F486078
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 932 | 485 | 731 | 323 |
Family's Representative Sequence
| Representative Sequence | 3300047320|Ga0495672_0022119|Ga0495672_0022119_596_1636 |
| Length | 346 |
| Sequence | MTSPIARSLFKRRRLLTGALVLATGLAYGLLAAPVQAQSQTVNPKLLRIGYQKYGTLTLLKARGTLEKRLASQGITVKWTEFPAGPQLLEGLNVGAVDFGTVGEAPPIFAQAAGAQLAYIGNEPPAPTAEAIVVPKGSALKSVADLRGKRVALNKGSNVHYLLVKQLEAAGVAYSEIQPVYLPPADARAAFERGAVDAWVIWDPFLAAAEKQLGARVLIDGRSADGKNVVSNHQFYLASRPYAQAKPDVVSTILDELAQLGQWAEKHPKDASAVLVKETGLDATVLDLAVSRFSYGAKPVTPAVLAEQQRIADAFHTLKLIPKPIQVADAAWTPPAGKASTQQAQR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 3 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 4 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 5 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 6 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 7 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 8 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 9 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 10 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 11 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 12 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 13 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 14 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 15 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 16 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 17 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 18 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 19 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 20 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 21 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 22 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 23 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 24 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 25 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 26 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 27 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 28 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 29 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 30 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 31 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 32 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 33 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 34 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 35 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 36 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 37 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 38 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 39 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 40 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 41 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 42 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 43 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 44 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 45 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 46 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 47 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 48 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 49 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 50 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 51 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 52 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 53 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 54 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 55 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 56 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 57 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 58 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 59 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 60 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 61 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 62 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 63 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 64 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 65 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 66 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 67 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 68 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 69 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 70 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 71 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 72 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 73 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 74 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 75 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 76 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 77 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 78 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 79 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 80 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 81 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 82 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 83 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 84 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 85 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 86 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 87 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 88 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 89 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 90 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 91 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 92 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 93 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 94 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 95 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 96 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 97 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 98 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 99 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 100 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 101 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 102 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 103 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 104 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 105 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 106 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 107 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 108 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 109 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 110 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 111 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 112 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 113 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 114 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 115 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 116 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 117 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 118 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 119 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 120 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 121 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 122 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 123 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 124 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 125 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 126 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 127 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 128 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 129 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 130 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 131 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 132 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 133 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 134 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 135 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 136 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 137 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 138 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 139 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 140 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 141 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 142 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 143 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 144 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 145 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 146 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 147 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 148 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 149 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 150 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 151 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 152 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 153 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 154 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 155 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 156 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 157 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 158 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 159 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 160 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 161 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 162 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 163 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 164 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 165 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 166 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 167 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 168 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 169 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 170 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 171 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 172 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 173 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 174 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 175 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 176 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 177 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 178 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 179 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 180 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 181 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 182 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 183 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 184 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 185 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 186 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 187 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 188 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 189 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 190 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 191 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 192 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 193 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 194 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 195 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 196 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 197 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 198 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 199 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 200 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 201 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 202 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 203 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 204 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 205 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 206 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 209 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 214 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 215 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 216 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 218 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 219 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 220 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 221 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 222 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 223 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 224 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 225 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 226 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 227 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 228 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 229 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 230 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 231 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 232 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 233 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 234 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 235 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 237 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 238 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 239 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 240 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 241 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 242 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 243 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 244 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 245 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 246 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 247 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 248 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 249 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 250 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 251 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 252 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 254 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 255 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 256 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 257 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 258 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 259 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 261 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 262 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 263 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 264 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 265 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 266 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 267 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 268 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 269 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 270 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 271 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 272 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 273 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 274 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 275 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 276 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 277 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 278 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 279 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 280 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 302 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 303 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 305 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 307 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 308 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 309 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 310 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 311 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 312 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 314 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 315 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 316 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 317 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 318 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 319 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 320 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 321 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 322 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 323 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 324 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 325 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 326 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 327 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 328 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 329 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 330 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 331 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 332 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 333 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 334 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 335 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 336 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 337 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 338 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 339 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 340 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 341 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 342 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 343 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 344 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 345 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 346 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 347 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 348 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 349 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 350 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 351 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 352 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 353 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 354 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 355 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 356 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 357 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 358 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 359 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 360 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 361 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 362 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 363 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 364 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 365 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 433 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 434 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 435 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 436 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 437 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 438 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 439 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 440 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 441 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 442 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 443 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 444 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 445 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 446 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 447 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 448 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 452 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 453 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 454 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 455 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 456 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 457 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 458 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 459 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 460 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 461 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 462 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 463 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 464 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 465 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 466 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 467 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 468 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 469 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 470 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 471 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 472 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 473 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 474 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 475 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 476 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 477 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 478 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 479 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 480 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 481 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 482 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 483 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 484 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 485 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.9 |
| Metatranscriptomes | 0.54 |
| Isolates | 21.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.37 |
| Nodule | 2.9 |
| Rhizoplane | 6.22 |
| Rhizosphere | 65.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1108591 | 2162886007 | Bacteria | 1624 |
| 2 | JGI24740J21852_10000827 | 3300001979 | Bacteria | 13630 |
| 3 | JGI24740J21852_10004627 | 3300001979 | Bacteria | 5902 |
| 4 | JGI25156J39149_1006414 | 3300002705 | Bacteria | 3216 |
| 5 | JGI25162J39368_1000319 | 3300002737 | Bacteria | 42383 |
| 6 | JGI25162J39368_1000474 | 3300002737 | Bacteria | 30875 |
| 7 | JGI25154J39366_1000255 | 3300002738 | Bacteria | 34051 |
| 8 | JGI25163J39215_1000691 | 3300002771 | Bacteria | 8909 |
| 9 | JGI25163J39215_1001488 | 3300002771 | Bacteria | 3765 |
| 10 | JGI25164J39214_1000236 | 3300002772 | Bacteria | 42383 |
| 11 | JGI25164J39214_1000674 | 3300002772 | Bacteria | 13675 |
| 12 | JGI25165J46597_1000434 | 3300003214 | Bacteria | 42383 |
| 13 | JGI25165J46597_1000600 | 3300003214 | Bacteria | 30875 |
| 14 | JGI25153J46596_10000049 | 3300003215 | Bacteria | 141434 |
| 15 | rootH1_10014519 | 3300003316 | Bacteria | 4330 |
| 16 | Ga0055538_1000032 | 3300003751 | Bacteria | 199718 |
| 17 | Ga0055538_1004396 | 3300003751 | Bacteria | 1607 |
| 18 | Ga0055539_1000043 | 3300003752 | Bacteria | 199718 |
| 19 | Ga0055539_1000123 | 3300003752 | Bacteria | 83036 |
| 20 | Ga0055533_1000052 | 3300003756 | Bacteria | 199718 |
| 21 | Ga0055533_1001539 | 3300003756 | Bacteria | 6009 |
| 22 | Ga0055533_1003373 | 3300003756 | Bacteria | 3232 |
| 23 | Ga0055533_1004209 | 3300003756 | Bacteria | 2651 |
| 24 | Ga0055532_1000029 | 3300003758 | Bacteria | 232900 |
| 25 | Ga0055532_1000047 | 3300003758 | Bacteria | 179201 |
| 26 | Ga0055525_1000062 | 3300003759 | Bacteria | 199718 |
| 27 | Ga0055525_1000345 | 3300003759 | Bacteria | 33665 |
| 28 | Ga0055527_1000127 | 3300003760 | Bacteria | 53422 |
| 29 | Ga0055535_1000137 | 3300003761 | Bacteria | 76845 |
| 30 | Ga0055542_1001189 | 3300003762 | Bacteria | 14846 |
| 31 | Ga0055542_1009505 | 3300003762 | Bacteria | 1830 |
| 32 | Ga0055529_1000062 | 3300003763 | Bacteria | 183782 |
| 33 | Ga0055529_1000376 | 3300003763 | Bacteria | 48166 |
| 34 | Ga0055536_1001726 | 3300003781 | Bacteria | 12927 |
| 35 | Ga0055536_1005342 | 3300003781 | Bacteria | 6306 |
| 36 | Ga0055530_10000658 | 3300003791 | Bacteria | 29519 |
| 37 | Ga0055530_10002203 | 3300003791 | Bacteria | 12895 |
| 38 | Ga0055530_10002392 | 3300003791 | Bacteria | 12142 |
| 39 | Ga0055540_1000506 | 3300003792 | Bacteria | 29519 |
| 40 | Ga0055540_1001504 | 3300003792 | Bacteria | 13845 |
| 41 | Ga0055540_1001654 | 3300003792 | Bacteria | 12927 |
| 42 | Ga0055531_10000483 | 3300003794 | Bacteria | 36666 |
| 43 | Ga0055541_1000030 | 3300003841 | Bacteria | 199616 |
| 44 | Ga0055541_1000208 | 3300003841 | Bacteria | 24817 |
| 45 | Ga0065165_1000006 | 3300005262 | Bacteria | 352298 |
| 46 | Ga0065714_10003312 | 3300005288 | Bacteria | 8289 |
| 47 | Ga0065714_10065219 | 3300005288 | Bacteria | 11788 |
| 48 | Ga0065714_10094760 | 3300005288 | Bacteria | 1806 |
| 49 | Ga0065714_10098794 | 3300005288 | Bacteria | 1698 |
| 50 | Ga0065704_10012375 | 3300005289 | Bacteria | 3554 |
| 51 | Ga0065704_10074610 | 3300005289 | Bacteria | 6130 |
| 52 | Ga0065712_10071153 | 3300005290 | Bacteria | 5449 |
| 53 | Ga0070658_10184415 | 3300005327 | Bacteria | 1757 |
| 54 | Ga0070670_100002144 | 3300005331 | Bacteria | 16199 |
| 55 | Ga0070682_100052508 | 3300005337 | Bacteria | 2551 |
| 56 | Ga0070661_100000126 | 3300005344 | Bacteria | 63357 |
| 57 | Ga0070661_100004017 | 3300005344 | Bacteria | 10113 |
| 58 | Ga0070669_100000481 | 3300005353 | Bacteria | 30338 |
| 59 | Ga0070669_100001507 | 3300005353 | Bacteria | 16825 |
| 60 | Ga0070659_100002881 | 3300005366 | Bacteria | 12246 |
| 61 | Ga0070663_100000011 | 3300005455 | Bacteria | 146097 |
| 62 | Ga0070663_100000690 | 3300005455 | Bacteria | 18167 |
| 63 | Ga0070662_100000101 | 3300005457 | Bacteria | 47097 |
| 64 | Ga0068853_100000187 | 3300005539 | Bacteria | 43749 |
| 65 | Ga0070665_100136876 | 3300005548 | Bacteria | 2452 |
| 66 | Ga0070664_100000008 | 3300005564 | Bacteria | 173734 |
| 67 | Ga0070664_100000491 | 3300005564 | Bacteria | 29927 |
| 68 | Ga0068857_100002038 | 3300005577 | Bacteria | 16379 |
| 69 | Ga0068854_100000072 | 3300005578 | Bacteria | 72718 |
| 70 | Ga0068856_100000009 | 3300005614 | Bacteria | 181448 |
| 71 | Ga0068851_10000007 | 3300005834 | Bacteria | 244101 |
| 72 | Ga0075364_10231431 | 3300006051 | Bacteria | 1255 |
| 73 | Ga0075432_10004620 | 3300006058 | Bacteria | 4688 |
| 74 | Ga0075432_10007556 | 3300006058 | Bacteria | 3703 |
| 75 | Ga0075432_10061212 | 3300006058 | Bacteria | 1340 |
| 76 | Ga0075436_100141875 | 3300006914 | Bacteria | 1688 |
| 77 | Ga0075436_100227520 | 3300006914 | Bacteria | 1324 |
| 78 | Ga0099823_1000086 | 3300006944 | Bacteria | 44633 |
| 79 | Ga0099823_1036036 | 3300006944 | Bacteria | 3825 |
| 80 | Ga0079104_1000718 | 3300006946 | Bacteria | 29917 |
| 81 | Ga0099826_10000012 | 3300006948 | Bacteria | 283499 |
| 82 | Ga0099826_10016562 | 3300006948 | Bacteria | 5567 |
| 83 | Ga0105251_10000027 | 3300009011 | Bacteria | 128893 |
| 84 | Ga0105251_10000274 | 3300009011 | Bacteria | 51694 |
| 85 | Ga0105251_10000828 | 3300009011 | Bacteria | 27688 |
| 86 | Ga0105251_10001027 | 3300009011 | Bacteria | 24511 |
| 87 | Ga0105251_10007236 | 3300009011 | Bacteria | 6886 |
| 88 | Ga0105251_10008916 | 3300009011 | Bacteria | 5999 |
| 89 | Ga0105251_10131130 | 3300009011 | Bacteria | 1136 |
| 90 | Ga0105244_10002564 | 3300009036 | Bacteria | 13641 |
| 91 | Ga0105244_10004785 | 3300009036 | Bacteria | 9202 |
| 92 | Ga0105244_10008881 | 3300009036 | Bacteria | 6232 |
| 93 | Ga0105244_10009575 | 3300009036 | Bacteria | 5941 |
| 94 | Ga0105244_10026014 | 3300009036 | Bacteria | 3172 |
| 95 | Ga0105244_10053920 | 3300009036 | Bacteria | 2041 |
| 96 | Ga0105244_10117284 | 3300009036 | Bacteria | 1291 |
| 97 | Ga0105250_10000191 | 3300009092 | Bacteria | 52429 |
| 98 | Ga0105250_10010893 | 3300009092 | Bacteria | 3781 |
| 99 | Ga0105250_10013949 | 3300009092 | Bacteria | 3309 |
| 100 | Ga0105250_10033566 | 3300009092 | Bacteria | 2061 |
| 101 | Ga0105250_10043742 | 3300009092 | Bacteria | 1795 |
| 102 | Ga0105250_10092144 | 3300009092 | Bacteria | 1233 |
| 103 | Ga0105240_10055439 | 3300009093 | Bacteria | 4962 |
| 104 | Ga0105243_10000418 | 3300009148 | Bacteria | 44790 |
| 105 | Ga0105243_10002911 | 3300009148 | Bacteria | 14171 |
| 106 | Ga0105243_10003724 | 3300009148 | Bacteria | 12232 |
| 107 | Ga0105243_10005562 | 3300009148 | Bacteria | 9815 |
| 108 | Ga0105243_10010759 | 3300009148 | Bacteria | 6926 |
| 109 | Ga0105243_10030328 | 3300009148 | Bacteria | 4162 |
| 110 | Ga0105242_10001499 | 3300009176 | Bacteria | 18352 |
| 111 | Ga0105237_10001509 | 3300009545 | Bacteria | 30588 |
| 112 | Ga0105249_10006152 | 3300009553 | Bacteria | 10410 |
| 113 | Ga0105246_10000446 | 3300011119 | Bacteria | 22168 |
| 114 | Ga0105246_10001749 | 3300011119 | Bacteria | 12998 |
| 115 | Ga0105246_10021610 | 3300011119 | Bacteria | 4143 |
| 116 | Ga0157345_1000031 | 3300012498 | Bacteria | 35083 |
| 117 | Ga0157373_10005361 | 3300013100 | Bacteria | 9635 |
| 118 | Ga0157373_10033054 | 3300013100 | Bacteria | 3723 |
| 119 | Ga0157373_10040572 | 3300013100 | Bacteria | 3330 |
| 120 | Ga0157371_10000068 | 3300013102 | Bacteria | 168110 |
| 121 | Ga0157371_10000609 | 3300013102 | Bacteria | 42602 |
| 122 | Ga0157371_10003267 | 3300013102 | Bacteria | 14869 |
| 123 | Ga0157371_10040665 | 3300013102 | Bacteria | 3320 |
| 124 | Ga0157370_10000200 | 3300013104 | Bacteria | 75469 |
| 125 | Ga0157370_10064044 | 3300013104 | Bacteria | 3481 |
| 126 | Ga0157370_10196182 | 3300013104 | Bacteria | 1874 |
| 127 | Ga0157370_10218524 | 3300013104 | Bacteria | 1765 |
| 128 | Ga0157369_10005953 | 3300013105 | Bacteria | 14161 |
| 129 | Ga0157369_10020339 | 3300013105 | Bacteria | 7420 |
| 130 | Ga0157369_10028400 | 3300013105 | Bacteria | 6191 |
| 131 | Ga0163162_10000591 | 3300013306 | Bacteria | 33702 |
| 132 | Ga0157372_10002606 | 3300013307 | Bacteria | 19510 |
| 133 | Ga0157372_10009606 | 3300013307 | Bacteria | 10280 |
| 134 | Ga0157372_10109564 | 3300013307 | Bacteria | 3162 |
| 135 | Ga0157375_10024520 | 3300013308 | Bacteria | 5585 |
| 136 | Ga0182008_10000293 | 3300014497 | Bacteria | 39393 |
| 137 | Ga0182008_10005460 | 3300014497 | Bacteria | 7239 |
| 138 | Ga0182008_10032172 | 3300014497 | Bacteria | 2636 |
| 139 | Ga0182006_1001907 | 3300015261 | Bacteria | 11876 |
| 140 | Ga0182006_1006450 | 3300015261 | Bacteria | 5450 |
| 141 | Ga0182006_1066241 | 3300015261 | Bacteria | 1350 |
| 142 | Ga0182007_10000284 | 3300015262 | Bacteria | 33721 |
| 143 | Ga0182007_10013025 | 3300015262 | Bacteria | 3186 |
| 144 | Ga0182005_1002545 | 3300015265 | Bacteria | 6473 |
| 145 | Ga0182005_1013344 | 3300015265 | Bacteria | 2310 |
| 146 | Ga0182005_1023817 | 3300015265 | Bacteria | 1672 |
| 147 | Ga0163161_10017835 | 3300017792 | Bacteria | 4973 |
| 148 | Ga0163161_10022215 | 3300017792 | Bacteria | 4465 |
| 149 | Ga0163161_10026201 | 3300017792 | Bacteria | 4130 |
| 150 | Ga0197907_10647456 | 3300020069 | Bacteria | 1834 |
| 151 | Ga0206351_10300647 | 3300020077 | Bacteria | 2051 |
| 152 | Ga0206353_10328413 | 3300020082 | Bacteria | 1832 |
| 153 | Ga0154015_1082437 | 3300020610 | Bacteria | 3647 |
| 154 | Ga0213875_10007177 | 3300021388 | Bacteria | 5787 |
| 155 | Ga0224572_1007229 | 3300024225 | Bacteria | 2030 |
| 156 | Ga0209435_100821 | 3300025206 | Bacteria | 4907 |
| 157 | Ga0209760_100027 | 3300025207 | Bacteria | 153290 |
| 158 | Ga0209760_100149 | 3300025207 | Bacteria | 43212 |
| 159 | Ga0209784_100003 | 3300025224 | Bacteria | 1379451 |
| 160 | Ga0209784_100007 | 3300025224 | Bacteria | 747715 |
| 161 | Ga0209784_100482 | 3300025224 | Bacteria | 16070 |
| 162 | Ga0209784_100539 | 3300025224 | Bacteria | 13930 |
| 163 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 164 | Ga0209566_100009 | 3300025225 | Bacteria | 554018 |
| 165 | Ga0209566_100970 | 3300025225 | Bacteria | 12691 |
| 166 | Ga0209674_100008 | 3300025226 | Bacteria | 1076909 |
| 167 | Ga0209674_100021 | 3300025226 | Bacteria | 629811 |
| 168 | Ga0209674_100229 | 3300025226 | Bacteria | 50211 |
| 169 | Ga0209674_101455 | 3300025226 | Bacteria | 6246 |
| 170 | Ga0209672_100015 | 3300025228 | Bacteria | 529352 |
| 171 | Ga0209147_100002 | 3300025229 | Bacteria | 2158988 |
| 172 | Ga0209147_100009 | 3300025229 | Bacteria | 747409 |
| 173 | Ga0209147_100016 | 3300025229 | Bacteria | 527606 |
| 174 | Ga0209563_100004 | 3300025230 | Bacteria | 1814108 |
| 175 | Ga0209563_100018 | 3300025230 | Bacteria | 747850 |
| 176 | Ga0209563_108111 | 3300025230 | Bacteria | 1676 |
| 177 | Ga0207427_100005 | 3300025231 | Bacteria | 797999 |
| 178 | Ga0207427_100006 | 3300025231 | Bacteria | 785415 |
| 179 | Ga0209437_100013 | 3300025233 | Bacteria | 785457 |
| 180 | Ga0209437_100018 | 3300025233 | Bacteria | 694400 |
| 181 | Ga0209437_112834 | 3300025233 | Bacteria | 1213 |
| 182 | Ga0209258_100002 | 3300025242 | Bacteria | 2158988 |
| 183 | Ga0209258_100026 | 3300025242 | Bacteria | 527606 |
| 184 | Ga0209258_100169 | 3300025242 | Bacteria | 145227 |
| 185 | Ga0209646_1000059 | 3300025246 | Bacteria | 256909 |
| 186 | Ga0209646_1000184 | 3300025246 | Bacteria | 78423 |
| 187 | Ga0209026_1001981 | 3300025250 | Bacteria | 8177 |
| 188 | Ga0209677_100009 | 3300025253 | Bacteria | 749530 |
| 189 | Ga0209677_100012 | 3300025253 | Bacteria | 554018 |
| 190 | Ga0209677_103507 | 3300025253 | Bacteria | 5029 |
| 191 | Ga0209148_1000021 | 3300025254 | Bacteria | 714645 |
| 192 | Ga0209148_1004936 | 3300025254 | Bacteria | 3149 |
| 193 | Ga0209759_1003731 | 3300025256 | Bacteria | 5963 |
| 194 | Ga0209759_1004724 | 3300025256 | Bacteria | 4984 |
| 195 | Ga0209759_1012125 | 3300025256 | Bacteria | 2406 |
| 196 | Ga0209759_1013200 | 3300025256 | Bacteria | 2247 |
| 197 | Ga0209233_1000021 | 3300025261 | Bacteria | 798078 |
| 198 | Ga0209233_1000022 | 3300025261 | Bacteria | 785415 |
| 199 | Ga0209455_1000021 | 3300025272 | Bacteria | 699993 |
| 200 | Ga0209455_1000321 | 3300025272 | Bacteria | 47677 |
| 201 | Ga0209675_1002099 | 3300025291 | Bacteria | 10560 |
| 202 | Ga0209676_1000015 | 3300025292 | Bacteria | 784458 |
| 203 | Ga0209676_1000030 | 3300025292 | Bacteria | 506421 |
| 204 | Ga0209676_1000041 | 3300025292 | Bacteria | 424583 |
| 205 | Ga0209676_1000510 | 3300025292 | Bacteria | 61272 |
| 206 | Ga0209676_1002546 | 3300025292 | Bacteria | 12662 |
| 207 | Ga0209676_1003117 | 3300025292 | Bacteria | 10646 |
| 208 | Ga0209564_1000003 | 3300025295 | Bacteria | 1585848 |
| 209 | Ga0209758_1000029 | 3300025297 | Bacteria | 520787 |
| 210 | Ga0209050_1000024 | 3300025298 | Bacteria | 533389 |
| 211 | Ga0209050_1000030 | 3300025298 | Bacteria | 463381 |
| 212 | Ga0209050_1000518 | 3300025298 | Bacteria | 64332 |
| 213 | Ga0209050_1000647 | 3300025298 | Bacteria | 54000 |
| 214 | Ga0209051_1000012 | 3300025303 | Bacteria | 595474 |
| 215 | Ga0209051_1000023 | 3300025303 | Bacteria | 437371 |
| 216 | Ga0209051_1000721 | 3300025303 | Bacteria | 36119 |
| 217 | Ga0209257_1001245 | 3300025304 | Bacteria | 31476 |
| 218 | Ga0209257_1008821 | 3300025304 | Bacteria | 5584 |
| 219 | Ga0207656_10000006 | 3300025321 | Bacteria | 395044 |
| 220 | Ga0207696_1000031 | 3300025711 | Bacteria | 384169 |
| 221 | Ga0207696_1000078 | 3300025711 | Bacteria | 207623 |
| 222 | Ga0207696_1000145 | 3300025711 | Bacteria | 122321 |
| 223 | Ga0207696_1000357 | 3300025711 | Bacteria | 46078 |
| 224 | Ga0207696_1002362 | 3300025711 | Bacteria | 9333 |
| 225 | Ga0207696_1005520 | 3300025711 | Bacteria | 5234 |
| 226 | Ga0207696_1010267 | 3300025711 | Bacteria | 3444 |
| 227 | Ga0207696_1010392 | 3300025711 | Bacteria | 3412 |
| 228 | Ga0207696_1019672 | 3300025711 | Bacteria | 2191 |
| 229 | Ga0207696_1039493 | 3300025711 | Bacteria | 1387 |
| 230 | Ga0207696_1046628 | 3300025711 | Bacteria | 1250 |
| 231 | Ga0207655_1000014 | 3300025728 | Bacteria | 607124 |
| 232 | Ga0207655_1000202 | 3300025728 | Bacteria | 103907 |
| 233 | Ga0207655_1000309 | 3300025728 | Bacteria | 72910 |
| 234 | Ga0207655_1000388 | 3300025728 | Bacteria | 61513 |
| 235 | Ga0207655_1001315 | 3300025728 | Bacteria | 23457 |
| 236 | Ga0207655_1005067 | 3300025728 | Bacteria | 9104 |
| 237 | Ga0207655_1007643 | 3300025728 | Bacteria | 6980 |
| 238 | Ga0207655_1008795 | 3300025728 | Bacteria | 6355 |
| 239 | Ga0207655_1015714 | 3300025728 | Bacteria | 4189 |
| 240 | Ga0207655_1016904 | 3300025728 | Bacteria | 3965 |
| 241 | Ga0207655_1030074 | 3300025728 | Bacteria | 2532 |
| 242 | Ga0207655_1036805 | 3300025728 | Bacteria | 2165 |
| 243 | Ga0207655_1066298 | 3300025728 | Bacteria | 1365 |
| 244 | Ga0207655_1079939 | 3300025728 | Bacteria | 1183 |
| 245 | Ga0207713_1000010 | 3300025735 | Bacteria | 528374 |
| 246 | Ga0207713_1000077 | 3300025735 | Bacteria | 176517 |
| 247 | Ga0207713_1000815 | 3300025735 | Bacteria | 28847 |
| 248 | Ga0207713_1001109 | 3300025735 | Bacteria | 23001 |
| 249 | Ga0207713_1001462 | 3300025735 | Bacteria | 18785 |
| 250 | Ga0207713_1003196 | 3300025735 | Bacteria | 11322 |
| 251 | Ga0207713_1003335 | 3300025735 | Bacteria | 11029 |
| 252 | Ga0207713_1005980 | 3300025735 | Bacteria | 7506 |
| 253 | Ga0207713_1006691 | 3300025735 | Bacteria | 6970 |
| 254 | Ga0207713_1006845 | 3300025735 | Bacteria | 6864 |
| 255 | Ga0207713_1012141 | 3300025735 | Bacteria | 4629 |
| 256 | Ga0207713_1037259 | 3300025735 | Bacteria | 2076 |
| 257 | Ga0207713_1037522 | 3300025735 | Bacteria | 2065 |
| 258 | Ga0207705_10022744 | 3300025909 | Bacteria | 4471 |
| 259 | Ga0207695_10000729 | 3300025913 | Bacteria | 63923 |
| 260 | Ga0207671_10000131 | 3300025914 | Bacteria | 116866 |
| 261 | Ga0207649_10000012 | 3300025920 | Bacteria | 265674 |
| 262 | Ga0207649_10000334 | 3300025920 | Bacteria | 35813 |
| 263 | Ga0207681_10000099 | 3300025923 | Bacteria | 73220 |
| 264 | Ga0207681_10003206 | 3300025923 | Bacteria | 10266 |
| 265 | Ga0207650_10000518 | 3300025925 | Bacteria | 31804 |
| 266 | Ga0207650_10000571 | 3300025925 | Bacteria | 29738 |
| 267 | Ga0207690_10001324 | 3300025932 | Bacteria | 15570 |
| 268 | Ga0207706_10000580 | 3300025933 | Bacteria | 38973 |
| 269 | Ga0207686_10000319 | 3300025934 | Bacteria | 34615 |
| 270 | Ga0207709_10000071 | 3300025935 | Bacteria | 181156 |
| 271 | Ga0207709_10000337 | 3300025935 | Bacteria | 49221 |
| 272 | Ga0207709_10003583 | 3300025935 | Bacteria | 9174 |
| 273 | Ga0207709_10017354 | 3300025935 | Bacteria | 4017 |
| 274 | Ga0207709_10021142 | 3300025935 | Bacteria | 3681 |
| 275 | Ga0207709_10061947 | 3300025935 | Bacteria | 2339 |
| 276 | Ga0207679_10000001 | 3300025945 | Bacteria | 777444 |
| 277 | Ga0207679_10000015 | 3300025945 | Bacteria | 265674 |
| 278 | Ga0207668_10026463 | 3300025972 | Bacteria | 3767 |
| 279 | Ga0207640_10000088 | 3300025981 | Bacteria | 72802 |
| 280 | Ga0207640_10011005 | 3300025981 | Bacteria | 5107 |
| 281 | Ga0207639_10000775 | 3300026041 | Bacteria | 21763 |
| 282 | Ga0207678_10000001 | 3300026067 | Bacteria | 433184 |
| 283 | Ga0207678_10002593 | 3300026067 | Bacteria | 16467 |
| 284 | Ga0207678_10091364 | 3300026067 | Bacteria | 2602 |
| 285 | Ga0207702_10039638 | 3300026078 | Bacteria | 3949 |
| 286 | Ga0207674_10198448 | 3300026116 | Bacteria | 1956 |
| 287 | Ga0209281_1000019 | 3300027111 | Bacteria | 576164 |
| 288 | Ga0209389_1000049 | 3300027296 | Bacteria | 114702 |
| 289 | Ga0209371_1000106 | 3300027312 | Bacteria | 146212 |
| 290 | Ga0207428_10064067 | 3300027907 | Bacteria | 2903 |
| 291 | Ga0207428_10110118 | 3300027907 | Bacteria | 2121 |
| 292 | Ga0268266_10122719 | 3300028379 | Bacteria | 2313 |
| 293 | Ga0307517_10125821 | 3300028786 | Bacteria | 1871 |
| 294 | Ga0268256_1000077 | 3300030500 | Bacteria | 177593 |
| 295 | Ga0307511_10061910 | 3300030521 | Bacteria | 2846 |
| 296 | Ga0316177_1038918 | 3300030731 | Bacteria | 3622 |
| 297 | Ga0316179_1012631 | 3300030734 | Bacteria | 5035 |
| 298 | Ga0316181_1237161 | 3300030744 | Bacteria | 1903 |
| 299 | Ga0265760_10004209 | 3300031090 | Bacteria | 4139 |
| 300 | Ga0265327_10000008 | 3300031251 | Bacteria | 658870 |
| 301 | Ga0307513_10204655 | 3300031456 | Bacteria | 1811 |
| 302 | Ga0307408_100001975 | 3300031548 | Bacteria | 14793 |
| 303 | Ga0307516_10095864 | 3300031730 | Bacteria | 2788 |
| 304 | Ga0307406_10153558 | 3300031901 | Bacteria | 1645 |
| 305 | Ga0307406_10281375 | 3300031901 | Bacteria | 1269 |
| 306 | Ga0307412_10007211 | 3300031911 | Bacteria | 6308 |
| 307 | Ga0307412_10010029 | 3300031911 | Bacteria | 5448 |
| 308 | Ga0307412_10093995 | 3300031911 | Bacteria | 2104 |
| 309 | Ga0307409_100313276 | 3300031995 | Bacteria | 1465 |
| 310 | Ga0307414_10292647 | 3300032004 | Bacteria | 1373 |
| 311 | Ga0307510_10017092 | 3300033180 | Bacteria | 8557 |
| 312 | Ga0316214_1000796 | 3300033545 | Bacteria | 3412 |
| 313 | Ga0395900_0030607 | 3300037418 | Bacteria | 5527 |
| 314 | Ga0237819_01092 | 3300038705 | Bacteria | 7986 |
| 315 | Ga0439436_0001261 | 3300041404 | Bacteria | 7227 |
| 316 | Ga0439438_003418 | 3300041405 | Bacteria | 6424 |
| 317 | Ga0439438_026980 | 3300041405 | Bacteria | 1553 |
| 318 | Ga0439447_000185 | 3300041407 | Bacteria | 22086 |
| 319 | Ga0439447_001317 | 3300041407 | Bacteria | 9029 |
| 320 | Ga0439447_005893 | 3300041407 | Bacteria | 4027 |
| 321 | Ga0439447_006479 | 3300041407 | Bacteria | 3796 |
| 322 | Ga0439447_019583 | 3300041407 | Bacteria | 1802 |
| 323 | Ga0439466_0000460 | 3300041411 | Bacteria | 15548 |
| 324 | Ga0439466_0002029 | 3300041411 | Bacteria | 7942 |
| 325 | Ga0439466_0005241 | 3300041411 | Bacteria | 4965 |
| 326 | Ga0439466_0007030 | 3300041411 | Bacteria | 4262 |
| 327 | Ga0439465_0015721 | 3300041413 | Bacteria | 2360 |
| 328 | Ga0439437_000374 | 3300042000 | Bacteria | 4282 |
| 329 | Ga0439432_000797 | 3300042006 | Bacteria | 11779 |
| 330 | Ga0439432_002776 | 3300042006 | Bacteria | 6527 |
| 331 | Ga0439432_003848 | 3300042006 | Bacteria | 5533 |
| 332 | Ga0439432_022369 | 3300042006 | Bacteria | 2088 |
| 333 | Ga0439432_028919 | 3300042006 | Bacteria | 1803 |
| 334 | Ga0439451_001405 | 3300042009 | Bacteria | 4759 |
| 335 | Ga0439451_005530 | 3300042009 | Bacteria | 2578 |
| 336 | Ga0439451_021998 | 3300042009 | Bacteria | 1285 |
| 337 | Ga0439452_000354 | 3300042010 | Bacteria | 28113 |
| 338 | Ga0439452_000769 | 3300042010 | Bacteria | 15322 |
| 339 | Ga0439452_004376 | 3300042010 | Bacteria | 4748 |
| 340 | Ga0439452_007020 | 3300042010 | Bacteria | 3477 |
| 341 | Ga0439452_011548 | 3300042010 | Bacteria | 2534 |
| 342 | Ga0439456_000043 | 3300042013 | Bacteria | 45603 |
| 343 | Ga0439456_000444 | 3300042013 | Bacteria | 9140 |
| 344 | Ga0439463_000538 | 3300042016 | Bacteria | 10595 |
| 345 | Ga0439463_000618 | 3300042016 | Bacteria | 9853 |
| 346 | Ga0439463_002794 | 3300042016 | Bacteria | 4429 |
| 347 | Ga0450888_001329 | 3300042126 | Bacteria | 2363 |
| 348 | Ga0450890_004100 | 3300042127 | Bacteria | 1913 |
| 349 | Ga0450892_001104 | 3300042130 | Bacteria | 2819 |
| 350 | Ga0450902_005290 | 3300042137 | Bacteria | 1944 |
| 351 | Ga0450905_000396 | 3300042142 | Bacteria | 5274 |
| 352 | Ga0450905_001922 | 3300042142 | Bacteria | 2652 |
| 353 | Ga0450905_006590 | 3300042142 | Bacteria | 1572 |
| 354 | Ga0450906_000802 | 3300042145 | Bacteria | 6878 |
| 355 | Ga0450907_000322 | 3300042146 | Bacteria | 15515 |
| 356 | Ga0450907_001362 | 3300042146 | Bacteria | 5388 |
| 357 | Ga0450907_014591 | 3300042146 | Bacteria | 1311 |
| 358 | Ga0439446_0000162 | 3300042156 | Bacteria | 11674 |
| 359 | Ga0450908_001252 | 3300042184 | Bacteria | 4911 |
| 360 | Ga0450909_001520 | 3300042185 | Bacteria | 3233 |
| 361 | Ga0439434_0000151 | 3300042435 | Bacteria | 18441 |
| 362 | Ga0439434_0016456 | 3300042435 | Bacteria | 2209 |
| 363 | Ga0439460_0000441 | 3300042461 | Bacteria | 8883 |
| 364 | Ga0439460_0015363 | 3300042461 | Bacteria | 2025 |
| 365 | Ga0450893_0005070 | 3300042532 | Bacteria | 2105 |
| 366 | Ga0450901_001959 | 3300042533 | Bacteria | 2287 |
| 367 | Ga0451577_0127737 | 3300042876 | Bacteria | 2279 |
| 368 | Ga0466986_0125542 | 3300044650 | Bacteria | 1752 |
| 369 | Ga0466969_0031299 | 3300044656 | Bacteria | 2709 |
| 370 | Ga0466972_0000111 | 3300044658 | Bacteria | 70764 |
| 371 | Ga0466972_0023033 | 3300044658 | Bacteria | 3099 |
| 372 | Ga0466982_0121209 | 3300044672 | Bacteria | 1613 |
| 373 | Ga0466965_0006859 | 3300044683 | Bacteria | 5205 |
| 374 | Ga0466965_0053064 | 3300044683 | Bacteria | 2014 |
| 375 | Ga0466965_0135414 | 3300044683 | Bacteria | 1279 |
| 376 | Ga0466961_0000456 | 3300044693 | Bacteria | 25995 |
| 377 | Ga0466964_0001262 | 3300044706 | Bacteria | 8611 |
| 378 | Ga0466964_0003758 | 3300044706 | Bacteria | 5563 |
| 379 | Ga0453684_0000280 | 3300044712 | Bacteria | 219955 |
| 380 | Ga0466968_0001055 | 3300044735 | Bacteria | 9764 |
| 381 | Ga0466968_0010840 | 3300044735 | Bacteria | 3541 |
| 382 | Ga0466970_0014919 | 3300044765 | Bacteria | 3994 |
| 383 | Ga0466957_0010145 | 3300044842 | Bacteria | 5390 |
| 384 | Ga0466960_0027620 | 3300044901 | Bacteria | 2590 |
| 385 | Ga0466959_0013895 | 3300045049 | Bacteria | 5845 |
| 386 | Ga0466959_0015430 | 3300045049 | Bacteria | 5564 |
| 387 | Ga0451576_0021037 | 3300045051 | Bacteria | 7097 |
| 388 | Ga0451576_0100429 | 3300045051 | Bacteria | 3009 |
| 389 | Ga0495617_000167 | 3300046452 | Bacteria | 41872 |
| 390 | Ga0495617_001375 | 3300046452 | Bacteria | 10746 |
| 391 | Ga0495617_017658 | 3300046452 | Bacteria | 2411 |
| 392 | Ga0495617_028103 | 3300046452 | Bacteria | 1891 |
| 393 | Ga0495627_000102 | 3300046453 | Bacteria | 104889 |
| 394 | Ga0495627_000333 | 3300046453 | Bacteria | 45231 |
| 395 | Ga0495627_001226 | 3300046453 | Bacteria | 16000 |
| 396 | Ga0495627_002838 | 3300046453 | Bacteria | 8012 |
| 397 | Ga0495627_011045 | 3300046453 | Bacteria | 3253 |
| 398 | Ga0495590_0003982 | 3300046457 | Bacteria | 5998 |
| 399 | Ga0495590_0048576 | 3300046457 | Bacteria | 1480 |
| 400 | Ga0495591_000105 | 3300046458 | Bacteria | 97199 |
| 401 | Ga0495591_000463 | 3300046458 | Bacteria | 32629 |
| 402 | Ga0495591_001494 | 3300046458 | Bacteria | 14433 |
| 403 | Ga0495591_007001 | 3300046458 | Bacteria | 4867 |
| 404 | Ga0495591_024875 | 3300046458 | Bacteria | 1888 |
| 405 | Ga0495591_031369 | 3300046458 | Bacteria | 1595 |
| 406 | Ga0495591_044177 | 3300046458 | Bacteria | 1249 |
| 407 | Ga0495638_0020892 | 3300046460 | Bacteria | 4322 |
| 408 | Ga0495638_0046756 | 3300046460 | Bacteria | 2717 |
| 409 | Ga0495638_0056461 | 3300046460 | Bacteria | 2436 |
| 410 | Ga0495653_0004797 | 3300046463 | Bacteria | 10964 |
| 411 | Ga0495653_0034075 | 3300046463 | Bacteria | 4030 |
| 412 | Ga0495653_0162455 | 3300046463 | Bacteria | 1549 |
| 413 | Ga0495650_0009035 | 3300046471 | Bacteria | 5719 |
| 414 | Ga0495650_0034108 | 3300046471 | Bacteria | 2257 |
| 415 | Ga0495650_0055864 | 3300046471 | Bacteria | 1605 |
| 416 | Ga0495650_0056548 | 3300046471 | Bacteria | 1591 |
| 417 | Ga0495580_0051756 | 3300046472 | Bacteria | 2902 |
| 418 | Ga0495582_0003854 | 3300046473 | Bacteria | 8443 |
| 419 | Ga0495605_0000064 | 3300046474 | Bacteria | 140769 |
| 420 | Ga0495605_0000255 | 3300046474 | Bacteria | 62826 |
| 421 | Ga0495605_0000620 | 3300046474 | Bacteria | 27429 |
| 422 | Ga0495605_0000714 | 3300046474 | Bacteria | 24495 |
| 423 | Ga0495605_0002506 | 3300046474 | Bacteria | 11361 |
| 424 | Ga0495605_0002791 | 3300046474 | Bacteria | 10633 |
| 425 | Ga0495605_0044799 | 3300046474 | Bacteria | 2184 |
| 426 | Ga0495605_0053349 | 3300046474 | Bacteria | 1961 |
| 427 | Ga0495605_0114829 | 3300046474 | Bacteria | 1225 |
| 428 | Ga0495639_0024724 | 3300046475 | Bacteria | 2645 |
| 429 | Ga0495584_0001930 | 3300046491 | Bacteria | 11930 |
| 430 | Ga0495584_0010251 | 3300046491 | Bacteria | 4814 |
| 431 | Ga0495584_0010587 | 3300046491 | Bacteria | 4737 |
| 432 | Ga0495584_0035444 | 3300046491 | Bacteria | 2522 |
| 433 | Ga0495585_0002921 | 3300046492 | Bacteria | 11833 |
| 434 | Ga0495585_0004927 | 3300046492 | Bacteria | 8540 |
| 435 | Ga0495585_0005380 | 3300046492 | Bacteria | 8077 |
| 436 | Ga0495585_0008461 | 3300046492 | Bacteria | 6236 |
| 437 | Ga0495585_0012191 | 3300046492 | Bacteria | 5066 |
| 438 | Ga0495585_0014826 | 3300046492 | Bacteria | 4533 |
| 439 | Ga0495585_0016202 | 3300046492 | Bacteria | 4318 |
| 440 | Ga0495585_0038452 | 3300046492 | Bacteria | 2693 |
| 441 | Ga0495594_0004681 | 3300046499 | Bacteria | 7052 |
| 442 | Ga0495594_0163553 | 3300046499 | Bacteria | 1265 |
| 443 | Ga0495596_0003229 | 3300046500 | Bacteria | 8349 |
| 444 | Ga0495596_0005753 | 3300046500 | Bacteria | 5817 |
| 445 | Ga0495596_0056131 | 3300046500 | Bacteria | 1538 |
| 446 | Ga0495607_0001049 | 3300046501 | Bacteria | 25238 |
| 447 | Ga0495607_0001370 | 3300046501 | Bacteria | 21666 |
| 448 | Ga0495607_0003022 | 3300046501 | Bacteria | 13121 |
| 449 | Ga0495607_0003939 | 3300046501 | Bacteria | 11172 |
| 450 | Ga0495607_0005722 | 3300046501 | Bacteria | 8848 |
| 451 | Ga0495607_0006981 | 3300046501 | Bacteria | 7863 |
| 452 | Ga0495607_0007583 | 3300046501 | Bacteria | 7488 |
| 453 | Ga0495607_0014419 | 3300046501 | Bacteria | 5143 |
| 454 | Ga0495607_0014785 | 3300046501 | Bacteria | 5074 |
| 455 | Ga0495607_0027621 | 3300046501 | Bacteria | 3506 |
| 456 | Ga0495607_0110750 | 3300046501 | Bacteria | 1456 |
| 457 | Ga0495583_0000015 | 3300046506 | Bacteria | 316392 |
| 458 | Ga0495583_0003590 | 3300046506 | Bacteria | 11654 |
| 459 | Ga0495583_0004202 | 3300046506 | Bacteria | 10483 |
| 460 | Ga0495583_0005217 | 3300046506 | Bacteria | 8922 |
| 461 | Ga0495583_0007640 | 3300046506 | Bacteria | 6745 |
| 462 | Ga0495606_0000177 | 3300046507 | Bacteria | 112843 |
| 463 | Ga0495606_0001016 | 3300046507 | Bacteria | 40685 |
| 464 | Ga0495606_0009604 | 3300046507 | Bacteria | 8153 |
| 465 | Ga0495606_0009768 | 3300046507 | Bacteria | 8067 |
| 466 | Ga0495606_0011424 | 3300046507 | Bacteria | 7242 |
| 467 | Ga0495606_0016424 | 3300046507 | Bacteria | 5643 |
| 468 | Ga0495606_0021409 | 3300046507 | Bacteria | 4735 |
| 469 | Ga0495610_0003101 | 3300046512 | Bacteria | 13241 |
| 470 | Ga0495610_0015192 | 3300046512 | Bacteria | 4486 |
| 471 | Ga0495610_0042477 | 3300046512 | Bacteria | 2273 |
| 472 | Ga0495610_0059364 | 3300046512 | Bacteria | 1826 |
| 473 | Ga0495610_0071757 | 3300046512 | Bacteria | 1613 |
| 474 | Ga0495610_0117880 | 3300046512 | Bacteria | 1167 |
| 475 | Ga0495616_0007584 | 3300046513 | Bacteria | 6493 |
| 476 | Ga0495616_0018417 | 3300046513 | Bacteria | 3833 |
| 477 | Ga0495616_0023813 | 3300046513 | Bacteria | 3290 |
| 478 | Ga0495616_0035147 | 3300046513 | Bacteria | 2595 |
| 479 | Ga0495620_0000039 | 3300046515 | Bacteria | 112877 |
| 480 | Ga0495620_0000301 | 3300046515 | Bacteria | 35173 |
| 481 | Ga0495620_0002335 | 3300046515 | Bacteria | 11001 |
| 482 | Ga0495620_0004177 | 3300046515 | Bacteria | 8176 |
| 483 | Ga0495620_0034967 | 3300046515 | Bacteria | 2265 |
| 484 | Ga0495631_0001929 | 3300046518 | Bacteria | 12184 |
| 485 | Ga0495631_0002026 | 3300046518 | Bacteria | 11793 |
| 486 | Ga0495631_0007430 | 3300046518 | Bacteria | 5570 |
| 487 | Ga0495631_0064891 | 3300046518 | Bacteria | 1580 |
| 488 | Ga0495632_0001966 | 3300046519 | Bacteria | 16344 |
| 489 | Ga0495632_0002219 | 3300046519 | Bacteria | 14975 |
| 490 | Ga0495632_0003351 | 3300046519 | Bacteria | 11416 |
| 491 | Ga0495632_0003817 | 3300046519 | Bacteria | 10487 |
| 492 | Ga0495632_0006873 | 3300046519 | Bacteria | 7242 |
| 493 | Ga0495632_0037285 | 3300046519 | Bacteria | 2467 |
| 494 | Ga0495632_0057031 | 3300046519 | Bacteria | 1907 |
| 495 | Ga0495632_0059774 | 3300046519 | Bacteria | 1853 |
| 496 | Ga0495637_0000393 | 3300046520 | Bacteria | 32465 |
| 497 | Ga0495637_0001586 | 3300046520 | Bacteria | 13195 |
| 498 | Ga0495637_0002084 | 3300046520 | Bacteria | 11247 |
| 499 | Ga0495637_0003136 | 3300046520 | Bacteria | 8823 |
| 500 | Ga0495637_0003862 | 3300046520 | Bacteria | 7862 |
| 501 | Ga0495637_0005606 | 3300046520 | Bacteria | 6373 |
| 502 | Ga0495637_0014306 | 3300046520 | Bacteria | 3743 |
| 503 | Ga0495637_0015516 | 3300046520 | Bacteria | 3573 |
| 504 | Ga0495637_0024098 | 3300046520 | Bacteria | 2754 |
| 505 | Ga0495637_0047894 | 3300046520 | Bacteria | 1802 |
| 506 | Ga0495637_0054723 | 3300046520 | Bacteria | 1656 |
| 507 | Ga0495643_0001673 | 3300046522 | Bacteria | 19405 |
| 508 | Ga0495643_0002515 | 3300046522 | Bacteria | 14383 |
| 509 | Ga0495643_0009122 | 3300046522 | Bacteria | 6205 |
| 510 | Ga0495643_0009672 | 3300046522 | Bacteria | 5968 |
| 511 | Ga0495643_0015413 | 3300046522 | Bacteria | 4517 |
| 512 | Ga0495643_0020423 | 3300046522 | Bacteria | 3817 |
| 513 | Ga0495643_0042615 | 3300046522 | Bacteria | 2472 |
| 514 | Ga0495644_0000975 | 3300046523 | Bacteria | 11863 |
| 515 | Ga0495648_0005114 | 3300046524 | Bacteria | 10994 |
| 516 | Ga0495648_0008794 | 3300046524 | Bacteria | 7900 |
| 517 | Ga0495648_0019560 | 3300046524 | Bacteria | 4757 |
| 518 | Ga0495648_0028082 | 3300046524 | Bacteria | 3752 |
| 519 | Ga0495648_0041508 | 3300046524 | Bacteria | 2904 |
| 520 | Ga0495648_0091576 | 3300046524 | Bacteria | 1700 |
| 521 | Ga0495666_0006845 | 3300046526 | Bacteria | 5724 |
| 522 | Ga0495666_0046014 | 3300046526 | Bacteria | 2104 |
| 523 | Ga0495642_0000237 | 3300046528 | Bacteria | 31221 |
| 524 | Ga0495642_0001374 | 3300046528 | Bacteria | 10885 |
| 525 | Ga0495654_0002801 | 3300046530 | Bacteria | 10991 |
| 526 | Ga0495654_0007639 | 3300046530 | Bacteria | 6019 |
| 527 | Ga0495654_0008960 | 3300046530 | Bacteria | 5497 |
| 528 | Ga0495654_0016049 | 3300046530 | Bacteria | 3967 |
| 529 | Ga0495654_0019909 | 3300046530 | Bacteria | 3503 |
| 530 | Ga0495654_0020989 | 3300046530 | Bacteria | 3401 |
| 531 | Ga0495654_0045704 | 3300046530 | Bacteria | 2159 |
| 532 | Ga0495665_0063814 | 3300046531 | Bacteria | 1944 |
| 533 | Ga0495587_0029373 | 3300046536 | Bacteria | 3337 |
| 534 | Ga0495587_0133165 | 3300046536 | Bacteria | 1420 |
| 535 | Ga0495609_0000192 | 3300046538 | Bacteria | 61042 |
| 536 | Ga0495609_0000773 | 3300046538 | Bacteria | 23957 |
| 537 | Ga0495609_0006042 | 3300046538 | Bacteria | 6240 |
| 538 | Ga0495609_0013995 | 3300046538 | Bacteria | 3780 |
| 539 | Ga0495609_0019412 | 3300046538 | Bacteria | 3145 |
| 540 | Ga0495597_0001180 | 3300046542 | Bacteria | 19588 |
| 541 | Ga0495597_0008969 | 3300046542 | Bacteria | 4983 |
| 542 | Ga0495597_0022069 | 3300046542 | Bacteria | 2954 |
| 543 | Ga0495597_0033827 | 3300046542 | Bacteria | 2311 |
| 544 | Ga0495597_0060014 | 3300046542 | Bacteria | 1660 |
| 545 | Ga0495622_0011141 | 3300046557 | Bacteria | 4150 |
| 546 | Ga0495633_0000373 | 3300046558 | Bacteria | 47781 |
| 547 | Ga0495633_0009466 | 3300046558 | Bacteria | 5376 |
| 548 | Ga0495633_0057255 | 3300046558 | Bacteria | 1831 |
| 549 | Ga0495656_0024359 | 3300046615 | Bacteria | 2389 |
| 550 | Ga0495668_0002371 | 3300046616 | Bacteria | 15670 |
| 551 | Ga0495668_0002528 | 3300046616 | Bacteria | 14911 |
| 552 | Ga0495668_0004160 | 3300046616 | Bacteria | 10447 |
| 553 | Ga0495668_0120154 | 3300046616 | Bacteria | 1437 |
| 554 | Ga0495668_0158061 | 3300046616 | Bacteria | 1241 |
| 555 | Ga0495611_0000749 | 3300046648 | Bacteria | 18315 |
| 556 | Ga0495611_0002123 | 3300046648 | Bacteria | 9279 |
| 557 | Ga0495611_0002529 | 3300046648 | Bacteria | 8315 |
| 558 | Ga0495611_0006971 | 3300046648 | Bacteria | 4801 |
| 559 | Ga0495625_0029129 | 3300046660 | Bacteria | 4133 |
| 560 | Ga0495625_0044451 | 3300046660 | Bacteria | 3215 |
| 561 | Ga0495625_0045572 | 3300046660 | Bacteria | 3168 |
| 562 | Ga0495625_0054046 | 3300046660 | Bacteria | 2869 |
| 563 | Ga0495625_0172462 | 3300046660 | Bacteria | 1443 |
| 564 | Ga0495635_0011428 | 3300046663 | Bacteria | 6226 |
| 565 | Ga0495659_0001738 | 3300046664 | Bacteria | 7248 |
| 566 | Ga0495661_0000061 | 3300046665 | Bacteria | 130811 |
| 567 | Ga0495661_0000097 | 3300046665 | Bacteria | 107784 |
| 568 | Ga0495661_0016216 | 3300046665 | Bacteria | 4946 |
| 569 | Ga0495661_0022508 | 3300046665 | Bacteria | 4100 |
| 570 | Ga0495661_0074765 | 3300046665 | Bacteria | 1971 |
| 571 | Ga0495588_0016999 | 3300046674 | Bacteria | 3524 |
| 572 | Ga0495646_0003313 | 3300046680 | Bacteria | 10017 |
| 573 | Ga0495669_0004664 | 3300046684 | Bacteria | 5681 |
| 574 | Ga0495669_0019373 | 3300046684 | Bacteria | 2936 |
| 575 | Ga0495670_0001123 | 3300046691 | Bacteria | 12976 |
| 576 | Ga0495670_0007368 | 3300046691 | Bacteria | 5407 |
| 577 | Ga0495670_0010430 | 3300046691 | Bacteria | 4565 |
| 578 | Ga0495670_0012881 | 3300046691 | Bacteria | 4110 |
| 579 | Ga0495670_0028928 | 3300046691 | Bacteria | 2748 |
| 580 | Ga0495670_0046550 | 3300046691 | Bacteria | 2166 |
| 581 | Ga0495671_0000805 | 3300046692 | Bacteria | 22397 |
| 582 | Ga0495671_0001452 | 3300046692 | Bacteria | 15924 |
| 583 | Ga0495671_0002987 | 3300046692 | Bacteria | 10508 |
| 584 | Ga0495671_0006866 | 3300046692 | Bacteria | 6535 |
| 585 | Ga0495671_0009698 | 3300046692 | Bacteria | 5369 |
| 586 | Ga0495671_0016307 | 3300046692 | Bacteria | 3968 |
| 587 | Ga0495671_0017994 | 3300046692 | Bacteria | 3757 |
| 588 | Ga0495671_0019232 | 3300046692 | Bacteria | 3614 |
| 589 | Ga0495671_0032565 | 3300046692 | Bacteria | 2662 |
| 590 | Ga0495671_0080538 | 3300046692 | Bacteria | 1595 |
| 591 | Ga0495649_0000531 | 3300046694 | Bacteria | 32369 |
| 592 | Ga0495649_0001245 | 3300046694 | Bacteria | 19590 |
| 593 | Ga0495649_0003048 | 3300046694 | Bacteria | 11493 |
| 594 | Ga0495649_0003710 | 3300046694 | Bacteria | 10160 |
| 595 | Ga0495649_0007703 | 3300046694 | Bacteria | 6540 |
| 596 | Ga0495649_0012604 | 3300046694 | Bacteria | 4908 |
| 597 | Ga0495649_0088630 | 3300046694 | Bacteria | 1650 |
| 598 | Ga0495589_0002695 | 3300046794 | Bacteria | 9817 |
| 599 | Ga0495589_0003948 | 3300046794 | Bacteria | 7959 |
| 600 | Ga0495589_0013142 | 3300046794 | Bacteria | 4273 |
| 601 | Ga0495589_0013949 | 3300046794 | Bacteria | 4142 |
| 602 | Ga0495589_0019206 | 3300046794 | Bacteria | 3506 |
| 603 | Ga0495600_0021373 | 3300046809 | Bacteria | 4143 |
| 604 | Ga0495660_0000492 | 3300046810 | Bacteria | 32646 |
| 605 | Ga0495660_0001739 | 3300046810 | Bacteria | 14532 |
| 606 | Ga0495660_0028240 | 3300046810 | Bacteria | 3171 |
| 607 | Ga0495660_0051239 | 3300046810 | Bacteria | 2246 |
| 608 | Ga0495660_0094337 | 3300046810 | Bacteria | 1549 |
| 609 | Ga0495581_0054175 | 3300047315 | Bacteria | 2315 |
| 610 | Ga0495604_0026614 | 3300047317 | Bacteria | 4604 |
| 611 | Ga0495604_0109386 | 3300047317 | Bacteria | 2017 |
| 612 | Ga0495636_0002667 | 3300047318 | Bacteria | 6887 |
| 613 | Ga0495672_0004415 | 3300047320 | Bacteria | 11531 |
| 614 | Ga0495672_0005033 | 3300047320 | Bacteria | 10571 |
| 615 | Ga0495672_0022119 | 3300047320 | Bacteria | 4138 |
| 616 | Ga0495672_0027434 | 3300047320 | Bacteria | 3618 |
| 617 | Ga0495672_0033562 | 3300047320 | Bacteria | 3178 |
| 618 | Ga0495680_0016523 | 3300047322 | Bacteria | 6336 |
| 619 | Ga0495680_0048546 | 3300047322 | Bacteria | 3332 |
| 620 | Ga0495683_0000106 | 3300047323 | Bacteria | 86579 |
| 621 | Ga0495683_0000207 | 3300047323 | Bacteria | 55998 |
| 622 | Ga0495683_0002916 | 3300047323 | Bacteria | 10128 |
| 623 | Ga0495683_0017999 | 3300047323 | Bacteria | 3657 |
| 624 | Ga0495683_0020899 | 3300047323 | Bacteria | 3374 |
| 625 | Ga0495687_005908 | 3300047443 | Bacteria | 7654 |
| 626 | Ga0495687_012488 | 3300047443 | Bacteria | 4486 |
| 627 | Ga0495675_0004892 | 3300047444 | Bacteria | 8157 |
| 628 | Ga0495677_0009101 | 3300047445 | Bacteria | 3671 |
| 629 | Ga0495679_000274 | 3300047446 | Bacteria | 43056 |
| 630 | Ga0495679_000371 | 3300047446 | Bacteria | 34489 |
| 631 | Ga0495679_007752 | 3300047446 | Bacteria | 4438 |
| 632 | Ga0495673_0000222 | 3300047469 | Bacteria | 84272 |
| 633 | Ga0495673_0002875 | 3300047469 | Bacteria | 11711 |
| 634 | Ga0495673_0012077 | 3300047469 | Bacteria | 4601 |
| 635 | Ga0495673_0020102 | 3300047469 | Bacteria | 3330 |
| 636 | Ga0495673_0022627 | 3300047469 | Bacteria | 3077 |
| 637 | Ga0495673_0024472 | 3300047469 | Bacteria | 2917 |
| 638 | Ga0495673_0024620 | 3300047469 | Bacteria | 2903 |
| 639 | Ga0495673_0031313 | 3300047469 | Bacteria | 2491 |
| 640 | Ga0495673_0059705 | 3300047469 | Bacteria | 1638 |
| 641 | Ga0495673_0089911 | 3300047469 | Bacteria | 1256 |
| 642 | Ga0495681_0005234 | 3300047470 | Bacteria | 8713 |
| 643 | Ga0495681_0007728 | 3300047470 | Bacteria | 6819 |
| 644 | Ga0495681_0007812 | 3300047470 | Bacteria | 6773 |
| 645 | Ga0495681_0035532 | 3300047470 | Bacteria | 2473 |
| 646 | Ga0495681_0040939 | 3300047470 | Bacteria | 2252 |
| 647 | Ga0495681_0045081 | 3300047470 | Bacteria | 2113 |
| 648 | Ga0495686_0008819 | 3300047472 | Bacteria | 7342 |
| 649 | Ga0495686_0164410 | 3300047472 | Bacteria | 1294 |
| 650 | Ga0495593_0009346 | 3300047673 | Bacteria | 5690 |
| 651 | Ga0495626_0000068 | 3300048091 | Bacteria | 139126 |
| 652 | Ga0495626_0000678 | 3300048091 | Bacteria | 32578 |
| 653 | Ga0495626_0011126 | 3300048091 | Bacteria | 4770 |
| 654 | Ga0495626_0020358 | 3300048091 | Bacteria | 3307 |
| 655 | Ga0496100_0263647 | 3300048903 | Bacteria | 1279 |
| 656 | Ga0496102_0002251 | 3300048905 | Bacteria | 16528 |
| 657 | Ga0496102_0005434 | 3300048905 | Bacteria | 10809 |
| 658 | Ga0496110_0091238 | 3300048913 | Bacteria | 2725 |
| 659 | Ga0496111_0129354 | 3300048914 | Bacteria | 1868 |
| 660 | Ga0496114_0007131 | 3300048917 | Bacteria | 8815 |
| 661 | Ga0496114_0057734 | 3300048917 | Bacteria | 3240 |
| 662 | Ga0496116_0000670 | 3300048919 | Bacteria | 44682 |
| 663 | Ga0496116_0009294 | 3300048919 | Bacteria | 8398 |
| 664 | Ga0496116_0043932 | 3300048919 | Bacteria | 3040 |
| 665 | Ga0496117_0002093 | 3300048920 | Bacteria | 26276 |
| 666 | Ga0496117_0003858 | 3300048920 | Bacteria | 17058 |
| 667 | Ga0496117_0006799 | 3300048920 | Bacteria | 11402 |
| 668 | Ga0496117_0013238 | 3300048920 | Bacteria | 7210 |
| 669 | Ga0496117_0019912 | 3300048920 | Bacteria | 5491 |
| 670 | Ga0496117_0061670 | 3300048920 | Bacteria | 2575 |
| 671 | Ga0496117_0115643 | 3300048920 | Bacteria | 1660 |
| 672 | Ga0496117_0118294 | 3300048920 | Bacteria | 1634 |
| 673 | Ga0496118_0001842 | 3300048921 | Bacteria | 30363 |
| 674 | Ga0496118_0010904 | 3300048921 | Bacteria | 8939 |
| 675 | Ga0496118_0030939 | 3300048921 | Bacteria | 4452 |
| 676 | Ga0496118_0032955 | 3300048921 | Bacteria | 4258 |
| 677 | Ga0496118_0041256 | 3300048921 | Bacteria | 3657 |
| 678 | Ga0496119_0000229 | 3300048922 | Bacteria | 78634 |
| 679 | Ga0496120_0001476 | 3300048923 | Bacteria | 27987 |
| 680 | Ga0496121_0001246 | 3300048924 | Bacteria | 44184 |
| 681 | Ga0496121_0002966 | 3300048924 | Bacteria | 24708 |
| 682 | Ga0496121_0031786 | 3300048924 | Bacteria | 4814 |
| 683 | Ga0496121_0098579 | 3300048924 | Bacteria | 2261 |
| 684 | Ga0496122_0000590 | 3300048925 | Bacteria | 74565 |
| 685 | Ga0496122_0001707 | 3300048925 | Bacteria | 34056 |
| 686 | Ga0496122_0009159 | 3300048925 | Bacteria | 10484 |
| 687 | Ga0496122_0017946 | 3300048925 | Bacteria | 6567 |
| 688 | Ga0496122_0040719 | 3300048925 | Bacteria | 3686 |
| 689 | Ga0496123_0000088 | 3300048926 | Bacteria | 180478 |
| 690 | Ga0496123_0000607 | 3300048926 | Bacteria | 60365 |
| 691 | Ga0496123_0012377 | 3300048926 | Bacteria | 7282 |
| 692 | Ga0496123_0018999 | 3300048926 | Bacteria | 5433 |
| 693 | Ga0496123_0062843 | 3300048926 | Bacteria | 2375 |
| 694 | Ga0496124_0000073 | 3300048927 | Bacteria | 219306 |
| 695 | Ga0496124_0001393 | 3300048927 | Bacteria | 36270 |
| 696 | Ga0496124_0003431 | 3300048927 | Bacteria | 19406 |
| 697 | Ga0496124_0005436 | 3300048927 | Bacteria | 14331 |
| 698 | Ga0496124_0005945 | 3300048927 | Bacteria | 13489 |
| 699 | Ga0496124_0033385 | 3300048927 | Bacteria | 4527 |
| 700 | Ga0496124_0062468 | 3300048927 | Bacteria | 3116 |
| 701 | Ga0496124_0120201 | 3300048927 | Bacteria | 2100 |
| 702 | Ga0496124_0259154 | 3300048927 | Bacteria | 1281 |
| 703 | Ga0496125_0001017 | 3300048928 | Bacteria | 43607 |
| 704 | Ga0496125_0014635 | 3300048928 | Bacteria | 7626 |
| 705 | Ga0496125_0015703 | 3300048928 | Bacteria | 7304 |
| 706 | Ga0496125_0041485 | 3300048928 | Bacteria | 3932 |
| 707 | Ga0496125_0060372 | 3300048928 | Bacteria | 3048 |
| 708 | Ga0496125_0178965 | 3300048928 | Bacteria | 1415 |
| 709 | Ga0496126_0109965 | 3300048929 | Bacteria | 2401 |
| 710 | Ga0496126_0267834 | 3300048929 | Bacteria | 1418 |
| 711 | Ga0495678_000404 | 3300049459 | Bacteria | 43644 |
| 712 | Ga0495678_003668 | 3300049459 | Bacteria | 9311 |
| 713 | Ga0495678_005047 | 3300049459 | Bacteria | 7423 |
| 714 | Ga0495678_010232 | 3300049459 | Bacteria | 4570 |
| 715 | Ga0495678_015508 | 3300049459 | Bacteria | 3502 |
| 716 | Ga0495678_022316 | 3300049459 | Bacteria | 2770 |
| 717 | Ga0495678_030790 | 3300049459 | Bacteria | 2242 |
| 718 | Ga0495682_0000681 | 3300049460 | Bacteria | 22388 |
| 719 | Ga0501034_0000101 | 3300049571 | Bacteria | 158656 |
| 720 | Ga0501037_0036053 | 3300049573 | Bacteria | 3646 |
| 721 | nmdc:mga0yw44_193846_c1 | 3300050492 | Bacteria | 1341 |
| 722 | nmdc:mga0yw44_279683_c1 | 3300050492 | Bacteria | 1115 |
| 723 | nmdc:mga06z11_8429_c1 | 3300050494 | Bacteria | 4298 |
| 724 | Ga0500641_0000779 | 3300053096 | Bacteria | 11551 |
| 725 | Ga0500650_0053694 | 3300053098 | Bacteria | 1875 |
| 726 | Ga0500659_0002113 | 3300053135 | Bacteria | 12131 |
| 727 | Ga0500561_0015366 | 3300053137 | Bacteria | 1697 |
| 728 | Ga0500604_0003366 | 3300053151 | Bacteria | 4301 |
| 729 | Ga0500622_0003764 | 3300053156 | Bacteria | 9907 |
| 730 | Ga0500636_0009771 | 3300053177 | Bacteria | 5588 |
| 731 | Ga0500609_007306 | 3300053731 | Bacteria | 1492 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2885266251 | 2885267076 | 300 |
| 2 | 3300013102 | Ga0157371_10000068 | Ga0157371_1000006892 | 302 |
| 3 | 3300037418 | Ga0395900_0030607 | Ga0395900_0030607_2314_3276 | 302 |
| 4 | 3300044650 | Ga0466986_0125542 | Ga0466986_0125542_487_1449 | 302 |
| 5 | 3300048928 | Ga0496125_0015703 | Ga0496125_0015703_2059_3021 | 302 |
| 6 | 3300033545 | Ga0316214_1000796 | Ga0316214_10007962 | 304 |
| 7 | iso_pu_bacteria | 2643221683 | 2644468144 | 305 |
| 8 | 3300046474 | Ga0495605_0053349 | Ga0495605_0053349_905_1897 | 307 |
| 9 | 3300048091 | Ga0495626_0011126 | Ga0495626_0011126_54_1046 | 307 |
| 10 | 3300048920 | Ga0496117_0019912 | Ga0496117_0019912_2759_3724 | 307 |
| 11 | 3300048921 | Ga0496118_0032955 | Ga0496118_0032955_1680_2645 | 307 |
| 12 | 3300024225 | Ga0224572_1007229 | Ga0224572_10072292 | 308 |
| 13 | 3300031090 | Ga0265760_10004209 | Ga0265760_100042092 | 308 |
| 14 | 3300048927 | Ga0496124_0259154 | Ga0496124_0259154_18_959 | 308 |
| 15 | iso_pu_bacteria | 2596583598 | 2597028581 | 308 |
| 16 | iso_pu_bacteria | 2599185178 | 2599444603 | 308 |
| 17 | iso_pu_bacteria | 2900577576 | 2900581615 | 308 |
| 18 | iso_pu_bacteria | 2928058823 | 2928062598 | 308 |
| 19 | iso_pu_bacteria | 2831864461 | 2831865031 | 309 |
| 20 | 3300001979 | JGI24740J21852_10000827 | JGI24740J21852_100008274 | 310 |
| 21 | 3300002705 | JGI25156J39149_1006414 | JGI25156J39149_10064143 | 310 |
| 22 | 3300003751 | Ga0055538_1004396 | Ga0055538_10043962 | 310 |
| 23 | 3300003752 | Ga0055539_1000123 | Ga0055539_100012327 | 310 |
| 24 | 3300003756 | Ga0055533_1003373 | Ga0055533_10033732 | 310 |
| 25 | 3300003756 | Ga0055533_1004209 | Ga0055533_10042092 | 310 |
| 26 | 3300003758 | Ga0055532_1000029 | Ga0055532_100002945 | 310 |
| 27 | 3300003759 | Ga0055525_1000345 | Ga0055525_100034516 | 310 |
| 28 | 3300003760 | Ga0055527_1000127 | Ga0055527_100012726 | 310 |
| 29 | 3300003761 | Ga0055535_1000137 | Ga0055535_100013746 | 310 |
| 30 | 3300003762 | Ga0055542_1009505 | Ga0055542_10095051 | 310 |
| 31 | 3300003763 | Ga0055529_1000062 | Ga0055529_100006214 | 310 |
| 32 | 3300003763 | Ga0055529_1000376 | Ga0055529_100037645 | 310 |
| 33 | 3300005327 | Ga0070658_10184415 | Ga0070658_101844151 | 310 |
| 34 | 3300005337 | Ga0070682_100052508 | Ga0070682_1000525082 | 310 |
| 35 | 3300005344 | Ga0070661_100004017 | Ga0070661_1000040173 | 310 |
| 36 | 3300005455 | Ga0070663_100000011 | Ga0070663_100000011110 | 310 |
| 37 | 3300005455 | Ga0070663_100000690 | Ga0070663_1000006901 | 310 |
| 38 | 3300005564 | Ga0070664_100000008 | Ga0070664_10000000854 | 310 |
| 39 | 3300005577 | Ga0068857_100002038 | Ga0068857_10000203813 | 310 |
| 40 | 3300005578 | Ga0068854_100000072 | Ga0068854_10000007265 | 310 |
| 41 | 3300005614 | Ga0068856_100000009 | Ga0068856_10000000987 | 310 |
| 42 | 3300009093 | Ga0105240_10055439 | Ga0105240_100554392 | 310 |
| 43 | 3300013100 | Ga0157373_10005361 | Ga0157373_1000536111 | 310 |
| 44 | 3300013104 | Ga0157370_10000200 | Ga0157370_1000020068 | 310 |
| 45 | 3300013105 | Ga0157369_10005953 | Ga0157369_1000595315 | 310 |
| 46 | 3300013307 | Ga0157372_10002606 | Ga0157372_1000260619 | 310 |
| 47 | 3300020069 | Ga0197907_10647456 | Ga0197907_106474562 | 310 |
| 48 | 3300020077 | Ga0206351_10300647 | Ga0206351_103006472 | 310 |
| 49 | 3300020082 | Ga0206353_10328413 | Ga0206353_103284132 | 310 |
| 50 | 3300020610 | Ga0154015_1082437 | Ga0154015_10824374 | 310 |
| 51 | 3300025224 | Ga0209784_100003 | Ga0209784_100003880 | 310 |
| 52 | 3300025224 | Ga0209784_100482 | Ga0209784_10048214 | 310 |
| 53 | 3300025225 | Ga0209566_100002 | Ga0209566_1000021834 | 310 |
| 54 | 3300025226 | Ga0209674_100008 | Ga0209674_100008351 | 310 |
| 55 | 3300025226 | Ga0209674_101455 | Ga0209674_1014556 | 310 |
| 56 | 3300025228 | Ga0209672_100015 | Ga0209672_100015364 | 310 |
| 57 | 3300025229 | Ga0209147_100002 | Ga0209147_1000021531 | 310 |
| 58 | 3300025229 | Ga0209147_100016 | Ga0209147_100016100 | 310 |
| 59 | 3300025230 | Ga0209563_100004 | Ga0209563_1000041251 | 310 |
| 60 | 3300025230 | Ga0209563_108111 | Ga0209563_1081112 | 310 |
| 61 | 3300025242 | Ga0209258_100002 | Ga0209258_1000021531 | 310 |
| 62 | 3300025242 | Ga0209258_100026 | Ga0209258_100026364 | 310 |
| 63 | 3300025253 | Ga0209677_100009 | Ga0209677_100009381 | 310 |
| 64 | 3300025254 | Ga0209148_1004936 | Ga0209148_10049362 | 310 |
| 65 | 3300025256 | Ga0209759_1003731 | Ga0209759_10037313 | 310 |
| 66 | 3300025256 | Ga0209759_1004724 | Ga0209759_10047245 | 310 |
| 67 | 3300025256 | Ga0209759_1013200 | Ga0209759_10132003 | 310 |
| 68 | 3300025272 | Ga0209455_1000021 | Ga0209455_1000021118 | 310 |
| 69 | 3300025272 | Ga0209455_1000321 | Ga0209455_100032147 | 310 |
| 70 | 3300025909 | Ga0207705_10022744 | Ga0207705_100227442 | 310 |
| 71 | 3300025913 | Ga0207695_10000729 | Ga0207695_100007292 | 310 |
| 72 | 3300025920 | Ga0207649_10000334 | Ga0207649_1000033436 | 310 |
| 73 | 3300025945 | Ga0207679_10000001 | Ga0207679_10000001122 | 310 |
| 74 | 3300025981 | Ga0207640_10000088 | Ga0207640_100000884 | 310 |
| 75 | 3300026067 | Ga0207678_10000001 | Ga0207678_10000001309 | 310 |
| 76 | 3300026067 | Ga0207678_10002593 | Ga0207678_1000259315 | 310 |
| 77 | 3300026078 | Ga0207702_10039638 | Ga0207702_100396382 | 310 |
| 78 | 3300026116 | Ga0207674_10198448 | Ga0207674_101984482 | 310 |
| 79 | 3300049573 | Ga0501037_0036053 | Ga0501037_0036053_1907_2896 | 310 |
| 80 | 3300053137 | Ga0500561_0015366 | Ga0500561_0015366_732_1679 | 310 |
| 81 | 3300053177 | Ga0500636_0009771 | Ga0500636_0009771_1541_2488 | 310 |
| 82 | iso_pu_bacteria | 2582581311 | 2585293740 | 310 |
| 83 | iso_pu_bacteria | 2816332286 | 2817453473 | 310 |
| 84 | iso_pu_bacteria | 2870068957 | 2870072968 | 310 |
| 85 | iso_pu_bacteria | 2928157003 | 2928157417 | 310 |
| 86 | iso_pu_bacteria | 8020938398 | 8020944118 | 310 |
| 87 | iso_pu_bacteria | 8020945358 | 8020948296 | 310 |
| 88 | iso_pu_bacteria | 8020953355 | 8020954071 | 310 |
| 89 | 3300003215 | JGI25153J46596_10000049 | JGI25153J46596_10000049113 | 311 |
| 90 | 3300005262 | Ga0065165_1000006 | Ga0065165_1000006110 | 311 |
| 91 | 3300021388 | Ga0213875_10007177 | Ga0213875_100071774 | 311 |
| 92 | 3300025295 | Ga0209564_1000003 | Ga0209564_10000031002 | 311 |
| 93 | 3300025297 | Ga0209758_1000029 | Ga0209758_1000029136 | 311 |
| 94 | 3300046507 | Ga0495606_0009604 | Ga0495606_0009604_2538_3521 | 311 |
| 95 | 3300046691 | Ga0495670_0010430 | Ga0495670_0010430_1665_2648 | 311 |
| 96 | 3300046694 | Ga0495649_0007703 | Ga0495649_0007703_4701_5684 | 311 |
| 97 | 3300048903 | Ga0496100_0263647 | Ga0496100_0263647_264_1214 | 311 |
| 98 | 3300050492 | nmdc:mga0yw44_193846_c1 | nmdc:mga0yw44_193846_c1_271_1221 | 311 |
| 99 | 3300050492 | nmdc:mga0yw44_279683_c1 | nmdc:mga0yw44_279683_c1_65_1015 | 311 |
| 100 | 3300053096 | Ga0500641_0000779 | Ga0500641_0000779_10233_11183 | 311 |
| 101 | 3300053098 | Ga0500650_0053694 | Ga0500650_0053694_885_1835 | 311 |
| 102 | 3300053151 | Ga0500604_0003366 | Ga0500604_0003366_89_1039 | 311 |
| 103 | 3300053156 | Ga0500622_0003764 | Ga0500622_0003764_6425_7408 | 311 |
| 104 | 3300053731 | Ga0500609_007306 | Ga0500609_007306_123_1073 | 311 |
| 105 | iso_pu_bacteria | 2738541337 | 2739055620 | 311 |
| 106 | 3300002738 | JGI25154J39366_1000255 | JGI25154J39366_100025531 | 313 |
| 107 | 3300003756 | Ga0055533_1001539 | Ga0055533_10015395 | 313 |
| 108 | 3300003762 | Ga0055542_1001189 | Ga0055542_100118913 | 313 |
| 109 | 3300003841 | Ga0055541_1000208 | Ga0055541_100020824 | 313 |
| 110 | 3300005366 | Ga0070659_100002881 | Ga0070659_1000028813 | 313 |
| 111 | 3300006051 | Ga0075364_10231431 | Ga0075364_102314311 | 313 |
| 112 | 3300015261 | Ga0182006_1006450 | Ga0182006_10064503 | 313 |
| 113 | 3300015262 | Ga0182007_10013025 | Ga0182007_100130252 | 313 |
| 114 | 3300025224 | Ga0209784_100539 | Ga0209784_1005397 | 313 |
| 115 | 3300025225 | Ga0209566_100970 | Ga0209566_10097011 | 313 |
| 116 | 3300025226 | Ga0209674_100229 | Ga0209674_10022910 | 313 |
| 117 | 3300025246 | Ga0209646_1000059 | Ga0209646_100005992 | 313 |
| 118 | 3300025250 | Ga0209026_1001981 | Ga0209026_10019813 | 313 |
| 119 | 3300025253 | Ga0209677_103507 | Ga0209677_1035075 | 313 |
| 120 | 3300025254 | Ga0209148_1000021 | Ga0209148_1000021207 | 313 |
| 121 | 3300025256 | Ga0209759_1012125 | Ga0209759_10121252 | 313 |
| 122 | 3300025932 | Ga0207690_10001324 | Ga0207690_1000132411 | 313 |
| 123 | 3300031456 | Ga0307513_10204655 | Ga0307513_102046552 | 313 |
| 124 | 3300048920 | Ga0496117_0115643 | Ga0496117_0115643_193_1197 | 313 |
| 125 | 3300044658 | Ga0466972_0000111 | Ga0466972_0000111_21813_22793 | 314 |
| 126 | 3300046460 | Ga0495638_0056461 | Ga0495638_0056461_591_1589 | 314 |
| 127 | 3300046472 | Ga0495580_0051756 | Ga0495580_0051756_152_1201 | 314 |
| 128 | 3300046499 | Ga0495594_0163553 | Ga0495594_0163553_13_1062 | 314 |
| 129 | 3300046507 | Ga0495606_0011424 | Ga0495606_0011424_2318_3295 | 314 |
| 130 | 3300046526 | Ga0495666_0046014 | Ga0495666_0046014_511_1560 | 314 |
| 131 | 3300046531 | Ga0495665_0063814 | Ga0495665_0063814_604_1653 | 314 |
| 132 | 3300047317 | Ga0495604_0109386 | Ga0495604_0109386_856_1905 | 314 |
| 133 | 3300047472 | Ga0495686_0164410 | Ga0495686_0164410_118_1113 | 314 |
| 134 | iso_pu_bacteria | 2511231023 | 2511370995 | 314 |
| 135 | iso_pu_bacteria | 2511231031 | 2511413467 | 314 |
| 136 | iso_pu_bacteria | 2738543025 | 2739312507 | 314 |
| 137 | iso_pu_bacteria | 2917832318 | 2917835130 | 314 |
| 138 | iso_pu_bacteria | 2919125081 | 2919130026 | 314 |
| 139 | iso_pu_bacteria | 2969304461 | 2969310172 | 314 |
| 140 | iso_pu_bacteria | 3007614139 | 3007618530 | 314 |
| 141 | 3300003316 | rootH1_10014519 | rootH1_100145193 | 315 |
| 142 | 3300006948 | Ga0099826_10000012 | Ga0099826_10000012233 | 315 |
| 143 | 3300031901 | Ga0307406_10281375 | Ga0307406_102813751 | 315 |
| 144 | 3300042000 | Ga0439437_000374 | Ga0439437_000374_723_1682 | 315 |
| 145 | 3300042126 | Ga0450888_001329 | Ga0450888_001329_248_1207 | 315 |
| 146 | 3300042127 | Ga0450890_004100 | Ga0450890_004100_408_1367 | 315 |
| 147 | 3300042130 | Ga0450892_001104 | Ga0450892_001104_179_1138 | 315 |
| 148 | 3300042532 | Ga0450893_0005070 | Ga0450893_0005070_996_1955 | 315 |
| 149 | 3300042533 | Ga0450901_001959 | Ga0450901_001959_437_1396 | 315 |
| 150 | 3300042876 | Ga0451577_0127737 | Ga0451577_0127737_956_1954 | 315 |
| 151 | 3300044683 | Ga0466965_0135414 | Ga0466965_0135414_13_1104 | 315 |
| 152 | 3300044712 | Ga0453684_0000280 | Ga0453684_0000280_14048_15046 | 315 |
| 153 | 3300044901 | Ga0466960_0027620 | Ga0466960_0027620_743_1834 | 315 |
| 154 | 3300045051 | Ga0451576_0021037 | Ga0451576_0021037_164_1162 | 315 |
| 155 | 3300045051 | Ga0451576_0100429 | Ga0451576_0100429_967_1959 | 315 |
| 156 | 3300046452 | Ga0495617_000167 | Ga0495617_000167_32956_33933 | 315 |
| 157 | 3300046458 | Ga0495591_024875 | Ga0495591_024875_833_1810 | 315 |
| 158 | 3300046474 | Ga0495605_0000064 | Ga0495605_0000064_8051_9028 | 315 |
| 159 | 3300046492 | Ga0495585_0016202 | Ga0495585_0016202_1083_2060 | 315 |
| 160 | 3300046501 | Ga0495607_0014419 | Ga0495607_0014419_525_1502 | 315 |
| 161 | 3300046524 | Ga0495648_0008794 | Ga0495648_0008794_360_1337 | 315 |
| 162 | 3300046616 | Ga0495668_0004160 | Ga0495668_0004160_1883_2860 | 315 |
| 163 | 3300046692 | Ga0495671_0001452 | Ga0495671_0001452_7144_8121 | 315 |
| 164 | 3300047320 | Ga0495672_0022119 | Ga0495672_0022119_596_1636 | 315 |
| 165 | 3300050494 | nmdc:mga06z11_8429_c1 | nmdc:mga06z11_8429_c1_1660_2646 | 315 |
| 166 | iso_pu_bacteria | 2718217725 | 2718636611 | 315 |
| 167 | iso_pu_bacteria | 2928108538 | 2928111949 | 315 |
| 168 | iso_pu_bacteria | 2928135762 | 2928139507 | 315 |
| 169 | 3300031251 | Ga0265327_10000008 | Ga0265327_10000008473 | 316 |
| 170 | 3300046457 | Ga0495590_0003982 | Ga0495590_0003982_194_1192 | 316 |
| 171 | 3300046538 | Ga0495609_0013995 | Ga0495609_0013995_2255_3253 | 316 |
| 172 | 3300046616 | Ga0495668_0002371 | Ga0495668_0002371_7736_8734 | 316 |
| 173 | 3300046692 | Ga0495671_0019232 | Ga0495671_0019232_1874_2872 | 316 |
| 174 | 3300047470 | Ga0495681_0035532 | Ga0495681_0035532_982_1980 | 316 |
| 175 | iso_pu_bacteria | 2808606373 | 2808905757 | 316 |
| 176 | 3300044656 | Ga0466969_0031299 | Ga0466969_0031299_1089_2177 | 317 |
| 177 | 3300044658 | Ga0466972_0023033 | Ga0466972_0023033_996_1991 | 317 |
| 178 | 3300044672 | Ga0466982_0121209 | Ga0466982_0121209_310_1326 | 317 |
| 179 | 3300044683 | Ga0466965_0006859 | Ga0466965_0006859_168_1163 | 317 |
| 180 | 3300044683 | Ga0466965_0053064 | Ga0466965_0053064_471_1559 | 317 |
| 181 | 3300044693 | Ga0466961_0000456 | Ga0466961_0000456_22090_23265 | 317 |
| 182 | 3300044706 | Ga0466964_0001262 | Ga0466964_0001262_2880_3875 | 317 |
| 183 | 3300044706 | Ga0466964_0003758 | Ga0466964_0003758_1889_2905 | 317 |
| 184 | 3300044735 | Ga0466968_0001055 | Ga0466968_0001055_1176_2171 | 317 |
| 185 | 3300044735 | Ga0466968_0010840 | Ga0466968_0010840_1921_3009 | 317 |
| 186 | 3300044765 | Ga0466970_0014919 | Ga0466970_0014919_1363_2379 | 317 |
| 187 | 3300044842 | Ga0466957_0010145 | Ga0466957_0010145_1627_2715 | 317 |
| 188 | 3300045049 | Ga0466959_0013895 | Ga0466959_0013895_2055_3143 | 317 |
| 189 | 3300045049 | Ga0466959_0015430 | Ga0466959_0015430_1236_2231 | 317 |
| 190 | 3300046453 | Ga0495627_001226 | Ga0495627_001226_7100_8089 | 317 |
| 191 | 3300046492 | Ga0495585_0012191 | Ga0495585_0012191_2543_3529 | 317 |
| 192 | 3300046500 | Ga0495596_0003229 | Ga0495596_0003229_1555_2544 | 317 |
| 193 | 3300046506 | Ga0495583_0004202 | Ga0495583_0004202_2263_3252 | 317 |
| 194 | 3300046518 | Ga0495631_0007430 | Ga0495631_0007430_2699_3688 | 317 |
| 195 | 3300046518 | Ga0495631_0064891 | Ga0495631_0064891_435_1424 | 317 |
| 196 | 3300046519 | Ga0495632_0002219 | Ga0495632_0002219_6865_7854 | 317 |
| 197 | 3300046522 | Ga0495643_0009122 | Ga0495643_0009122_3990_4991 | 317 |
| 198 | 3300046528 | Ga0495642_0001374 | Ga0495642_0001374_7983_8972 | 317 |
| 199 | 3300046558 | Ga0495633_0057255 | Ga0495633_0057255_684_1670 | 317 |
| 200 | 3300046616 | Ga0495668_0120154 | Ga0495668_0120154_397_1386 | 317 |
| 201 | 3300046660 | Ga0495625_0029129 | Ga0495625_0029129_1726_2727 | 317 |
| 202 | 3300046674 | Ga0495588_0016999 | Ga0495588_0016999_168_1154 | 317 |
| 203 | 3300046684 | Ga0495669_0004664 | Ga0495669_0004664_730_1719 | 317 |
| 204 | 3300046694 | Ga0495649_0012604 | Ga0495649_0012604_670_1659 | 317 |
| 205 | 3300048905 | Ga0496102_0002251 | Ga0496102_0002251_7497_8486 | 317 |
| 206 | 3300048914 | Ga0496111_0129354 | Ga0496111_0129354_452_1453 | 317 |
| 207 | 3300049459 | Ga0495678_003668 | Ga0495678_003668_6765_7754 | 317 |
| 208 | iso_pu_bacteria | 2511231004 | 2511254855 | 317 |
| 209 | iso_pu_bacteria | 2511231008 | 2511275093 | 317 |
| 210 | iso_pu_bacteria | 2511231010 | 2511289403 | 317 |
| 211 | iso_pu_bacteria | 2511231012 | 2511302817 | 317 |
| 212 | iso_pu_bacteria | 2511231014 | 2511314411 | 317 |
| 213 | iso_pu_bacteria | 2511231015 | 2511317231 | 317 |
| 214 | iso_pu_bacteria | 2511231016 | 2511328010 | 317 |
| 215 | iso_pu_bacteria | 2511231018 | 2511336834 | 317 |
| 216 | iso_pu_bacteria | 2511231019 | 2511344796 | 317 |
| 217 | iso_pu_bacteria | 2511231020 | 2511349561 | 317 |
| 218 | iso_pu_bacteria | 2511231021 | 2511359288 | 317 |
| 219 | iso_pu_bacteria | 2511231022 | 2511360898 | 317 |
| 220 | iso_pu_bacteria | 2511231024 | 2511375655 | 317 |
| 221 | iso_pu_bacteria | 2554235231 | 2555245588 | 317 |
| 222 | iso_pu_bacteria | 2554235341 | 2555672835 | 317 |
| 223 | iso_pu_bacteria | 2599185160 | 2599355960 | 317 |
| 224 | iso_pu_bacteria | 2599185161 | 2599362638 | 317 |
| 225 | iso_pu_bacteria | 2599185162 | 2599369056 | 317 |
| 226 | iso_pu_bacteria | 2599185163 | 2599375747 | 317 |
| 227 | iso_pu_bacteria | 2599185164 | 2599381066 | 317 |
| 228 | iso_pu_bacteria | 2599185165 | 2599387418 | 317 |
| 229 | iso_pu_bacteria | 2599185166 | 2599394605 | 317 |
| 230 | iso_pu_bacteria | 2599185168 | 2599406370 | 317 |
| 231 | iso_pu_bacteria | 2599185181 | 2599462794 | 317 |
| 232 | iso_pu_bacteria | 2599185182 | 2599467783 | 317 |
| 233 | iso_pu_bacteria | 2599185186 | 2599491811 | 317 |
| 234 | iso_pu_bacteria | 2599185188 | 2599500260 | 317 |
| 235 | iso_pu_bacteria | 2599185248 | 2599768148 | 317 |
| 236 | iso_pu_bacteria | 2599185289 | 2599885583 | 317 |
| 237 | iso_pu_bacteria | 2599185291 | 2599897297 | 317 |
| 238 | iso_pu_bacteria | 2599185302 | 2599942350 | 317 |
| 239 | iso_pu_bacteria | 2599185304 | 2599954237 | 317 |
| 240 | iso_pu_bacteria | 2599185305 | 2599961915 | 317 |
| 241 | iso_pu_bacteria | 2599185307 | 2599972226 | 317 |
| 242 | iso_pu_bacteria | 2599185309 | 2599982920 | 317 |
| 243 | iso_pu_bacteria | 2599185310 | 2599988330 | 317 |
| 244 | iso_pu_bacteria | 2599185312 | 2599999125 | 317 |
| 245 | iso_pu_bacteria | 2599185313 | 2600004311 | 317 |
| 246 | iso_pu_bacteria | 2599185315 | 2600020400 | 317 |
| 247 | iso_pu_bacteria | 2599185321 | 2600054922 | 317 |
| 248 | iso_pu_bacteria | 2599185324 | 2600071866 | 317 |
| 249 | iso_pu_bacteria | 2599185356 | 2600215420 | 317 |
| 250 | iso_pu_bacteria | 2600255283 | 2601627310 | 317 |
| 251 | iso_pu_bacteria | 2600255313 | 2601775586 | 317 |
| 252 | iso_pu_bacteria | 2600255318 | 2601798561 | 317 |
| 253 | iso_pu_bacteria | 2600255389 | 2602011083 | 317 |
| 254 | iso_pu_bacteria | 2603880185 | 2606077455 | 317 |
| 255 | iso_pu_bacteria | 2603880199 | 2606129299 | 317 |
| 256 | iso_pu_bacteria | 2623620443 | 2624483410 | 317 |
| 257 | iso_pu_bacteria | 2643221565 | 2643842962 | 317 |
| 258 | iso_pu_bacteria | 2643221633 | 2644184484 | 317 |
| 259 | iso_pu_bacteria | 2651869719 | 2652545893 | 317 |
| 260 | iso_pu_bacteria | 2667528170 | 2671089553 | 317 |
| 261 | iso_pu_bacteria | 2667528171 | 2671099278 | 317 |
| 262 | iso_pu_bacteria | 2713897149 | 2715754849 | 317 |
| 263 | iso_pu_bacteria | 2738541271 | 2738691938 | 317 |
| 264 | iso_pu_bacteria | 2738543004 | 2739199057 | 317 |
| 265 | iso_pu_bacteria | 2738543015 | 2739258998 | 317 |
| 266 | iso_pu_bacteria | 2738543016 | 2739263312 | 317 |
| 267 | iso_pu_bacteria | 2738543020 | 2739289600 | 317 |
| 268 | iso_pu_bacteria | 2738543021 | 2739294912 | 317 |
| 269 | iso_pu_bacteria | 2765235841 | 2765586556 | 317 |
| 270 | iso_pu_bacteria | 2773857673 | 2774135570 | 317 |
| 271 | iso_pu_bacteria | 2784132063 | 2784261820 | 317 |
| 272 | iso_pu_bacteria | 2791355520 | 2794593840 | 317 |
| 273 | iso_pu_bacteria | 2806310737 | 2807410791 | 317 |
| 274 | iso_pu_bacteria | 2806310745 | 2807459132 | 317 |
| 275 | iso_pu_bacteria | 2808606377 | 2808928444 | 317 |
| 276 | iso_pu_bacteria | 2808606381 | 2808950373 | 317 |
| 277 | iso_pu_bacteria | 2808606382 | 2808959845 | 317 |
| 278 | iso_pu_bacteria | 2808606445 | 2809217184 | 317 |
| 279 | iso_pu_bacteria | 2811994881 | 2812369982 | 317 |
| 280 | iso_pu_bacteria | 2818991456 | 2819655129 | 317 |
| 281 | iso_pu_bacteria | 2818991464 | 2819704400 | 317 |
| 282 | iso_pu_bacteria | 2823421272 | 2823421596 | 317 |
| 283 | iso_pu_bacteria | 2842843487 | 2842845688 | 317 |
| 284 | iso_pu_bacteria | 2842854478 | 2842855620 | 317 |
| 285 | iso_pu_bacteria | 2844665904 | 2844667087 | 317 |
| 286 | iso_pu_bacteria | 2852657418 | 2852659675 | 317 |
| 287 | iso_pu_bacteria | 2860339153 | 2860341712 | 317 |
| 288 | iso_pu_bacteria | 2878029506 | 2878035352 | 317 |
| 289 | iso_pu_bacteria | 2880230671 | 2880235993 | 317 |
| 290 | iso_pu_bacteria | 2904518522 | 2904518959 | 317 |
| 291 | iso_pu_bacteria | 2904550169 | 2904551330 | 317 |
| 292 | iso_pu_bacteria | 2912963787 | 2912968856 | 317 |
| 293 | iso_pu_bacteria | 2917070673 | 2917076732 | 317 |
| 294 | iso_pu_bacteria | 2919063839 | 2919065518 | 317 |
| 295 | iso_pu_bacteria | 2919155634 | 2919159587 | 317 |
| 296 | iso_pu_bacteria | 2919385768 | 2919389191 | 317 |
| 297 | iso_pu_bacteria | 2923519811 | 2923524068 | 317 |
| 298 | iso_pu_bacteria | 2923586266 | 2923588998 | 317 |
| 299 | iso_pu_bacteria | 2931369376 | 2931372641 | 317 |
| 300 | iso_pu_bacteria | 2931396565 | 2931398077 | 317 |
| 301 | iso_pu_bacteria | 2935353572 | 2935358301 | 317 |
| 302 | iso_pu_bacteria | 2939636861 | 2939640807 | 317 |
| 303 | iso_pu_bacteria | 2939651529 | 2939654196 | 317 |
| 304 | iso_pu_bacteria | 2974289157 | 2974294080 | 317 |
| 305 | iso_pu_bacteria | 2998139840 | 2998145396 | 317 |
| 306 | iso_pu_bacteria | 3007419365 | 3007419815 | 317 |
| 307 | iso_pu_bacteria | 3007511990 | 3007517178 | 317 |
| 308 | iso_pu_bacteria | 3007619802 | 3007622520 | 317 |
| 309 | iso_pu_bacteria | 3007718800 | 3007721754 | 317 |
| 310 | iso_pu_bacteria | 3007803356 | 3007805024 | 317 |
| 311 | iso_pu_bacteria | 637000220 | 637323272 | 317 |
| 312 | iso_pu_bacteria | 8052494512 | 8052499744 | 317 |
| 313 | iso_pu_bacteria | 8054929484 | 8054934079 | 317 |
| 314 | iso_pu_bacteria | 8055878733 | 8055881246 | 317 |
| 315 | iso_pu_bacteria | 8056115690 | 8056116522 | 317 |
| 316 | iso_pu_bacteria | 8056120720 | 8056125702 | 317 |
| 317 | iso_pu_bacteria | 8056125926 | 8056131603 | 317 |
| 318 | iso_pu_bacteria | 8056137416 | 8056142772 | 317 |
| 319 | iso_pu_bacteria | 8056143049 | 8056148769 | 317 |
| 320 | iso_pu_bacteria | 8056177738 | 8056181998 | 317 |
| 321 | iso_pu_bacteria | 8057798959 | 8057801940 | 317 |
| 322 | 3300001979 | JGI24740J21852_10004627 | JGI24740J21852_100046277 | 318 |
| 323 | 3300005548 | Ga0070665_100136876 | Ga0070665_1001368762 | 318 |
| 324 | 3300012498 | Ga0157345_1000031 | Ga0157345_100003131 | 318 |
| 325 | 3300013100 | Ga0157373_10033054 | Ga0157373_100330543 | 318 |
| 326 | 3300013306 | Ga0163162_10000591 | Ga0163162_100005917 | 318 |
| 327 | 3300017792 | Ga0163161_10026201 | Ga0163161_100262013 | 318 |
| 328 | 3300025711 | Ga0207696_1002362 | Ga0207696_10023627 | 318 |
| 329 | 3300025728 | Ga0207655_1036805 | Ga0207655_10368052 | 318 |
| 330 | 3300028379 | Ga0268266_10122719 | Ga0268266_101227192 | 318 |
| 331 | 3300031730 | Ga0307516_10095864 | Ga0307516_100958642 | 318 |
| 332 | 3300033180 | Ga0307510_10017092 | Ga0307510_100170927 | 318 |
| 333 | 3300041407 | Ga0439447_019583 | Ga0439447_019583_781_1758 | 318 |
| 334 | 3300046453 | Ga0495627_002838 | Ga0495627_002838_2283_3248 | 318 |
| 335 | 3300046463 | Ga0495653_0162455 | Ga0495653_0162455_28_993 | 318 |
| 336 | 3300046471 | Ga0495650_0056548 | Ga0495650_0056548_365_1330 | 318 |
| 337 | 3300046492 | Ga0495585_0038452 | Ga0495585_0038452_309_1274 | 318 |
| 338 | 3300046500 | Ga0495596_0056131 | Ga0495596_0056131_539_1504 | 318 |
| 339 | 3300046507 | Ga0495606_0016424 | Ga0495606_0016424_4542_5507 | 318 |
| 340 | 3300046512 | Ga0495610_0003101 | Ga0495610_0003101_9440_10405 | 318 |
| 341 | 3300046515 | Ga0495620_0004177 | Ga0495620_0004177_4628_5593 | 318 |
| 342 | 3300046519 | Ga0495632_0006873 | Ga0495632_0006873_4676_5641 | 318 |
| 343 | 3300046520 | Ga0495637_0001586 | Ga0495637_0001586_7682_8647 | 318 |
| 344 | 3300046524 | Ga0495648_0019560 | Ga0495648_0019560_2266_3231 | 318 |
| 345 | 3300046538 | Ga0495609_0019412 | Ga0495609_0019412_1450_2415 | 318 |
| 346 | 3300046542 | Ga0495597_0022069 | Ga0495597_0022069_1313_2278 | 318 |
| 347 | 3300046557 | Ga0495622_0011141 | Ga0495622_0011141_2006_2971 | 318 |
| 348 | 3300046648 | Ga0495611_0006971 | Ga0495611_0006971_1549_2514 | 318 |
| 349 | 3300046660 | Ga0495625_0045572 | Ga0495625_0045572_45_1010 | 318 |
| 350 | 3300046660 | Ga0495625_0172462 | Ga0495625_0172462_424_1389 | 318 |
| 351 | 3300046691 | Ga0495670_0012881 | Ga0495670_0012881_1652_2617 | 318 |
| 352 | 3300046692 | Ga0495671_0017994 | Ga0495671_0017994_1531_2496 | 318 |
| 353 | 3300046794 | Ga0495589_0003948 | Ga0495589_0003948_2216_3181 | 318 |
| 354 | 3300047469 | Ga0495673_0022627 | Ga0495673_0022627_458_1423 | 318 |
| 355 | 3300047470 | Ga0495681_0040939 | Ga0495681_0040939_35_1000 | 318 |
| 356 | 3300047472 | Ga0495686_0008819 | Ga0495686_0008819_1756_2721 | 318 |
| 357 | 3300048919 | Ga0496116_0009294 | Ga0496116_0009294_2653_3618 | 318 |
| 358 | iso_pu_bacteria | 2511231006 | 2511266841 | 318 |
| 359 | iso_pu_bacteria | 2511231017 | 2511329669 | 318 |
| 360 | iso_pu_bacteria | 2512047018 | 2512329493 | 318 |
| 361 | iso_pu_bacteria | 2582580891 | 2583795725 | 318 |
| 362 | iso_pu_bacteria | 2597489887 | 2597860880 | 318 |
| 363 | iso_pu_bacteria | 2597489888 | 2597866629 | 318 |
| 364 | iso_pu_bacteria | 2597489889 | 2597872485 | 318 |
| 365 | iso_pu_bacteria | 2599185167 | 2599400541 | 318 |
| 366 | iso_pu_bacteria | 2599185179 | 2599449865 | 318 |
| 367 | iso_pu_bacteria | 2599185185 | 2599485885 | 318 |
| 368 | iso_pu_bacteria | 2599185189 | 2599505750 | 318 |
| 369 | iso_pu_bacteria | 2599185190 | 2599511939 | 318 |
| 370 | iso_pu_bacteria | 2599185191 | 2599516923 | 318 |
| 371 | iso_pu_bacteria | 2599185257 | 2599804667 | 318 |
| 372 | iso_pu_bacteria | 2599185288 | 2599879035 | 318 |
| 373 | iso_pu_bacteria | 2599185290 | 2599892699 | 318 |
| 374 | iso_pu_bacteria | 2599185303 | 2599951449 | 318 |
| 375 | iso_pu_bacteria | 2600254931 | 2600363549 | 318 |
| 376 | iso_pu_bacteria | 2600255296 | 2601693447 | 318 |
| 377 | iso_pu_bacteria | 2619619299 | 2621296848 | 318 |
| 378 | iso_pu_bacteria | 2643221571 | 2643872262 | 318 |
| 379 | iso_pu_bacteria | 2643221713 | 2644620166 | 318 |
| 380 | iso_pu_bacteria | 2671180172 | 2671771674 | 318 |
| 381 | iso_pu_bacteria | 2675903420 | 2677897129 | 318 |
| 382 | iso_pu_bacteria | 2721755607 | 2723251364 | 318 |
| 383 | iso_pu_bacteria | 2738541265 | 2738671668 | 318 |
| 384 | iso_pu_bacteria | 2738541282 | 2738750062 | 318 |
| 385 | iso_pu_bacteria | 2738541294 | 2738807251 | 318 |
| 386 | iso_pu_bacteria | 2738541303 | 2738859102 | 318 |
| 387 | iso_pu_bacteria | 2738541309 | 2738894611 | 318 |
| 388 | iso_pu_bacteria | 2740892503 | 2743740421 | 318 |
| 389 | iso_pu_bacteria | 2808606385 | 2808976147 | 318 |
| 390 | iso_pu_bacteria | 2808606388 | 2808993247 | 318 |
| 391 | iso_pu_bacteria | 2816332298 | 2817494039 | 318 |
| 392 | iso_pu_bacteria | 2834028612 | 2834030948 | 318 |
| 393 | iso_pu_bacteria | 2842826826 | 2842831287 | 318 |
| 394 | iso_pu_bacteria | 2842837860 | 2842837897 | 318 |
| 395 | iso_pu_bacteria | 2852612431 | 2852616349 | 318 |
| 396 | iso_pu_bacteria | 2852667396 | 2852671317 | 318 |
| 397 | iso_pu_bacteria | 2860867994 | 2860873026 | 318 |
| 398 | iso_pu_bacteria | 2908446538 | 2908452579 | 318 |
| 399 | iso_pu_bacteria | 2919456309 | 2919457546 | 318 |
| 400 | iso_pu_bacteria | 2923153595 | 2923159514 | 318 |
| 401 | iso_pu_bacteria | 2929189879 | 2929195149 | 318 |
| 402 | iso_pu_bacteria | 2931390751 | 2931396408 | 318 |
| 403 | iso_pu_bacteria | 2945961074 | 2945966854 | 318 |
| 404 | iso_pu_bacteria | 2946006987 | 2946013287 | 318 |
| 405 | iso_pu_bacteria | 2946027586 | 2946027901 | 318 |
| 406 | iso_pu_bacteria | 2947233263 | 2947234421 | 318 |
| 407 | iso_pu_bacteria | 2984286254 | 2984286602 | 318 |
| 408 | iso_pu_bacteria | 3007395558 | 3007399400 | 318 |
| 409 | iso_pu_bacteria | 8015687852 | 8015693613 | 318 |
| 410 | iso_pu_bacteria | 8054285046 | 8054285729 | 318 |
| 411 | iso_pu_bacteria | 8054347763 | 8054349584 | 318 |
| 412 | iso_pu_bacteria | 8054503363 | 8054508931 | 318 |
| 413 | iso_pu_bacteria | 8055770955 | 8055776859 | 318 |
| 414 | iso_pu_bacteria | 8055817908 | 8055823900 | 318 |
| 415 | iso_pu_bacteria | 8056131705 | 8056137307 | 318 |
| 416 | iso_pu_bacteria | 8056148874 | 8056151496 | 318 |
| 417 | iso_pu_bacteria | 8056155041 | 8056160849 | 318 |
| 418 | iso_pu_bacteria | 8056161164 | 8056163630 | 318 |
| 419 | 3300041404 | Ga0439436_0001261 | Ga0439436_0001261_3844_4806 | 320 |
| 420 | 3300041407 | Ga0439447_000185 | Ga0439447_000185_9288_10250 | 320 |
| 421 | 3300041411 | Ga0439466_0005241 | Ga0439466_0005241_33_995 | 320 |
| 422 | 3300042006 | Ga0439432_003848 | Ga0439432_003848_88_1050 | 320 |
| 423 | 3300042156 | Ga0439446_0000162 | Ga0439446_0000162_261_1223 | 320 |
| 424 | 3300046492 | Ga0495585_0008461 | Ga0495585_0008461_4934_5899 | 320 |
| 425 | 3300046507 | Ga0495606_0009768 | Ga0495606_0009768_1875_2840 | 320 |
| 426 | 3300046665 | Ga0495661_0000061 | Ga0495661_0000061_77974_78939 | 320 |
| 427 | 3300002737 | JGI25162J39368_1000319 | JGI25162J39368_10003198 | 321 |
| 428 | 3300002771 | JGI25163J39215_1000691 | JGI25163J39215_10006918 | 321 |
| 429 | 3300002772 | JGI25164J39214_1000236 | JGI25164J39214_10002368 | 321 |
| 430 | 3300003214 | JGI25165J46597_1000434 | JGI25165J46597_10004348 | 321 |
| 431 | 3300003781 | Ga0055536_1005342 | Ga0055536_10053421 | 321 |
| 432 | 3300003791 | Ga0055530_10000658 | Ga0055530_1000065824 | 321 |
| 433 | 3300003791 | Ga0055530_10002203 | Ga0055530_100022038 | 321 |
| 434 | 3300003792 | Ga0055540_1000506 | Ga0055540_100050624 | 321 |
| 435 | 3300003792 | Ga0055540_1001504 | Ga0055540_10015047 | 321 |
| 436 | 3300003794 | Ga0055531_10000483 | Ga0055531_100004838 | 321 |
| 437 | 3300005288 | Ga0065714_10065219 | Ga0065714_100652196 | 321 |
| 438 | 3300005288 | Ga0065714_10094760 | Ga0065714_100947602 | 321 |
| 439 | 3300005289 | Ga0065704_10074610 | Ga0065704_100746106 | 321 |
| 440 | 3300005353 | Ga0070669_100001507 | Ga0070669_1000015077 | 321 |
| 441 | 3300006058 | Ga0075432_10004620 | Ga0075432_100046203 | 321 |
| 442 | 3300006058 | Ga0075432_10007556 | Ga0075432_100075563 | 321 |
| 443 | 3300006058 | Ga0075432_10061212 | Ga0075432_100612121 | 321 |
| 444 | 3300006914 | Ga0075436_100141875 | Ga0075436_1001418752 | 321 |
| 445 | 3300006914 | Ga0075436_100227520 | Ga0075436_1002275202 | 321 |
| 446 | 3300006944 | Ga0099823_1000086 | Ga0099823_100008625 | 321 |
| 447 | 3300006944 | Ga0099823_1036036 | Ga0099823_10360365 | 321 |
| 448 | 3300006946 | Ga0079104_1000718 | Ga0079104_100071823 | 321 |
| 449 | 3300006948 | Ga0099826_10016562 | Ga0099826_100165626 | 321 |
| 450 | 3300009011 | Ga0105251_10000027 | Ga0105251_100000276 | 321 |
| 451 | 3300009011 | Ga0105251_10000274 | Ga0105251_1000027414 | 321 |
| 452 | 3300009011 | Ga0105251_10001027 | Ga0105251_1000102716 | 321 |
| 453 | 3300009011 | Ga0105251_10008916 | Ga0105251_100089163 | 321 |
| 454 | 3300009011 | Ga0105251_10131130 | Ga0105251_101311301 | 321 |
| 455 | 3300009036 | Ga0105244_10002564 | Ga0105244_100025648 | 321 |
| 456 | 3300009036 | Ga0105244_10009575 | Ga0105244_100095754 | 321 |
| 457 | 3300009036 | Ga0105244_10026014 | Ga0105244_100260142 | 321 |
| 458 | 3300009036 | Ga0105244_10053920 | Ga0105244_100539202 | 321 |
| 459 | 3300009036 | Ga0105244_10117284 | Ga0105244_101172842 | 321 |
| 460 | 3300009092 | Ga0105250_10000191 | Ga0105250_1000019116 | 321 |
| 461 | 3300009092 | Ga0105250_10033566 | Ga0105250_100335662 | 321 |
| 462 | 3300009092 | Ga0105250_10092144 | Ga0105250_100921441 | 321 |
| 463 | 3300009148 | Ga0105243_10000418 | Ga0105243_100004188 | 321 |
| 464 | 3300009148 | Ga0105243_10002911 | Ga0105243_100029118 | 321 |
| 465 | 3300009148 | Ga0105243_10003724 | Ga0105243_100037246 | 321 |
| 466 | 3300009148 | Ga0105243_10005562 | Ga0105243_100055624 | 321 |
| 467 | 3300009148 | Ga0105243_10010759 | Ga0105243_100107598 | 321 |
| 468 | 3300009553 | Ga0105249_10006152 | Ga0105249_100061525 | 321 |
| 469 | 3300011119 | Ga0105246_10000446 | Ga0105246_100004461 | 321 |
| 470 | 3300011119 | Ga0105246_10021610 | Ga0105246_100216103 | 321 |
| 471 | 3300013100 | Ga0157373_10040572 | Ga0157373_100405723 | 321 |
| 472 | 3300013102 | Ga0157371_10000609 | Ga0157371_1000060933 | 321 |
| 473 | 3300013102 | Ga0157371_10003267 | Ga0157371_100032677 | 321 |
| 474 | 3300013104 | Ga0157370_10064044 | Ga0157370_100640443 | 321 |
| 475 | 3300013104 | Ga0157370_10196182 | Ga0157370_101961822 | 321 |
| 476 | 3300013307 | Ga0157372_10009606 | Ga0157372_100096065 | 321 |
| 477 | 3300013307 | Ga0157372_10109564 | Ga0157372_101095642 | 321 |
| 478 | 3300014497 | Ga0182008_10000293 | Ga0182008_1000029335 | 321 |
| 479 | 3300014497 | Ga0182008_10005460 | Ga0182008_100054608 | 321 |
| 480 | 3300015261 | Ga0182006_1066241 | Ga0182006_10662412 | 321 |
| 481 | 3300015262 | Ga0182007_10000284 | Ga0182007_100002847 | 321 |
| 482 | 3300015265 | Ga0182005_1002545 | Ga0182005_10025452 | 321 |
| 483 | 3300015265 | Ga0182005_1013344 | Ga0182005_10133442 | 321 |
| 484 | 3300015265 | Ga0182005_1023817 | Ga0182005_10238172 | 321 |
| 485 | 3300017792 | Ga0163161_10017835 | Ga0163161_100178354 | 321 |
| 486 | 3300017792 | Ga0163161_10022215 | Ga0163161_100222152 | 321 |
| 487 | 3300025207 | Ga0209760_100149 | Ga0209760_10014934 | 321 |
| 488 | 3300025231 | Ga0207427_100005 | Ga0207427_100005330 | 321 |
| 489 | 3300025233 | Ga0209437_100018 | Ga0209437_100018240 | 321 |
| 490 | 3300025261 | Ga0209233_1000021 | Ga0209233_1000021330 | 321 |
| 491 | 3300025291 | Ga0209675_1002099 | Ga0209675_10020991 | 321 |
| 492 | 3300025292 | Ga0209676_1000015 | Ga0209676_1000015412 | 321 |
| 493 | 3300025292 | Ga0209676_1000041 | Ga0209676_1000041174 | 321 |
| 494 | 3300025292 | Ga0209676_1000510 | Ga0209676_10005109 | 321 |
| 495 | 3300025292 | Ga0209676_1002546 | Ga0209676_10025467 | 321 |
| 496 | 3300025292 | Ga0209676_1003117 | Ga0209676_10031172 | 321 |
| 497 | 3300025298 | Ga0209050_1000024 | Ga0209050_1000024173 | 321 |
| 498 | 3300025298 | Ga0209050_1000030 | Ga0209050_100003026 | 321 |
| 499 | 3300025298 | Ga0209050_1000518 | Ga0209050_100051837 | 321 |
| 500 | 3300025303 | Ga0209051_1000012 | Ga0209051_1000012268 | 321 |
| 501 | 3300025303 | Ga0209051_1000023 | Ga0209051_100002389 | 321 |
| 502 | 3300025304 | Ga0209257_1001245 | Ga0209257_100124524 | 321 |
| 503 | 3300025304 | Ga0209257_1008821 | Ga0209257_10088216 | 321 |
| 504 | 3300025711 | Ga0207696_1000031 | Ga0207696_1000031231 | 321 |
| 505 | 3300025711 | Ga0207696_1000078 | Ga0207696_1000078187 | 321 |
| 506 | 3300025711 | Ga0207696_1000145 | Ga0207696_100014575 | 321 |
| 507 | 3300025711 | Ga0207696_1005520 | Ga0207696_10055207 | 321 |
| 508 | 3300025711 | Ga0207696_1010267 | Ga0207696_10102672 | 321 |
| 509 | 3300025711 | Ga0207696_1010392 | Ga0207696_10103922 | 321 |
| 510 | 3300025711 | Ga0207696_1046628 | Ga0207696_10466281 | 321 |
| 511 | 3300025728 | Ga0207655_1000014 | Ga0207655_1000014435 | 321 |
| 512 | 3300025728 | Ga0207655_1000202 | Ga0207655_100020243 | 321 |
| 513 | 3300025728 | Ga0207655_1000309 | Ga0207655_100030966 | 321 |
| 514 | 3300025728 | Ga0207655_1001315 | Ga0207655_10013159 | 321 |
| 515 | 3300025728 | Ga0207655_1005067 | Ga0207655_10050672 | 321 |
| 516 | 3300025728 | Ga0207655_1008795 | Ga0207655_10087957 | 321 |
| 517 | 3300025728 | Ga0207655_1015714 | Ga0207655_10157144 | 321 |
| 518 | 3300025728 | Ga0207655_1016904 | Ga0207655_10169042 | 321 |
| 519 | 3300025728 | Ga0207655_1030074 | Ga0207655_10300743 | 321 |
| 520 | 3300025728 | Ga0207655_1079939 | Ga0207655_10799392 | 321 |
| 521 | 3300025735 | Ga0207713_1000010 | Ga0207713_1000010317 | 321 |
| 522 | 3300025735 | Ga0207713_1000077 | Ga0207713_100007750 | 321 |
| 523 | 3300025735 | Ga0207713_1001109 | Ga0207713_10011097 | 321 |
| 524 | 3300025735 | Ga0207713_1001462 | Ga0207713_10014629 | 321 |
| 525 | 3300025735 | Ga0207713_1003196 | Ga0207713_10031968 | 321 |
| 526 | 3300025735 | Ga0207713_1003335 | Ga0207713_10033357 | 321 |
| 527 | 3300025735 | Ga0207713_1005980 | Ga0207713_10059803 | 321 |
| 528 | 3300025735 | Ga0207713_1012141 | Ga0207713_10121414 | 321 |
| 529 | 3300025735 | Ga0207713_1037259 | Ga0207713_10372592 | 321 |
| 530 | 3300025735 | Ga0207713_1037522 | Ga0207713_10375221 | 321 |
| 531 | 3300025923 | Ga0207681_10003206 | Ga0207681_100032062 | 321 |
| 532 | 3300025935 | Ga0207709_10000071 | Ga0207709_1000007124 | 321 |
| 533 | 3300025935 | Ga0207709_10000337 | Ga0207709_1000033732 | 321 |
| 534 | 3300025935 | Ga0207709_10003583 | Ga0207709_100035838 | 321 |
| 535 | 3300025935 | Ga0207709_10021142 | Ga0207709_100211424 | 321 |
| 536 | 3300025935 | Ga0207709_10061947 | Ga0207709_100619471 | 321 |
| 537 | 3300025972 | Ga0207668_10026463 | Ga0207668_100264633 | 321 |
| 538 | 3300026067 | Ga0207678_10091364 | Ga0207678_100913643 | 321 |
| 539 | 3300027111 | Ga0209281_1000019 | Ga0209281_1000019222 | 321 |
| 540 | 3300027296 | Ga0209389_1000049 | Ga0209389_100004944 | 321 |
| 541 | 3300027312 | Ga0209371_1000106 | Ga0209371_100010663 | 321 |
| 542 | 3300027907 | Ga0207428_10064067 | Ga0207428_100640672 | 321 |
| 543 | 3300027907 | Ga0207428_10110118 | Ga0207428_101101182 | 321 |
| 544 | 3300028786 | Ga0307517_10125821 | Ga0307517_101258212 | 321 |
| 545 | 3300030500 | Ga0268256_1000077 | Ga0268256_100007763 | 321 |
| 546 | 3300030521 | Ga0307511_10061910 | Ga0307511_100619103 | 321 |
| 547 | 3300030731 | Ga0316177_1038918 | Ga0316177_10389182 | 321 |
| 548 | 3300030734 | Ga0316179_1012631 | Ga0316179_10126313 | 321 |
| 549 | 3300030744 | Ga0316181_1237161 | Ga0316181_12371611 | 321 |
| 550 | 3300031548 | Ga0307408_100001975 | Ga0307408_1000019757 | 321 |
| 551 | 3300031901 | Ga0307406_10153558 | Ga0307406_101535582 | 321 |
| 552 | 3300031911 | Ga0307412_10007211 | Ga0307412_100072111 | 321 |
| 553 | 3300031911 | Ga0307412_10010029 | Ga0307412_100100297 | 321 |
| 554 | 3300031911 | Ga0307412_10093995 | Ga0307412_100939952 | 321 |
| 555 | 3300031995 | Ga0307409_100313276 | Ga0307409_1003132762 | 321 |
| 556 | 3300032004 | Ga0307414_10292647 | Ga0307414_102926471 | 321 |
| 557 | 3300038705 | Ga0237819_01092 | Ga0237819_01092_5346_6326 | 321 |
| 558 | 3300041405 | Ga0439438_003418 | Ga0439438_003418_4593_5558 | 321 |
| 559 | 3300041405 | Ga0439438_026980 | Ga0439438_026980_488_1459 | 321 |
| 560 | 3300041407 | Ga0439447_001317 | Ga0439447_001317_7491_8456 | 321 |
| 561 | 3300041407 | Ga0439447_006479 | Ga0439447_006479_2693_3658 | 321 |
| 562 | 3300041411 | Ga0439466_0007030 | Ga0439466_0007030_1166_2137 | 321 |
| 563 | 3300041413 | Ga0439465_0015721 | Ga0439465_0015721_1308_2273 | 321 |
| 564 | 3300042006 | Ga0439432_002776 | Ga0439432_002776_2220_3185 | 321 |
| 565 | 3300042006 | Ga0439432_028919 | Ga0439432_028919_101_1072 | 321 |
| 566 | 3300042009 | Ga0439451_001405 | Ga0439451_001405_1229_2194 | 321 |
| 567 | 3300042009 | Ga0439451_021998 | Ga0439451_021998_220_1185 | 321 |
| 568 | 3300042010 | Ga0439452_000354 | Ga0439452_000354_25789_26763 | 321 |
| 569 | 3300042010 | Ga0439452_000769 | Ga0439452_000769_9576_10541 | 321 |
| 570 | 3300042010 | Ga0439452_004376 | Ga0439452_004376_2593_3558 | 321 |
| 571 | 3300042010 | Ga0439452_007020 | Ga0439452_007020_496_1461 | 321 |
| 572 | 3300042010 | Ga0439452_011548 | Ga0439452_011548_1166_2131 | 321 |
| 573 | 3300042013 | Ga0439456_000043 | Ga0439456_000043_15085_16050 | 321 |
| 574 | 3300042013 | Ga0439456_000444 | Ga0439456_000444_7132_8097 | 321 |
| 575 | 3300042016 | Ga0439463_000538 | Ga0439463_000538_1776_2741 | 321 |
| 576 | 3300042016 | Ga0439463_002794 | Ga0439463_002794_918_1883 | 321 |
| 577 | 3300042137 | Ga0450902_005290 | Ga0450902_005290_449_1414 | 321 |
| 578 | 3300042142 | Ga0450905_000396 | Ga0450905_000396_1191_2156 | 321 |
| 579 | 3300042142 | Ga0450905_001922 | Ga0450905_001922_1170_2135 | 321 |
| 580 | 3300042142 | Ga0450905_006590 | Ga0450905_006590_262_1227 | 321 |
| 581 | 3300042145 | Ga0450906_000802 | Ga0450906_000802_1944_2909 | 321 |
| 582 | 3300042146 | Ga0450907_000322 | Ga0450907_000322_5232_6197 | 321 |
| 583 | 3300042146 | Ga0450907_001362 | Ga0450907_001362_119_1084 | 321 |
| 584 | 3300042146 | Ga0450907_014591 | Ga0450907_014591_270_1235 | 321 |
| 585 | 3300042184 | Ga0450908_001252 | Ga0450908_001252_1830_2795 | 321 |
| 586 | 3300042185 | Ga0450909_001520 | Ga0450909_001520_1269_2234 | 321 |
| 587 | 3300042435 | Ga0439434_0000151 | Ga0439434_0000151_5404_6369 | 321 |
| 588 | 3300042435 | Ga0439434_0016456 | Ga0439434_0016456_254_1219 | 321 |
| 589 | 3300042461 | Ga0439460_0000441 | Ga0439460_0000441_367_1332 | 321 |
| 590 | 3300042461 | Ga0439460_0015363 | Ga0439460_0015363_612_1577 | 321 |
| 591 | 3300046452 | Ga0495617_001375 | Ga0495617_001375_9478_10443 | 321 |
| 592 | 3300046452 | Ga0495617_017658 | Ga0495617_017658_73_1038 | 321 |
| 593 | 3300046452 | Ga0495617_028103 | Ga0495617_028103_581_1546 | 321 |
| 594 | 3300046453 | Ga0495627_000102 | Ga0495627_000102_76538_77590 | 321 |
| 595 | 3300046453 | Ga0495627_000333 | Ga0495627_000333_10209_11174 | 321 |
| 596 | 3300046453 | Ga0495627_011045 | Ga0495627_011045_311_1276 | 321 |
| 597 | 3300046457 | Ga0495590_0048576 | Ga0495590_0048576_321_1286 | 321 |
| 598 | 3300046458 | Ga0495591_000105 | Ga0495591_000105_37857_38822 | 321 |
| 599 | 3300046458 | Ga0495591_000463 | Ga0495591_000463_26915_27880 | 321 |
| 600 | 3300046458 | Ga0495591_001494 | Ga0495591_001494_9347_10312 | 321 |
| 601 | 3300046458 | Ga0495591_007001 | Ga0495591_007001_2357_3337 | 321 |
| 602 | 3300046458 | Ga0495591_031369 | Ga0495591_031369_55_1035 | 321 |
| 603 | 3300046458 | Ga0495591_044177 | Ga0495591_044177_181_1146 | 321 |
| 604 | 3300046460 | Ga0495638_0020892 | Ga0495638_0020892_1544_2524 | 321 |
| 605 | 3300046460 | Ga0495638_0046756 | Ga0495638_0046756_160_1125 | 321 |
| 606 | 3300046463 | Ga0495653_0004797 | Ga0495653_0004797_3680_4645 | 321 |
| 607 | 3300046463 | Ga0495653_0034075 | Ga0495653_0034075_1379_2344 | 321 |
| 608 | 3300046471 | Ga0495650_0009035 | Ga0495650_0009035_4653_5618 | 321 |
| 609 | 3300046471 | Ga0495650_0034108 | Ga0495650_0034108_921_1886 | 321 |
| 610 | 3300046471 | Ga0495650_0055864 | Ga0495650_0055864_64_1029 | 321 |
| 611 | 3300046473 | Ga0495582_0003854 | Ga0495582_0003854_1300_2265 | 321 |
| 612 | 3300046474 | Ga0495605_0000255 | Ga0495605_0000255_56568_57533 | 321 |
| 613 | 3300046474 | Ga0495605_0000620 | Ga0495605_0000620_22086_23051 | 321 |
| 614 | 3300046474 | Ga0495605_0000714 | Ga0495605_0000714_18082_19047 | 321 |
| 615 | 3300046474 | Ga0495605_0002506 | Ga0495605_0002506_6492_7457 | 321 |
| 616 | 3300046474 | Ga0495605_0002791 | Ga0495605_0002791_5188_6153 | 321 |
| 617 | 3300046474 | Ga0495605_0044799 | Ga0495605_0044799_1054_2019 | 321 |
| 618 | 3300046474 | Ga0495605_0114829 | Ga0495605_0114829_29_994 | 321 |
| 619 | 3300046475 | Ga0495639_0024724 | Ga0495639_0024724_1348_2313 | 321 |
| 620 | 3300046491 | Ga0495584_0001930 | Ga0495584_0001930_1548_2528 | 321 |
| 621 | 3300046491 | Ga0495584_0010587 | Ga0495584_0010587_2285_3250 | 321 |
| 622 | 3300046491 | Ga0495584_0035444 | Ga0495584_0035444_61_1026 | 321 |
| 623 | 3300046492 | Ga0495585_0002921 | Ga0495585_0002921_1549_2514 | 321 |
| 624 | 3300046492 | Ga0495585_0004927 | Ga0495585_0004927_96_1061 | 321 |
| 625 | 3300046492 | Ga0495585_0005380 | Ga0495585_0005380_2484_3449 | 321 |
| 626 | 3300046492 | Ga0495585_0014826 | Ga0495585_0014826_3540_4505 | 321 |
| 627 | 3300046499 | Ga0495594_0004681 | Ga0495594_0004681_381_1346 | 321 |
| 628 | 3300046500 | Ga0495596_0005753 | Ga0495596_0005753_4751_5716 | 321 |
| 629 | 3300046501 | Ga0495607_0001049 | Ga0495607_0001049_20615_21580 | 321 |
| 630 | 3300046501 | Ga0495607_0001370 | Ga0495607_0001370_3790_4758 | 321 |
| 631 | 3300046501 | Ga0495607_0003022 | Ga0495607_0003022_5933_6898 | 321 |
| 632 | 3300046501 | Ga0495607_0003939 | Ga0495607_0003939_2825_3790 | 321 |
| 633 | 3300046501 | Ga0495607_0005722 | Ga0495607_0005722_5082_6047 | 321 |
| 634 | 3300046501 | Ga0495607_0006981 | Ga0495607_0006981_5252_6217 | 321 |
| 635 | 3300046501 | Ga0495607_0007583 | Ga0495607_0007583_6153_7118 | 321 |
| 636 | 3300046501 | Ga0495607_0014785 | Ga0495607_0014785_2525_3490 | 321 |
| 637 | 3300046501 | Ga0495607_0027621 | Ga0495607_0027621_1439_2407 | 321 |
| 638 | 3300046501 | Ga0495607_0110750 | Ga0495607_0110750_474_1439 | 321 |
| 639 | 3300046506 | Ga0495583_0000015 | Ga0495583_0000015_28683_29648 | 321 |
| 640 | 3300046506 | Ga0495583_0003590 | Ga0495583_0003590_3478_4521 | 321 |
| 641 | 3300046506 | Ga0495583_0005217 | Ga0495583_0005217_7522_8502 | 321 |
| 642 | 3300046506 | Ga0495583_0007640 | Ga0495583_0007640_5263_6228 | 321 |
| 643 | 3300046507 | Ga0495606_0000177 | Ga0495606_0000177_60494_61459 | 321 |
| 644 | 3300046507 | Ga0495606_0001016 | Ga0495606_0001016_36343_37308 | 321 |
| 645 | 3300046507 | Ga0495606_0021409 | Ga0495606_0021409_1213_2178 | 321 |
| 646 | 3300046512 | Ga0495610_0015192 | Ga0495610_0015192_335_1300 | 321 |
| 647 | 3300046512 | Ga0495610_0042477 | Ga0495610_0042477_1209_2189 | 321 |
| 648 | 3300046512 | Ga0495610_0059364 | Ga0495610_0059364_128_1108 | 321 |
| 649 | 3300046512 | Ga0495610_0071757 | Ga0495610_0071757_29_994 | 321 |
| 650 | 3300046512 | Ga0495610_0117880 | Ga0495610_0117880_85_1050 | 321 |
| 651 | 3300046513 | Ga0495616_0007584 | Ga0495616_0007584_5235_6200 | 321 |
| 652 | 3300046513 | Ga0495616_0018417 | Ga0495616_0018417_356_1321 | 321 |
| 653 | 3300046513 | Ga0495616_0023813 | Ga0495616_0023813_98_1078 | 321 |
| 654 | 3300046513 | Ga0495616_0035147 | Ga0495616_0035147_1450_2415 | 321 |
| 655 | 3300046515 | Ga0495620_0000039 | Ga0495620_0000039_20475_21440 | 321 |
| 656 | 3300046515 | Ga0495620_0000301 | Ga0495620_0000301_4566_5531 | 321 |
| 657 | 3300046515 | Ga0495620_0002335 | Ga0495620_0002335_1289_2254 | 321 |
| 658 | 3300046515 | Ga0495620_0034967 | Ga0495620_0034967_928_1893 | 321 |
| 659 | 3300046518 | Ga0495631_0001929 | Ga0495631_0001929_459_1424 | 321 |
| 660 | 3300046518 | Ga0495631_0002026 | Ga0495631_0002026_1471_2436 | 321 |
| 661 | 3300046519 | Ga0495632_0001966 | Ga0495632_0001966_1588_2553 | 321 |
| 662 | 3300046519 | Ga0495632_0003351 | Ga0495632_0003351_8862_9827 | 321 |
| 663 | 3300046519 | Ga0495632_0037285 | Ga0495632_0037285_875_1840 | 321 |
| 664 | 3300046519 | Ga0495632_0057031 | Ga0495632_0057031_145_1110 | 321 |
| 665 | 3300046519 | Ga0495632_0059774 | Ga0495632_0059774_504_1469 | 321 |
| 666 | 3300046520 | Ga0495637_0000393 | Ga0495637_0000393_4651_5616 | 321 |
| 667 | 3300046520 | Ga0495637_0002084 | Ga0495637_0002084_2027_2992 | 321 |
| 668 | 3300046520 | Ga0495637_0003136 | Ga0495637_0003136_131_1096 | 321 |
| 669 | 3300046520 | Ga0495637_0003862 | Ga0495637_0003862_1685_2653 | 321 |
| 670 | 3300046520 | Ga0495637_0005606 | Ga0495637_0005606_4566_5531 | 321 |
| 671 | 3300046520 | Ga0495637_0014306 | Ga0495637_0014306_1662_2627 | 321 |
| 672 | 3300046520 | Ga0495637_0015516 | Ga0495637_0015516_1347_2312 | 321 |
| 673 | 3300046520 | Ga0495637_0024098 | Ga0495637_0024098_1339_2304 | 321 |
| 674 | 3300046520 | Ga0495637_0047894 | Ga0495637_0047894_206_1171 | 321 |
| 675 | 3300046520 | Ga0495637_0054723 | Ga0495637_0054723_480_1445 | 321 |
| 676 | 3300046522 | Ga0495643_0001673 | Ga0495643_0001673_2463_3428 | 321 |
| 677 | 3300046522 | Ga0495643_0002515 | Ga0495643_0002515_13325_14290 | 321 |
| 678 | 3300046522 | Ga0495643_0009672 | Ga0495643_0009672_1540_2505 | 321 |
| 679 | 3300046522 | Ga0495643_0015413 | Ga0495643_0015413_3403_4368 | 321 |
| 680 | 3300046522 | Ga0495643_0020423 | Ga0495643_0020423_2120_3085 | 321 |
| 681 | 3300046522 | Ga0495643_0042615 | Ga0495643_0042615_1327_2292 | 321 |
| 682 | 3300046523 | Ga0495644_0000975 | Ga0495644_0000975_9379_10344 | 321 |
| 683 | 3300046524 | Ga0495648_0005114 | Ga0495648_0005114_6572_7537 | 321 |
| 684 | 3300046524 | Ga0495648_0028082 | Ga0495648_0028082_1617_2582 | 321 |
| 685 | 3300046524 | Ga0495648_0041508 | Ga0495648_0041508_1564_2529 | 321 |
| 686 | 3300046524 | Ga0495648_0091576 | Ga0495648_0091576_101_1081 | 321 |
| 687 | 3300046526 | Ga0495666_0006845 | Ga0495666_0006845_2654_3619 | 321 |
| 688 | 3300046528 | Ga0495642_0000237 | Ga0495642_0000237_1579_2544 | 321 |
| 689 | 3300046530 | Ga0495654_0002801 | Ga0495654_0002801_9543_10508 | 321 |
| 690 | 3300046530 | Ga0495654_0007639 | Ga0495654_0007639_4725_5690 | 321 |
| 691 | 3300046530 | Ga0495654_0008960 | Ga0495654_0008960_863_1828 | 321 |
| 692 | 3300046530 | Ga0495654_0016049 | Ga0495654_0016049_151_1116 | 321 |
| 693 | 3300046530 | Ga0495654_0019909 | Ga0495654_0019909_795_1775 | 321 |
| 694 | 3300046530 | Ga0495654_0020989 | Ga0495654_0020989_101_1081 | 321 |
| 695 | 3300046530 | Ga0495654_0045704 | Ga0495654_0045704_344_1309 | 321 |
| 696 | 3300046536 | Ga0495587_0029373 | Ga0495587_0029373_1032_1997 | 321 |
| 697 | 3300046536 | Ga0495587_0133165 | Ga0495587_0133165_197_1162 | 321 |
| 698 | 3300046538 | Ga0495609_0000192 | Ga0495609_0000192_55209_56174 | 321 |
| 699 | 3300046538 | Ga0495609_0000773 | Ga0495609_0000773_4313_5278 | 321 |
| 700 | 3300046542 | Ga0495597_0001180 | Ga0495597_0001180_4320_5285 | 321 |
| 701 | 3300046542 | Ga0495597_0008969 | Ga0495597_0008969_1510_2475 | 321 |
| 702 | 3300046542 | Ga0495597_0033827 | Ga0495597_0033827_98_1063 | 321 |
| 703 | 3300046542 | Ga0495597_0060014 | Ga0495597_0060014_364_1329 | 321 |
| 704 | 3300046558 | Ga0495633_0000373 | Ga0495633_0000373_41538_42503 | 321 |
| 705 | 3300046558 | Ga0495633_0009466 | Ga0495633_0009466_2891_3856 | 321 |
| 706 | 3300046615 | Ga0495656_0024359 | Ga0495656_0024359_799_1764 | 321 |
| 707 | 3300046616 | Ga0495668_0002528 | Ga0495668_0002528_9280_10245 | 321 |
| 708 | 3300046616 | Ga0495668_0158061 | Ga0495668_0158061_86_1051 | 321 |
| 709 | 3300046648 | Ga0495611_0000749 | Ga0495611_0000749_9465_10430 | 321 |
| 710 | 3300046648 | Ga0495611_0002123 | Ga0495611_0002123_5052_6017 | 321 |
| 711 | 3300046648 | Ga0495611_0002529 | Ga0495611_0002529_6880_7845 | 321 |
| 712 | 3300046660 | Ga0495625_0044451 | Ga0495625_0044451_209_1174 | 321 |
| 713 | 3300046660 | Ga0495625_0054046 | Ga0495625_0054046_1547_2512 | 321 |
| 714 | 3300046663 | Ga0495635_0011428 | Ga0495635_0011428_3887_4852 | 321 |
| 715 | 3300046664 | Ga0495659_0001738 | Ga0495659_0001738_181_1146 | 321 |
| 716 | 3300046665 | Ga0495661_0000097 | Ga0495661_0000097_101533_102498 | 321 |
| 717 | 3300046665 | Ga0495661_0016216 | Ga0495661_0016216_3117_4082 | 321 |
| 718 | 3300046665 | Ga0495661_0022508 | Ga0495661_0022508_2341_3306 | 321 |
| 719 | 3300046680 | Ga0495646_0003313 | Ga0495646_0003313_7736_8701 | 321 |
| 720 | 3300046684 | Ga0495669_0019373 | Ga0495669_0019373_730_1695 | 321 |
| 721 | 3300046691 | Ga0495670_0001123 | Ga0495670_0001123_8258_9223 | 321 |
| 722 | 3300046691 | Ga0495670_0007368 | Ga0495670_0007368_309_1274 | 321 |
| 723 | 3300046691 | Ga0495670_0028928 | Ga0495670_0028928_539_1504 | 321 |
| 724 | 3300046691 | Ga0495670_0046550 | Ga0495670_0046550_1085_2050 | 321 |
| 725 | 3300046692 | Ga0495671_0000805 | Ga0495671_0000805_1519_2484 | 321 |
| 726 | 3300046692 | Ga0495671_0002987 | Ga0495671_0002987_9443_10408 | 321 |
| 727 | 3300046692 | Ga0495671_0006866 | Ga0495671_0006866_2515_3480 | 321 |
| 728 | 3300046692 | Ga0495671_0009698 | Ga0495671_0009698_73_1038 | 321 |
| 729 | 3300046692 | Ga0495671_0016307 | Ga0495671_0016307_859_1824 | 321 |
| 730 | 3300046692 | Ga0495671_0032565 | Ga0495671_0032565_669_1634 | 321 |
| 731 | 3300046692 | Ga0495671_0080538 | Ga0495671_0080538_318_1298 | 321 |
| 732 | 3300046694 | Ga0495649_0000531 | Ga0495649_0000531_25426_26391 | 321 |
| 733 | 3300046694 | Ga0495649_0001245 | Ga0495649_0001245_16830_17798 | 321 |
| 734 | 3300046694 | Ga0495649_0003048 | Ga0495649_0003048_9396_10376 | 321 |
| 735 | 3300046694 | Ga0495649_0088630 | Ga0495649_0088630_29_994 | 321 |
| 736 | 3300046794 | Ga0495589_0002695 | Ga0495589_0002695_7410_8375 | 321 |
| 737 | 3300046794 | Ga0495589_0013142 | Ga0495589_0013142_187_1152 | 321 |
| 738 | 3300046794 | Ga0495589_0013949 | Ga0495589_0013949_294_1259 | 321 |
| 739 | 3300046794 | Ga0495589_0019206 | Ga0495589_0019206_1565_2530 | 321 |
| 740 | 3300046809 | Ga0495600_0021373 | Ga0495600_0021373_333_1298 | 321 |
| 741 | 3300046810 | Ga0495660_0000492 | Ga0495660_0000492_5140_6105 | 321 |
| 742 | 3300046810 | Ga0495660_0001739 | Ga0495660_0001739_13041_14006 | 321 |
| 743 | 3300046810 | Ga0495660_0028240 | Ga0495660_0028240_1571_2536 | 321 |
| 744 | 3300046810 | Ga0495660_0051239 | Ga0495660_0051239_385_1350 | 321 |
| 745 | 3300046810 | Ga0495660_0094337 | Ga0495660_0094337_72_1052 | 321 |
| 746 | 3300047315 | Ga0495581_0054175 | Ga0495581_0054175_972_1937 | 321 |
| 747 | 3300047317 | Ga0495604_0026614 | Ga0495604_0026614_416_1381 | 321 |
| 748 | 3300047318 | Ga0495636_0002667 | Ga0495636_0002667_5697_6662 | 321 |
| 749 | 3300047320 | Ga0495672_0004415 | Ga0495672_0004415_5288_6253 | 321 |
| 750 | 3300047320 | Ga0495672_0005033 | Ga0495672_0005033_158_1138 | 321 |
| 751 | 3300047320 | Ga0495672_0027434 | Ga0495672_0027434_1403_2368 | 321 |
| 752 | 3300047320 | Ga0495672_0033562 | Ga0495672_0033562_499_1464 | 321 |
| 753 | 3300047322 | Ga0495680_0016523 | Ga0495680_0016523_2718_3683 | 321 |
| 754 | 3300047322 | Ga0495680_0048546 | Ga0495680_0048546_2311_3276 | 321 |
| 755 | 3300047323 | Ga0495683_0000106 | Ga0495683_0000106_56526_57491 | 321 |
| 756 | 3300047323 | Ga0495683_0000207 | Ga0495683_0000207_50168_51136 | 321 |
| 757 | 3300047323 | Ga0495683_0002916 | Ga0495683_0002916_1809_2774 | 321 |
| 758 | 3300047323 | Ga0495683_0017999 | Ga0495683_0017999_968_1933 | 321 |
| 759 | 3300047323 | Ga0495683_0020899 | Ga0495683_0020899_963_1928 | 321 |
| 760 | 3300047443 | Ga0495687_005908 | Ga0495687_005908_6163_7128 | 321 |
| 761 | 3300047443 | Ga0495687_012488 | Ga0495687_012488_1528_2493 | 321 |
| 762 | 3300047444 | Ga0495675_0004892 | Ga0495675_0004892_3913_4878 | 321 |
| 763 | 3300047445 | Ga0495677_0009101 | Ga0495677_0009101_1679_2644 | 321 |
| 764 | 3300047446 | Ga0495679_000274 | Ga0495679_000274_15900_16865 | 321 |
| 765 | 3300047446 | Ga0495679_000371 | Ga0495679_000371_28944_29909 | 321 |
| 766 | 3300047469 | Ga0495673_0000222 | Ga0495673_0000222_5532_6497 | 321 |
| 767 | 3300047469 | Ga0495673_0002875 | Ga0495673_0002875_1458_2423 | 321 |
| 768 | 3300047469 | Ga0495673_0012077 | Ga0495673_0012077_2125_3090 | 321 |
| 769 | 3300047469 | Ga0495673_0020102 | Ga0495673_0020102_129_1109 | 321 |
| 770 | 3300047469 | Ga0495673_0024472 | Ga0495673_0024472_1856_2821 | 321 |
| 771 | 3300047469 | Ga0495673_0024620 | Ga0495673_0024620_918_1883 | 321 |
| 772 | 3300047469 | Ga0495673_0031313 | Ga0495673_0031313_887_1852 | 321 |
| 773 | 3300047469 | Ga0495673_0059705 | Ga0495673_0059705_657_1622 | 321 |
| 774 | 3300047469 | Ga0495673_0089911 | Ga0495673_0089911_151_1116 | 321 |
| 775 | 3300047470 | Ga0495681_0005234 | Ga0495681_0005234_7320_8285 | 321 |
| 776 | 3300047470 | Ga0495681_0007728 | Ga0495681_0007728_782_1747 | 321 |
| 777 | 3300047470 | Ga0495681_0007812 | Ga0495681_0007812_166_1131 | 321 |
| 778 | 3300047470 | Ga0495681_0045081 | Ga0495681_0045081_379_1359 | 321 |
| 779 | 3300047673 | Ga0495593_0009346 | Ga0495593_0009346_117_1082 | 321 |
| 780 | 3300048091 | Ga0495626_0000068 | Ga0495626_0000068_120589_121554 | 321 |
| 781 | 3300048091 | Ga0495626_0000678 | Ga0495626_0000678_26960_27925 | 321 |
| 782 | 3300048091 | Ga0495626_0020358 | Ga0495626_0020358_74_1054 | 321 |
| 783 | 3300048905 | Ga0496102_0005434 | Ga0496102_0005434_9763_10728 | 321 |
| 784 | 3300048913 | Ga0496110_0091238 | Ga0496110_0091238_411_1376 | 321 |
| 785 | 3300048917 | Ga0496114_0007131 | Ga0496114_0007131_4712_5677 | 321 |
| 786 | 3300048917 | Ga0496114_0057734 | Ga0496114_0057734_789_1754 | 321 |
| 787 | 3300048919 | Ga0496116_0000670 | Ga0496116_0000670_6104_7069 | 321 |
| 788 | 3300048919 | Ga0496116_0043932 | Ga0496116_0043932_371_1336 | 321 |
| 789 | 3300048920 | Ga0496117_0002093 | Ga0496117_0002093_6105_7070 | 321 |
| 790 | 3300048920 | Ga0496117_0003858 | Ga0496117_0003858_2600_3565 | 321 |
| 791 | 3300048920 | Ga0496117_0006799 | Ga0496117_0006799_7900_8865 | 321 |
| 792 | 3300048920 | Ga0496117_0013238 | Ga0496117_0013238_3153_4118 | 321 |
| 793 | 3300048920 | Ga0496117_0061670 | Ga0496117_0061670_215_1195 | 321 |
| 794 | 3300048920 | Ga0496117_0118294 | Ga0496117_0118294_286_1251 | 321 |
| 795 | 3300048921 | Ga0496118_0001842 | Ga0496118_0001842_1491_2456 | 321 |
| 796 | 3300048921 | Ga0496118_0010904 | Ga0496118_0010904_6562_7527 | 321 |
| 797 | 3300048921 | Ga0496118_0030939 | Ga0496118_0030939_2231_3211 | 321 |
| 798 | 3300048921 | Ga0496118_0041256 | Ga0496118_0041256_2598_3563 | 321 |
| 799 | 3300048922 | Ga0496119_0000229 | Ga0496119_0000229_63693_64658 | 321 |
| 800 | 3300048923 | Ga0496120_0001476 | Ga0496120_0001476_9981_10946 | 321 |
| 801 | 3300048924 | Ga0496121_0001246 | Ga0496121_0001246_37665_38630 | 321 |
| 802 | 3300048924 | Ga0496121_0002966 | Ga0496121_0002966_20049_21014 | 321 |
| 803 | 3300048924 | Ga0496121_0031786 | Ga0496121_0031786_251_1216 | 321 |
| 804 | 3300048924 | Ga0496121_0098579 | Ga0496121_0098579_34_999 | 321 |
| 805 | 3300048925 | Ga0496122_0000590 | Ga0496122_0000590_60656_61621 | 321 |
| 806 | 3300048925 | Ga0496122_0001707 | Ga0496122_0001707_19651_20616 | 321 |
| 807 | 3300048925 | Ga0496122_0009159 | Ga0496122_0009159_558_1523 | 321 |
| 808 | 3300048925 | Ga0496122_0017946 | Ga0496122_0017946_5464_6429 | 321 |
| 809 | 3300048925 | Ga0496122_0040719 | Ga0496122_0040719_1451_2416 | 321 |
| 810 | 3300048926 | Ga0496123_0000088 | Ga0496123_0000088_88803_89768 | 321 |
| 811 | 3300048926 | Ga0496123_0000607 | Ga0496123_0000607_20904_21869 | 321 |
| 812 | 3300048926 | Ga0496123_0012377 | Ga0496123_0012377_1480_2445 | 321 |
| 813 | 3300048926 | Ga0496123_0018999 | Ga0496123_0018999_1608_2573 | 321 |
| 814 | 3300048926 | Ga0496123_0062843 | Ga0496123_0062843_1325_2290 | 321 |
| 815 | 3300048927 | Ga0496124_0000073 | Ga0496124_0000073_20721_21686 | 321 |
| 816 | 3300048927 | Ga0496124_0001393 | Ga0496124_0001393_10115_11080 | 321 |
| 817 | 3300048927 | Ga0496124_0003431 | Ga0496124_0003431_3552_4517 | 321 |
| 818 | 3300048927 | Ga0496124_0005436 | Ga0496124_0005436_3722_4687 | 321 |
| 819 | 3300048927 | Ga0496124_0005945 | Ga0496124_0005945_9376_10341 | 321 |
| 820 | 3300048927 | Ga0496124_0033385 | Ga0496124_0033385_236_1201 | 321 |
| 821 | 3300048927 | Ga0496124_0062468 | Ga0496124_0062468_1145_2125 | 321 |
| 822 | 3300048928 | Ga0496125_0001017 | Ga0496125_0001017_14893_15858 | 321 |
| 823 | 3300048928 | Ga0496125_0041485 | Ga0496125_0041485_1276_2241 | 321 |
| 824 | 3300048928 | Ga0496125_0060372 | Ga0496125_0060372_1590_2555 | 321 |
| 825 | 3300048929 | Ga0496126_0109965 | Ga0496126_0109965_1409_2374 | 321 |
| 826 | 3300048929 | Ga0496126_0267834 | Ga0496126_0267834_104_1069 | 321 |
| 827 | 3300049459 | Ga0495678_000404 | Ga0495678_000404_19389_20354 | 321 |
| 828 | 3300049459 | Ga0495678_005047 | Ga0495678_005047_131_1096 | 321 |
| 829 | 3300049459 | Ga0495678_010232 | Ga0495678_010232_828_1793 | 321 |
| 830 | 3300049459 | Ga0495678_022316 | Ga0495678_022316_1034_1999 | 321 |
| 831 | 3300049459 | Ga0495678_030790 | Ga0495678_030790_1097_2077 | 321 |
| 832 | 3300049460 | Ga0495682_0000681 | Ga0495682_0000681_4182_5159 | 321 |
| 833 | 3300049571 | Ga0501034_0000101 | Ga0501034_0000101_76704_77669 | 321 |
| 834 | 3300053135 | Ga0500659_0002113 | Ga0500659_0002113_8685_9650 | 321 |
| 835 | 2162886007 | SwRhRL2b_contig_1108591 | SwRhRL2b_0799.00000790 | 322 |
| 836 | 3300002737 | JGI25162J39368_1000474 | JGI25162J39368_10004747 | 322 |
| 837 | 3300002771 | JGI25163J39215_1001488 | JGI25163J39215_10014882 | 322 |
| 838 | 3300002772 | JGI25164J39214_1000674 | JGI25164J39214_10006747 | 322 |
| 839 | 3300003214 | JGI25165J46597_1000600 | JGI25165J46597_10006007 | 322 |
| 840 | 3300003751 | Ga0055538_1000032 | Ga0055538_1000032134 | 322 |
| 841 | 3300003752 | Ga0055539_1000043 | Ga0055539_1000043134 | 322 |
| 842 | 3300003756 | Ga0055533_1000052 | Ga0055533_1000052134 | 322 |
| 843 | 3300003758 | Ga0055532_1000047 | Ga0055532_1000047114 | 322 |
| 844 | 3300003759 | Ga0055525_1000062 | Ga0055525_1000062134 | 322 |
| 845 | 3300003781 | Ga0055536_1001726 | Ga0055536_10017267 | 322 |
| 846 | 3300003791 | Ga0055530_10002392 | Ga0055530_100023926 | 322 |
| 847 | 3300003792 | Ga0055540_1001654 | Ga0055540_10016546 | 322 |
| 848 | 3300003841 | Ga0055541_1000030 | Ga0055541_1000030134 | 322 |
| 849 | 3300005288 | Ga0065714_10003312 | Ga0065714_100033128 | 322 |
| 850 | 3300005288 | Ga0065714_10098794 | Ga0065714_100987942 | 322 |
| 851 | 3300005289 | Ga0065704_10012375 | Ga0065704_100123752 | 322 |
| 852 | 3300005290 | Ga0065712_10071153 | Ga0065712_100711531 | 322 |
| 853 | 3300005331 | Ga0070670_100002144 | Ga0070670_10000214412 | 322 |
| 854 | 3300005344 | Ga0070661_100000126 | Ga0070661_1000001266 | 322 |
| 855 | 3300005353 | Ga0070669_100000481 | Ga0070669_1000004817 | 322 |
| 856 | 3300005457 | Ga0070662_100000101 | Ga0070662_10000010142 | 322 |
| 857 | 3300005539 | Ga0068853_100000187 | Ga0068853_10000018712 | 322 |
| 858 | 3300005564 | Ga0070664_100000491 | Ga0070664_10000049126 | 322 |
| 859 | 3300005834 | Ga0068851_10000007 | Ga0068851_1000000736 | 322 |
| 860 | 3300009011 | Ga0105251_10000828 | Ga0105251_100008285 | 322 |
| 861 | 3300009011 | Ga0105251_10007236 | Ga0105251_100072363 | 322 |
| 862 | 3300009036 | Ga0105244_10004785 | Ga0105244_100047854 | 322 |
| 863 | 3300009036 | Ga0105244_10008881 | Ga0105244_100088817 | 322 |
| 864 | 3300009092 | Ga0105250_10010893 | Ga0105250_100108933 | 322 |
| 865 | 3300009092 | Ga0105250_10013949 | Ga0105250_100139492 | 322 |
| 866 | 3300009092 | Ga0105250_10043742 | Ga0105250_100437422 | 322 |
| 867 | 3300009148 | Ga0105243_10030328 | Ga0105243_100303282 | 322 |
| 868 | 3300009176 | Ga0105242_10001499 | Ga0105242_1000149915 | 322 |
| 869 | 3300009545 | Ga0105237_10001509 | Ga0105237_1000150925 | 322 |
| 870 | 3300011119 | Ga0105246_10001749 | Ga0105246_100017497 | 322 |
| 871 | 3300013102 | Ga0157371_10040665 | Ga0157371_100406652 | 322 |
| 872 | 3300013104 | Ga0157370_10218524 | Ga0157370_102185242 | 322 |
| 873 | 3300013105 | Ga0157369_10020339 | Ga0157369_100203397 | 322 |
| 874 | 3300013105 | Ga0157369_10028400 | Ga0157369_100284006 | 322 |
| 875 | 3300013308 | Ga0157375_10024520 | Ga0157375_100245201 | 322 |
| 876 | 3300014497 | Ga0182008_10032172 | Ga0182008_100321723 | 322 |
| 877 | 3300015261 | Ga0182006_1001907 | Ga0182006_10019077 | 322 |
| 878 | 3300025206 | Ga0209435_100821 | Ga0209435_1008215 | 322 |
| 879 | 3300025207 | Ga0209760_100027 | Ga0209760_100027110 | 322 |
| 880 | 3300025224 | Ga0209784_100007 | Ga0209784_100007382 | 322 |
| 881 | 3300025225 | Ga0209566_100009 | Ga0209566_100009382 | 322 |
| 882 | 3300025226 | Ga0209674_100021 | Ga0209674_100021382 | 322 |
| 883 | 3300025229 | Ga0209147_100009 | Ga0209147_100009382 | 322 |
| 884 | 3300025230 | Ga0209563_100018 | Ga0209563_100018382 | 322 |
| 885 | 3300025231 | Ga0207427_100006 | Ga0207427_100006442 | 322 |
| 886 | 3300025233 | Ga0209437_100013 | Ga0209437_100013442 | 322 |
| 887 | 3300025233 | Ga0209437_112834 | Ga0209437_1128342 | 322 |
| 888 | 3300025242 | Ga0209258_100169 | Ga0209258_100169101 | 322 |
| 889 | 3300025246 | Ga0209646_1000184 | Ga0209646_100018417 | 322 |
| 890 | 3300025253 | Ga0209677_100012 | Ga0209677_100012382 | 322 |
| 891 | 3300025261 | Ga0209233_1000022 | Ga0209233_1000022442 | 322 |
| 892 | 3300025292 | Ga0209676_1000030 | Ga0209676_1000030267 | 322 |
| 893 | 3300025298 | Ga0209050_1000647 | Ga0209050_100064724 | 322 |
| 894 | 3300025303 | Ga0209051_1000721 | Ga0209051_10007217 | 322 |
| 895 | 3300025321 | Ga0207656_10000006 | Ga0207656_1000000666 | 322 |
| 896 | 3300025711 | Ga0207696_1000357 | Ga0207696_100035739 | 322 |
| 897 | 3300025711 | Ga0207696_1019672 | Ga0207696_10196722 | 322 |
| 898 | 3300025711 | Ga0207696_1039493 | Ga0207696_10394932 | 322 |
| 899 | 3300025728 | Ga0207655_1000388 | Ga0207655_100038843 | 322 |
| 900 | 3300025728 | Ga0207655_1007643 | Ga0207655_10076433 | 322 |
| 901 | 3300025728 | Ga0207655_1066298 | Ga0207655_10662982 | 322 |
| 902 | 3300025735 | Ga0207713_1000815 | Ga0207713_10008157 | 322 |
| 903 | 3300025735 | Ga0207713_1006691 | Ga0207713_10066917 | 322 |
| 904 | 3300025735 | Ga0207713_1006845 | Ga0207713_10068457 | 322 |
| 905 | 3300025914 | Ga0207671_10000131 | Ga0207671_1000013139 | 322 |
| 906 | 3300025920 | Ga0207649_10000012 | Ga0207649_10000012104 | 322 |
| 907 | 3300025923 | Ga0207681_10000099 | Ga0207681_1000009938 | 322 |
| 908 | 3300025925 | Ga0207650_10000518 | Ga0207650_100005187 | 322 |
| 909 | 3300025925 | Ga0207650_10000571 | Ga0207650_1000057124 | 322 |
| 910 | 3300025933 | Ga0207706_10000580 | Ga0207706_1000058035 | 322 |
| 911 | 3300025934 | Ga0207686_10000319 | Ga0207686_1000031927 | 322 |
| 912 | 3300025935 | Ga0207709_10017354 | Ga0207709_100173543 | 322 |
| 913 | 3300025945 | Ga0207679_10000015 | Ga0207679_10000015104 | 322 |
| 914 | 3300025981 | Ga0207640_10011005 | Ga0207640_100110056 | 322 |
| 915 | 3300026041 | Ga0207639_10000775 | Ga0207639_100007758 | 322 |
| 916 | 3300041407 | Ga0439447_005893 | Ga0439447_005893_2619_3599 | 322 |
| 917 | 3300041411 | Ga0439466_0000460 | Ga0439466_0000460_4515_5519 | 322 |
| 918 | 3300041411 | Ga0439466_0002029 | Ga0439466_0002029_534_1514 | 322 |
| 919 | 3300042006 | Ga0439432_000797 | Ga0439432_000797_6539_7507 | 322 |
| 920 | 3300042006 | Ga0439432_022369 | Ga0439432_022369_184_1164 | 322 |
| 921 | 3300042009 | Ga0439451_005530 | Ga0439451_005530_434_1414 | 322 |
| 922 | 3300042016 | Ga0439463_000618 | Ga0439463_000618_4440_5444 | 322 |
| 923 | 3300046491 | Ga0495584_0010251 | Ga0495584_0010251_1536_2516 | 322 |
| 924 | 3300046519 | Ga0495632_0003817 | Ga0495632_0003817_1528_2508 | 322 |
| 925 | 3300046538 | Ga0495609_0006042 | Ga0495609_0006042_3693_4673 | 322 |
| 926 | 3300046665 | Ga0495661_0074765 | Ga0495661_0074765_668_1651 | 322 |
| 927 | 3300046694 | Ga0495649_0003710 | Ga0495649_0003710_1530_2510 | 322 |
| 928 | 3300047446 | Ga0495679_007752 | Ga0495679_007752_2802_3770 | 322 |
| 929 | 3300048927 | Ga0496124_0120201 | Ga0496124_0120201_78_1046 | 322 |
| 930 | 3300048928 | Ga0496125_0014635 | Ga0496125_0014635_6635_7603 | 322 |
| 931 | 3300048928 | Ga0496125_0178965 | Ga0496125_0178965_294_1262 | 322 |
| 932 | 3300049459 | Ga0495678_015508 | Ga0495678_015508_189_1169 | 322 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF12974
Phosphonate-bd
ABC transporter, phosphonate, periplasmic substrate-binding protein
63
225
0.78
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2x26-assembly2.cif.gz_B | crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli | 0.9298 | 30 | 312 |
| 2x26-assembly1.cif.gz_A | crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli | 0.9222 | 30 | 315 |
| 3ksx-assembly1.cif.gz_A | the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops | 0.9222 | 28 | 312 |
| 3ksx-assembly1.cif.gz_A | the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops | 0.907 | 28 | 312 |
| 2x26-assembly2.cif.gz_B | crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli | 0.9024 | 30 | 312 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ksxA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.972 | 112 | 208 | 3.40.190.10 |
| 3ksxA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9343 | 112 | 208 | 3.40.190.10 |
| 3uifA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8979 | 115 | 205 | 3.40.190.10 |
| 3e4rA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8959 | 30 | 315 | 3.40.190.10 |
| 2x26A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8725 | 30 | 312 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X1F4P9-F1-model_v4 | SsuA/THI5-like domain-containing protein | 0.972 | 112 | 206 |
|
| AF-A0A838R042-F1-model_v4 | Aliphatic sulfonate ABC transporter substrate-binding protein | 0.9673 | 29 | 317 |
GO:0016020
GO:0042597 GO:0042626 |
| AF-A0A6B3TU84-F1-model_v4 | ABC transporter substrate-binding protein | 0.9664 | 94 | 239 |
|
| AF-A0A653S803-F1-model_v4 | ABC transporter substrate-binding protein | 0.9648 | 82 | 312 |
|
| AF-A0A3S1ZSK7-F1-model_v4 | Transporter substrate-binding domain-containing protein | 0.9619 | 115 | 297 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar