057578326 357
584 3300025295 Ga0209564_1000105 Ga0209564_1000105170 358
585 3300028794 Ga0307515_10000569 Ga0307515_1000056958 358
586 3300035692 Ga0373935_0084405 Ga0373935_0084405_418_1554 358
587 3300035695 Ga0373927_0002488 Ga0373927_0002488_2536_3672 358
588 3300037068 Ga0373925_0001826 Ga0373925_0001826_4084_5220 358
589 3300037471 Ga0395905_0000386 Ga0395905_0000386_31350_32429 358
590 3300046460 Ga0495638_0034607 Ga0495638_0034607_808_1887 358
591 3300053104 Ga0500556_0081163 Ga0500556_0081163_118_1197 358
592 3300053136 Ga0500559_0062107 Ga0500559_0062107_80_1159 358
593 3300053156 Ga0500622_0000378 Ga0500622_0000378_16766_17845 358
594 3300003187 JGI25151J46595_10003454 JGI25151J46595_100034549 359
595 3300003187 JGI25151J46595_10005103 JGI25151J46595_100051038 359
596 3300003215 JGI25153J46596_10004316 JGI25153J46596_100043166 359
597 3300003354 JGI25160J50197_1000593 JGI25160J50197_100059316 359
598 3300003374 JGI25161J50226_1002628 JGI25161J50226_10026284 359
599 3300003771 Ga0055526_1010394 Ga0055526_10103944 359
600 3300003775 Ga0055524_1020480 Ga0055524_10204802 359
601 3300003856 Ga0058692_1002330 Ga0058692_10023302 359
602 3300004625 Ga0055543_1001144 Ga0055543_100114410 359
603 3300005262 Ga0065165_1023781 Ga0065165_10237812 359
604 3300006038 Ga0075365_10012329 Ga0075365_100123298 359
605 3300006042 Ga0075368_10002095 Ga0075368_100020952 359
606 3300006051 Ga0075364_10129542 Ga0075364_101295422 359
607 3300006177 Ga0075362_10011839 Ga0075362_100118394 359
608 3300006177 Ga0075362_10012116 Ga0075362_100121162 359
609 3300006178 Ga0075367_10032147 Ga0075367_100321472 359
610 3300006186 Ga0075369_10009230 Ga0075369_100092305 359
611 3300006195 Ga0075366_10021694 Ga0075366_100216943 359
612 3300006948 Ga0099826_10000090 Ga0099826_1000009012 359
613 3300006948 Ga0099826_10004510 Ga0099826_100045104 359
614 3300009148 Ga0105243_10089667 Ga0105243_100896673 359
615 3300013100 Ga0157373_10002285 Ga0157373_100022853 359
616 3300013100 Ga0157373_10131447 Ga0157373_101314472 359
617 3300013102 Ga0157371_10000015 Ga0157371_10000015194 359
618 3300013104 Ga0157370_10000992 Ga0157370_100009929 359
619 3300013105 Ga0157369_10050141 Ga0157369_100501414 359
620 3300025245 Ga0207425_1008820 Ga0207425_10088202 359
621 3300025258 Ga0209129_1001442 Ga0209129_10014428 359
622 3300025294 Ga0209025_1000563 Ga0209025_100056346 359
623 3300025294 Ga0209025_1001678 Ga0209025_100167811 359
624 3300025295 Ga0209564_1001528 Ga0209564_100152817 359
625 3300025297 Ga0209758_1000534 Ga0209758_100053454 359
626 3300025299 Ga0209256_1008787 Ga0209256_10087872 359
627 3300025302 Ga0207426_1000408 Ga0207426_10004088 359
628 3300025303 Ga0209051_1039840 Ga0209051_10398402 359
629 3300027312 Ga0209371_1000178 Ga0209371_100017856 359
630 3300027312 Ga0209371_1000382 Ga0209371_10003822 359
631 3300027666 Ga0209282_1000235 Ga0209282_100023516 359
632 3300027666 Ga0209282_1075229 Ga0209282_10752292 359
633 3300030500 Ga0268256_1000251 Ga0268256_100025131 359
634 3300030500 Ga0268256_1006569 Ga0268256_10065694 359
635 3300046674 Ga0495588_0020089 Ga0495588_0020089_2097_3179 359
636 3300047470 Ga0495681_0077664 Ga0495681_0077664_118_1200 359
637 3300048919 Ga0496116_0000232 Ga0496116_0000232_31844_32926 359
638 3300048920 Ga0496117_0000002 Ga0496117_0000002_926869_927951 359
639 3300048921 Ga0496118_0000460 Ga0496118_0000460_53302_54384 359
640 3300048921 Ga0496118_0020559 Ga0496118_0020559_4606_5688 359
641 3300048922 Ga0496119_0047784 Ga0496119_0047784_1275_2357 359
642 3300048923 Ga0496120_0000078 Ga0496120_0000078_55945_57027 359
643 3300048925 Ga0496122_0000001 Ga0496122_0000001_233302_234384 359
644 3300048925 Ga0496122_0011586 Ga0496122_0011586_6558_7640 359
645 3300048925 Ga0496122_0113931 Ga0496122_0113931_138_1220 359
646 3300048926 Ga0496123_0000001 Ga0496123_0000001_237033_238115 359
647 3300048926 Ga0496123_0050289 Ga0496123_0050289_1510_2592 359
648 3300048927 Ga0496124_0000377 Ga0496124_0000377_60126_61208 359
649 3300048927 Ga0496124_0014237 Ga0496124_0014237_4399_5481 359
650 3300048929 Ga0496126_0001369 Ga0496126_0001369_27593_28675 359
651 3300048929 Ga0496126_0230043 Ga0496126_0230043_169_1251 359
652 3300050489 nmdc:mga03683_3419_c1 nmdc:mga03683_3419_c1_2620_3699 359
653 3300050490 nmdc:mga03n38_26274_c1 nmdc:mga03n38_26274_c1_1090_2172 359
654 3300050491 nmdc:mga00v17_3726_c1 nmdc:mga00v17_3726_c1_790_1872 359
655 3300050492 nmdc:mga0yw44_697_c1 nmdc:mga0yw44_697_c1_9080_10162 359
656 3300050492 nmdc:mga0yw44_95712_c1 nmdc:mga0yw44_95712_c1_702_1781 359
657 3300050493 nmdc:mga0k408_112515_c1 nmdc:mga0k408_112515_c1_314_1396 359
658 3300050493 nmdc:mga0k408_25595_c1 nmdc:mga0k408_25595_c1_2244_3323 359
659 3300050516 nmdc:mga0sz30_16497_c1 nmdc:mga0sz30_16497_c1_616_1698 359
660 3300050516 nmdc:mga0sz30_4182_c1 nmdc:mga0sz30_4182_c1_2949_4028 359
661 3300053107 Ga0500560_001846 Ga0500560_001846_387_1469 359
662 3300053111 Ga0500572_003892 Ga0500572_003892_1700_2782 359
663 3300053137 Ga0500561_0002360 Ga0500561_0002360_1515_2597 359
664 3300053157 Ga0500624_001373 Ga0500624_001373_934_2016 359
665 3300053161 Ga0500634_0010832 Ga0500634_0010832_2940_4025 359
666 3300053177 Ga0500636_0000123 Ga0500636_0000123_25594_26697 359
667 3300053177 Ga0500636_0001081 Ga0500636_0001081_10845_11927 359
668 iso_pu_bacteria 2585427528 2585540495 359
669 iso_pu_bacteria 2585427593 2585838711 359
670 iso_pu_bacteria 2738541333 2739037991 359
671 iso_pu_bacteria 2802429633 2806045384 359
672 iso_pu_bacteria 2802429634 2806055423 359
673 iso_pu_bacteria 2802429635 2806061466 359
674 iso_pu_bacteria 2802429636 2806068040 359
675 iso_pu_bacteria 2802429637 2806072612 359
676 iso_pu_bacteria 650716007 650740142 359
677 iso_pu_bacteria 8005570704 8005575563 359
678 3300002739 JGI25158J39367_1000167 JGI25158J39367_10001678 360
679 3300002773 JGI25152J39213_1008181 JGI25152J39213_10081811 360
680 3300002987 JGI25159J45721_1000029 JGI25159J45721_10000296 360
681 3300002987 JGI25159J45721_1001125 JGI25159J45721_10011258 360
682 3300003187 JGI25151J46595_10004048 JGI25151J46595_1000404812 360
683 3300003187 JGI25151J46595_10005052 JGI25151J46595_100050523 360
684 3300003215 JGI25153J46596_10011346 JGI25153J46596_100113464 360
685 3300003354 JGI25160J50197_1000011 JGI25160J50197_1000011251 360
686 3300003374 JGI25161J50226_1001956 JGI25161J50226_10019562 360
687 3300003771 Ga0055526_1001995 Ga0055526_100199513 360
688 3300003771 Ga0055526_1003733 Ga0055526_100373310 360
689 3300003771 Ga0055526_1006958 Ga0055526_10069587 360
690 3300003771 Ga0055526_1010214 Ga0055526_10102142 360
691 3300003771 Ga0055526_1021566 Ga0055526_10215662 360
692 3300003775 Ga0055524_1003862 Ga0055524_10038627 360
693 3300003775 Ga0055524_1013014 Ga0055524_10130141 360
694 3300003775 Ga0055524_1028237 Ga0055524_10282371 360
695 3300003781 Ga0055536_1000356 Ga0055536_100035628 360
696 3300003790 Ga0055528_1001267 Ga0055528_100126712 360
697 3300003790 Ga0055528_1001601 Ga0055528_100160113 360
698 3300003790 Ga0055528_1005825 Ga0055528_10058259 360
699 3300003790 Ga0055528_1013134 Ga0055528_10131344 360
700 3300003792 Ga0055540_1000177 Ga0055540_100017758 360
701 3300003794 Ga0055531_10003828 Ga0055531_100038288 360
702 3300003794 Ga0055531_10003846 Ga0055531_100038467 360
703 3300004625 Ga0055543_1000097 Ga0055543_10000976 360
704 3300004625 Ga0055543_1000255 Ga0055543_100025531 360
705 3300005262 Ga0065165_1000018 Ga0065165_1000018251 360
706 3300005355 Ga0070671_100033264 Ga0070671_1000332643 360
707 3300006038 Ga0075365_10005053 Ga0075365_100050534 360
708 3300006051 Ga0075364_10000043 Ga0075364_1000004313 360
709 3300006353 Ga0075370_10001750 Ga0075370_1000175010 360
710 3300006946 Ga0079104_1000022 Ga0079104_1000022125 360
711 3300006946 Ga0079104_1001402 Ga0079104_100140211 360
712 3300009011 Ga0105251_10020317 Ga0105251_100203173 360
713 3300009765 Ga0123341_1000049 Ga0123341_100004934 360
714 3300013249 Ga0171463_1008 Ga0171463_100881 360
715 3300015690 Ga0183363_1281 Ga0183363_12818 360
716 3300021320 Ga0214544_1000129 Ga0214544_100012975 360
717 3300021321 Ga0214542_1000828 Ga0214542_100082818 360
718 3300021321 Ga0214542_1027439 Ga0214542_10274392 360
719 3300021327 Ga0214543_1000010 Ga0214543_1000010139 360
720 3300021327 Ga0214543_1000134 Ga0214543_100013413 360
721 3300022739 Ga0228711_1002680 Ga0228711_10026809 360
722 3300022740 Ga0228710_1002851 Ga0228710_10028519 360
723 3300025208 Ga0209436_100507 Ga0209436_10050711 360
724 3300025245 Ga0207425_1009643 Ga0207425_10096432 360
725 3300025258 Ga0209129_1000127 Ga0209129_100012768 360
726 3300025258 Ga0209129_1001042 Ga0209129_100104212 360
727 3300025258 Ga0209129_1002372 Ga0209129_10023729 360
728 3300025258 Ga0209129_1012798 Ga0209129_10127981 360
729 3300025258 Ga0209129_1012818 Ga0209129_10128181 360
730 3300025273 Ga0209673_1000139 Ga0209673_100013913 360
731 3300025273 Ga0209673_1001327 Ga0209673_10013272 360
732 3300025273 Ga0209673_1002230 Ga0209673_10022305 360
733 3300025273 Ga0209673_1003846 Ga0209673_10038469 360
734 3300025273 Ga0209673_1004486 Ga0209673_10044869 360
735 3300025273 Ga0209673_1004582 Ga0209673_10045826 360
736 3300025284 Ga0209130_1000029 Ga0209130_10000296 360
737 3300025284 Ga0209130_1000097 Ga0209130_1000097130 360
738 3300025284 Ga0209130_1008169 Ga0209130_10081692 360
739 3300025292 Ga0209676_1000438 Ga0209676_10004388 360
740 3300025292 Ga0209676_1007877 Ga0209676_10078774 360
741 3300025292 Ga0209676_1016797 Ga0209676_10167973 360
742 3300025294 Ga0209025_1000033 Ga0209025_1000033193 360
743 3300025294 Ga0209025_1001703 Ga0209025_100170318 360
744 3300025294 Ga0209025_1003459 Ga0209025_100345912 360
745 3300025294 Ga0209025_1010390 Ga0209025_10103903 360
746 3300025295 Ga0209564_1000275 Ga0209564_100027593 360
747 3300025295 Ga0209564_1000986 Ga0209564_100098613 360
748 3300025295 Ga0209564_1001611 Ga0209564_100161112 360
749 3300025295 Ga0209564_1022689 Ga0209564_10226892 360
750 3300025297 Ga0209758_1000505 Ga0209758_100050552 360
751 3300025297 Ga0209758_1000805 Ga0209758_100080532 360
752 3300025297 Ga0209758_1001745 Ga0209758_100174525 360
753 3300025297 Ga0209758_1003872 Ga0209758_100387213 360
754 3300025297 Ga0209758_1007599 Ga0209758_100759911 360
755 3300025297 Ga0209758_1020108 Ga0209758_10201084 360
756 3300025298 Ga0209050_1000516 Ga0209050_10005166 360
757 3300025298 Ga0209050_1004356 Ga0209050_100435611 360
758 3300025299 Ga0209256_1001255 Ga0209256_10012556 360
759 3300025299 Ga0209256_1001768 Ga0209256_100176813 360
760 3300025299 Ga0209256_1002167 Ga0209256_100216713 360
761 3300025299 Ga0209256_1003073 Ga0209256_10030739 360
762 3300025299 Ga0209256_1009219 Ga0209256_10092195 360
763 3300025299 Ga0209256_1042308 Ga0209256_10423081 360
764 3300025302 Ga0207426_1000003 Ga0207426_1000003736 360
765 3300025302 Ga0207426_1000074 Ga0207426_1000074291 360
766 3300025302 Ga0207426_1000290 Ga0207426_10002908 360
767 3300025303 Ga0209051_1000125 Ga0209051_100012517 360
768 3300025303 Ga0209051_1003377 Ga0209051_10033779 360
769 3300025303 Ga0209051_1004697 Ga0209051_10046973 360
770 3300025303 Ga0209051_1036652 Ga0209051_10366522 360
771 3300025304 Ga0209257_1009229 Ga0209257_10092293 360
772 3300026067 Ga0207678_10064346 Ga0207678_100643465 360
773 3300027111 Ga0209281_1000036 Ga0209281_1000036401 360
774 3300027111 Ga0209281_1000047 Ga0209281_1000047343 360
775 3300027111 Ga0209281_1000508 Ga0209281_100050831 360
776 3300027111 Ga0209281_1004020 Ga0209281_10040206 360
777 3300027666 Ga0209282_1000116 Ga0209282_100011631 360
778 3300028794 Ga0307515_10000233 Ga0307515_1000023361 360
779 3300028794 Ga0307515_10013071 Ga0307515_1001307113 360
780 3300028794 Ga0307515_10095379 Ga0307515_100953797 360
781 3300031456 Ga0307513_10021520 Ga0307513_100215207 360
782 3300031548 Ga0307408_100129754 Ga0307408_1001297541 360
783 3300031731 Ga0307405_10026000 Ga0307405_100260002 360
784 3300031901 Ga0307406_10006937 Ga0307406_100069373 360
785 3300031911 Ga0307412_10000449 Ga0307412_100004495 360
786 3300031967 Ga0315914_1002646 Ga0315914_10026469 360
787 3300033430 Ga0315913_1001232 Ga0315913_10012329 360
788 3300033464 Ga0315915_1000058 Ga0315915_100005846 360
789 3300041404 Ga0439436_0020716 Ga0439436_0020716_799_1884 360
790 3300041413 Ga0439465_0002627 Ga0439465_0002627_2726_3811 360
791 3300041413 Ga0439465_0012232 Ga0439465_0012232_385_1470 360
792 3300041491 Ga0451833_0326332 Ga0451833_0326332_942_2024 360
793 3300041496 Ga0451839_0624369 Ga0451839_0624369_64_1146 360
794 3300041496 Ga0451839_1171986 Ga0451839_1171986_508_1590 360
795 3300041501 Ga0451845_0406102 Ga0451845_0406102_3815_4897 360
796 3300041505 Ga0451849_1391146 Ga0451849_1391146_3037_4119 360
797 3300041507 Ga0451851_0083156 Ga0451851_0083156_202_1287 360
798 3300041507 Ga0451851_0085829 Ga0451851_0085829_824_1906 360
799 3300041507 Ga0451851_1152225 Ga0451851_1152225_819_1901 360
800 3300041509 Ga0451843_0892284 Ga0451843_0892284_587_1669 360
801 3300042002 Ga0439442_022028 Ga0439442_022028_179_1264 360
802 3300042007 Ga0439449_0005586 Ga0439449_0005586_1660_2742 360
803 3300042015 Ga0439462_0019440 Ga0439462_0019440_385_1470 360
804 3300044735 Ga0466968_0033665 Ga0466968_0033665_141_1226 360
805 3300046460 Ga0495638_0001886 Ga0495638_0001886_8690_9775 360
806 3300046476 Ga0495662_0037834 Ga0495662_0037834_214_1317 360
807 3300046492 Ga0495585_0066062 Ga0495585_0066062_597_1682 360
808 3300046492 Ga0495585_0106093 Ga0495585_0106093_101_1186 360
809 3300046501 Ga0495607_0127700 Ga0495607_0127700_72_1154 360
810 3300046506 Ga0495583_0051972 Ga0495583_0051972_151_1236 360
811 3300046506 Ga0495583_0076388 Ga0495583_0076388_28_1113 360
812 3300046507 Ga0495606_0002073 Ga0495606_0002073_4581_5663 360
813 3300046507 Ga0495606_0029987 Ga0495606_0029987_1777_2859 360
814 3300046515 Ga0495620_0028632 Ga0495620_0028632_1160_2242 360
815 3300046518 Ga0495631_0080968 Ga0495631_0080968_26_1111 360
816 3300046519 Ga0495632_0050841 Ga0495632_0050841_32_1114 360
817 3300046522 Ga0495643_0027844 Ga0495643_0027844_1986_3071 360
818 3300046522 Ga0495643_0078683 Ga0495643_0078683_303_1385 360
819 3300046530 Ga0495654_0003690 Ga0495654_0003690_124_1227 360
820 3300046557 Ga0495622_0046432 Ga0495622_0046432_567_1670 360
821 3300046616 Ga0495668_0006310 Ga0495668_0006310_6407_7492 360
822 3300046648 Ga0495611_0041726 Ga0495611_0041726_476_1561 360
823 3300046660 Ga0495625_0038361 Ga0495625_0038361_2294_3376 360
824 3300046660 Ga0495625_0119427 Ga0495625_0119427_297_1382 360
825 3300046660 Ga0495625_0185123 Ga0495625_0185123_119_1204 360
826 3300046663 Ga0495635_0142511 Ga0495635_0142511_167_1270 360
827 3300046683 Ga0495658_0054226 Ga0495658_0054226_490_1593 360
828 3300046694 Ga0495649_0103253 Ga0495649_0103253_176_1258 360
829 3300046810 Ga0495660_0071744 Ga0495660_0071744_491_1573 360
830 3300047317 Ga0495604_0013679 Ga0495604_0013679_4942_6045 360
831 3300047443 Ga0495687_068952 Ga0495687_068952_252_1334 360
832 3300047472 Ga0495686_0002178 Ga0495686_0002178_2166_3248 360
833 3300047472 Ga0495686_0005411 Ga0495686_0005411_6353_7435 360
834 3300048909 Ga0496106_0000478 Ga0496106_0000478_8009_9094 360
835 3300048914 Ga0496111_0003975 Ga0496111_0003975_257_1339 360
836 3300048917 Ga0496114_0335013 Ga0496114_0335013_10_1092 360
837 3300048919 Ga0496116_0083325 Ga0496116_0083325_515_1597 360
838 3300048919 Ga0496116_0097864 Ga0496116_0097864_22_1128 360
839 3300048919 Ga0496116_0101076 Ga0496116_0101076_518_1600 360
840 3300048920 Ga0496117_0011144 Ga0496117_0011144_6677_7783 360
841 3300048921 Ga0496118_0071214 Ga0496118_0071214_690_1772 360
842 3300048921 Ga0496118_0109262 Ga0496118_0109262_517_1602 360
843 3300048922 Ga0496119_0023760 Ga0496119_0023760_2243_3349 360
844 3300048924 Ga0496121_0000001 Ga0496121_0000001_1716242_1717348 360
845 3300048924 Ga0496121_0005949 Ga0496121_0005949_387_1475 360
846 3300048924 Ga0496121_0009598 Ga0496121_0009598_246_1328 360
847 3300048924 Ga0496121_0010507 Ga0496121_0010507_2454_3539 360
848 3300048924 Ga0496121_0081738 Ga0496121_0081738_124_1206 360
849 3300048924 Ga0496121_0087328 Ga0496121_0087328_1099_2184 360
850 3300048925 Ga0496122_0052212 Ga0496122_0052212_107_1192 360
851 3300048925 Ga0496122_0100963 Ga0496122_0100963_627_1709 360
852 3300048925 Ga0496122_0118521 Ga0496122_0118521_364_1449 360
853 3300048926 Ga0496123_0000032 Ga0496123_0000032_271051_272154 360
854 3300048926 Ga0496123_0005232 Ga0496123_0005232_10906_11988 360
855 3300048926 Ga0496123_0076430 Ga0496123_0076430_866_1972 360
856 3300048927 Ga0496124_0004853 Ga0496124_0004853_10334_11416 360
857 3300048927 Ga0496124_0093699 Ga0496124_0093699_1126_2211 360
858 3300048927 Ga0496124_0127798 Ga0496124_0127798_304_1386 360
859 3300048927 Ga0496124_0231886 Ga0496124_0231886_86_1192 360
860 3300048928 Ga0496125_0000155 Ga0496125_0000155_26979_28085 360
861 3300048928 Ga0496125_0053841 Ga0496125_0053841_1846_2931 360
862 3300048929 Ga0496126_0052656 Ga0496126_0052656_190_1296 360
863 3300049571 Ga0501034_0254277 Ga0501034_0254277_245_1330 360
864 3300049572 Ga0501036_0201895 Ga0501036_0201895_322_1407 360
865 3300049573 Ga0501037_0154721 Ga0501037_0154721_356_1441 360
866 3300049822 Ga0501035_0208503 Ga0501035_0208503_48_1133 360
867 3300050491 nmdc:mga00v17_203_c1 nmdc:mga00v17_203_c1_12512_13600 360
868 3300050491 nmdc:mga00v17_68969_c1 nmdc:mga00v17_68969_c1_778_1884 360
869 3300053125 Ga0500618_009375 Ga0500618_009375_874_1962 360
870 3300053125 Ga0500618_018902 Ga0500618_018902_180_1274 360
871 3300053134 Ga0500658_0000485 Ga0500658_0000485_10263_11345 360
872 3300053134 Ga0500658_0012162 Ga0500658_0012162_2037_3122 360
873 3300053139 Ga0500568_0003249 Ga0500568_0003249_226_1311 360
874 3300053142 Ga0500577_0078061 Ga0500577_0078061_198_1280 360
875 3300053153 Ga0500616_0002587 Ga0500616_0002587_5208_6293 360
876 3300053153 Ga0500616_0011140 Ga0500616_0011140_3839_4921 360
877 3300053156 Ga0500622_0000778 Ga0500622_0000778_18162_19247 360
878 3300053156 Ga0500622_0039798 Ga0500622_0039798_1190_2272 360
879 iso_pu_bacteria 2510461076 2510899441 360
880 iso_pu_bacteria 2515154113 2515633798 360
881 iso_pu_bacteria 2515154114 2515645037 360
882 iso_pu_bacteria 2515154116 2515660179 360
883 iso_pu_bacteria 2516143018 2516209510 360
884 iso_pu_bacteria 2516653085 2517076162 360
885 iso_pu_bacteria 2585427526 2585528318 360
886 iso_pu_bacteria 2657244999 2657683822 360
887 iso_pu_bacteria 2724679232 2725948736 360
888 iso_pu_bacteria 2751185821 2753458334 360
889 iso_pu_bacteria 2802429268 2804752085 360
890 iso_pu_bacteria 2933570622 2933576555 360
891 iso_pu_bacteria 643692032 643825785 360
892 iso_pu_bacteria 8005556819 8005557982 360
893 iso_pu_bacteria 8005563573 8005569155 360
894 iso_pu_bacteria 8057874678 8057875342 360
895 3300001979 JGI24740J21852_10001389 JGI24740J21852_100013899 361
896 3300002704 JGI25155J39150_1000011 JGI25155J39150_1000011192 361
897 3300002705 JGI25156J39149_1000030 JGI25156J39149_1000030106 361
898 3300002738 JGI25154J39366_1000289 JGI25154J39366_100028914 361
899 3300002741 JGI25157J39369_1000010 JGI25157J39369_100001020 361
900 3300002987 JGI25159J45721_1001806 JGI25159J45721_10018062 361
901 3300003214 JGI25165J46597_1006781 JGI25165J46597_10067811 361
902 3300003354 JGI25160J50197_1000004 JGI25160J50197_100000424 361
903 3300003374 JGI25161J50226_1000003 JGI25161J50226_1000003404 361
904 3300004625 Ga0055543_1000001 Ga0055543_1000001410 361
905 3300005548 Ga0070665_100107355 Ga0070665_1001073552 361
906 3300005563 Ga0068855_100109341 Ga0068855_1001093414 361
907 3300005614 Ga0068856_100032523 Ga0068856_1000325232 361
908 3300009093 Ga0105240_10000005 Ga0105240_10000005400 361
909 3300009545 Ga0105237_10000773 Ga0105237_1000077322 361
910 3300010375 Ga0105239_10004008 Ga0105239_1000400817 361
911 3300013104 Ga0157370_10003013 Ga0157370_1000301317 361
912 3300015262 Ga0182007_10000618 Ga0182007_1000061814 361
913 3300015265 Ga0182005_1018412 Ga0182005_10184122 361
914 3300025206 Ga0209435_100022 Ga0209435_10002218 361
915 3300025233 Ga0209437_100122 Ga0209437_100122159 361
916 3300025233 Ga0209437_100160 Ga0209437_10016017 361
917 3300025246 Ga0209646_1000078 Ga0209646_100007818 361
918 3300025246 Ga0209646_1003812 Ga0209646_10038122 361
919 3300025250 Ga0209026_1000065 Ga0209026_100006518 361
920 3300025256 Ga0209759_1000055 Ga0209759_100005518 361
921 3300025261 Ga0209233_1000168 Ga0209233_1000168143 361
922 3300025261 Ga0209233_1000170 Ga0209233_1000170159 361
923 3300025261 Ga0209233_1001127 Ga0209233_10011275 361
924 3300025284 Ga0209130_1000012 Ga0209130_100001224 361
925 3300025302 Ga0207426_1000010 Ga0207426_1000010383 361
926 3300025913 Ga0207695_10000011 Ga0207695_10000011517 361
927 3300025914 Ga0207671_10004599 Ga0207671_1000459912 361
928 3300026078 Ga0207702_10009685 Ga0207702_100096856 361
929 3300028379 Ga0268266_10076615 Ga0268266_100766154 361
930 3300048920 Ga0496117_0002298 Ga0496117_0002298_9490_10575 361
931 3300048921 Ga0496118_0003956 Ga0496118_0003956_2578_3663 361
932 3300048922 Ga0496119_0012145 Ga0496119_0012145_1051_2136 361
933 3300048923 Ga0496120_0006355 Ga0496120_0006355_352_1437 361
934 3300048924 Ga0496121_0002309 Ga0496121_0002309_14453_15538 361
935 3300048925 Ga0496122_0012223 Ga0496122_0012223_2574_3659 361

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02547

Queuosine_synth

Queuosine biosynthesis protein

3

358

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fks-assembly1.cif.gz_D yeast f1 atpase in the absence of bound nucleotides 0.7441 72 147
6q45-assembly1.cif.gz_F f1-atpase from fusobacterium nucleatum 0.743 86 151
6re2-assembly1.cif.gz_X cryo-em structure of polytomella f-atp synthase, rotary substate 2b, composite map 0.7389 86 147
3oaa-assembly4.cif.gz_b structure of the e.coli f1-atp synthase inhibited by subunit epsilon 0.7344 86 151
6foc-assembly1.cif.gz_D f1-atpase from mycobacterium smegmatis 0.734 86 151
ID Description Score Start End Superfamily
1vkyA01 Alpha Beta;3-Layer(aba) Sandwich;QueA-like;QueA-like 0.9371 5 356 3.40.1780.10
1vkyA01 Alpha Beta;3-Layer(aba) Sandwich;QueA-like;QueA-like 0.9193 5 356 3.40.1780.10
af_P0A7F9_64_163_3.40.1780.10 Alpha Beta;3-Layer(aba) Sandwich;QueA-like;QueA-like 0.8244 66 178 3.40.1780.10
af_P0A7F9_64_163_3.40.1780.10 Alpha Beta;3-Layer(aba) Sandwich;QueA-like;QueA-like 0.8097 66 178 3.40.1780.10
1vkyA02 Mainly Beta;Beta Barrel;Thrombin, subunit H;QueA-like 0.7995 66 151 2.40.10.240
ID Description Score Start End GO Terms
AF-A0A4V1UHR0-F1-model_v4 tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA 0.9592 260 361 GO:0002099
GO:0005737
GO:0008616
GO:0051075
AF-A0A3D4QLI7-F1-model_v4 tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA 0.9585 219 361 GO:0002099
GO:0005737
GO:0008616
GO:0051075
AF-L1MKH9-F1-model_v4 S-adenosylmethionine:tRNA ribosyltransferase-isomerase 0.9573 247 357 GO:0002099
GO:0005737
GO:0008616
GO:0051075
AF-A0A3N5F0H8-F1-model_v4 tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA 0.9491 228 359 GO:0002099
GO:0005737
GO:0008616
GO:0051075
AF-A0A522W263-F1-model_v4 tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA 0.9486 247 360 GO:0002099
GO:0005737
GO:0008616
GO:0051075

Feature Viewer

pLDDT pTM Quality
84.05 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map