F486124

General Info

Members Datasets Scaffolds Average Seq Length
934 520 792 400

Family's Representative Sequence

Representative Sequence 3300025906|Ga0207699_10049705|Ga0207699_100497053
Length 409
Sequence MNSRSETSGEAFICEALRTPIGRYGGALAAVRADDLAAIPIAALLKRQPALDPAAIEEVILGCANQAGEDNRNVARMAALLAGLPTSVPGATVNRLCGSGLDAVAIAARAIRTGELQLAIAGGVESMSRAPFVIPKSDSAFSRNAEIFDTTIGWRFVNPRLKERYGIDSMPETGENVAAQFNIARADQDRFALRSQQRAAAAAARGLFASELTPVEIPQRKGKPPLVVARDEHPRPETTLEQLASLPTPFRANGTVTAGNASGVNDGACALLLASAEAARRWNLTPRARIVAAATAGVEPRIMGMGPVPATRKVLALAHLSLAQLDTIELNEAFASQALAVLRELGLPDDAAHVNPNGGAIALGHPLGMSGARLATTAIWQLQASGGRYALCTMCIGVGQGIAMVLERV

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2508501050 Microvirga lupini Lut6 Isolate Nodule
4 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
5 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
6 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
7 2511231006 Pseudomonas sp. GM17 Isolate Nodule
8 2511231024 Pseudomonas sp. GM84 Isolate Nodule
9 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
10 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
11 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
12 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
13 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
14 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
15 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
16 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
17 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
18 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
19 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
20 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
21 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
22 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
23 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
24 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
25 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
26 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
27 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
28 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
29 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
30 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
31 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
32 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
33 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
34 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
35 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
36 2643221557 Ensifer sp. Root558 Isolate Unclassified
37 2643221558 Rhizobium sp. Root149 Isolate Unclassified
38 2643221599 Rhizobium sp. Root708 Isolate Unclassified
39 2643221610 Ensifer sp. Root74 Isolate Unclassified
40 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
41 2643221668 Ensifer sp. Root423 Isolate Unclassified
42 2643221675 Ensifer sp. Root1298 Isolate Unclassified
43 2643221680 Ensifer sp. Root1312 Isolate Unclassified
44 2643221723 Ensifer sp. Root278 Isolate Unclassified
45 2643221726 Ensifer sp. Root954 Isolate Unclassified
46 2643221736 Bosea sp. Root483D1 Isolate Unclassified
47 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
48 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
49 2738541297 Duganella sp. GV083 Isolate Unclassified
50 2738541357 Duganella sp. GV053 Isolate Unclassified
51 2738543003 Duganella sp. GV066 Isolate Unclassified
52 2738543026 Duganella sp. GV089 Isolate Unclassified
53 2738543029 Duganella sp. GV039 Isolate Unclassified
54 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
55 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
56 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
57 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
58 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
59 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
60 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
61 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
62 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
63 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
64 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
65 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
66 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
67 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
68 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
69 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
70 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
71 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
72 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
73 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
74 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
75 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
76 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
77 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
78 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
79 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
80 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
81 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
82 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
83 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
84 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
85 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
86 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
87 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
88 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
89 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
90 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
91 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
92 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
93 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
94 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
95 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
96 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
97 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
98 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
99 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
100 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
101 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
102 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
103 2919476304 Duganella sp. 3397 Isolate Unclassified
104 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
105 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
106 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
107 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
108 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
109 2937539931 Pantoea sp. LS15 Isolate Unclassified
110 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
111 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
112 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
113 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
114 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
115 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
116 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
117 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
118 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
119 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
120 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
121 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
122 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
123 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
124 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
125 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
126 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
127 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
128 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
129 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
130 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
131 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
132 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
133 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
134 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
135 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
136 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
137 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
138 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
139 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
140 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
141 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
142 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
143 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
144 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
145 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
146 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
147 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
149 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
150 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
151 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
152 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
153 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
154 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
155 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
156 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
157 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
158 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
159 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
160 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
161 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
162 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
163 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
164 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
165 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
166 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
167 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
168 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
169 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
170 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
171 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
172 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
173 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
174 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
175 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
176 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
177 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
178 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
179 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
180 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
181 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
182 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
183 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
184 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
185 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
186 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
187 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
188 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
189 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
190 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
191 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
192 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
193 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
194 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
195 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
196 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
197 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
198 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
199 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
200 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
201 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
202 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
203 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
204 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
205 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
206 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
207 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
208 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
209 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
210 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
211 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
212 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
213 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
214 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
215 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
216 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
217 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
218 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
219 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
220 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
221 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
222 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
223 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
224 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
225 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
226 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
227 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
228 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
229 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
230 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
231 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
232 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
233 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
234 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
235 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
236 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
238 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
240 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
241 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
242 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
243 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
244 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
245 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
246 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
247 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
248 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
249 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
250 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
251 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
252 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
253 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
254 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
255 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
300 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
302 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
306 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
307 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
308 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
309 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
310 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
311 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
312 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
313 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
314 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
315 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
316 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
317 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
318 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
319 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
320 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
321 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
322 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
323 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
324 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
325 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
326 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
327 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
328 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
329 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
330 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
331 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
332 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
333 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
334 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
335 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
336 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
337 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
338 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
339 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
340 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
341 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
342 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
343 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
344 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
345 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
346 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
347 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
348 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
349 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
350 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
351 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
352 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
353 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
354 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
355 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
356 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
357 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
358 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
359 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
360 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
361 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
362 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
363 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
364 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
365 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
366 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
367 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
368 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
369 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
370 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
371 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
372 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
373 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
374 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
375 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
376 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
377 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
378 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
379 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
380 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
381 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
382 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
383 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
384 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
385 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
386 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
387 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
388 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
389 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
390 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
391 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
392 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
393 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
394 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
395 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
396 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
397 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
398 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
399 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
400 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
401 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
402 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
403 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
404 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
405 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
406 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
407 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
408 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
409 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
410 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
411 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
412 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
413 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
414 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
415 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
416 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
417 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
418 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
419 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
420 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
421 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
422 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
423 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
424 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
425 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
426 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
427 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
428 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
429 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
430 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
431 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
432 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
433 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
434 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
435 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
436 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
437 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
438 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
439 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
440 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
441 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
442 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
443 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
444 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
445 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
446 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
447 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
448 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
449 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
450 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
451 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
452 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
453 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
454 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
455 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
456 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
457 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
458 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
459 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
460 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
461 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
462 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
463 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
464 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
465 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
466 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
467 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
468 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
469 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
470 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
471 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
472 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
473 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
474 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
475 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
476 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
477 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
478 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
479 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
480 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
481 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
482 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
483 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
484 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
485 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
486 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
487 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
488 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
489 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
490 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
491 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
492 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
493 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
494 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
495 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
496 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
497 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
498 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
499 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
500 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
501 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
502 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
503 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
504 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
505 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
506 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
507 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
508 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
509 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
510 639633007 Azoarcus olearius BH72 Isolate Unclassified
511 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
512 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
513 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
514 8005258706 Rhizobium sp. R693 Isolate Nodule
515 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
516 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
517 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
518 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
519 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
520 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.58
Metatranscriptomes 0.21
Isolates 15.2

Biome Distribution

Category Percentage (%)
Aerial Root 0.11
Bulb 0
Endosphere 8.46
Nodule 5.57
Rhizoplane 3.21
Rhizosphere 69.16
Stem 0
Stem Tuber 0.11
Unclassified 13.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_1767 2124908027 Bacteria 19337
2 MRS2a_Contig_1768 2124908027 Bacteria 8639
3 MRS2a_Contig_70 2124908027 Bacteria 29249
4 SwRhRL2b_contig_1954747 2162886007 Bacteria 6272
5 JGI25155J39150_1000048 3300002704 Bacteria 78968
6 JGI25155J39150_1000162 3300002704 Bacteria 29967
7 JGI25156J39149_1000068 3300002705 Bacteria 81397
8 JGI25156J39149_1005786 3300002705 Bacteria 3500
9 JGI25162J39368_1006021 3300002737 Bacteria 2193
10 JGI25154J39366_1000066 3300002738 Bacteria 103361
11 JGI25154J39366_1000084 3300002738 Bacteria 88167
12 JGI25157J39369_1000097 3300002741 Bacteria 74420
13 JGI25159J45721_1000454 3300002987 Bacteria 18937
14 JGI25151J46595_10016628 3300003187 Bacteria 3212
15 rootH1_10037457 3300003316 Bacteria 3996
16 JGI25160J50197_1000005 3300003354 Bacteria 417280
17 JGI25160J50197_1000014 3300003354 Bacteria 259862
18 JGI25161J50226_1000022 3300003374 Bacteria 158544
19 JGI25161J50226_1000349 3300003374 Bacteria 24501
20 Ga0055532_1000015 3300003758 Bacteria 340197
21 Ga0055526_1007416 3300003771 Bacteria 5701
22 Ga0055537_1001060 3300003773 Bacteria 12288
23 Ga0055524_1002559 3300003775 Bacteria 9280
24 Ga0055524_1012855 3300003775 Bacteria 3191
25 Ga0055524_1030908 3300003775 Bacteria 1551
26 Ga0055536_1000014 3300003781 Bacteria 240624
27 Ga0055534_1000072 3300003784 Bacteria 78212
28 Ga0055528_1000043 3300003790 Bacteria 103664
29 Ga0055528_1006829 3300003790 Bacteria 5128
30 Ga0055530_10000009 3300003791 Bacteria 174044
31 Ga0055540_1000342 3300003792 Bacteria 39754
32 Ga0055543_1000005 3300004625 Bacteria 223621
33 Ga0055543_1000082 3300004625 Bacteria 83659
34 Ga0055543_1002336 3300004625 Bacteria 6359
35 Ga0058861_11837734 3300004800 Bacteria 1344
36 Ga0065165_1000002 3300005262 Bacteria 444192
37 Ga0065165_1000187 3300005262 Bacteria 108694
38 Ga0065165_1000463 3300005262 Bacteria 63644
39 Ga0065714_10000917 3300005288 Bacteria 19048
40 Ga0070683_100000407 3300005329 Bacteria 29702
41 Ga0070683_100012192 3300005329 Bacteria 7461
42 Ga0070683_100111389 3300005329 Bacteria 2582
43 Ga0070683_100140509 3300005329 Bacteria 2288
44 Ga0070690_100012887 3300005330 Bacteria 4928
45 Ga0070670_100001173 3300005331 Bacteria 20806
46 Ga0070670_100024696 3300005331 Bacteria 5169
47 Ga0070666_10004887 3300005335 Bacteria 8193
48 Ga0070666_10015348 3300005335 Bacteria 4884
49 Ga0070666_10029975 3300005335 Bacteria 3581
50 Ga0070680_100003368 3300005336 Bacteria 11929
51 Ga0070680_100013212 3300005336 Bacteria 6427
52 Ga0070680_100056113 3300005336 Bacteria 3219
53 Ga0070680_100088865 3300005336 Bacteria 2556
54 Ga0068868_100002348 3300005338 Bacteria 13095
55 Ga0068868_100004425 3300005338 Bacteria 9854
56 Ga0068868_100005551 3300005338 Bacteria 8872
57 Ga0070691_10000505 3300005341 Bacteria 14641
58 Ga0070669_100041490 3300005353 Bacteria 3346
59 Ga0070671_100016932 3300005355 Bacteria 5895
60 Ga0070671_100028433 3300005355 Bacteria 4604
61 Ga0070671_100031183 3300005355 Bacteria 4403
62 Ga0070667_100000046 3300005367 Bacteria 162942
63 Ga0070667_100022349 3300005367 Bacteria 5246
64 Ga0070667_100061990 3300005367 Bacteria 3167
65 Ga0070667_100226934 3300005367 Bacteria 1664
66 Ga0070714_100000679 3300005435 Bacteria 24018
67 Ga0070714_100086560 3300005435 Bacteria 2738
68 Ga0070714_100130594 3300005435 Bacteria 2245
69 Ga0070714_100341774 3300005435 Bacteria 1404
70 Ga0070713_100008248 3300005436 Bacteria 7384
71 Ga0070713_100022654 3300005436 Bacteria 4857
72 Ga0070713_100088383 3300005436 Bacteria 2659
73 Ga0070662_100118561 3300005457 Bacteria 2026
74 Ga0070681_10000278 3300005458 Bacteria 40975
75 Ga0070681_10005588 3300005458 Bacteria 12144
76 Ga0070681_10008207 3300005458 Bacteria 10218
77 Ga0070681_10030852 3300005458 Bacteria 5380
78 Ga0070681_10076711 3300005458 Bacteria 3300
79 Ga0070681_10084359 3300005458 Bacteria 3129
80 Ga0068867_100014256 3300005459 Bacteria 5630
81 Ga0068867_100166422 3300005459 Bacteria 1743
82 Ga0070706_100040154 3300005467 Bacteria 4319
83 Ga0070699_100039576 3300005518 Bacteria 4081
84 Ga0070679_100010630 3300005530 Bacteria 8735
85 Ga0070679_100011761 3300005530 Bacteria 8343
86 Ga0070679_100039079 3300005530 Bacteria 4716
87 Ga0070679_100059190 3300005530 Bacteria 3818
88 Ga0070679_100078890 3300005530 Bacteria 3282
89 Ga0070679_100113034 3300005530 Bacteria 2701
90 Ga0070684_100000856 3300005535 Bacteria 21482
91 Ga0070684_100057257 3300005535 Bacteria 3403
92 Ga0070697_100032440 3300005536 Bacteria 4203
93 Ga0068853_100128029 3300005539 Bacteria 2270
94 Ga0070695_100059472 3300005545 Bacteria 2474
95 Ga0070665_100001514 3300005548 Bacteria 26960
96 Ga0070665_100010456 3300005548 Bacteria 9390
97 Ga0070665_100038832 3300005548 Bacteria 4786
98 Ga0070665_100039405 3300005548 Bacteria 4751
99 Ga0070665_100139058 3300005548 Bacteria 2432
100 Ga0068855_100000946 3300005563 Bacteria 36185
101 Ga0068855_100004315 3300005563 Bacteria 17384
102 Ga0068855_100010388 3300005563 Bacteria 11229
103 Ga0068855_100332226 3300005563 Bacteria 1678
104 Ga0068855_100409240 3300005563 Bacteria 1485
105 Ga0070664_100225222 3300005564 Bacteria 1679
106 Ga0068857_100000139 3300005577 Bacteria 44602
107 Ga0068857_100015494 3300005577 Bacteria 6660
108 Ga0068854_100085487 3300005578 Bacteria 2336
109 Ga0068856_100001980 3300005614 Bacteria 21357
110 Ga0068856_100003335 3300005614 Bacteria 16308
111 Ga0068856_100011282 3300005614 Bacteria 8672
112 Ga0068856_100066173 3300005614 Bacteria 3571
113 Ga0068856_100079057 3300005614 Bacteria 3261
114 Ga0068852_100009656 3300005616 Bacteria 7169
115 Ga0068852_100026807 3300005616 Bacteria 4690
116 Ga0068852_100062674 3300005616 Bacteria 3235
117 Ga0068859_100007848 3300005617 Bacteria 10832
118 Ga0068859_100057855 3300005617 Bacteria 3905
119 Ga0068859_100178947 3300005617 Bacteria 2203
120 Ga0068863_100001619 3300005841 Bacteria 22229
121 Ga0068863_100015117 3300005841 Bacteria 7414
122 Ga0068863_100042715 3300005841 Bacteria 4308
123 Ga0068863_100100625 3300005841 Bacteria 2747
124 Ga0068858_100000996 3300005842 Bacteria 29246
125 Ga0068858_100003356 3300005842 Bacteria 15940
126 Ga0068858_100166497 3300005842 Bacteria 2077
127 Ga0068860_100002939 3300005843 Bacteria 17616
128 Ga0068860_100003553 3300005843 Bacteria 16033
129 Ga0068860_100022586 3300005843 Bacteria 6082
130 Ga0068860_100034234 3300005843 Bacteria 4871
131 Ga0068860_100186876 3300005843 Bacteria 2004
132 Ga0068860_100357648 3300005843 Bacteria 1438
133 Ga0068862_100098962 3300005844 Bacteria 2548
134 Ga0068862_100106478 3300005844 Bacteria 2458
135 Ga0081455_10000002 3300005937 Bacteria 460472
136 Ga0081455_10000075 3300005937 Bacteria 106313
137 Ga0081539_10000123 3300005985 Bacteria 181245
138 Ga0070717_10022763 3300006028 Bacteria 4956
139 Ga0075364_10000122 3300006051 Bacteria 32120
140 Ga0075364_10009211 3300006051 Bacteria 5917
141 Ga0070715_10025500 3300006163 Bacteria 2343
142 Ga0070716_100005359 3300006173 Bacteria 6204
143 Ga0070712_100001354 3300006175 Bacteria 14871
144 Ga0070712_100018344 3300006175 Bacteria 4544
145 Ga0075367_10000065 3300006178 Bacteria 26310
146 Ga0075367_10106018 3300006178 Bacteria 1722
147 Ga0097621_100003036 3300006237 Bacteria 11528
148 Ga0097621_100023168 3300006237 Bacteria 4831
149 Ga0097621_100041334 3300006237 Bacteria 3711
150 Ga0097621_100139274 3300006237 Bacteria 2072
151 Ga0075370_10045293 3300006353 Bacteria 2488
152 Ga0068871_100003128 3300006358 Bacteria 11356
153 Ga0068871_100006989 3300006358 Bacteria 8043
154 Ga0068871_100007934 3300006358 Bacteria 7611
155 Ga0075433_10140160 3300006852 Bacteria 2149
156 Ga0068865_100000854 3300006881 Bacteria 17259
157 Ga0068865_100003193 3300006881 Bacteria 9812
158 Ga0075436_100048012 3300006914 Bacteria 2946
159 Ga0075436_100067416 3300006914 Bacteria 2473
160 Ga0097620_100007848 3300006931 Bacteria 10832
161 Ga0097620_100057855 3300006931 Bacteria 3905
162 Ga0097620_100178950 3300006931 Bacteria 2203
163 Ga0079104_1000243 3300006946 Bacteria 72656
164 Ga0079104_1011586 3300006946 Bacteria 2825
165 Ga0099794_10021173 3300007265 Bacteria 2952
166 Ga0099794_10027462 3300007265 Bacteria 2638
167 Ga0105251_10001382 3300009011 Bacteria 20993
168 Ga0105251_10008811 3300009011 Bacteria 6046
169 Ga0105251_10073173 3300009011 Bacteria 1593
170 Ga0105244_10003953 3300009036 Bacteria 10397
171 Ga0105244_10031082 3300009036 Bacteria 2835
172 Ga0105250_10000059 3300009092 Bacteria 109549
173 Ga0105250_10001065 3300009092 Bacteria 15652
174 Ga0105250_10046057 3300009092 Bacteria 1748
175 Ga0105240_10000721 3300009093 Bacteria 60541
176 Ga0105240_10002166 3300009093 Bacteria 32053
177 Ga0105240_10005036 3300009093 Bacteria 19826
178 Ga0105240_10006325 3300009093 Bacteria 17434
179 Ga0105240_10012887 3300009093 Bacteria 11513
180 Ga0105240_10058545 3300009093 Bacteria 4810
181 Ga0105240_10095545 3300009093 Bacteria 3624
182 Ga0105240_10215450 3300009093 Bacteria 2241
183 Ga0105240_10409042 3300009093 Bacteria 1526
184 Ga0111539_10000107 3300009094 Bacteria 89993
185 Ga0105245_10002527 3300009098 Bacteria 16491
186 Ga0105245_10003212 3300009098 Bacteria 14632
187 Ga0105245_10018741 3300009098 Bacteria 6055
188 Ga0105245_10019040 3300009098 Bacteria 6008
189 Ga0105245_10102026 3300009098 Bacteria 2656
190 Ga0105247_10010886 3300009101 Bacteria 5495
191 Ga0105247_10016238 3300009101 Bacteria 4460
192 Ga0105247_10026517 3300009101 Bacteria 3500
193 Ga0105243_10079262 3300009148 Bacteria 2676
194 Ga0105241_10000274 3300009174 Bacteria 38434
195 Ga0105241_10000595 3300009174 Bacteria 27201
196 Ga0105241_10032378 3300009174 Bacteria 3919
197 Ga0105241_10047004 3300009174 Bacteria 3280
198 Ga0105241_10115502 3300009174 Bacteria 2155
199 Ga0105242_10001176 3300009176 Bacteria 20604
200 Ga0105242_10017229 3300009176 Bacteria 5625
201 Ga0105242_10022525 3300009176 Bacteria 4957
202 Ga0105248_10002359 3300009177 Bacteria 20966
203 Ga0105248_10003426 3300009177 Bacteria 17619
204 Ga0105248_10051703 3300009177 Bacteria 4610
205 Ga0105248_10286623 3300009177 Bacteria 1854
206 Ga0105248_10351867 3300009177 Bacteria 1658
207 Ga0105237_10004017 3300009545 Bacteria 17192
208 Ga0105237_10193993 3300009545 Bacteria 2031
209 Ga0105238_10001117 3300009551 Bacteria 27102
210 Ga0105238_10003110 3300009551 Bacteria 16554
211 Ga0105238_10006903 3300009551 Bacteria 11339
212 Ga0105238_10009735 3300009551 Bacteria 9624
213 Ga0105238_10046694 3300009551 Bacteria 4368
214 Ga0105238_10193557 3300009551 Bacteria 2009
215 Ga0105249_10026594 3300009553 Bacteria 5217
216 Ga0105239_10002184 3300010375 Bacteria 25162
217 Ga0105239_10005500 3300010375 Bacteria 14848
218 Ga0105239_10011109 3300010375 Bacteria 10050
219 Ga0105239_10029023 3300010375 Bacteria 6081
220 Ga0105239_10033015 3300010375 Bacteria 5685
221 Ga0105239_10045243 3300010375 Bacteria 4824
222 Ga0105239_10190021 3300010375 Bacteria 2299
223 Ga0105239_10207182 3300010375 Bacteria 2197
224 Ga0105246_10008333 3300011119 Bacteria 6369
225 Ga0105246_10072511 3300011119 Bacteria 2428
226 Ga0157371_10015446 3300013102 Bacteria 5726
227 Ga0157370_10002686 3300013104 Bacteria 21320
228 Ga0157370_10015891 3300013104 Bacteria 7638
229 Ga0157370_10177484 3300013104 Bacteria 1980
230 Ga0157369_10005407 3300013105 Bacteria 14866
231 Ga0157369_10024762 3300013105 Bacteria 6668
232 Ga0157369_10045001 3300013105 Bacteria 4802
233 Ga0157369_10090441 3300013105 Bacteria 3268
234 Ga0157369_10259330 3300013105 Bacteria 1813
235 Ga0157374_10005928 3300013296 Bacteria 10326
236 Ga0157374_10032993 3300013296 Bacteria 4721
237 Ga0157374_10064220 3300013296 Bacteria 3444
238 Ga0157378_10000037 3300013297 Bacteria 117305
239 Ga0157378_10006931 3300013297 Bacteria 9894
240 Ga0157378_10052411 3300013297 Bacteria 3630
241 Ga0163162_10054706 3300013306 Bacteria 4015
242 Ga0157372_10164098 3300013307 Bacteria 2568
243 Ga0157372_10171737 3300013307 Bacteria 2508
244 Ga0163163_10117984 3300014325 Bacteria 2686
245 Ga0157380_10242171 3300014326 Bacteria 1627
246 Ga0182008_10050005 3300014497 Bacteria 2074
247 Ga0157379_10039188 3300014968 Bacteria 4227
248 Ga0157379_10114627 3300014968 Bacteria 2422
249 Ga0157376_10000094 3300014969 Bacteria 67036
250 Ga0157376_10032475 3300014969 Bacteria 4192
251 Ga0157376_10053068 3300014969 Bacteria 3374
252 Ga0182006_1000010 3300015261 Bacteria 413414
253 Ga0182006_1000055 3300015261 Bacteria 173139
254 Ga0182007_10000030 3300015262 Bacteria 156866
255 Ga0182005_1000003 3300015265 Bacteria 683269
256 Ga0182005_1000009 3300015265 Bacteria 455334
257 Ga0213872_10000523 3300021361 Bacteria 30011
258 Ga0213872_10011662 3300021361 Bacteria 4155
259 Ga0213872_10013790 3300021361 Bacteria 3780
260 Ga0213872_10039873 3300021361 Bacteria 2143
261 Ga0213876_10107298 3300021384 Bacteria 1482
262 Ga0209435_100021 3300025206 Bacteria 223961
263 Ga0209435_100074 3300025206 Bacteria 55837
264 Ga0209436_100869 3300025208 Bacteria 12075
265 Ga0209147_100004 3300025229 Bacteria 1371850
266 Ga0209437_100045 3300025233 Bacteria 429809
267 Ga0209258_100083 3300025242 Bacteria 246008
268 Ga0209646_1000057 3300025246 Bacteria 266384
269 Ga0209646_1000074 3300025246 Bacteria 223961
270 Ga0209026_1000058 3300025250 Bacteria 228656
271 Ga0209759_1000046 3300025256 Bacteria 230149
272 Ga0209759_1000112 3300025256 Bacteria 143361
273 Ga0209129_1003788 3300025258 Bacteria 6348
274 Ga0209565_1000006 3300025263 Bacteria 897294
275 Ga0209455_1008156 3300025272 Bacteria 2875
276 Ga0209673_1000004 3300025273 Bacteria 896155
277 Ga0209673_1016330 3300025273 Bacteria 2781
278 Ga0209673_1018668 3300025273 Bacteria 2513
279 Ga0209130_1000010 3300025284 Bacteria 444920
280 Ga0209130_1000013 3300025284 Bacteria 412810
281 Ga0209130_1000191 3300025284 Bacteria 85239
282 Ga0209675_1000006 3300025291 Bacteria 732267
283 Ga0209676_1000003 3300025292 Bacteria 1454178
284 Ga0209676_1006358 3300025292 Bacteria 5854
285 Ga0209025_1000687 3300025294 Bacteria 58005
286 Ga0209025_1010541 3300025294 Bacteria 6252
287 Ga0209564_1000025 3300025295 Bacteria 520535
288 Ga0209564_1000085 3300025295 Bacteria 251509
289 Ga0209564_1001631 3300025295 Bacteria 21730
290 Ga0209564_1020303 3300025295 Bacteria 2438
291 Ga0209050_1000004 3300025298 Bacteria 1600040
292 Ga0209256_1000037 3300025299 Bacteria 377661
293 Ga0209256_1000320 3300025299 Bacteria 82751
294 Ga0209256_1002250 3300025299 Bacteria 16402
295 Ga0209256_1009820 3300025299 Bacteria 4119
296 Ga0209256_1030930 3300025299 Bacteria 1471
297 Ga0207426_1000022 3300025302 Bacteria 547377
298 Ga0207426_1000036 3300025302 Bacteria 444920
299 Ga0207426_1001794 3300025302 Bacteria 16028
300 Ga0207426_1002644 3300025302 Bacteria 11044
301 Ga0209051_1000006 3300025303 Bacteria 1015785
302 Ga0209051_1039420 3300025303 Bacteria 1706
303 Ga0207696_1000005 3300025711 Bacteria 642078
304 Ga0207696_1002284 3300025711 Bacteria 9522
305 Ga0207696_1014942 3300025711 Bacteria 2645
306 Ga0207713_1000002 3300025735 Bacteria 1061749
307 Ga0207713_1000501 3300025735 Bacteria 40333
308 Ga0207713_1018816 3300025735 Bacteria 3403
309 Ga0207642_10030714 3300025899 Bacteria 2242
310 Ga0207710_10014096 3300025900 Bacteria 3367
311 Ga0207710_10015856 3300025900 Bacteria 3187
312 Ga0207688_10033070 3300025901 Bacteria 2859
313 Ga0207688_10095460 3300025901 Bacteria 1711
314 Ga0207680_10001892 3300025903 Bacteria 9820
315 Ga0207699_10049705 3300025906 Bacteria 2469
316 Ga0207684_10268390 3300025910 Bacteria 1472
317 Ga0207654_10002301 3300025911 Bacteria 9797
318 Ga0207654_10004032 3300025911 Bacteria 7393
319 Ga0207654_10080279 3300025911 Bacteria 1961
320 Ga0207707_10000094 3300025912 Bacteria 89818
321 Ga0207707_10002920 3300025912 Bacteria 15246
322 Ga0207707_10003000 3300025912 Bacteria 15007
323 Ga0207707_10017442 3300025912 Bacteria 6259
324 Ga0207707_10018558 3300025912 Bacteria 6062
325 Ga0207707_10025363 3300025912 Bacteria 5186
326 Ga0207707_10085423 3300025912 Bacteria 2757
327 Ga0207707_10133024 3300025912 Bacteria 2175
328 Ga0207695_10000471 3300025913 Bacteria 87529
329 Ga0207695_10000776 3300025913 Bacteria 60540
330 Ga0207695_10010991 3300025913 Bacteria 10997
331 Ga0207695_10020093 3300025913 Bacteria 7662
332 Ga0207695_10028070 3300025913 Bacteria 6251
333 Ga0207695_10034697 3300025913 Bacteria 5482
334 Ga0207695_10042276 3300025913 Bacteria 4869
335 Ga0207695_10049827 3300025913 Bacteria 4410
336 Ga0207695_10058899 3300025913 Bacteria 3985
337 Ga0207695_10059123 3300025913 Bacteria 3977
338 Ga0207695_10140611 3300025913 Bacteria 2363
339 Ga0207671_10067008 3300025914 Bacteria 2673
340 Ga0207671_10125706 3300025914 Bacteria 1964
341 Ga0207693_10000245 3300025915 Bacteria 50171
342 Ga0207693_10015257 3300025915 Bacteria 6165
343 Ga0207693_10023591 3300025915 Bacteria 4884
344 Ga0207693_10046941 3300025915 Bacteria 3394
345 Ga0207693_10071257 3300025915 Bacteria 2720
346 Ga0207663_10058484 3300025916 Bacteria 2433
347 Ga0207663_10077898 3300025916 Bacteria 2159
348 Ga0207660_10185308 3300025917 Bacteria 1618
349 Ga0207660_10222041 3300025917 Bacteria 1483
350 Ga0207657_10003974 3300025919 Bacteria 15707
351 Ga0207649_10148192 3300025920 Bacteria 1613
352 Ga0207652_10014668 3300025921 Bacteria 6350
353 Ga0207652_10017165 3300025921 Bacteria 5921
354 Ga0207652_10090331 3300025921 Bacteria 2691
355 Ga0207694_10001821 3300025924 Bacteria 17755
356 Ga0207694_10006998 3300025924 Bacteria 8562
357 Ga0207694_10047733 3300025924 Bacteria 3312
358 Ga0207694_10077597 3300025924 Bacteria 2603
359 Ga0207694_10147527 3300025924 Bacteria 1894
360 Ga0207650_10000745 3300025925 Bacteria 25118
361 Ga0207687_10021803 3300025927 Bacteria 4258
362 Ga0207687_10126370 3300025927 Bacteria 1920
363 Ga0207700_10076405 3300025928 Bacteria 2599
364 Ga0207700_10111680 3300025928 Bacteria 2200
365 Ga0207664_10052053 3300025929 Bacteria 3236
366 Ga0207664_10186473 3300025929 Bacteria 1784
367 Ga0207664_10209203 3300025929 Bacteria 1687
368 Ga0207644_10005836 3300025931 Bacteria 8020
369 Ga0207644_10054521 3300025931 Bacteria 2880
370 Ga0207706_10114151 3300025933 Bacteria 2376
371 Ga0207686_10126294 3300025934 Bacteria 1748
372 Ga0207709_10057705 3300025935 Bacteria 2408
373 Ga0207670_10074848 3300025936 Bacteria 2352
374 Ga0207665_10001531 3300025939 Bacteria 15559
375 Ga0207665_10009385 3300025939 Bacteria 6420
376 Ga0207665_10022989 3300025939 Bacteria 4105
377 Ga0207691_10206589 3300025940 Bacteria 1708
378 Ga0207711_10020187 3300025941 Bacteria 5552
379 Ga0207711_10042882 3300025941 Bacteria 3857
380 Ga0207689_10003574 3300025942 Bacteria 14204
381 Ga0207661_10056496 3300025944 Bacteria 3151
382 Ga0207661_10066357 3300025944 Bacteria 2932
383 Ga0207661_10194725 3300025944 Bacteria 1779
384 Ga0207661_10242893 3300025944 Bacteria 1598
385 Ga0207667_10000399 3300025949 Bacteria 58694
386 Ga0207667_10001596 3300025949 Bacteria 28502
387 Ga0207667_10018532 3300025949 Bacteria 7804
388 Ga0207667_10061184 3300025949 Bacteria 3940
389 Ga0207712_10010235 3300025961 Bacteria 5947
390 Ga0207658_10000058 3300025986 Bacteria 122331
391 Ga0207658_10000493 3300025986 Bacteria 36279
392 Ga0207703_10000259 3300026035 Bacteria 59607
393 Ga0207703_10019229 3300026035 Bacteria 5335
394 Ga0207703_10356729 3300026035 Bacteria 1347
395 Ga0207639_10053821 3300026041 Bacteria 3073
396 Ga0207639_10389788 3300026041 Bacteria 1253
397 Ga0207678_10038195 3300026067 Bacteria 4173
398 Ga0207678_10046814 3300026067 Bacteria 3741
399 Ga0207678_10106260 3300026067 Bacteria 2395
400 Ga0207702_10011423 3300026078 Bacteria 7402
401 Ga0207702_10021345 3300026078 Bacteria 5360
402 Ga0207702_10032008 3300026078 Bacteria 4387
403 Ga0207641_10000196 3300026088 Bacteria 81985
404 Ga0207641_10002905 3300026088 Bacteria 15500
405 Ga0207641_10010473 3300026088 Bacteria 7614
406 Ga0207641_10035754 3300026088 Bacteria 4142
407 Ga0207648_10005986 3300026089 Bacteria 12160
408 Ga0207674_10000042 3300026116 Bacteria 126790
409 Ga0207674_10017528 3300026116 Bacteria 7813
410 Ga0207674_10050909 3300026116 Bacteria 4228
411 Ga0207683_10156324 3300026121 Bacteria 2060
412 Ga0209281_1000179 3300027111 Bacteria 148102
413 Ga0209281_1011946 3300027111 Bacteria 1926
414 Ga0209588_1007148 3300027671 Bacteria 3273
415 Ga0209588_1009766 3300027671 Bacteria 2872
416 Ga0207428_10000040 3300027907 Bacteria 210887
417 Ga0268266_10000512 3300028379 Bacteria 54629
418 Ga0268266_10003024 3300028379 Bacteria 17278
419 Ga0268266_10017708 3300028379 Bacteria 6071
420 Ga0268266_10024513 3300028379 Bacteria 5130
421 Ga0268266_10097277 3300028379 Bacteria 2589
422 Ga0268266_10180864 3300028379 Bacteria 1920
423 Ga0268265_10140521 3300028380 Bacteria 2021
424 Ga0268264_10000182 3300028381 Bacteria 134007
425 Ga0268264_10006165 3300028381 Bacteria 10125
426 Ga0268264_10036379 3300028381 Bacteria 4056
427 Ga0268264_10179163 3300028381 Bacteria 1923
428 Ga0265319_1001093 3300028563 Bacteria 16859
429 Ga0265318_10000259 3300028577 Bacteria 45975
430 Ga0307515_10015010 3300028794 Bacteria 14308
431 Ga0265338_10064956 3300028800 Bacteria 3170
432 Ga0307511_10000008 3300030521 Bacteria 159928
433 Ga0265332_10005055 3300031238 Bacteria 6122
434 Ga0265320_10000057 3300031240 Bacteria 104186
435 Ga0265325_10022067 3300031241 Bacteria 3490
436 Ga0265325_10036749 3300031241 Bacteria 2594
437 Ga0265329_10000235 3300031242 Bacteria 29416
438 Ga0265340_10010715 3300031247 Bacteria 4898
439 Ga0265340_10019722 3300031247 Bacteria 3470
440 Ga0265339_10045581 3300031249 Bacteria 2413
441 Ga0265331_10000041 3300031250 Bacteria 191831
442 Ga0265331_10007068 3300031250 Bacteria 6546
443 Ga0265316_10003938 3300031344 Bacteria 14877
444 Ga0307509_10000099 3300031507 Bacteria 121307
445 Ga0265313_10001609 3300031595 Bacteria 20973
446 Ga0265313_10015924 3300031595 Bacteria 4349
447 Ga0265314_10009866 3300031711 Bacteria 8013
448 Ga0265342_10000124 3300031712 Bacteria 85296
449 Ga0265342_10083331 3300031712 Bacteria 1843
450 Ga0307410_10232781 3300031852 Bacteria 1423
451 Ga0307416_100090149 3300032002 Bacteria 2628
452 Ga0307414_10142053 3300032004 Bacteria 1881
453 Ga0307411_10025255 3300032005 Bacteria 3557
454 Ga0307510_10000003 3300033180 Bacteria 756654
455 Ga0373926_0016824 3300035083 Bacteria 2506
456 Ga0373934_0002106 3300035086 Bacteria 7296
457 Ga0373923_0010433 3300035111 Bacteria 3378
458 Ga0373936_0000768 3300035113 Bacteria 11285
459 Ga0373939_0028085 3300035114 Bacteria 1599
460 Ga0373945_0037383 3300035116 Bacteria 1742
461 Ga0373954_0001458 3300035118 Bacteria 9602
462 Ga0373954_0003051 3300035118 Bacteria 7070
463 Ga0373954_0029875 3300035118 Bacteria 2512
464 Ga0373956_0000242 3300035119 Bacteria 21615
465 Ga0373946_0021451 3300035171 Bacteria 2505
466 Ga0373955_0016254 3300035172 Bacteria 3659
467 Ga0373955_0026367 3300035172 Bacteria 2993
468 Ga0373955_0112459 3300035172 Bacteria 1575
469 Ga0373924_0002488 3300035410 Bacteria 6192
470 Ga0373935_0182616 3300035692 Bacteria 1441
471 Ga0373935_0295051 3300035692 Bacteria 1144
472 Ga0373927_0032769 3300035695 Bacteria 3384
473 Ga0373927_0047483 3300035695 Bacteria 2777
474 Ga0373927_0058624 3300035695 Bacteria 2490
475 Ga0373933_0007183 3300035724 Bacteria 6069
476 Ga0373933_0084299 3300035724 Bacteria 1952
477 Ga0373933_0129967 3300035724 Bacteria 1583
478 Ga0373947_0033007 3300035725 Bacteria 3054
479 Ga0373947_0127092 3300035725 Bacteria 1624
480 Ga0373937_0023699 3300036401 Bacteria 5532
481 Ga0373937_0038961 3300036401 Bacteria 4330
482 Ga0373937_0097241 3300036401 Bacteria 2730
483 Ga0373925_0000300 3300037068 Bacteria 51846
484 Ga0373925_0012304 3300037068 Bacteria 6193
485 Ga0373925_0122088 3300037068 Bacteria 2023
486 Ga0373925_0129063 3300037068 Bacteria 1969
487 Ga0373925_0173869 3300037068 Bacteria 1701
488 Ga0395899_0000093 3300037312 Bacteria 153541
489 Ga0400490_25320 3300038726 Bacteria 33187
490 Ga0400491_04543 3300038727 Bacteria 2469
491 Ga0400487_32217 3300039110 Bacteria 35879
492 Ga0400487_61000 3300039110 Bacteria 27948
493 Ga0436365_0255902 3300039437 Bacteria 3958
494 Ga0436365_0268609 3300039437 Bacteria 3710
495 Ga0436365_1801098 3300039437 Bacteria 12302
496 Ga0436360_0201373 3300039438 Bacteria 6723
497 Ga0436360_0661826 3300039438 Bacteria 1505
498 Ga0436360_0721843 3300039438 Bacteria 2565
499 Ga0436361_0411839 3300039447 Bacteria 4454
500 Ga0436361_0590398 3300039447 Bacteria 11821
501 Ga0436361_0787586 3300039447 Bacteria 8153
502 Ga0436361_1186001 3300039447 Bacteria 4044
503 Ga0436363_1307392 3300039450 Bacteria 4051
504 Ga0436362_0935796 3300039453 Bacteria 2779
505 Ga0439452_000014 3300042010 Bacteria 344969
506 Ga0439463_000483 3300042016 Bacteria 11084
507 Ga0450920_015654 3300042122 Bacteria 1443
508 Ga0439464_0008277 3300042439 Bacteria 2726
509 Ga0451577_0001799 3300042876 Bacteria 27435
510 Ga0451577_0008240 3300042876 Bacteria 10156
511 Ga0466969_0004853 3300044656 Bacteria 7161
512 Ga0453683_0004409 3300044673 Bacteria 9994
513 Ga0466966_0001376 3300044684 Bacteria 15650
514 Ga0466961_0000376 3300044693 Bacteria 28754
515 Ga0466964_0002233 3300044706 Bacteria 6863
516 Ga0453684_0013054 3300044712 Bacteria 13565
517 Ga0466971_0000405 3300044719 Bacteria 16776
518 Ga0466970_0002295 3300044765 Bacteria 9250
519 Ga0466957_0024969 3300044842 Bacteria 3540
520 Ga0466959_0000875 3300045049 Bacteria 17741
521 Ga0466959_0003679 3300045049 Bacteria 10110
522 Ga0466959_0040113 3300045049 Bacteria 3459
523 Ga0466958_0045289 3300045836 Bacteria 2653
524 Ga0495617_000102 3300046452 Bacteria 61763
525 Ga0495592_0022246 3300046454 Bacteria 4822
526 Ga0495603_0087967 3300046455 Bacteria 1818
527 Ga0495638_0055259 3300046460 Bacteria 2466
528 Ga0495638_0067627 3300046460 Bacteria 2193
529 Ga0495651_0000348 3300046462 Bacteria 35669
530 Ga0495651_0013606 3300046462 Bacteria 6289
531 Ga0495651_0028066 3300046462 Bacteria 4387
532 Ga0495653_0004156 3300046463 Bacteria 11715
533 Ga0495653_0006412 3300046463 Bacteria 9646
534 Ga0495653_0135064 3300046463 Bacteria 1741
535 Ga0495650_0000005 3300046471 Bacteria 766553
536 Ga0495650_0005139 3300046471 Bacteria 8635
537 Ga0495650_0006809 3300046471 Bacteria 7049
538 Ga0495580_0002011 3300046472 Bacteria 17897
539 Ga0495580_0002088 3300046472 Bacteria 17538
540 Ga0495580_0019041 3300046472 Bacteria 5104
541 Ga0495580_0020188 3300046472 Bacteria 4936
542 Ga0495580_0050048 3300046472 Bacteria 2954
543 Ga0495580_0146630 3300046472 Bacteria 1636
544 Ga0495582_0056196 3300046473 Bacteria 2169
545 Ga0495605_0003384 3300046474 Bacteria 9515
546 Ga0495605_0006358 3300046474 Bacteria 6809
547 Ga0495605_0037577 3300046474 Bacteria 2434
548 Ga0495639_0049491 3300046475 Bacteria 1907
549 Ga0495662_0050420 3300046476 Bacteria 2009
550 Ga0495662_0083488 3300046476 Bacteria 1555
551 Ga0495584_0002192 3300046491 Bacteria 11134
552 Ga0495584_0012645 3300046491 Bacteria 4308
553 Ga0495585_0003916 3300046492 Bacteria 9858
554 Ga0495585_0021789 3300046492 Bacteria 3679
555 Ga0495585_0046010 3300046492 Bacteria 2434
556 Ga0495594_0000446 3300046499 Bacteria 20938
557 Ga0495594_0008871 3300046499 Bacteria 5186
558 Ga0495594_0009958 3300046499 Bacteria 4921
559 Ga0495596_0000101 3300046500 Bacteria 60820
560 Ga0495596_0004579 3300046500 Bacteria 6709
561 Ga0495607_0000130 3300046501 Bacteria 80479
562 Ga0495607_0004562 3300046501 Bacteria 10158
563 Ga0495607_0067818 3300046501 Bacteria 2003
564 Ga0495583_0000193 3300046506 Bacteria 101909
565 Ga0495583_0008294 3300046506 Bacteria 6369
566 Ga0495583_0016708 3300046506 Bacteria 3932
567 Ga0495606_0001674 3300046507 Bacteria 28659
568 Ga0495606_0002849 3300046507 Bacteria 19153
569 Ga0495606_0003983 3300046507 Bacteria 15105
570 Ga0495606_0055672 3300046507 Bacteria 2557
571 Ga0495608_0019974 3300046511 Bacteria 4607
572 Ga0495610_0001540 3300046512 Bacteria 20312
573 Ga0495616_0000103 3300046513 Bacteria 73155
574 Ga0495616_0027556 3300046513 Bacteria 3014
575 Ga0495616_0071247 3300046513 Bacteria 1681
576 Ga0495618_0013834 3300046514 Bacteria 4910
577 Ga0495618_0020574 3300046514 Bacteria 4062
578 Ga0495628_0001861 3300046516 Bacteria 19163
579 Ga0495628_0065434 3300046516 Bacteria 2843
580 Ga0495630_0011337 3300046517 Bacteria 6451
581 Ga0495630_0032771 3300046517 Bacteria 3873
582 Ga0495630_0148687 3300046517 Bacteria 1782
583 Ga0495631_0003800 3300046518 Bacteria 8210
584 Ga0495631_0008257 3300046518 Bacteria 5248
585 Ga0495637_0000926 3300046520 Bacteria 18783
586 Ga0495637_0075608 3300046520 Bacteria 1351
587 Ga0495643_0000192 3300046522 Bacteria 96511
588 Ga0495643_0006207 3300046522 Bacteria 7927
589 Ga0495648_0001877 3300046524 Bacteria 20080
590 Ga0495648_0008158 3300046524 Bacteria 8265
591 Ga0495648_0042718 3300046524 Bacteria 2849
592 Ga0495666_0019718 3300046526 Bacteria 3344
593 Ga0495666_0032636 3300046526 Bacteria 2547
594 Ga0495652_0011879 3300046529 Bacteria 7871
595 Ga0495654_0000005 3300046530 Bacteria 491381
596 Ga0495654_0006665 3300046530 Bacteria 6537
597 Ga0495654_0007231 3300046530 Bacteria 6224
598 Ga0495665_0050933 3300046531 Bacteria 2194
599 Ga0495640_0125800 3300046533 Bacteria 1662
600 Ga0495586_0004892 3300046535 Bacteria 7164
601 Ga0495586_0044988 3300046535 Bacteria 2378
602 Ga0495586_0146199 3300046535 Bacteria 1328
603 Ga0495587_0044903 3300046536 Bacteria 2627
604 Ga0495597_0000135 3300046542 Bacteria 67103
605 Ga0495597_0001100 3300046542 Bacteria 20478
606 Ga0495633_0064456 3300046558 Bacteria 1713
607 Ga0495667_0003887 3300046559 Bacteria 10024
608 Ga0495667_0043170 3300046559 Bacteria 2988
609 Ga0495667_0053754 3300046559 Bacteria 2651
610 Ga0495667_0081970 3300046559 Bacteria 2096
611 Ga0495667_0157278 3300046559 Bacteria 1462
612 Ga0495656_0014247 3300046615 Bacteria 2978
613 Ga0495668_0000008 3300046616 Bacteria 498364
614 Ga0495668_0004107 3300046616 Bacteria 10549
615 Ga0495634_0037638 3300046642 Bacteria 3304
616 Ga0495611_0001932 3300046648 Bacteria 9849
617 Ga0495611_0008093 3300046648 Bacteria 4462
618 Ga0495625_0001718 3300046660 Bacteria 25444
619 Ga0495625_0022308 3300046660 Bacteria 4857
620 Ga0495625_0026038 3300046660 Bacteria 4424
621 Ga0495635_0062625 3300046663 Bacteria 2554
622 Ga0495635_0154072 3300046663 Bacteria 1564
623 Ga0495588_0009267 3300046674 Bacteria 4546
624 Ga0495588_0016076 3300046674 Bacteria 3612
625 Ga0495588_0045257 3300046674 Bacteria 2255
626 Ga0495657_0007580 3300046675 Bacteria 8377
627 Ga0495599_0012765 3300046678 Bacteria 5183
628 Ga0495647_0022142 3300046681 Bacteria 2294
629 Ga0495658_0068550 3300046683 Bacteria 2054
630 Ga0495613_0028378 3300046689 Bacteria 4161
631 Ga0495624_0162647 3300046690 Bacteria 1363
632 Ga0495670_0015449 3300046691 Bacteria 3751
633 Ga0495670_0128351 3300046691 Bacteria 1320
634 Ga0495671_0000074 3300046692 Bacteria 96288
635 Ga0495600_0001912 3300046809 Bacteria 11695
636 Ga0495600_0003135 3300046809 Bacteria 9677
637 Ga0495660_0039808 3300046810 Bacteria 2608
638 Ga0495660_0081744 3300046810 Bacteria 1693
639 Ga0495660_0112321 3300046810 Bacteria 1389
640 Ga0495581_0111988 3300047315 Bacteria 1587
641 Ga0495604_0002736 3300047317 Bacteria 14142
642 Ga0495604_0005234 3300047317 Bacteria 10276
643 Ga0495604_0041001 3300047317 Bacteria 3632
644 Ga0495604_0090131 3300047317 Bacteria 2278
645 Ga0495636_0001344 3300047318 Bacteria 9341
646 Ga0495674_0002913 3300047319 Bacteria 16653
647 Ga0495674_0022167 3300047319 Bacteria 5860
648 Ga0495674_0078327 3300047319 Bacteria 2840
649 Ga0495672_0000155 3300047320 Bacteria 100026
650 Ga0495672_0000576 3300047320 Bacteria 41488
651 Ga0495672_0013299 3300047320 Bacteria 5685
652 Ga0495676_0073898 3300047321 Bacteria 2612
653 Ga0495680_0001336 3300047322 Bacteria 26857
654 Ga0495680_0024344 3300047322 Bacteria 5022
655 Ga0495680_0205521 3300047322 Bacteria 1411
656 Ga0495683_0009085 3300047323 Bacteria 5294
657 Ga0495683_0009490 3300047323 Bacteria 5182
658 Ga0495675_0000061 3300047444 Bacteria 76035
659 Ga0495675_0012333 3300047444 Bacteria 5379
660 Ga0495679_004406 3300047446 Bacteria 6515
661 Ga0495673_0000252 3300047469 Bacteria 74793
662 Ga0495681_0017359 3300047470 Bacteria 3998
663 Ga0495686_0005019 3300047472 Bacteria 10625
664 Ga0495686_0113106 3300047472 Bacteria 1626
665 Ga0495593_0091906 3300047673 Bacteria 1562
666 Ga0495602_0005525 3300048088 Bacteria 13263
667 Ga0495615_0002903 3300048090 Bacteria 2810
668 Ga0496100_0003279 3300048903 Bacteria 8412
669 Ga0496101_0002542 3300048904 Bacteria 11190
670 Ga0496102_0000253 3300048905 Bacteria 69634
671 Ga0496102_0004416 3300048905 Bacteria 11878
672 Ga0496102_0006100 3300048905 Bacteria 10273
673 Ga0496103_0027532 3300048906 Bacteria 3445
674 Ga0496103_0099321 3300048906 Bacteria 1841
675 Ga0496104_0000537 3300048907 Bacteria 32588
676 Ga0496104_0280899 3300048907 Bacteria 1578
677 Ga0496104_0352862 3300048907 Bacteria 1383
678 Ga0496105_0022794 3300048908 Bacteria 5073
679 Ga0496105_0069144 3300048908 Bacteria 2918
680 Ga0496106_0003355 3300048909 Bacteria 11939
681 Ga0496107_0002233 3300048910 Bacteria 12472
682 Ga0496108_0160256 3300048911 Bacteria 1944
683 Ga0496109_0149914 3300048912 Bacteria 2183
684 Ga0496110_0000704 3300048913 Bacteria 23091
685 Ga0496111_0027318 3300048914 Bacteria 4036
686 Ga0496112_0094432 3300048915 Bacteria 2961
687 Ga0496112_0153370 3300048915 Bacteria 2271
688 Ga0496113_0118527 3300048916 Bacteria 2067
689 Ga0496114_0004267 3300048917 Bacteria 11063
690 Ga0496114_0208558 3300048917 Bacteria 1713
691 Ga0496115_0007045 3300048918 Bacteria 8260
692 Ga0496115_0067942 3300048918 Bacteria 2884
693 Ga0496115_0203522 3300048918 Bacteria 1635
694 Ga0496116_0003291 3300048919 Bacteria 16067
695 Ga0496116_0040404 3300048919 Bacteria 3212
696 Ga0496116_0077769 3300048919 Bacteria 2071
697 Ga0496117_0000010 3300048920 Bacteria 611954
698 Ga0496117_0000020 3300048920 Bacteria 458405
699 Ga0496117_0000095 3300048920 Bacteria 198731
700 Ga0496117_0001093 3300048920 Bacteria 40952
701 Ga0496118_0000003 3300048921 Bacteria 773148
702 Ga0496118_0000009 3300048921 Bacteria 611954
703 Ga0496118_0000015 3300048921 Bacteria 551359
704 Ga0496118_0105408 3300048921 Bacteria 1890
705 Ga0496119_0006799 3300048922 Bacteria 10487
706 Ga0496119_0020291 3300048922 Bacteria 4853
707 Ga0496119_0074648 3300048922 Bacteria 1974
708 Ga0496119_0084377 3300048922 Bacteria 1821
709 Ga0496119_0100611 3300048922 Bacteria 1623
710 Ga0496120_0000693 3300048923 Bacteria 49436
711 Ga0496120_0002649 3300048923 Bacteria 17666
712 Ga0496120_0054557 3300048923 Bacteria 2264
713 Ga0496120_0060868 3300048923 Bacteria 2110
714 Ga0496120_0065802 3300048923 Bacteria 2006
715 Ga0496121_0000760 3300048924 Bacteria 59241
716 Ga0496121_0002573 3300048924 Bacteria 27446
717 Ga0496121_0003236 3300048924 Bacteria 23416
718 Ga0496121_0005330 3300048924 Bacteria 16532
719 Ga0496121_0005691 3300048924 Bacteria 15840
720 Ga0496121_0013141 3300048924 Bacteria 8931
721 Ga0496122_0000491 3300048925 Bacteria 82131
722 Ga0496122_0001880 3300048925 Bacteria 31877
723 Ga0496122_0005531 3300048925 Bacteria 15007
724 Ga0496122_0064238 3300048925 Bacteria 2672
725 Ga0496123_0000488 3300048926 Bacteria 69002
726 Ga0496123_0008787 3300048926 Bacteria 9210
727 Ga0496123_0017366 3300048926 Bacteria 5791
728 Ga0496123_0112970 3300048926 Bacteria 1548
729 Ga0496124_0005346 3300048927 Bacteria 14493
730 Ga0496124_0077686 3300048927 Bacteria 2737
731 Ga0496124_0220544 3300048927 Bacteria 1426
732 Ga0496125_0000757 3300048928 Bacteria 52952
733 Ga0496125_0014409 3300048928 Bacteria 7700
734 Ga0496125_0021615 3300048928 Bacteria 5997
735 Ga0496125_0022315 3300048928 Bacteria 5881
736 Ga0496125_0110181 3300048928 Bacteria 1997
737 Ga0496126_0003855 3300048929 Bacteria 18532
738 Ga0496126_0017291 3300048929 Bacteria 7185
739 Ga0496126_0066928 3300048929 Bacteria 3211
740 Ga0496126_0087972 3300048929 Bacteria 2738
741 Ga0496126_0306455 3300048929 Bacteria 1308
742 Ga0495678_036141 3300049459 Bacteria 2018
743 Ga0501032_0002698 3300049569 Bacteria 13838
744 Ga0501033_0000753 3300049570 Bacteria 29818
745 Ga0501033_0001575 3300049570 Bacteria 20086
746 Ga0501033_0023597 3300049570 Bacteria 4639
747 Ga0501034_0011345 3300049571 Bacteria 9239
748 Ga0501037_0004419 3300049573 Bacteria 10213
749 Ga0501037_0024004 3300049573 Bacteria 4508
750 Ga0501038_0006279 3300049574 Bacteria 10986
751 Ga0501043_0000559 3300049579 Bacteria 33347
752 Ga0501046_0001485 3300049580 Bacteria 22466
753 Ga0501047_0054565 3300049581 Bacteria 3865
754 Ga0501067_0008950 3300049583 Bacteria 5548
755 Ga0501068_0000229 3300049584 Bacteria 27255
756 Ga0501070_0028668 3300049586 Bacteria 4668
757 Ga0501070_0107625 3300049586 Bacteria 2304
758 Ga0501072_0000003 3300049588 Bacteria 298632
759 Ga0501074_0002384 3300049590 Bacteria 13098
760 Ga0501076_0157196 3300049592 Bacteria 1851
761 Ga0501079_0007057 3300049741 Bacteria 8476
762 Ga0501035_0002193 3300049822 Bacteria 19383
763 Ga0501035_0006107 3300049822 Bacteria 11338
764 Ga0501044_0000563 3300049823 Bacteria 45153
765 Ga0501044_0002141 3300049823 Bacteria 22624
766 Ga0501044_0179097 3300049823 Bacteria 2087
767 nmdc:mga00v17_21_c1 3300050491 Bacteria 55853
768 nmdc:mga00v17_31_c1 3300050491 Bacteria 87312
769 nmdc:mga08y16_233_c1 3300050511 Bacteria 49640
770 nmdc:mga08x19_23707_c1 3300050514 Bacteria 3808
771 nmdc:mga08x19_511_c1 3300050514 Bacteria 25777
772 nmdc:mga0a205_131476_c1 3300050515 Bacteria 2403
773 Ga0495601_0123143 3300053077 Bacteria 1685
774 Ga0495595_0025762 3300053084 Bacteria 2608
775 Ga0500646_0044336 3300053090 Bacteria 1262
776 Ga0500556_0001489 3300053104 Bacteria 9718
777 Ga0500557_009266 3300053105 Bacteria 2404
778 Ga0500591_022251 3300053115 Bacteria 3077
779 Ga0500618_000946 3300053125 Bacteria 14873
780 Ga0500658_0017191 3300053134 Bacteria 2699
781 Ga0500588_0000099 3300053146 Bacteria 11307
782 Ga0500590_119386 3300053148 Bacteria 1238
783 Ga0500622_0031117 3300053156 Bacteria 2799
784 Ga0500624_008964 3300053157 Bacteria 1412
785 Ga0500627_0022083 3300053158 Bacteria 2576
786 Ga0500639_057883 3300053163 Bacteria 2004
787 Ga0500636_0000038 3300053177 Bacteria 70653
788 Ga0501084_0000794 3300054114 Bacteria 24153
789 Ga0587077_004819 3300059493 Bacteria 1802
790 Ga0501082_0000045 3300060353 Bacteria 86365
791 Ga0466962_0000283 3300061719 Bacteria 21482
792 Ga0530510_0050043 3300061734 Bacteria 3018

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035724 Ga0373933_0129967 Ga0373933_0129967_556_1557 332
2 3300035692 Ga0373935_0295051 Ga0373935_0295051_15_1112 347
3 3300047322 Ga0495680_0205521 Ga0495680_0205521_258_1355 347
4 3300046810 Ga0495660_0112321 Ga0495660_0112321_14_1075 352
5 3300046559 Ga0495667_0053754 Ga0495667_0053754_25_1140 353
6 3300053158 Ga0500627_0022083 Ga0500627_0022083_959_2062 357
7 2124908027 MRS2a_Contig_70 MRS2a_00559370 361
8 3300046474 Ga0495605_0003384 Ga0495605_0003384_3079_4164 361
9 3300046559 Ga0495667_0157278 Ga0495667_0157278_15_1118 366
10 3300048929 Ga0496126_0066928 Ga0496126_0066928_2080_3186 367
11 3300053148 Ga0500590_119386 Ga0500590_119386_53_1159 367
12 3300035113 Ga0373936_0000768 Ga0373936_0000768_7131_8252 372
13 3300014326 Ga0157380_10242171 Ga0157380_102421712 376
14 3300009101 Ga0105247_10016238 Ga0105247_100162384 377
15 3300009177 Ga0105248_10051703 Ga0105248_100517032 377
16 3300009553 Ga0105249_10026594 Ga0105249_100265944 377
17 3300013306 Ga0163162_10054706 Ga0163162_100547062 377
18 3300048911 Ga0496108_0160256 Ga0496108_0160256_322_1458 377
19 3300048915 Ga0496112_0153370 Ga0496112_0153370_271_1407 377
20 3300048928 Ga0496125_0014409 Ga0496125_0014409_4893_6029 377
21 3300031247 Ga0265340_10010715 Ga0265340_100107152 381
22 3300031249 Ga0265339_10045581 Ga0265339_100455813 381
23 3300031250 Ga0265331_10007068 Ga0265331_100070683 381
24 3300031595 Ga0265313_10015924 Ga0265313_100159243 381
25 3300031712 Ga0265342_10083331 Ga0265342_100833312 381
26 3300005530 Ga0070679_100039079 Ga0070679_1000390792 384
27 3300013105 Ga0157369_10045001 Ga0157369_100450015 384
28 3300025912 Ga0207707_10000094 Ga0207707_1000009464 384
29 3300025913 Ga0207695_10028070 Ga0207695_100280702 384
30 3300005336 Ga0070680_100088865 Ga0070680_1000888652 385
31 3300039447 Ga0436361_1186001 Ga0436361_1186001_744_1973 385
32 3300049586 Ga0501070_0107625 Ga0501070_0107625_50_1255 385
33 3300005355 Ga0070671_100028433 Ga0070671_1000284332 387
34 3300005841 Ga0068863_100100625 Ga0068863_1001006252 387
35 3300025986 Ga0207658_10000493 Ga0207658_1000049313 387
36 3300026088 Ga0207641_10010473 Ga0207641_100104736 387
37 3300046529 Ga0495652_0011879 Ga0495652_0011879_6053_7258 391
38 3300025901 Ga0207688_10033070 Ga0207688_100330702 392
39 3300005436 Ga0070713_100088383 Ga0070713_1000883832 393
40 3300025915 Ga0207693_10071257 Ga0207693_100712572 393
41 3300025916 Ga0207663_10077898 Ga0207663_100778981 393
42 iso_pu_bacteria 2891048133 2891049811 394
43 iso_pu_bacteria 2995392953 2995397143 394
44 iso_pu_bacteria 2511231003 2511249084 395
45 iso_pu_bacteria 2818991445 2819592316 395
46 iso_pu_bacteria 2884811622 2884816254 395
47 iso_pu_bacteria 2884836552 2884840267 395
48 iso_pu_bacteria 2884852848 2884856967 395
49 iso_pu_bacteria 2896154374 2896157552 395
50 iso_pu_bacteria 2508501050 2508732928 396
51 iso_pu_bacteria 2508501114 2509075607 396
52 iso_pu_bacteria 2510917022 2511132878 396
53 iso_pu_bacteria 2511231006 2511265900 396
54 iso_pu_bacteria 2512047018 2512323789 396
55 iso_pu_bacteria 2513237088 2513595733 396
56 iso_pu_bacteria 2513237088 2513595798 396
57 iso_pu_bacteria 2513237090 2513611401 396
58 iso_pu_bacteria 2513237138 2513870468 396
59 iso_pu_bacteria 2513237159 2514001174 396
60 iso_pu_bacteria 2534681796 2535519906 396
61 iso_pu_bacteria 2534681796 2535519980 396
62 iso_pu_bacteria 2582580891 2583791954 396
63 iso_pu_bacteria 2582581294 2585204738 396
64 iso_pu_bacteria 2582581299 2585232891 396
65 iso_pu_bacteria 2582581306 2585268396 396
66 iso_pu_bacteria 2582581307 2585272407 396
67 iso_pu_bacteria 2582581315 2585324687 396
68 iso_pu_bacteria 2582581316 2585332112 396
69 iso_pu_bacteria 2582581865 2585390395 396
70 iso_pu_bacteria 2582581866 2585397588 396
71 iso_pu_bacteria 2582581867 2585399511 396
72 iso_pu_bacteria 2582581867 2585401342 396
73 iso_pu_bacteria 2585427528 2585542897 396
74 iso_pu_bacteria 2585427531 2585561530 396
75 iso_pu_bacteria 2585427590 2585821513 396
76 iso_pu_bacteria 2585427593 2585841161 396
77 iso_pu_bacteria 2585427608 2585899378 396
78 iso_pu_bacteria 2585427609 2585906758 396
79 iso_pu_bacteria 2585428125 2587982179 396
80 iso_pu_bacteria 2597489887 2597858015 396
81 iso_pu_bacteria 2599185185 2599485046 396
82 iso_pu_bacteria 2599185352 2600197345 396
83 iso_pu_bacteria 2600255292 2601670442 396
84 iso_pu_bacteria 2643221557 2643809424 396
85 iso_pu_bacteria 2643221558 2643814796 396
86 iso_pu_bacteria 2643221599 2644003549 396
87 iso_pu_bacteria 2643221610 2644069412 396
88 iso_pu_bacteria 2643221643 2644241166 396
89 iso_pu_bacteria 2643221668 2644379989 396
90 iso_pu_bacteria 2643221675 2644420565 396
91 iso_pu_bacteria 2643221680 2644454091 396
92 iso_pu_bacteria 2643221723 2644674746 396
93 iso_pu_bacteria 2643221726 2644686136 396
94 iso_pu_bacteria 2643221736 2644744100 396
95 iso_pu_bacteria 2667528172 2671103031 396
96 iso_pu_bacteria 2693429783 2694630968 396
97 iso_pu_bacteria 2738541297 2738825602 396
98 iso_pu_bacteria 2738541357 2739149399 396
99 iso_pu_bacteria 2738543003 2739191318 396
100 iso_pu_bacteria 2738543026 2739317795 396
101 iso_pu_bacteria 2738543029 2739336036 396
102 iso_pu_bacteria 2740892503 2743737481 396
103 iso_pu_bacteria 2765235842 2765588897 396
104 iso_pu_bacteria 2775506901 2776260535 396
105 iso_pu_bacteria 2775507266 2778174740 396
106 iso_pu_bacteria 2775507266 2778178181 396
107 iso_pu_bacteria 2791355094 2792641789 396
108 iso_pu_bacteria 2818991272 2819244036 396
109 iso_pu_bacteria 2821123053 2821126460 396
110 iso_pu_bacteria 2823373977 2823374689 396
111 iso_pu_bacteria 2835312727 2835319036 396
112 iso_pu_bacteria 2838736955 2838737064 396
113 iso_pu_bacteria 2841840854 2841842567 396
114 iso_pu_bacteria 2842140634 2842142347 396
115 iso_pu_bacteria 2842509118 2842512192 396
116 iso_pu_bacteria 2842521101 2842526849 396
117 iso_pu_bacteria 2844425489 2844427456 396
118 iso_pu_bacteria 2854896431 2854899819 396
119 iso_pu_bacteria 2854916844 2854920961 396
120 iso_pu_bacteria 2855020534 2855022605 396
121 iso_pu_bacteria 2856314179 2856314238 396
122 iso_pu_bacteria 2856342000 2856344653 396
123 iso_pu_bacteria 2856364286 2856369365 396
124 iso_pu_bacteria 2857531043 2857533022 396
125 iso_pu_bacteria 2857547612 2857548217 396
126 iso_pu_bacteria 2857576091 2857576187 396
127 iso_pu_bacteria 2869285874 2869286562 396
128 iso_pu_bacteria 2871429161 2871434715 396
129 iso_pu_bacteria 2874146452 2874149920 396
130 iso_pu_bacteria 2874155637 2874158178 396
131 iso_pu_bacteria 2876413966 2876416382 396
132 iso_pu_bacteria 2878745973 2878751848 396
133 iso_pu_bacteria 2885080285 2885085213 396
134 iso_pu_bacteria 2885342637 2885349856 396
135 iso_pu_bacteria 2888337043 2888337097 396
136 iso_pu_bacteria 2888343758 2888345844 396
137 iso_pu_bacteria 2894232714 2894233290 396
138 iso_pu_bacteria 2903492973 2903504794 396
139 iso_pu_bacteria 2906308376 2906314246 396
140 iso_pu_bacteria 2906321335 2906327412 396
141 iso_pu_bacteria 2906414383 2906414660 396
142 iso_pu_bacteria 2919108558 2919109321 396
143 iso_pu_bacteria 2919166419 2919169070 396
144 iso_pu_bacteria 2923153595 2923156522 396
145 iso_pu_bacteria 2923556063 2923560393 396
146 iso_pu_bacteria 2923634449 2923634773 396
147 iso_pu_bacteria 2932410948 2932412812 396
148 iso_pu_bacteria 2932416698 2932420327 396
149 iso_pu_bacteria 2937539931 2937541734 396
150 iso_pu_bacteria 2937813078 2937815644 396
151 iso_pu_bacteria 2958130278 2958130965 396
152 iso_pu_bacteria 2958179912 2958184886 396
153 iso_pu_bacteria 2961077736 2961083053 396
154 iso_pu_bacteria 2965062239 2965063113 396
155 iso_pu_bacteria 2968128360 2968129802 396
156 iso_pu_bacteria 2968128360 2968130256 396
157 iso_pu_bacteria 2974310843 2974312179 396
158 iso_pu_bacteria 2977843712 2977845880 396
159 iso_pu_bacteria 2978969890 2978970549 396
160 iso_pu_bacteria 2984587000 2984587556 396
161 iso_pu_bacteria 2989776772 2989780572 396
162 iso_pu_bacteria 3004211236 3004217668 396
163 iso_pu_bacteria 3004218560 3004220015 396
164 iso_pu_bacteria 3007395558 3007395906 396
165 iso_pu_bacteria 639633007 639785420 396
166 iso_pu_bacteria 8004387939 8004393736 396
167 iso_pu_bacteria 8004714634 8004720504 396
168 iso_pu_bacteria 8005246636 8005250276 396
169 iso_pu_bacteria 8005258706 8005263813 396
170 iso_pu_bacteria 8005258706 8005263978 396
171 iso_pu_bacteria 8005542996 8005547630 396
172 iso_pu_bacteria 8005542996 8005547706 396
173 iso_pu_bacteria 8018150411 8018152405 396
174 iso_pu_bacteria 8018405270 8018407852 396
175 iso_pu_bacteria 8054558443 8054561616 396
176 iso_pu_bacteria 8055770955 8055773851 396
177 iso_pu_bacteria 8054849141 8054853176 397
178 3300005367 Ga0070667_100000046 Ga0070667_100000046119 398
179 3300025986 Ga0207658_10000058 Ga0207658_1000005869 398
180 3300036401 Ga0373937_0023699 Ga0373937_0023699_834_2045 398
181 iso_pu_bacteria 2919476304 2919479116 398
182 2162886007 SwRhRL2b_contig_1954747 SwRhRL2b_0274.00006750 399
183 3300002704 JGI25155J39150_1000048 JGI25155J39150_100004834 399
184 3300002704 JGI25155J39150_1000162 JGI25155J39150_100016215 399
185 3300002705 JGI25156J39149_1000068 JGI25156J39149_100006838 399
186 3300002705 JGI25156J39149_1005786 JGI25156J39149_10057862 399
187 3300002737 JGI25162J39368_1006021 JGI25162J39368_10060212 399
188 3300002738 JGI25154J39366_1000066 JGI25154J39366_100006655 399
189 3300002738 JGI25154J39366_1000084 JGI25154J39366_100008436 399
190 3300002741 JGI25157J39369_1000097 JGI25157J39369_100009736 399
191 3300002987 JGI25159J45721_1000454 JGI25159J45721_100045414 399
192 3300003187 JGI25151J46595_10016628 JGI25151J46595_100166283 399
193 3300003316 rootH1_10037457 rootH1_100374572 399
194 3300003354 JGI25160J50197_1000005 JGI25160J50197_100000563 399
195 3300003354 JGI25160J50197_1000014 JGI25160J50197_1000014201 399
196 3300003374 JGI25161J50226_1000022 JGI25161J50226_1000022101 399
197 3300003374 JGI25161J50226_1000349 JGI25161J50226_100034912 399
198 3300003758 Ga0055532_1000015 Ga0055532_1000015173 399
199 3300003771 Ga0055526_1007416 Ga0055526_10074161 399
200 3300003773 Ga0055537_1001060 Ga0055537_100106010 399
201 3300003775 Ga0055524_1002559 Ga0055524_10025597 399
202 3300003775 Ga0055524_1012855 Ga0055524_10128553 399
203 3300003775 Ga0055524_1030908 Ga0055524_10309082 399
204 3300003781 Ga0055536_1000014 Ga0055536_1000014124 399
205 3300003784 Ga0055534_1000072 Ga0055534_100007269 399
206 3300003790 Ga0055528_1000043 Ga0055528_100004377 399
207 3300003790 Ga0055528_1006829 Ga0055528_10068295 399
208 3300003791 Ga0055530_10000009 Ga0055530_10000009124 399
209 3300003792 Ga0055540_1000342 Ga0055540_100034225 399
210 3300004625 Ga0055543_1000005 Ga0055543_100000532 399
211 3300004625 Ga0055543_1000082 Ga0055543_10000827 399
212 3300004625 Ga0055543_1002336 Ga0055543_10023363 399
213 3300005262 Ga0065165_1000002 Ga0065165_1000002327 399
214 3300005262 Ga0065165_1000187 Ga0065165_100018767 399
215 3300005262 Ga0065165_1000463 Ga0065165_100046333 399
216 3300005329 Ga0070683_100000407 Ga0070683_10000040724 399
217 3300005329 Ga0070683_100012192 Ga0070683_1000121924 399
218 3300005329 Ga0070683_100111389 Ga0070683_1001113892 399
219 3300005329 Ga0070683_100140509 Ga0070683_1001405092 399
220 3300005330 Ga0070690_100012887 Ga0070690_1000128873 399
221 3300005331 Ga0070670_100001173 Ga0070670_1000011732 399
222 3300005331 Ga0070670_100024696 Ga0070670_1000246965 399
223 3300005335 Ga0070666_10004887 Ga0070666_100048875 399
224 3300005335 Ga0070666_10015348 Ga0070666_100153483 399
225 3300005335 Ga0070666_10029975 Ga0070666_100299752 399
226 3300005336 Ga0070680_100003368 Ga0070680_1000033687 399
227 3300005336 Ga0070680_100013212 Ga0070680_1000132123 399
228 3300005336 Ga0070680_100056113 Ga0070680_1000561133 399
229 3300005338 Ga0068868_100002348 Ga0068868_1000023482 399
230 3300005338 Ga0068868_100004425 Ga0068868_1000044254 399
231 3300005338 Ga0068868_100005551 Ga0068868_1000055511 399
232 3300005341 Ga0070691_10000505 Ga0070691_100005052 399
233 3300005353 Ga0070669_100041490 Ga0070669_1000414902 399
234 3300005355 Ga0070671_100016932 Ga0070671_1000169322 399
235 3300005355 Ga0070671_100031183 Ga0070671_1000311833 399
236 3300005367 Ga0070667_100022349 Ga0070667_1000223493 399
237 3300005367 Ga0070667_100061990 Ga0070667_1000619904 399
238 3300005367 Ga0070667_100226934 Ga0070667_1002269341 399
239 3300005435 Ga0070714_100000679 Ga0070714_1000006793 399
240 3300005435 Ga0070714_100130594 Ga0070714_1001305942 399
241 3300005435 Ga0070714_100341774 Ga0070714_1003417741 399
242 3300005436 Ga0070713_100008248 Ga0070713_1000082486 399
243 3300005436 Ga0070713_100022654 Ga0070713_1000226544 399
244 3300005457 Ga0070662_100118561 Ga0070662_1001185612 399
245 3300005458 Ga0070681_10000278 Ga0070681_1000027839 399
246 3300005458 Ga0070681_10005588 Ga0070681_1000558810 399
247 3300005458 Ga0070681_10008207 Ga0070681_100082077 399
248 3300005458 Ga0070681_10030852 Ga0070681_100308524 399
249 3300005458 Ga0070681_10076711 Ga0070681_100767113 399
250 3300005458 Ga0070681_10084359 Ga0070681_100843594 399
251 3300005459 Ga0068867_100014256 Ga0068867_1000142565 399
252 3300005459 Ga0068867_100166422 Ga0068867_1001664221 399
253 3300005467 Ga0070706_100040154 Ga0070706_1000401542 399
254 3300005518 Ga0070699_100039576 Ga0070699_1000395763 399
255 3300005530 Ga0070679_100010630 Ga0070679_1000106304 399
256 3300005530 Ga0070679_100011761 Ga0070679_1000117613 399
257 3300005530 Ga0070679_100059190 Ga0070679_1000591905 399
258 3300005530 Ga0070679_100078890 Ga0070679_1000788902 399
259 3300005530 Ga0070679_100113034 Ga0070679_1001130342 399
260 3300005535 Ga0070684_100000856 Ga0070684_1000008568 399
261 3300005535 Ga0070684_100057257 Ga0070684_1000572572 399
262 3300005536 Ga0070697_100032440 Ga0070697_1000324404 399
263 3300005539 Ga0068853_100128029 Ga0068853_1001280291 399
264 3300005545 Ga0070695_100059472 Ga0070695_1000594722 399
265 3300005548 Ga0070665_100001514 Ga0070665_10000151420 399
266 3300005548 Ga0070665_100010456 Ga0070665_1000104564 399
267 3300005548 Ga0070665_100038832 Ga0070665_1000388323 399
268 3300005548 Ga0070665_100039405 Ga0070665_1000394052 399
269 3300005548 Ga0070665_100139058 Ga0070665_1001390583 399
270 3300005563 Ga0068855_100000946 Ga0068855_1000009464 399
271 3300005563 Ga0068855_100004315 Ga0068855_1000043151 399
272 3300005563 Ga0068855_100010388 Ga0068855_1000103887 399
273 3300005563 Ga0068855_100332226 Ga0068855_1003322262 399
274 3300005563 Ga0068855_100409240 Ga0068855_1004092402 399
275 3300005564 Ga0070664_100225222 Ga0070664_1002252222 399
276 3300005577 Ga0068857_100000139 Ga0068857_10000013922 399
277 3300005577 Ga0068857_100015494 Ga0068857_1000154948 399
278 3300005578 Ga0068854_100085487 Ga0068854_1000854872 399
279 3300005614 Ga0068856_100003335 Ga0068856_1000033358 399
280 3300005614 Ga0068856_100011282 Ga0068856_1000112829 399
281 3300005614 Ga0068856_100066173 Ga0068856_1000661732 399
282 3300005614 Ga0068856_100079057 Ga0068856_1000790573 399
283 3300005616 Ga0068852_100009656 Ga0068852_1000096567 399
284 3300005616 Ga0068852_100026807 Ga0068852_1000268072 399
285 3300005616 Ga0068852_100062674 Ga0068852_1000626743 399
286 3300005617 Ga0068859_100007848 Ga0068859_1000078487 399
287 3300005617 Ga0068859_100057855 Ga0068859_1000578553 399
288 3300005617 Ga0068859_100178947 Ga0068859_1001789472 399
289 3300005841 Ga0068863_100001619 Ga0068863_10000161918 399
290 3300005841 Ga0068863_100015117 Ga0068863_1000151173 399
291 3300005841 Ga0068863_100042715 Ga0068863_1000427152 399
292 3300005842 Ga0068858_100000996 Ga0068858_1000009964 399
293 3300005842 Ga0068858_100003356 Ga0068858_1000033563 399
294 3300005842 Ga0068858_100166497 Ga0068858_1001664972 399
295 3300005843 Ga0068860_100002939 Ga0068860_1000029395 399
296 3300005843 Ga0068860_100003553 Ga0068860_10000355314 399
297 3300005843 Ga0068860_100022586 Ga0068860_1000225867 399
298 3300005843 Ga0068860_100034234 Ga0068860_1000342343 399
299 3300005843 Ga0068860_100186876 Ga0068860_1001868762 399
300 3300005843 Ga0068860_100357648 Ga0068860_1003576481 399
301 3300005844 Ga0068862_100098962 Ga0068862_1000989622 399
302 3300005844 Ga0068862_100106478 Ga0068862_1001064782 399
303 3300005937 Ga0081455_10000075 Ga0081455_1000007585 399
304 3300005985 Ga0081539_10000123 Ga0081539_10000123133 399
305 3300006028 Ga0070717_10022763 Ga0070717_100227632 399
306 3300006051 Ga0075364_10000122 Ga0075364_1000012222 399
307 3300006051 Ga0075364_10009211 Ga0075364_100092112 399
308 3300006163 Ga0070715_10025500 Ga0070715_100255002 399
309 3300006173 Ga0070716_100005359 Ga0070716_1000053596 399
310 3300006175 Ga0070712_100001354 Ga0070712_10000135412 399
311 3300006175 Ga0070712_100018344 Ga0070712_1000183443 399
312 3300006178 Ga0075367_10000065 Ga0075367_1000006510 399
313 3300006178 Ga0075367_10106018 Ga0075367_101060181 399
314 3300006237 Ga0097621_100003036 Ga0097621_1000030367 399
315 3300006237 Ga0097621_100023168 Ga0097621_1000231685 399
316 3300006237 Ga0097621_100041334 Ga0097621_1000413344 399
317 3300006237 Ga0097621_100139274 Ga0097621_1001392742 399
318 3300006353 Ga0075370_10045293 Ga0075370_100452933 399
319 3300006358 Ga0068871_100003128 Ga0068871_1000031282 399
320 3300006358 Ga0068871_100006989 Ga0068871_1000069896 399
321 3300006358 Ga0068871_100007934 Ga0068871_1000079347 399
322 3300006852 Ga0075433_10140160 Ga0075433_101401602 399
323 3300006881 Ga0068865_100000854 Ga0068865_1000008542 399
324 3300006881 Ga0068865_100003193 Ga0068865_1000031934 399
325 3300006914 Ga0075436_100048012 Ga0075436_1000480123 399
326 3300006914 Ga0075436_100067416 Ga0075436_1000674162 399
327 3300006931 Ga0097620_100007848 Ga0097620_1000078482 399
328 3300006931 Ga0097620_100057855 Ga0097620_1000578553 399
329 3300006931 Ga0097620_100178950 Ga0097620_1001789502 399
330 3300006946 Ga0079104_1000243 Ga0079104_10002433 399
331 3300007265 Ga0099794_10021173 Ga0099794_100211733 399
332 3300007265 Ga0099794_10027462 Ga0099794_100274622 399
333 3300009011 Ga0105251_10008811 Ga0105251_100088112 399
334 3300009011 Ga0105251_10073173 Ga0105251_100731731 399
335 3300009036 Ga0105244_10031082 Ga0105244_100310823 399
336 3300009092 Ga0105250_10000059 Ga0105250_1000005937 399
337 3300009092 Ga0105250_10046057 Ga0105250_100460572 399
338 3300009093 Ga0105240_10000721 Ga0105240_1000072130 399
339 3300009093 Ga0105240_10002166 Ga0105240_100021669 399
340 3300009093 Ga0105240_10005036 Ga0105240_100050366 399
341 3300009093 Ga0105240_10006325 Ga0105240_1000632517 399
342 3300009093 Ga0105240_10012887 Ga0105240_100128874 399
343 3300009093 Ga0105240_10058545 Ga0105240_100585456 399
344 3300009093 Ga0105240_10095545 Ga0105240_100955454 399
345 3300009093 Ga0105240_10215450 Ga0105240_102154502 399
346 3300009093 Ga0105240_10409042 Ga0105240_104090421 399
347 3300009094 Ga0111539_10000107 Ga0111539_1000010753 399
348 3300009098 Ga0105245_10002527 Ga0105245_100025275 399
349 3300009098 Ga0105245_10003212 Ga0105245_1000321210 399
350 3300009098 Ga0105245_10018741 Ga0105245_100187413 399
351 3300009098 Ga0105245_10019040 Ga0105245_100190403 399
352 3300009098 Ga0105245_10102026 Ga0105245_101020262 399
353 3300009101 Ga0105247_10010886 Ga0105247_100108866 399
354 3300009101 Ga0105247_10026517 Ga0105247_100265172 399
355 3300009148 Ga0105243_10079262 Ga0105243_100792622 399
356 3300009174 Ga0105241_10000274 Ga0105241_100002746 399
357 3300009174 Ga0105241_10000595 Ga0105241_1000059519 399
358 3300009174 Ga0105241_10032378 Ga0105241_100323783 399
359 3300009174 Ga0105241_10047004 Ga0105241_100470043 399
360 3300009174 Ga0105241_10115502 Ga0105241_101155022 399
361 3300009176 Ga0105242_10001176 Ga0105242_100011767 399
362 3300009176 Ga0105242_10017229 Ga0105242_100172291 399
363 3300009176 Ga0105242_10022525 Ga0105242_100225256 399
364 3300009177 Ga0105248_10002359 Ga0105248_1000235921 399
365 3300009177 Ga0105248_10003426 Ga0105248_1000342611 399
366 3300009177 Ga0105248_10286623 Ga0105248_102866232 399
367 3300009177 Ga0105248_10351867 Ga0105248_103518672 399
368 3300009545 Ga0105237_10004017 Ga0105237_100040174 399
369 3300009545 Ga0105237_10193993 Ga0105237_101939932 399
370 3300009551 Ga0105238_10001117 Ga0105238_100011175 399
371 3300009551 Ga0105238_10003110 Ga0105238_1000311014 399
372 3300009551 Ga0105238_10006903 Ga0105238_100069034 399
373 3300009551 Ga0105238_10009735 Ga0105238_100097354 399
374 3300009551 Ga0105238_10046694 Ga0105238_100466942 399
375 3300009551 Ga0105238_10193557 Ga0105238_101935571 399
376 3300010375 Ga0105239_10002184 Ga0105239_1000218420 399
377 3300010375 Ga0105239_10005500 Ga0105239_100055007 399
378 3300010375 Ga0105239_10011109 Ga0105239_100111092 399
379 3300010375 Ga0105239_10029023 Ga0105239_100290234 399
380 3300010375 Ga0105239_10033015 Ga0105239_100330151 399
381 3300010375 Ga0105239_10045243 Ga0105239_100452435 399
382 3300010375 Ga0105239_10190021 Ga0105239_101900213 399
383 3300010375 Ga0105239_10207182 Ga0105239_102071822 399
384 3300011119 Ga0105246_10008333 Ga0105246_100083335 399
385 3300011119 Ga0105246_10072511 Ga0105246_100725112 399
386 3300013102 Ga0157371_10015446 Ga0157371_100154466 399
387 3300013104 Ga0157370_10002686 Ga0157370_1000268619 399
388 3300013104 Ga0157370_10015891 Ga0157370_100158915 399
389 3300013104 Ga0157370_10177484 Ga0157370_101774842 399
390 3300013105 Ga0157369_10005407 Ga0157369_100054077 399
391 3300013105 Ga0157369_10024762 Ga0157369_100247627 399
392 3300013105 Ga0157369_10090441 Ga0157369_100904412 399
393 3300013105 Ga0157369_10259330 Ga0157369_102593302 399
394 3300013296 Ga0157374_10005928 Ga0157374_1000592810 399
395 3300013296 Ga0157374_10032993 Ga0157374_100329932 399
396 3300013296 Ga0157374_10064220 Ga0157374_100642203 399
397 3300013297 Ga0157378_10000037 Ga0157378_1000003735 399
398 3300013297 Ga0157378_10006931 Ga0157378_100069319 399
399 3300013297 Ga0157378_10052411 Ga0157378_100524112 399
400 3300013307 Ga0157372_10164098 Ga0157372_101640982 399
401 3300013307 Ga0157372_10171737 Ga0157372_101717374 399
402 3300014325 Ga0163163_10117984 Ga0163163_101179842 399
403 3300014497 Ga0182008_10050005 Ga0182008_100500052 399
404 3300014968 Ga0157379_10039188 Ga0157379_100391884 399
405 3300014968 Ga0157379_10114627 Ga0157379_101146271 399
406 3300014969 Ga0157376_10000094 Ga0157376_1000009440 399
407 3300014969 Ga0157376_10032475 Ga0157376_100324753 399
408 3300014969 Ga0157376_10053068 Ga0157376_100530684 399
409 3300015261 Ga0182006_1000010 Ga0182006_100001026 399
410 3300015262 Ga0182007_10000030 Ga0182007_1000003026 399
411 3300015265 Ga0182005_1000009 Ga0182005_1000009401 399
412 3300021361 Ga0213872_10000523 Ga0213872_1000052310 399
413 3300021361 Ga0213872_10011662 Ga0213872_100116621 399
414 3300021361 Ga0213872_10013790 Ga0213872_100137902 399
415 3300021361 Ga0213872_10039873 Ga0213872_100398732 399
416 3300021384 Ga0213876_10107298 Ga0213876_101072981 399
417 3300025206 Ga0209435_100021 Ga0209435_10002126 399
418 3300025206 Ga0209435_100074 Ga0209435_10007424 399
419 3300025208 Ga0209436_100869 Ga0209436_1008693 399
420 3300025229 Ga0209147_100004 Ga0209147_100004738 399
421 3300025233 Ga0209437_100045 Ga0209437_10004594 399
422 3300025242 Ga0209258_100083 Ga0209258_100083171 399
423 3300025246 Ga0209646_1000057 Ga0209646_1000057143 399
424 3300025246 Ga0209646_1000074 Ga0209646_100007426 399
425 3300025250 Ga0209026_1000058 Ga0209026_1000058177 399
426 3300025256 Ga0209759_1000046 Ga0209759_1000046176 399
427 3300025256 Ga0209759_1000112 Ga0209759_100011254 399
428 3300025258 Ga0209129_1003788 Ga0209129_10037883 399
429 3300025263 Ga0209565_1000006 Ga0209565_1000006392 399
430 3300025272 Ga0209455_1008156 Ga0209455_10081563 399
431 3300025273 Ga0209673_1000004 Ga0209673_1000004437 399
432 3300025273 Ga0209673_1016330 Ga0209673_10163302 399
433 3300025273 Ga0209673_1018668 Ga0209673_10186681 399
434 3300025284 Ga0209130_1000010 Ga0209130_1000010323 399
435 3300025284 Ga0209130_1000013 Ga0209130_1000013349 399
436 3300025284 Ga0209130_1000191 Ga0209130_100019134 399
437 3300025291 Ga0209675_1000006 Ga0209675_1000006391 399
438 3300025292 Ga0209676_1000003 Ga0209676_1000003778 399
439 3300025292 Ga0209676_1006358 Ga0209676_10063587 399
440 3300025294 Ga0209025_1000687 Ga0209025_100068743 399
441 3300025294 Ga0209025_1010541 Ga0209025_10105416 399
442 3300025295 Ga0209564_1000025 Ga0209564_100002523 399
443 3300025295 Ga0209564_1000085 Ga0209564_1000085116 399
444 3300025295 Ga0209564_1001631 Ga0209564_100163112 399
445 3300025295 Ga0209564_1020303 Ga0209564_10203032 399
446 3300025298 Ga0209050_1000004 Ga0209050_1000004760 399
447 3300025299 Ga0209256_1000037 Ga0209256_1000037281 399
448 3300025299 Ga0209256_1000320 Ga0209256_100032048 399
449 3300025299 Ga0209256_1002250 Ga0209256_100225012 399
450 3300025299 Ga0209256_1009820 Ga0209256_10098203 399
451 3300025299 Ga0209256_1030930 Ga0209256_10309302 399
452 3300025302 Ga0207426_1000022 Ga0207426_100002232 399
453 3300025302 Ga0207426_1000036 Ga0207426_1000036323 399
454 3300025302 Ga0207426_1001794 Ga0207426_10017947 399
455 3300025302 Ga0207426_1002644 Ga0207426_10026449 399
456 3300025303 Ga0209051_1000006 Ga0209051_1000006215 399
457 3300025303 Ga0209051_1039420 Ga0209051_10394201 399
458 3300025711 Ga0207696_1000005 Ga0207696_100000574 399
459 3300025711 Ga0207696_1014942 Ga0207696_10149422 399
460 3300025735 Ga0207713_1000002 Ga0207713_1000002316 399
461 3300025735 Ga0207713_1018816 Ga0207713_10188162 399
462 3300025899 Ga0207642_10030714 Ga0207642_100307143 399
463 3300025900 Ga0207710_10014096 Ga0207710_100140962 399
464 3300025900 Ga0207710_10015856 Ga0207710_100158562 399
465 3300025901 Ga0207688_10095460 Ga0207688_100954602 399
466 3300025903 Ga0207680_10001892 Ga0207680_100018927 399
467 3300025910 Ga0207684_10268390 Ga0207684_102683901 399
468 3300025911 Ga0207654_10002301 Ga0207654_100023014 399
469 3300025911 Ga0207654_10004032 Ga0207654_100040327 399
470 3300025911 Ga0207654_10080279 Ga0207654_100802793 399
471 3300025912 Ga0207707_10002920 Ga0207707_100029207 399
472 3300025912 Ga0207707_10003000 Ga0207707_1000300013 399
473 3300025912 Ga0207707_10017442 Ga0207707_100174424 399
474 3300025912 Ga0207707_10018558 Ga0207707_100185587 399
475 3300025912 Ga0207707_10025363 Ga0207707_100253633 399
476 3300025912 Ga0207707_10085423 Ga0207707_100854232 399
477 3300025912 Ga0207707_10133024 Ga0207707_101330242 399
478 3300025913 Ga0207695_10000471 Ga0207695_1000047111 399
479 3300025913 Ga0207695_10000776 Ga0207695_1000077618 399
480 3300025913 Ga0207695_10010991 Ga0207695_100109913 399
481 3300025913 Ga0207695_10020093 Ga0207695_100200934 399
482 3300025913 Ga0207695_10034697 Ga0207695_100346973 399
483 3300025913 Ga0207695_10042276 Ga0207695_100422762 399
484 3300025913 Ga0207695_10049827 Ga0207695_100498273 399
485 3300025913 Ga0207695_10058899 Ga0207695_100588994 399
486 3300025913 Ga0207695_10059123 Ga0207695_100591233 399
487 3300025913 Ga0207695_10140611 Ga0207695_101406111 399
488 3300025914 Ga0207671_10067008 Ga0207671_100670081 399
489 3300025914 Ga0207671_10125706 Ga0207671_101257062 399
490 3300025915 Ga0207693_10000245 Ga0207693_1000024525 399
491 3300025915 Ga0207693_10015257 Ga0207693_100152575 399
492 3300025915 Ga0207693_10023591 Ga0207693_100235916 399
493 3300025916 Ga0207663_10058484 Ga0207663_100584843 399
494 3300025917 Ga0207660_10185308 Ga0207660_101853082 399
495 3300025917 Ga0207660_10222041 Ga0207660_102220412 399
496 3300025919 Ga0207657_10003974 Ga0207657_100039744 399
497 3300025920 Ga0207649_10148192 Ga0207649_101481922 399
498 3300025921 Ga0207652_10014668 Ga0207652_100146684 399
499 3300025921 Ga0207652_10017165 Ga0207652_100171654 399
500 3300025921 Ga0207652_10090331 Ga0207652_100903314 399
501 3300025924 Ga0207694_10001821 Ga0207694_100018211 399
502 3300025924 Ga0207694_10006998 Ga0207694_100069985 399
503 3300025924 Ga0207694_10047733 Ga0207694_100477334 399
504 3300025924 Ga0207694_10077597 Ga0207694_100775974 399
505 3300025924 Ga0207694_10147527 Ga0207694_101475272 399
506 3300025925 Ga0207650_10000745 Ga0207650_100007454 399
507 3300025927 Ga0207687_10021803 Ga0207687_100218034 399
508 3300025927 Ga0207687_10126370 Ga0207687_101263702 399
509 3300025928 Ga0207700_10076405 Ga0207700_100764052 399
510 3300025928 Ga0207700_10111680 Ga0207700_101116802 399
511 3300025929 Ga0207664_10186473 Ga0207664_101864732 399
512 3300025929 Ga0207664_10209203 Ga0207664_102092031 399
513 3300025931 Ga0207644_10005836 Ga0207644_100058366 399
514 3300025931 Ga0207644_10054521 Ga0207644_100545213 399
515 3300025933 Ga0207706_10114151 Ga0207706_101141513 399
516 3300025934 Ga0207686_10126294 Ga0207686_101262941 399
517 3300025935 Ga0207709_10057705 Ga0207709_100577053 399
518 3300025936 Ga0207670_10074848 Ga0207670_100748483 399
519 3300025939 Ga0207665_10001531 Ga0207665_100015316 399
520 3300025939 Ga0207665_10009385 Ga0207665_100093853 399
521 3300025940 Ga0207691_10206589 Ga0207691_102065892 399
522 3300025941 Ga0207711_10020187 Ga0207711_100201873 399
523 3300025941 Ga0207711_10042882 Ga0207711_100428823 399
524 3300025942 Ga0207689_10003574 Ga0207689_100035744 399
525 3300025944 Ga0207661_10056496 Ga0207661_100564963 399
526 3300025944 Ga0207661_10066357 Ga0207661_100663572 399
527 3300025944 Ga0207661_10194725 Ga0207661_101947252 399
528 3300025944 Ga0207661_10242893 Ga0207661_102428932 399
529 3300025949 Ga0207667_10000399 Ga0207667_100003997 399
530 3300025949 Ga0207667_10001596 Ga0207667_100015963 399
531 3300025949 Ga0207667_10018532 Ga0207667_100185324 399
532 3300025949 Ga0207667_10061184 Ga0207667_100611843 399
533 3300025961 Ga0207712_10010235 Ga0207712_100102354 399
534 3300026035 Ga0207703_10000259 Ga0207703_1000025954 399
535 3300026035 Ga0207703_10019229 Ga0207703_100192293 399
536 3300026035 Ga0207703_10356729 Ga0207703_103567291 399
537 3300026041 Ga0207639_10053821 Ga0207639_100538212 399
538 3300026041 Ga0207639_10389788 Ga0207639_103897881 399
539 3300026067 Ga0207678_10038195 Ga0207678_100381952 399
540 3300026067 Ga0207678_10046814 Ga0207678_100468142 399
541 3300026067 Ga0207678_10106260 Ga0207678_101062601 399
542 3300026078 Ga0207702_10011423 Ga0207702_100114238 399
543 3300026078 Ga0207702_10021345 Ga0207702_100213452 399
544 3300026088 Ga0207641_10000196 Ga0207641_1000019658 399
545 3300026088 Ga0207641_10002905 Ga0207641_100029052 399
546 3300026088 Ga0207641_10035754 Ga0207641_100357544 399
547 3300026089 Ga0207648_10005986 Ga0207648_100059869 399
548 3300026116 Ga0207674_10000042 Ga0207674_1000004268 399
549 3300026116 Ga0207674_10017528 Ga0207674_100175283 399
550 3300026116 Ga0207674_10050909 Ga0207674_100509092 399
551 3300026121 Ga0207683_10156324 Ga0207683_101563242 399
552 3300027111 Ga0209281_1000179 Ga0209281_1000179113 399
553 3300027671 Ga0209588_1007148 Ga0209588_10071482 399
554 3300027671 Ga0209588_1009766 Ga0209588_10097663 399
555 3300027907 Ga0207428_10000040 Ga0207428_1000004035 399
556 3300028379 Ga0268266_10000512 Ga0268266_1000051232 399
557 3300028379 Ga0268266_10003024 Ga0268266_100030243 399
558 3300028379 Ga0268266_10017708 Ga0268266_100177082 399
559 3300028379 Ga0268266_10024513 Ga0268266_100245133 399
560 3300028379 Ga0268266_10097277 Ga0268266_100972773 399
561 3300028379 Ga0268266_10180864 Ga0268266_101808642 399
562 3300028380 Ga0268265_10140521 Ga0268265_101405212 399
563 3300028381 Ga0268264_10000182 Ga0268264_1000018281 399
564 3300028381 Ga0268264_10006165 Ga0268264_100061657 399
565 3300028381 Ga0268264_10036379 Ga0268264_100363792 399
566 3300028381 Ga0268264_10179163 Ga0268264_101791632 399
567 3300028563 Ga0265319_1001093 Ga0265319_10010937 399
568 3300028577 Ga0265318_10000259 Ga0265318_1000025917 399
569 3300028794 Ga0307515_10015010 Ga0307515_1001501012 399
570 3300028800 Ga0265338_10064956 Ga0265338_100649561 399
571 3300030521 Ga0307511_10000008 Ga0307511_1000000842 399
572 3300031238 Ga0265332_10005055 Ga0265332_100050553 399
573 3300031240 Ga0265320_10000057 Ga0265320_1000005779 399
574 3300031241 Ga0265325_10022067 Ga0265325_100220672 399
575 3300031241 Ga0265325_10036749 Ga0265325_100367492 399
576 3300031242 Ga0265329_10000235 Ga0265329_100002358 399
577 3300031247 Ga0265340_10019722 Ga0265340_100197222 399
578 3300031250 Ga0265331_10000041 Ga0265331_1000004174 399
579 3300031344 Ga0265316_10003938 Ga0265316_100039389 399
580 3300031507 Ga0307509_10000099 Ga0307509_10000099102 399
581 3300031595 Ga0265313_10001609 Ga0265313_1000160913 399
582 3300031711 Ga0265314_10009866 Ga0265314_100098667 399
583 3300031712 Ga0265342_10000124 Ga0265342_1000012424 399
584 3300031852 Ga0307410_10232781 Ga0307410_102327812 399
585 3300032002 Ga0307416_100090149 Ga0307416_1000901493 399
586 3300032004 Ga0307414_10142053 Ga0307414_101420531 399
587 3300032005 Ga0307411_10025255 Ga0307411_100252554 399
588 3300033180 Ga0307510_10000003 Ga0307510_1000000395 399
589 3300035083 Ga0373926_0016824 Ga0373926_0016824_147_1352 399
590 3300035086 Ga0373934_0002106 Ga0373934_0002106_5446_6651 399
591 3300035111 Ga0373923_0010433 Ga0373923_0010433_1395_2600 399
592 3300035114 Ga0373939_0028085 Ga0373939_0028085_37_1242 399
593 3300035116 Ga0373945_0037383 Ga0373945_0037383_420_1625 399
594 3300035118 Ga0373954_0003051 Ga0373954_0003051_2876_4081 399
595 3300035118 Ga0373954_0029875 Ga0373954_0029875_871_2076 399
596 3300035119 Ga0373956_0000242 Ga0373956_0000242_11360_12565 399
597 3300035171 Ga0373946_0021451 Ga0373946_0021451_732_1937 399
598 3300035172 Ga0373955_0016254 Ga0373955_0016254_1031_2236 399
599 3300035172 Ga0373955_0026367 Ga0373955_0026367_686_1891 399
600 3300035172 Ga0373955_0112459 Ga0373955_0112459_142_1347 399
601 3300035410 Ga0373924_0002488 Ga0373924_0002488_1773_2978 399
602 3300035692 Ga0373935_0182616 Ga0373935_0182616_119_1333 399
603 3300035695 Ga0373927_0032769 Ga0373927_0032769_1628_2833 399
604 3300035695 Ga0373927_0047483 Ga0373927_0047483_1158_2372 399
605 3300035695 Ga0373927_0058624 Ga0373927_0058624_258_1463 399
606 3300035724 Ga0373933_0007183 Ga0373933_0007183_846_2051 399
607 3300035724 Ga0373933_0084299 Ga0373933_0084299_435_1640 399
608 3300035725 Ga0373947_0033007 Ga0373947_0033007_464_1669 399
609 3300035725 Ga0373947_0127092 Ga0373947_0127092_350_1555 399
610 3300036401 Ga0373937_0038961 Ga0373937_0038961_2511_3716 399
611 3300036401 Ga0373937_0097241 Ga0373937_0097241_328_1533 399
612 3300037068 Ga0373925_0000300 Ga0373925_0000300_4192_5397 399
613 3300037068 Ga0373925_0012304 Ga0373925_0012304_4444_5751 399
614 3300037068 Ga0373925_0122088 Ga0373925_0122088_548_1753 399
615 3300037068 Ga0373925_0129063 Ga0373925_0129063_438_1643 399
616 3300037068 Ga0373925_0173869 Ga0373925_0173869_252_1457 399
617 3300037312 Ga0395899_0000093 Ga0395899_0000093_102955_104160 399
618 3300038726 Ga0400490_25320 Ga0400490_25320_25540_26745 399
619 3300038727 Ga0400491_04543 Ga0400491_04543_711_1916 399
620 3300039110 Ga0400487_32217 Ga0400487_32217_21799_23004 399
621 3300039110 Ga0400487_61000 Ga0400487_61000_3471_4676 399
622 3300039437 Ga0436365_0268609 Ga0436365_0268609_2285_3490 399
623 3300039437 Ga0436365_1801098 Ga0436365_1801098_4352_5557 399
624 3300039438 Ga0436360_0201373 Ga0436360_0201373_1883_3088 399
625 3300039438 Ga0436360_0661826 Ga0436360_0661826_147_1352 399
626 3300039447 Ga0436361_0411839 Ga0436361_0411839_1386_2591 399
627 3300039447 Ga0436361_0590398 Ga0436361_0590398_9594_10799 399
628 3300042010 Ga0439452_000014 Ga0439452_000014_32287_33492 399
629 3300042016 Ga0439463_000483 Ga0439463_000483_2182_3387 399
630 3300042122 Ga0450920_015654 Ga0450920_015654_13_1218 399
631 3300042439 Ga0439464_0008277 Ga0439464_0008277_267_1472 399
632 3300042876 Ga0451577_0001799 Ga0451577_0001799_24263_25471 399
633 3300042876 Ga0451577_0008240 Ga0451577_0008240_2358_3563 399
634 3300044656 Ga0466969_0004853 Ga0466969_0004853_2630_3835 399
635 3300044673 Ga0453683_0004409 Ga0453683_0004409_6979_8187 399
636 3300044684 Ga0466966_0001376 Ga0466966_0001376_4126_5331 399
637 3300044693 Ga0466961_0000376 Ga0466961_0000376_6695_7900 399
638 3300044706 Ga0466964_0002233 Ga0466964_0002233_1398_2603 399
639 3300044712 Ga0453684_0013054 Ga0453684_0013054_12221_13429 399
640 3300044719 Ga0466971_0000405 Ga0466971_0000405_14859_16064 399
641 3300044765 Ga0466970_0002295 Ga0466970_0002295_6695_7900 399
642 3300044842 Ga0466957_0024969 Ga0466957_0024969_763_1968 399
643 3300045049 Ga0466959_0000875 Ga0466959_0000875_12652_13857 399
644 3300045049 Ga0466959_0003679 Ga0466959_0003679_3049_4254 399
645 3300045049 Ga0466959_0040113 Ga0466959_0040113_1997_3202 399
646 3300045836 Ga0466958_0045289 Ga0466958_0045289_212_1417 399
647 3300046452 Ga0495617_000102 Ga0495617_000102_9859_11064 399
648 3300046454 Ga0495592_0022246 Ga0495592_0022246_1870_3075 399
649 3300046455 Ga0495603_0087967 Ga0495603_0087967_42_1244 399
650 3300046460 Ga0495638_0055259 Ga0495638_0055259_189_1394 399
651 3300046460 Ga0495638_0067627 Ga0495638_0067627_838_2052 399
652 3300046462 Ga0495651_0000348 Ga0495651_0000348_18347_19552 399
653 3300046462 Ga0495651_0013606 Ga0495651_0013606_1203_2408 399
654 3300046462 Ga0495651_0028066 Ga0495651_0028066_467_1672 399
655 3300046463 Ga0495653_0004156 Ga0495653_0004156_9544_10749 399
656 3300046463 Ga0495653_0006412 Ga0495653_0006412_485_1690 399
657 3300046463 Ga0495653_0135064 Ga0495653_0135064_133_1338 399
658 3300046471 Ga0495650_0000005 Ga0495650_0000005_522781_523986 399
659 3300046471 Ga0495650_0005139 Ga0495650_0005139_4716_5921 399
660 3300046471 Ga0495650_0006809 Ga0495650_0006809_2361_3566 399
661 3300046472 Ga0495580_0002011 Ga0495580_0002011_16361_17566 399
662 3300046472 Ga0495580_0002088 Ga0495580_0002088_10970_12175 399
663 3300046472 Ga0495580_0019041 Ga0495580_0019041_893_2098 399
664 3300046472 Ga0495580_0020188 Ga0495580_0020188_314_1555 399
665 3300046472 Ga0495580_0050048 Ga0495580_0050048_1551_2756 399
666 3300046472 Ga0495580_0146630 Ga0495580_0146630_165_1379 399
667 3300046473 Ga0495582_0056196 Ga0495582_0056196_460_1665 399
668 3300046474 Ga0495605_0006358 Ga0495605_0006358_5027_6232 399
669 3300046475 Ga0495639_0049491 Ga0495639_0049491_548_1753 399
670 3300046476 Ga0495662_0050420 Ga0495662_0050420_157_1362 399
671 3300046476 Ga0495662_0083488 Ga0495662_0083488_15_1220 399
672 3300046491 Ga0495584_0002192 Ga0495584_0002192_7569_8774 399
673 3300046491 Ga0495584_0012645 Ga0495584_0012645_2984_4189 399
674 3300046492 Ga0495585_0003916 Ga0495585_0003916_1174_2379 399
675 3300046492 Ga0495585_0021789 Ga0495585_0021789_2026_3231 399
676 3300046492 Ga0495585_0046010 Ga0495585_0046010_603_1808 399
677 3300046499 Ga0495594_0000446 Ga0495594_0000446_9868_11073 399
678 3300046499 Ga0495594_0008871 Ga0495594_0008871_3538_4743 399
679 3300046499 Ga0495594_0009958 Ga0495594_0009958_2309_3514 399
680 3300046500 Ga0495596_0000101 Ga0495596_0000101_55368_56573 399
681 3300046500 Ga0495596_0004579 Ga0495596_0004579_4811_6016 399
682 3300046501 Ga0495607_0000130 Ga0495607_0000130_6793_7998 399
683 3300046501 Ga0495607_0004562 Ga0495607_0004562_6720_7925 399
684 3300046501 Ga0495607_0067818 Ga0495607_0067818_544_1749 399
685 3300046506 Ga0495583_0000193 Ga0495583_0000193_47286_48500 399
686 3300046506 Ga0495583_0008294 Ga0495583_0008294_4718_5923 399
687 3300046506 Ga0495583_0016708 Ga0495583_0016708_2654_3859 399
688 3300046507 Ga0495606_0001674 Ga0495606_0001674_5348_6553 399
689 3300046507 Ga0495606_0002849 Ga0495606_0002849_6736_7941 399
690 3300046507 Ga0495606_0003983 Ga0495606_0003983_5330_6535 399
691 3300046507 Ga0495606_0055672 Ga0495606_0055672_1099_2304 399
692 3300046511 Ga0495608_0019974 Ga0495608_0019974_215_1420 399
693 3300046512 Ga0495610_0001540 Ga0495610_0001540_8046_9251 399
694 3300046513 Ga0495616_0000103 Ga0495616_0000103_53545_54750 399
695 3300046513 Ga0495616_0027556 Ga0495616_0027556_1398_2603 399
696 3300046513 Ga0495616_0071247 Ga0495616_0071247_304_1509 399
697 3300046514 Ga0495618_0013834 Ga0495618_0013834_3100_4305 399
698 3300046514 Ga0495618_0020574 Ga0495618_0020574_497_1702 399
699 3300046516 Ga0495628_0001861 Ga0495628_0001861_5262_6467 399
700 3300046516 Ga0495628_0065434 Ga0495628_0065434_626_1831 399
701 3300046517 Ga0495630_0011337 Ga0495630_0011337_1811_3025 399
702 3300046517 Ga0495630_0032771 Ga0495630_0032771_2240_3445 399
703 3300046517 Ga0495630_0148687 Ga0495630_0148687_555_1760 399
704 3300046518 Ga0495631_0003800 Ga0495631_0003800_2614_3819 399
705 3300046518 Ga0495631_0008257 Ga0495631_0008257_3436_4641 399
706 3300046520 Ga0495637_0000926 Ga0495637_0000926_2739_3944 399
707 3300046520 Ga0495637_0075608 Ga0495637_0075608_17_1222 399
708 3300046522 Ga0495643_0000192 Ga0495643_0000192_65151_66356 399
709 3300046522 Ga0495643_0006207 Ga0495643_0006207_6342_7547 399
710 3300046524 Ga0495648_0001877 Ga0495648_0001877_7694_8899 399
711 3300046524 Ga0495648_0008158 Ga0495648_0008158_34_1239 399
712 3300046524 Ga0495648_0042718 Ga0495648_0042718_651_1868 399
713 3300046526 Ga0495666_0019718 Ga0495666_0019718_1758_2963 399
714 3300046526 Ga0495666_0032636 Ga0495666_0032636_606_1811 399
715 3300046530 Ga0495654_0000005 Ga0495654_0000005_389284_390489 399
716 3300046530 Ga0495654_0006665 Ga0495654_0006665_906_2111 399
717 3300046531 Ga0495665_0050933 Ga0495665_0050933_307_1512 399
718 3300046533 Ga0495640_0125800 Ga0495640_0125800_199_1404 399
719 3300046535 Ga0495586_0004892 Ga0495586_0004892_3798_5003 399
720 3300046535 Ga0495586_0044988 Ga0495586_0044988_1016_2221 399
721 3300046535 Ga0495586_0146199 Ga0495586_0146199_112_1317 399
722 3300046536 Ga0495587_0044903 Ga0495587_0044903_199_1404 399
723 3300046542 Ga0495597_0001100 Ga0495597_0001100_545_1750 399
724 3300046558 Ga0495633_0064456 Ga0495633_0064456_258_1463 399
725 3300046559 Ga0495667_0003887 Ga0495667_0003887_6188_7393 399
726 3300046559 Ga0495667_0043170 Ga0495667_0043170_803_2008 399
727 3300046559 Ga0495667_0081970 Ga0495667_0081970_633_1838 399
728 3300046615 Ga0495656_0014247 Ga0495656_0014247_1609_2814 399
729 3300046616 Ga0495668_0000008 Ga0495668_0000008_76575_77780 399
730 3300046616 Ga0495668_0004107 Ga0495668_0004107_375_1580 399
731 3300046642 Ga0495634_0037638 Ga0495634_0037638_327_1532 399
732 3300046648 Ga0495611_0001932 Ga0495611_0001932_5603_6808 399
733 3300046648 Ga0495611_0008093 Ga0495611_0008093_417_1622 399
734 3300046660 Ga0495625_0001718 Ga0495625_0001718_14786_15988 399
735 3300046660 Ga0495625_0022308 Ga0495625_0022308_2913_4118 399
736 3300046660 Ga0495625_0026038 Ga0495625_0026038_741_1946 399
737 3300046663 Ga0495635_0062625 Ga0495635_0062625_700_1905 399
738 3300046663 Ga0495635_0154072 Ga0495635_0154072_292_1497 399
739 3300046674 Ga0495588_0009267 Ga0495588_0009267_78_1283 399
740 3300046674 Ga0495588_0016076 Ga0495588_0016076_2147_3352 399
741 3300046674 Ga0495588_0045257 Ga0495588_0045257_628_1833 399
742 3300046675 Ga0495657_0007580 Ga0495657_0007580_2038_3243 399
743 3300046678 Ga0495599_0012765 Ga0495599_0012765_2052_3257 399
744 3300046681 Ga0495647_0022142 Ga0495647_0022142_716_1921 399
745 3300046683 Ga0495658_0068550 Ga0495658_0068550_523_1728 399
746 3300046689 Ga0495613_0028378 Ga0495613_0028378_327_1532 399
747 3300046690 Ga0495624_0162647 Ga0495624_0162647_110_1315 399
748 3300046691 Ga0495670_0015449 Ga0495670_0015449_1908_3113 399
749 3300046691 Ga0495670_0128351 Ga0495670_0128351_55_1260 399
750 3300046692 Ga0495671_0000074 Ga0495671_0000074_32804_34042 399
751 3300046809 Ga0495600_0001912 Ga0495600_0001912_5556_6761 399
752 3300046809 Ga0495600_0003135 Ga0495600_0003135_7903_9108 399
753 3300046810 Ga0495660_0039808 Ga0495660_0039808_543_1748 399
754 3300046810 Ga0495660_0081744 Ga0495660_0081744_385_1590 399
755 3300047315 Ga0495581_0111988 Ga0495581_0111988_306_1520 399
756 3300047317 Ga0495604_0002736 Ga0495604_0002736_875_2080 399
757 3300047317 Ga0495604_0041001 Ga0495604_0041001_2042_3247 399
758 3300047317 Ga0495604_0090131 Ga0495604_0090131_601_1806 399
759 3300047318 Ga0495636_0001344 Ga0495636_0001344_7480_8685 399
760 3300047319 Ga0495674_0002913 Ga0495674_0002913_1621_2826 399
761 3300047319 Ga0495674_0022167 Ga0495674_0022167_2303_3508 399
762 3300047319 Ga0495674_0078327 Ga0495674_0078327_240_1445 399
763 3300047320 Ga0495672_0000576 Ga0495672_0000576_8676_9881 399
764 3300047320 Ga0495672_0013299 Ga0495672_0013299_1873_3078 399
765 3300047321 Ga0495676_0073898 Ga0495676_0073898_542_1747 399
766 3300047322 Ga0495680_0001336 Ga0495680_0001336_7556_8761 399
767 3300047322 Ga0495680_0024344 Ga0495680_0024344_2568_3773 399
768 3300047323 Ga0495683_0009085 Ga0495683_0009085_1271_2476 399
769 3300047323 Ga0495683_0009490 Ga0495683_0009490_407_1612 399
770 3300047444 Ga0495675_0000061 Ga0495675_0000061_58214_59419 399
771 3300047444 Ga0495675_0012333 Ga0495675_0012333_3912_5117 399
772 3300047446 Ga0495679_004406 Ga0495679_004406_2298_3503 399
773 3300047469 Ga0495673_0000252 Ga0495673_0000252_9810_11015 399
774 3300047472 Ga0495686_0005019 Ga0495686_0005019_6997_8202 399
775 3300047472 Ga0495686_0113106 Ga0495686_0113106_294_1499 399
776 3300047673 Ga0495593_0091906 Ga0495593_0091906_89_1294 399
777 3300048088 Ga0495602_0005525 Ga0495602_0005525_5951_7156 399
778 3300048090 Ga0495615_0002903 Ga0495615_0002903_486_1700 399
779 3300048903 Ga0496100_0003279 Ga0496100_0003279_3721_4926 399
780 3300048904 Ga0496101_0002542 Ga0496101_0002542_7577_8782 399
781 3300048905 Ga0496102_0000253 Ga0496102_0000253_26155_27369 399
782 3300048905 Ga0496102_0004416 Ga0496102_0004416_8334_9539 399
783 3300048905 Ga0496102_0006100 Ga0496102_0006100_7860_9065 399
784 3300048906 Ga0496103_0027532 Ga0496103_0027532_765_1979 399
785 3300048906 Ga0496103_0099321 Ga0496103_0099321_490_1704 399
786 3300048907 Ga0496104_0352862 Ga0496104_0352862_93_1298 399
787 3300048908 Ga0496105_0022794 Ga0496105_0022794_175_1380 399
788 3300048908 Ga0496105_0069144 Ga0496105_0069144_1404_2609 399
789 3300048909 Ga0496106_0003355 Ga0496106_0003355_7124_8329 399
790 3300048910 Ga0496107_0002233 Ga0496107_0002233_5672_6877 399
791 3300048912 Ga0496109_0149914 Ga0496109_0149914_29_1234 399
792 3300048913 Ga0496110_0000704 Ga0496110_0000704_4581_5786 399
793 3300048914 Ga0496111_0027318 Ga0496111_0027318_645_1850 399
794 3300048915 Ga0496112_0094432 Ga0496112_0094432_1079_2284 399
795 3300048916 Ga0496113_0118527 Ga0496113_0118527_758_1963 399
796 3300048917 Ga0496114_0004267 Ga0496114_0004267_1126_2331 399
797 3300048917 Ga0496114_0208558 Ga0496114_0208558_109_1314 399
798 3300048918 Ga0496115_0007045 Ga0496115_0007045_1046_2251 399
799 3300048918 Ga0496115_0067942 Ga0496115_0067942_288_1493 399
800 3300048918 Ga0496115_0203522 Ga0496115_0203522_386_1591 399
801 3300048919 Ga0496116_0003291 Ga0496116_0003291_10602_11807 399
802 3300048919 Ga0496116_0040404 Ga0496116_0040404_1070_2272 399
803 3300048919 Ga0496116_0077769 Ga0496116_0077769_774_1979 399
804 3300048920 Ga0496117_0000010 Ga0496117_0000010_217587_218792 399
805 3300048920 Ga0496117_0000020 Ga0496117_0000020_296379_297584 399
806 3300048920 Ga0496117_0000095 Ga0496117_0000095_114934_116139 399
807 3300048920 Ga0496117_0001093 Ga0496117_0001093_16910_18130 399
808 3300048921 Ga0496118_0000003 Ga0496118_0000003_75450_76655 399
809 3300048921 Ga0496118_0000009 Ga0496118_0000009_393163_394368 399
810 3300048921 Ga0496118_0000015 Ga0496118_0000015_311594_312799 399
811 3300048921 Ga0496118_0105408 Ga0496118_0105408_484_1686 399
812 3300048922 Ga0496119_0006799 Ga0496119_0006799_4583_5788 399
813 3300048922 Ga0496119_0020291 Ga0496119_0020291_3186_4391 399
814 3300048922 Ga0496119_0074648 Ga0496119_0074648_670_1875 399
815 3300048922 Ga0496119_0084377 Ga0496119_0084377_66_1271 399
816 3300048922 Ga0496119_0100611 Ga0496119_0100611_224_1429 399
817 3300048923 Ga0496120_0000693 Ga0496120_0000693_24518_25723 399
818 3300048923 Ga0496120_0002649 Ga0496120_0002649_6629_7834 399
819 3300048923 Ga0496120_0054557 Ga0496120_0054557_390_1595 399
820 3300048923 Ga0496120_0060868 Ga0496120_0060868_714_1919 399
821 3300048923 Ga0496120_0065802 Ga0496120_0065802_45_1250 399
822 3300048924 Ga0496121_0000760 Ga0496121_0000760_4544_5749 399
823 3300048924 Ga0496121_0002573 Ga0496121_0002573_3411_4616 399
824 3300048924 Ga0496121_0003236 Ga0496121_0003236_21073_22278 399
825 3300048924 Ga0496121_0005330 Ga0496121_0005330_7723_8928 399
826 3300048924 Ga0496121_0005691 Ga0496121_0005691_8139_9344 399
827 3300048924 Ga0496121_0013141 Ga0496121_0013141_4098_5303 399
828 3300048925 Ga0496122_0000491 Ga0496122_0000491_66325_67527 399
829 3300048925 Ga0496122_0001880 Ga0496122_0001880_21189_22394 399
830 3300048925 Ga0496122_0005531 Ga0496122_0005531_13124_14329 399
831 3300048925 Ga0496122_0064238 Ga0496122_0064238_964_2169 399
832 3300048926 Ga0496123_0000488 Ga0496123_0000488_58413_59615 399
833 3300048926 Ga0496123_0008787 Ga0496123_0008787_7327_8532 399
834 3300048926 Ga0496123_0017366 Ga0496123_0017366_2753_3958 399
835 3300048926 Ga0496123_0112970 Ga0496123_0112970_178_1383 399
836 3300048927 Ga0496124_0005346 Ga0496124_0005346_5422_6627 399
837 3300048927 Ga0496124_0077686 Ga0496124_0077686_942_2147 399
838 3300048927 Ga0496124_0220544 Ga0496124_0220544_17_1222 399
839 3300048928 Ga0496125_0000757 Ga0496125_0000757_21325_22527 399
840 3300048928 Ga0496125_0021615 Ga0496125_0021615_3177_4382 399
841 3300048928 Ga0496125_0022315 Ga0496125_0022315_1778_2983 399
842 3300048928 Ga0496125_0110181 Ga0496125_0110181_773_1978 399
843 3300048929 Ga0496126_0003855 Ga0496126_0003855_5704_6909 399
844 3300048929 Ga0496126_0017291 Ga0496126_0017291_1138_2343 399
845 3300048929 Ga0496126_0087972 Ga0496126_0087972_1517_2722 399
846 3300048929 Ga0496126_0306455 Ga0496126_0306455_58_1263 399
847 3300049459 Ga0495678_036141 Ga0495678_036141_304_1509 399
848 3300049570 Ga0501033_0001575 Ga0501033_0001575_11301_12506 399
849 3300049583 Ga0501067_0008950 Ga0501067_0008950_288_1493 399
850 3300049584 Ga0501068_0000229 Ga0501068_0000229_16935_18140 399
851 3300049588 Ga0501072_0000003 Ga0501072_0000003_225739_226944 399
852 3300049590 Ga0501074_0002384 Ga0501074_0002384_5399_6604 399
853 3300049592 Ga0501076_0157196 Ga0501076_0157196_525_1730 399
854 3300049741 Ga0501079_0007057 Ga0501079_0007057_7187_8392 399
855 3300049822 Ga0501035_0006107 Ga0501035_0006107_2611_3816 399
856 3300049823 Ga0501044_0002141 Ga0501044_0002141_19309_20514 399
857 3300049823 Ga0501044_0179097 Ga0501044_0179097_674_1879 399
858 3300050491 nmdc:mga00v17_21_c1 nmdc:mga00v17_21_c1_25000_26205 399
859 3300050491 nmdc:mga00v17_31_c1 nmdc:mga00v17_31_c1_63292_64497 399
860 3300050511 nmdc:mga08y16_233_c1 nmdc:mga08y16_233_c1_12525_13730 399
861 3300050514 nmdc:mga08x19_511_c1 nmdc:mga08x19_511_c1_11527_12732 399
862 3300050515 nmdc:mga0a205_131476_c1 nmdc:mga0a205_131476_c1_997_2202 399
863 3300053077 Ga0495601_0123143 Ga0495601_0123143_281_1486 399
864 3300053084 Ga0495595_0025762 Ga0495595_0025762_1071_2276 399
865 3300053090 Ga0500646_0044336 Ga0500646_0044336_40_1245 399
866 3300053104 Ga0500556_0001489 Ga0500556_0001489_4080_5285 399
867 3300053105 Ga0500557_009266 Ga0500557_009266_1049_2254 399
868 3300053115 Ga0500591_022251 Ga0500591_022251_1230_2435 399
869 3300053125 Ga0500618_000946 Ga0500618_000946_1054_2259 399
870 3300053134 Ga0500658_0017191 Ga0500658_0017191_428_1633 399
871 3300053146 Ga0500588_0000099 Ga0500588_0000099_7939_9144 399
872 3300053156 Ga0500622_0031117 Ga0500622_0031117_787_2043 399
873 3300053157 Ga0500624_008964 Ga0500624_008964_81_1286 399
874 3300053163 Ga0500639_057883 Ga0500639_057883_666_1871 399
875 3300053177 Ga0500636_0000038 Ga0500636_0000038_24603_25808 399
876 3300054114 Ga0501084_0000794 Ga0501084_0000794_10897_12102 399
877 3300059493 Ga0587077_004819 Ga0587077_004819_220_1425 399
878 3300060353 Ga0501082_0000045 Ga0501082_0000045_27391_28596 399
879 3300061719 Ga0466962_0000283 Ga0466962_0000283_618_1823 399
880 3300061734 Ga0530510_0050043 Ga0530510_0050043_154_1359 399
881 iso_pu_bacteria 2511231024 2511376222 399
882 iso_pu_bacteria 2852612431 2852617670 399
883 iso_pu_bacteria 2852667396 2852672966 399
884 iso_pu_bacteria 2939636861 2939639374 399
885 iso_pu_bacteria 3000135777 3000137811 399
886 3300004800 Ga0058861_11837734 Ga0058861_118377341 400
887 3300005435 Ga0070714_100086560 Ga0070714_1000865603 400
888 3300005614 Ga0068856_100001980 Ga0068856_10000198012 400
889 3300005937 Ga0081455_10000002 Ga0081455_1000000267 400
890 3300006946 Ga0079104_1011586 Ga0079104_10115862 400
891 3300009036 Ga0105244_10003953 Ga0105244_1000395311 400
892 3300009092 Ga0105250_10001065 Ga0105250_100010658 400
893 3300015261 Ga0182006_1000055 Ga0182006_1000055128 400
894 3300015265 Ga0182005_1000003 Ga0182005_1000003347 400
895 3300025711 Ga0207696_1002284 Ga0207696_100228411 400
896 3300025906 Ga0207699_10049705 Ga0207699_100497053 400
897 3300025915 Ga0207693_10046941 Ga0207693_100469412 400
898 3300025929 Ga0207664_10052053 Ga0207664_100520532 400
899 3300025939 Ga0207665_10022989 Ga0207665_100229893 400
900 3300026078 Ga0207702_10032008 Ga0207702_100320083 400
901 3300027111 Ga0209281_1011946 Ga0209281_10119462 400
902 3300035118 Ga0373954_0001458 Ga0373954_0001458_1527_2744 400
903 3300039437 Ga0436365_0255902 Ga0436365_0255902_2260_3468 400
904 3300039450 Ga0436363_1307392 Ga0436363_1307392_942_2150 400
905 3300046530 Ga0495654_0007231 Ga0495654_0007231_2915_4123 400
906 3300046542 Ga0495597_0000135 Ga0495597_0000135_37585_38793 400
907 3300047317 Ga0495604_0005234 Ga0495604_0005234_8678_9886 400
908 3300047320 Ga0495672_0000155 Ga0495672_0000155_52758_53966 400
909 3300047470 Ga0495681_0017359 Ga0495681_0017359_1237_2445 400
910 3300048907 Ga0496104_0000537 Ga0496104_0000537_12139_13371 400
911 3300048907 Ga0496104_0280899 Ga0496104_0280899_154_1383 400
912 3300049569 Ga0501032_0002698 Ga0501032_0002698_6010_7233 400
913 3300049570 Ga0501033_0000753 Ga0501033_0000753_23179_24402 400
914 3300049570 Ga0501033_0023597 Ga0501033_0023597_2902_4110 400
915 3300049571 Ga0501034_0011345 Ga0501034_0011345_1825_3048 400
916 3300049573 Ga0501037_0004419 Ga0501037_0004419_2801_4024 400
917 3300049573 Ga0501037_0024004 Ga0501037_0024004_621_1844 400
918 3300049574 Ga0501038_0006279 Ga0501038_0006279_3891_5114 400
919 3300049579 Ga0501043_0000559 Ga0501043_0000559_31812_33035 400
920 3300049580 Ga0501046_0001485 Ga0501046_0001485_2753_3976 400
921 3300049581 Ga0501047_0054565 Ga0501047_0054565_2182_3390 400
922 3300049586 Ga0501070_0028668 Ga0501070_0028668_2604_3812 400
923 3300049822 Ga0501035_0002193 Ga0501035_0002193_831_2054 400
924 3300049823 Ga0501044_0000563 Ga0501044_0000563_39594_40817 400
925 3300050514 nmdc:mga08x19_23707_c1 nmdc:mga08x19_23707_c1_2415_3644 400
926 3300046474 Ga0495605_0037577 Ga0495605_0037577_1074_2285 401
927 3300039438 Ga0436360_0721843 Ga0436360_0721843_713_2047 404
928 3300039447 Ga0436361_0787586 Ga0436361_0787586_3153_4490 404
929 3300039453 Ga0436362_0935796 Ga0436362_0935796_1342_2676 404
930 2124908027 MRS2a_Contig_1767 MRS2a_00624890 405
931 2124908027 MRS2a_Contig_1768 MRS2a_00625630 405
932 3300005288 Ga0065714_10000917 Ga0065714_1000091716 405
933 3300009011 Ga0105251_10001382 Ga0105251_100013825 405
934 3300025735 Ga0207713_1000501 Ga0207713_10005015 405

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02803

Thiolase_C

Thiolase, C-terminal domain

284

408

0.96

PF00108

Thiolase_N

Thiolase, N-terminal domain

11

277

0.92

PF00109

ketoacyl-synt

Beta-ketoacyl synthase, N-terminal domain

82

146

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pcc-assembly1.cif.gz_B crystal structure of beta-ketoadipyl-coa thiolase mutant (h356a) in complex hexanoyl coenzyme a 0.9742 2 400
6pca-assembly1.cif.gz_D crystal structure of beta-ketoadipyl-coa thiolase 0.9734 2 400
6pcd-assembly1.cif.gz_B crystal structure of beta-ketoadipyl-coa thiolase mutant (c90s-h356a) in complex octanoyl coenzyme a 0.9731 2 400
6pca-assembly1.cif.gz_C crystal structure of beta-ketoadipyl-coa thiolase 0.9726 2 400
6pcc-assembly1.cif.gz_A crystal structure of beta-ketoadipyl-coa thiolase mutant (h356a) in complex hexanoyl coenzyme a 0.9725 2 400
ID Description Score Start End Superfamily
1ulqE02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9806 140 400 3.40.47.10
af_A0A096MJY8_281_393_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9759 282 394 3.40.47.10
af_O53871_287_399_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9754 282 394 3.40.47.10
1ulqE02 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9752 140 400 3.40.47.10
af_P0C7L2_1_401_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9736 2 400 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A0C1E3A8-F1-model_v4 Beta-ketoadipyl CoA thiolase 0.9944 265 400 GO:0016747
AF-A0A257Y4U2-F1-model_v4 Beta-ketoadipyl CoA thiolase 0.9929 265 400 GO:0003988
GO:0006635
GO:0010124
AF-A0A2E4A3X8-F1-model_v4 deleted 0.992 279 400
AF-A0A2H6HFU3-F1-model_v4 3-oxoadipyl-CoA/3-oxo-5,6-dehydrosuberyl-CoA thiolase (EC 2.3.1.174) 0.9904 285 400 GO:0006635
GO:0010124
GO:0033812
AF-A0A4Q6EKK0-F1-model_v4 deleted 0.9862 260 400

Feature Viewer

pLDDT pTM Quality
92.66 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map