F486078

General Info

Members Datasets Scaffolds Average Seq Length
932 485 731 323

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0022119|Ga0495672_0022119_596_1636
Length 346
Sequence MTSPIARSLFKRRRLLTGALVLATGLAYGLLAAPVQAQSQTVNPKLLRIGYQKYGTLTLLKARGTLEKRLASQGITVKWTEFPAGPQLLEGLNVGAVDFGTVGEAPPIFAQAAGAQLAYIGNEPPAPTAEAIVVPKGSALKSVADLRGKRVALNKGSNVHYLLVKQLEAAGVAYSEIQPVYLPPADARAAFERGAVDAWVIWDPFLAAAEKQLGARVLIDGRSADGKNVVSNHQFYLASRPYAQAKPDVVSTILDELAQLGQWAEKHPKDASAVLVKETGLDATVLDLAVSRFSYGAKPVTPAVLAEQQRIADAFHTLKLIPKPIQVADAAWTPPAGKASTQQAQR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231004 Pseudomonas sp. GM102 Isolate Nodule
3 2511231006 Pseudomonas sp. GM17 Isolate Nodule
4 2511231008 Pseudomonas sp. GM21 Isolate Nodule
5 2511231010 Pseudomonas sp. GM25 Isolate Nodule
6 2511231012 Pseudomonas sp. GM33 Isolate Nodule
7 2511231014 Pseudomonas sp. GM48 Isolate Nodule
8 2511231015 Pseudomonas sp. GM49 Isolate Nodule
9 2511231016 Pseudomonas sp. GM50 Isolate Nodule
10 2511231017 Pseudomonas sp. GM55 Isolate Nodule
11 2511231018 Pseudomonas sp. GM60 Isolate Nodule
12 2511231019 Pseudomonas sp. GM67 Isolate Nodule
13 2511231020 Pseudomonas sp. GM74 Isolate Nodule
14 2511231021 Pseudomonas sp. GM78 Isolate Nodule
15 2511231022 Pseudomonas sp. GM79 Isolate Nodule
16 2511231023 Pseudomonas sp. GM80 Isolate Nodule
17 2511231024 Pseudomonas sp. GM84 Isolate Nodule
18 2511231031 Pseudomonas sp. GM16 Isolate Nodule
19 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
20 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
21 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
22 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
23 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
24 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
25 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
26 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
27 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
28 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
29 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
30 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
31 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
32 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
33 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
34 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
35 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
36 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
37 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
38 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
39 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
40 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
41 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
42 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
43 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
44 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
45 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
46 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
47 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
48 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
49 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
50 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
51 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
52 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
53 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
54 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
55 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
56 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
57 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
58 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
59 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
60 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
61 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
62 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
63 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
64 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
65 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
66 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
67 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
68 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
69 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
70 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
71 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
72 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
73 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
74 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
75 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
76 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
77 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
78 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
79 2643221683 Variovorax sp. Root473 Isolate Unclassified
80 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
81 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
82 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
83 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
84 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
85 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
86 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
87 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
88 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
89 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
90 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
91 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
92 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
93 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
94 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
95 2738541337 Pelomonas sp. BT06 Isolate Unclassified
96 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
97 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
98 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
99 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
100 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
101 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
102 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
103 2765235841 Pseudomonas putida AA7 Isolate Unclassified
104 2773857673 Pseudomonas sp. 443 Isolate Unclassified
105 2784132063 Pseudomonas sp. 424 Isolate Unclassified
106 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
107 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
108 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
109 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
110 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
111 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
112 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
113 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
114 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
115 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
116 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
117 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
118 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
119 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
120 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
121 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
122 2831864461 Roseateles noduli HZ7 Isolate Nodule
123 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
124 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
125 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
126 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
127 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
128 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
129 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
130 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
131 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
132 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
133 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
134 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
135 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
136 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
137 2885266251 Ralstonia sp. SET104 Isolate Nodule
138 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
139 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
140 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
141 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
142 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
143 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
144 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
145 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
146 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
147 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
148 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
149 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
150 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
151 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
152 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
153 2928058823 Ralstonia sp. 1138 Isolate Unclassified
154 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
155 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
156 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
157 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
158 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
159 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
160 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
161 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
162 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
163 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
164 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
165 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
166 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
167 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
168 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
169 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
170 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
171 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
172 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
173 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
174 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
175 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
176 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
177 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
178 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
179 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
180 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
181 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
182 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
183 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
184 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
185 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
186 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
187 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
188 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
189 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
190 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
191 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
192 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
193 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
194 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
195 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
196 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
197 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
198 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
199 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
200 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
201 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
202 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
203 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
204 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
205 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
206 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
207 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
208 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
209 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
210 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
211 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
212 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
213 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
214 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
215 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
216 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
217 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
218 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
219 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
220 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
221 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
222 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
223 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
224 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
225 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
226 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
227 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
228 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
229 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
230 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
231 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
232 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
233 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
234 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
235 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
236 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
237 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
238 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
239 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
240 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
241 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
242 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
243 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
244 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
245 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
246 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
247 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
248 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
249 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
250 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
251 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
252 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
254 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
255 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
256 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
257 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
258 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
259 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
260 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
261 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
262 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
263 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
264 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
265 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
266 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
267 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
268 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
270 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
271 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
272 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
274 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
275 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
276 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
277 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
278 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
279 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
280 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
302 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
303 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
304 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
305 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
307 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
308 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
309 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
310 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
311 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
312 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
314 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
315 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
316 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
317 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
318 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
319 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
320 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
321 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
322 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
323 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
324 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
325 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
326 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
327 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
328 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
329 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
330 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
331 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
332 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
333 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
334 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
335 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
336 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
337 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
338 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
339 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
340 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
341 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
342 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
343 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
344 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
345 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
346 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
347 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
348 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
349 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
350 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
351 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
352 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
353 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
354 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
355 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
356 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
357 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
358 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
359 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
360 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
361 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
362 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
363 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
364 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
365 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
366 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
367 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
368 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
369 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
370 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
371 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
372 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
373 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
374 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
375 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
376 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
377 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
378 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
379 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
380 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
381 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
382 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
383 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
384 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
385 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
386 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
387 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
388 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
389 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
390 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
391 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
392 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
393 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
394 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
395 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
396 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
397 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
398 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
399 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
400 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
401 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
402 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
403 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
404 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
405 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
406 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
407 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
408 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
409 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
410 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
411 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
412 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
413 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
414 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
415 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
416 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
417 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
418 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
419 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
420 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
421 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
422 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
423 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
424 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
425 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
426 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
427 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
428 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
429 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
430 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
431 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
432 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
433 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
434 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
435 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
436 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
437 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
438 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
439 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
440 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
441 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
442 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
443 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
444 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
445 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
446 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
447 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
448 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
449 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
450 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
451 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
452 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
453 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
454 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
455 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
456 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
457 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
458 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
459 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
460 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
461 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
462 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
463 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
464 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
465 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
466 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
467 8052494512 Pseudomonas putida LD6 Isolate Unclassified
468 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
469 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
470 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
471 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
472 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
473 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
474 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
475 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
476 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
477 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
478 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
479 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
480 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
481 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
482 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
483 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
484 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
485 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.9
Metatranscriptomes 0.54
Isolates 21.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.37
Nodule 2.9
Rhizoplane 6.22
Rhizosphere 65.77
Stem 0
Stem Tuber 0
Unclassified 13.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1108591 2162886007 Bacteria 1624
2 JGI24740J21852_10000827 3300001979 Bacteria 13630
3 JGI24740J21852_10004627 3300001979 Bacteria 5902
4 JGI25156J39149_1006414 3300002705 Bacteria 3216
5 JGI25162J39368_1000319 3300002737 Bacteria 42383
6 JGI25162J39368_1000474 3300002737 Bacteria 30875
7 JGI25154J39366_1000255 3300002738 Bacteria 34051
8 JGI25163J39215_1000691 3300002771 Bacteria 8909
9 JGI25163J39215_1001488 3300002771 Bacteria 3765
10 JGI25164J39214_1000236 3300002772 Bacteria 42383
11 JGI25164J39214_1000674 3300002772 Bacteria 13675
12 JGI25165J46597_1000434 3300003214 Bacteria 42383
13 JGI25165J46597_1000600 3300003214 Bacteria 30875
14 JGI25153J46596_10000049 3300003215 Bacteria 141434
15 rootH1_10014519 3300003316 Bacteria 4330
16 Ga0055538_1000032 3300003751 Bacteria 199718
17 Ga0055538_1004396 3300003751 Bacteria 1607
18 Ga0055539_1000043 3300003752 Bacteria 199718
19 Ga0055539_1000123 3300003752 Bacteria 83036
20 Ga0055533_1000052 3300003756 Bacteria 199718
21 Ga0055533_1001539 3300003756 Bacteria 6009
22 Ga0055533_1003373 3300003756 Bacteria 3232
23 Ga0055533_1004209 3300003756 Bacteria 2651
24 Ga0055532_1000029 3300003758 Bacteria 232900
25 Ga0055532_1000047 3300003758 Bacteria 179201
26 Ga0055525_1000062 3300003759 Bacteria 199718
27 Ga0055525_1000345 3300003759 Bacteria 33665
28 Ga0055527_1000127 3300003760 Bacteria 53422
29 Ga0055535_1000137 3300003761 Bacteria 76845
30 Ga0055542_1001189 3300003762 Bacteria 14846
31 Ga0055542_1009505 3300003762 Bacteria 1830
32 Ga0055529_1000062 3300003763 Bacteria 183782
33 Ga0055529_1000376 3300003763 Bacteria 48166
34 Ga0055536_1001726 3300003781 Bacteria 12927
35 Ga0055536_1005342 3300003781 Bacteria 6306
36 Ga0055530_10000658 3300003791 Bacteria 29519
37 Ga0055530_10002203 3300003791 Bacteria 12895
38 Ga0055530_10002392 3300003791 Bacteria 12142
39 Ga0055540_1000506 3300003792 Bacteria 29519
40 Ga0055540_1001504 3300003792 Bacteria 13845
41 Ga0055540_1001654 3300003792 Bacteria 12927
42 Ga0055531_10000483 3300003794 Bacteria 36666
43 Ga0055541_1000030 3300003841 Bacteria 199616
44 Ga0055541_1000208 3300003841 Bacteria 24817
45 Ga0065165_1000006 3300005262 Bacteria 352298
46 Ga0065714_10003312 3300005288 Bacteria 8289
47 Ga0065714_10065219 3300005288 Bacteria 11788
48 Ga0065714_10094760 3300005288 Bacteria 1806
49 Ga0065714_10098794 3300005288 Bacteria 1698
50 Ga0065704_10012375 3300005289 Bacteria 3554
51 Ga0065704_10074610 3300005289 Bacteria 6130
52 Ga0065712_10071153 3300005290 Bacteria 5449
53 Ga0070658_10184415 3300005327 Bacteria 1757
54 Ga0070670_100002144 3300005331 Bacteria 16199
55 Ga0070682_100052508 3300005337 Bacteria 2551
56 Ga0070661_100000126 3300005344 Bacteria 63357
57 Ga0070661_100004017 3300005344 Bacteria 10113
58 Ga0070669_100000481 3300005353 Bacteria 30338
59 Ga0070669_100001507 3300005353 Bacteria 16825
60 Ga0070659_100002881 3300005366 Bacteria 12246
61 Ga0070663_100000011 3300005455 Bacteria 146097
62 Ga0070663_100000690 3300005455 Bacteria 18167
63 Ga0070662_100000101 3300005457 Bacteria 47097
64 Ga0068853_100000187 3300005539 Bacteria 43749
65 Ga0070665_100136876 3300005548 Bacteria 2452
66 Ga0070664_100000008 3300005564 Bacteria 173734
67 Ga0070664_100000491 3300005564 Bacteria 29927
68 Ga0068857_100002038 3300005577 Bacteria 16379
69 Ga0068854_100000072 3300005578 Bacteria 72718
70 Ga0068856_100000009 3300005614 Bacteria 181448
71 Ga0068851_10000007 3300005834 Bacteria 244101
72 Ga0075364_10231431 3300006051 Bacteria 1255
73 Ga0075432_10004620 3300006058 Bacteria 4688
74 Ga0075432_10007556 3300006058 Bacteria 3703
75 Ga0075432_10061212 3300006058 Bacteria 1340
76 Ga0075436_100141875 3300006914 Bacteria 1688
77 Ga0075436_100227520 3300006914 Bacteria 1324
78 Ga0099823_1000086 3300006944 Bacteria 44633
79 Ga0099823_1036036 3300006944 Bacteria 3825
80 Ga0079104_1000718 3300006946 Bacteria 29917
81 Ga0099826_10000012 3300006948 Bacteria 283499
82 Ga0099826_10016562 3300006948 Bacteria 5567
83 Ga0105251_10000027 3300009011 Bacteria 128893
84 Ga0105251_10000274 3300009011 Bacteria 51694
85 Ga0105251_10000828 3300009011 Bacteria 27688
86 Ga0105251_10001027 3300009011 Bacteria 24511
87 Ga0105251_10007236 3300009011 Bacteria 6886
88 Ga0105251_10008916 3300009011 Bacteria 5999
89 Ga0105251_10131130 3300009011 Bacteria 1136
90 Ga0105244_10002564 3300009036 Bacteria 13641
91 Ga0105244_10004785 3300009036 Bacteria 9202
92 Ga0105244_10008881 3300009036 Bacteria 6232
93 Ga0105244_10009575 3300009036 Bacteria 5941
94 Ga0105244_10026014 3300009036 Bacteria 3172
95 Ga0105244_10053920 3300009036 Bacteria 2041
96 Ga0105244_10117284 3300009036 Bacteria 1291
97 Ga0105250_10000191 3300009092 Bacteria 52429
98 Ga0105250_10010893 3300009092 Bacteria 3781
99 Ga0105250_10013949 3300009092 Bacteria 3309
100 Ga0105250_10033566 3300009092 Bacteria 2061
101 Ga0105250_10043742 3300009092 Bacteria 1795
102 Ga0105250_10092144 3300009092 Bacteria 1233
103 Ga0105240_10055439 3300009093 Bacteria 4962
104 Ga0105243_10000418 3300009148 Bacteria 44790
105 Ga0105243_10002911 3300009148 Bacteria 14171
106 Ga0105243_10003724 3300009148 Bacteria 12232
107 Ga0105243_10005562 3300009148 Bacteria 9815
108 Ga0105243_10010759 3300009148 Bacteria 6926
109 Ga0105243_10030328 3300009148 Bacteria 4162
110 Ga0105242_10001499 3300009176 Bacteria 18352
111 Ga0105237_10001509 3300009545 Bacteria 30588
112 Ga0105249_10006152 3300009553 Bacteria 10410
113 Ga0105246_10000446 3300011119 Bacteria 22168
114 Ga0105246_10001749 3300011119 Bacteria 12998
115 Ga0105246_10021610 3300011119 Bacteria 4143
116 Ga0157345_1000031 3300012498 Bacteria 35083
117 Ga0157373_10005361 3300013100 Bacteria 9635
118 Ga0157373_10033054 3300013100 Bacteria 3723
119 Ga0157373_10040572 3300013100 Bacteria 3330
120 Ga0157371_10000068 3300013102 Bacteria 168110
121 Ga0157371_10000609 3300013102 Bacteria 42602
122 Ga0157371_10003267 3300013102 Bacteria 14869
123 Ga0157371_10040665 3300013102 Bacteria 3320
124 Ga0157370_10000200 3300013104 Bacteria 75469
125 Ga0157370_10064044 3300013104 Bacteria 3481
126 Ga0157370_10196182 3300013104 Bacteria 1874
127 Ga0157370_10218524 3300013104 Bacteria 1765
128 Ga0157369_10005953 3300013105 Bacteria 14161
129 Ga0157369_10020339 3300013105 Bacteria 7420
130 Ga0157369_10028400 3300013105 Bacteria 6191
131 Ga0163162_10000591 3300013306 Bacteria 33702
132 Ga0157372_10002606 3300013307 Bacteria 19510
133 Ga0157372_10009606 3300013307 Bacteria 10280
134 Ga0157372_10109564 3300013307 Bacteria 3162
135 Ga0157375_10024520 3300013308 Bacteria 5585
136 Ga0182008_10000293 3300014497 Bacteria 39393
137 Ga0182008_10005460 3300014497 Bacteria 7239
138 Ga0182008_10032172 3300014497 Bacteria 2636
139 Ga0182006_1001907 3300015261 Bacteria 11876
140 Ga0182006_1006450 3300015261 Bacteria 5450
141 Ga0182006_1066241 3300015261 Bacteria 1350
142 Ga0182007_10000284 3300015262 Bacteria 33721
143 Ga0182007_10013025 3300015262 Bacteria 3186
144 Ga0182005_1002545 3300015265 Bacteria 6473
145 Ga0182005_1013344 3300015265 Bacteria 2310
146 Ga0182005_1023817 3300015265 Bacteria 1672
147 Ga0163161_10017835 3300017792 Bacteria 4973
148 Ga0163161_10022215 3300017792 Bacteria 4465
149 Ga0163161_10026201 3300017792 Bacteria 4130
150 Ga0197907_10647456 3300020069 Bacteria 1834
151 Ga0206351_10300647 3300020077 Bacteria 2051
152 Ga0206353_10328413 3300020082 Bacteria 1832
153 Ga0154015_1082437 3300020610 Bacteria 3647
154 Ga0213875_10007177 3300021388 Bacteria 5787
155 Ga0224572_1007229 3300024225 Bacteria 2030
156 Ga0209435_100821 3300025206 Bacteria 4907
157 Ga0209760_100027 3300025207 Bacteria 153290
158 Ga0209760_100149 3300025207 Bacteria 43212
159 Ga0209784_100003 3300025224 Bacteria 1379451
160 Ga0209784_100007 3300025224 Bacteria 747715
161 Ga0209784_100482 3300025224 Bacteria 16070
162 Ga0209784_100539 3300025224 Bacteria 13930
163 Ga0209566_100002 3300025225 Bacteria 2614868
164 Ga0209566_100009 3300025225 Bacteria 554018
165 Ga0209566_100970 3300025225 Bacteria 12691
166 Ga0209674_100008 3300025226 Bacteria 1076909
167 Ga0209674_100021 3300025226 Bacteria 629811
168 Ga0209674_100229 3300025226 Bacteria 50211
169 Ga0209674_101455 3300025226 Bacteria 6246
170 Ga0209672_100015 3300025228 Bacteria 529352
171 Ga0209147_100002 3300025229 Bacteria 2158988
172 Ga0209147_100009 3300025229 Bacteria 747409
173 Ga0209147_100016 3300025229 Bacteria 527606
174 Ga0209563_100004 3300025230 Bacteria 1814108
175 Ga0209563_100018 3300025230 Bacteria 747850
176 Ga0209563_108111 3300025230 Bacteria 1676
177 Ga0207427_100005 3300025231 Bacteria 797999
178 Ga0207427_100006 3300025231 Bacteria 785415
179 Ga0209437_100013 3300025233 Bacteria 785457
180 Ga0209437_100018 3300025233 Bacteria 694400
181 Ga0209437_112834 3300025233 Bacteria 1213
182 Ga0209258_100002 3300025242 Bacteria 2158988
183 Ga0209258_100026 3300025242 Bacteria 527606
184 Ga0209258_100169 3300025242 Bacteria 145227
185 Ga0209646_1000059 3300025246 Bacteria 256909
186 Ga0209646_1000184 3300025246 Bacteria 78423
187 Ga0209026_1001981 3300025250 Bacteria 8177
188 Ga0209677_100009 3300025253 Bacteria 749530
189 Ga0209677_100012 3300025253 Bacteria 554018
190 Ga0209677_103507 3300025253 Bacteria 5029
191 Ga0209148_1000021 3300025254 Bacteria 714645
192 Ga0209148_1004936 3300025254 Bacteria 3149
193 Ga0209759_1003731 3300025256 Bacteria 5963
194 Ga0209759_1004724 3300025256 Bacteria 4984
195 Ga0209759_1012125 3300025256 Bacteria 2406
196 Ga0209759_1013200 3300025256 Bacteria 2247
197 Ga0209233_1000021 3300025261 Bacteria 798078
198 Ga0209233_1000022 3300025261 Bacteria 785415
199 Ga0209455_1000021 3300025272 Bacteria 699993
200 Ga0209455_1000321 3300025272 Bacteria 47677
201 Ga0209675_1002099 3300025291 Bacteria 10560
202 Ga0209676_1000015 3300025292 Bacteria 784458
203 Ga0209676_1000030 3300025292 Bacteria 506421
204 Ga0209676_1000041 3300025292 Bacteria 424583
205 Ga0209676_1000510 3300025292 Bacteria 61272
206 Ga0209676_1002546 3300025292 Bacteria 12662
207 Ga0209676_1003117 3300025292 Bacteria 10646
208 Ga0209564_1000003 3300025295 Bacteria 1585848
209 Ga0209758_1000029 3300025297 Bacteria 520787
210 Ga0209050_1000024 3300025298 Bacteria 533389
211 Ga0209050_1000030 3300025298 Bacteria 463381
212 Ga0209050_1000518 3300025298 Bacteria 64332
213 Ga0209050_1000647 3300025298 Bacteria 54000
214 Ga0209051_1000012 3300025303 Bacteria 595474
215 Ga0209051_1000023 3300025303 Bacteria 437371
216 Ga0209051_1000721 3300025303 Bacteria 36119
217 Ga0209257_1001245 3300025304 Bacteria 31476
218 Ga0209257_1008821 3300025304 Bacteria 5584
219 Ga0207656_10000006 3300025321 Bacteria 395044
220 Ga0207696_1000031 3300025711 Bacteria 384169
221 Ga0207696_1000078 3300025711 Bacteria 207623
222 Ga0207696_1000145 3300025711 Bacteria 122321
223 Ga0207696_1000357 3300025711 Bacteria 46078
224 Ga0207696_1002362 3300025711 Bacteria 9333
225 Ga0207696_1005520 3300025711 Bacteria 5234
226 Ga0207696_1010267 3300025711 Bacteria 3444
227 Ga0207696_1010392 3300025711 Bacteria 3412
228 Ga0207696_1019672 3300025711 Bacteria 2191
229 Ga0207696_1039493 3300025711 Bacteria 1387
230 Ga0207696_1046628 3300025711 Bacteria 1250
231 Ga0207655_1000014 3300025728 Bacteria 607124
232 Ga0207655_1000202 3300025728 Bacteria 103907
233 Ga0207655_1000309 3300025728 Bacteria 72910
234 Ga0207655_1000388 3300025728 Bacteria 61513
235 Ga0207655_1001315 3300025728 Bacteria 23457
236 Ga0207655_1005067 3300025728 Bacteria 9104
237 Ga0207655_1007643 3300025728 Bacteria 6980
238 Ga0207655_1008795 3300025728 Bacteria 6355
239 Ga0207655_1015714 3300025728 Bacteria 4189
240 Ga0207655_1016904 3300025728 Bacteria 3965
241 Ga0207655_1030074 3300025728 Bacteria 2532
242 Ga0207655_1036805 3300025728 Bacteria 2165
243 Ga0207655_1066298 3300025728 Bacteria 1365
244 Ga0207655_1079939 3300025728 Bacteria 1183
245 Ga0207713_1000010 3300025735 Bacteria 528374
246 Ga0207713_1000077 3300025735 Bacteria 176517
247 Ga0207713_1000815 3300025735 Bacteria 28847
248 Ga0207713_1001109 3300025735 Bacteria 23001
249 Ga0207713_1001462 3300025735 Bacteria 18785
250 Ga0207713_1003196 3300025735 Bacteria 11322
251 Ga0207713_1003335 3300025735 Bacteria 11029
252 Ga0207713_1005980 3300025735 Bacteria 7506
253 Ga0207713_1006691 3300025735 Bacteria 6970
254 Ga0207713_1006845 3300025735 Bacteria 6864
255 Ga0207713_1012141 3300025735 Bacteria 4629
256 Ga0207713_1037259 3300025735 Bacteria 2076
257 Ga0207713_1037522 3300025735 Bacteria 2065
258 Ga0207705_10022744 3300025909 Bacteria 4471
259 Ga0207695_10000729 3300025913 Bacteria 63923
260 Ga0207671_10000131 3300025914 Bacteria 116866
261 Ga0207649_10000012 3300025920 Bacteria 265674
262 Ga0207649_10000334 3300025920 Bacteria 35813
263 Ga0207681_10000099 3300025923 Bacteria 73220
264 Ga0207681_10003206 3300025923 Bacteria 10266
265 Ga0207650_10000518 3300025925 Bacteria 31804
266 Ga0207650_10000571 3300025925 Bacteria 29738
267 Ga0207690_10001324 3300025932 Bacteria 15570
268 Ga0207706_10000580 3300025933 Bacteria 38973
269 Ga0207686_10000319 3300025934 Bacteria 34615
270 Ga0207709_10000071 3300025935 Bacteria 181156
271 Ga0207709_10000337 3300025935 Bacteria 49221
272 Ga0207709_10003583 3300025935 Bacteria 9174
273 Ga0207709_10017354 3300025935 Bacteria 4017
274 Ga0207709_10021142 3300025935 Bacteria 3681
275 Ga0207709_10061947 3300025935 Bacteria 2339
276 Ga0207679_10000001 3300025945 Bacteria 777444
277 Ga0207679_10000015 3300025945 Bacteria 265674
278 Ga0207668_10026463 3300025972 Bacteria 3767
279 Ga0207640_10000088 3300025981 Bacteria 72802
280 Ga0207640_10011005 3300025981 Bacteria 5107
281 Ga0207639_10000775 3300026041 Bacteria 21763
282 Ga0207678_10000001 3300026067 Bacteria 433184
283 Ga0207678_10002593 3300026067 Bacteria 16467
284 Ga0207678_10091364 3300026067 Bacteria 2602
285 Ga0207702_10039638 3300026078 Bacteria 3949
286 Ga0207674_10198448 3300026116 Bacteria 1956
287 Ga0209281_1000019 3300027111 Bacteria 576164
288 Ga0209389_1000049 3300027296 Bacteria 114702
289 Ga0209371_1000106 3300027312 Bacteria 146212
290 Ga0207428_10064067 3300027907 Bacteria 2903
291 Ga0207428_10110118 3300027907 Bacteria 2121
292 Ga0268266_10122719 3300028379 Bacteria 2313
293 Ga0307517_10125821 3300028786 Bacteria 1871
294 Ga0268256_1000077 3300030500 Bacteria 177593
295 Ga0307511_10061910 3300030521 Bacteria 2846
296 Ga0316177_1038918 3300030731 Bacteria 3622
297 Ga0316179_1012631 3300030734 Bacteria 5035
298 Ga0316181_1237161 3300030744 Bacteria 1903
299 Ga0265760_10004209 3300031090 Bacteria 4139
300 Ga0265327_10000008 3300031251 Bacteria 658870
301 Ga0307513_10204655 3300031456 Bacteria 1811
302 Ga0307408_100001975 3300031548 Bacteria 14793
303 Ga0307516_10095864 3300031730 Bacteria 2788
304 Ga0307406_10153558 3300031901 Bacteria 1645
305 Ga0307406_10281375 3300031901 Bacteria 1269
306 Ga0307412_10007211 3300031911 Bacteria 6308
307 Ga0307412_10010029 3300031911 Bacteria 5448
308 Ga0307412_10093995 3300031911 Bacteria 2104
309 Ga0307409_100313276 3300031995 Bacteria 1465
310 Ga0307414_10292647 3300032004 Bacteria 1373
311 Ga0307510_10017092 3300033180 Bacteria 8557
312 Ga0316214_1000796 3300033545 Bacteria 3412
313 Ga0395900_0030607 3300037418 Bacteria 5527
314 Ga0237819_01092 3300038705 Bacteria 7986
315 Ga0439436_0001261 3300041404 Bacteria 7227
316 Ga0439438_003418 3300041405 Bacteria 6424
317 Ga0439438_026980 3300041405 Bacteria 1553
318 Ga0439447_000185 3300041407 Bacteria 22086
319 Ga0439447_001317 3300041407 Bacteria 9029
320 Ga0439447_005893 3300041407 Bacteria 4027
321 Ga0439447_006479 3300041407 Bacteria 3796
322 Ga0439447_019583 3300041407 Bacteria 1802
323 Ga0439466_0000460 3300041411 Bacteria 15548
324 Ga0439466_0002029 3300041411 Bacteria 7942
325 Ga0439466_0005241 3300041411 Bacteria 4965
326 Ga0439466_0007030 3300041411 Bacteria 4262
327 Ga0439465_0015721 3300041413 Bacteria 2360
328 Ga0439437_000374 3300042000 Bacteria 4282
329 Ga0439432_000797 3300042006 Bacteria 11779
330 Ga0439432_002776 3300042006 Bacteria 6527
331 Ga0439432_003848 3300042006 Bacteria 5533
332 Ga0439432_022369 3300042006 Bacteria 2088
333 Ga0439432_028919 3300042006 Bacteria 1803
334 Ga0439451_001405 3300042009 Bacteria 4759
335 Ga0439451_005530 3300042009 Bacteria 2578
336 Ga0439451_021998 3300042009 Bacteria 1285
337 Ga0439452_000354 3300042010 Bacteria 28113
338 Ga0439452_000769 3300042010 Bacteria 15322
339 Ga0439452_004376 3300042010 Bacteria 4748
340 Ga0439452_007020 3300042010 Bacteria 3477
341 Ga0439452_011548 3300042010 Bacteria 2534
342 Ga0439456_000043 3300042013 Bacteria 45603
343 Ga0439456_000444 3300042013 Bacteria 9140
344 Ga0439463_000538 3300042016 Bacteria 10595
345 Ga0439463_000618 3300042016 Bacteria 9853
346 Ga0439463_002794 3300042016 Bacteria 4429
347 Ga0450888_001329 3300042126 Bacteria 2363
348 Ga0450890_004100 3300042127 Bacteria 1913
349 Ga0450892_001104 3300042130 Bacteria 2819
350 Ga0450902_005290 3300042137 Bacteria 1944
351 Ga0450905_000396 3300042142 Bacteria 5274
352 Ga0450905_001922 3300042142 Bacteria 2652
353 Ga0450905_006590 3300042142 Bacteria 1572
354 Ga0450906_000802 3300042145 Bacteria 6878
355 Ga0450907_000322 3300042146 Bacteria 15515
356 Ga0450907_001362 3300042146 Bacteria 5388
357 Ga0450907_014591 3300042146 Bacteria 1311
358 Ga0439446_0000162 3300042156 Bacteria 11674
359 Ga0450908_001252 3300042184 Bacteria 4911
360 Ga0450909_001520 3300042185 Bacteria 3233
361 Ga0439434_0000151 3300042435 Bacteria 18441
362 Ga0439434_0016456 3300042435 Bacteria 2209
363 Ga0439460_0000441 3300042461 Bacteria 8883
364 Ga0439460_0015363 3300042461 Bacteria 2025
365 Ga0450893_0005070 3300042532 Bacteria 2105
366 Ga0450901_001959 3300042533 Bacteria 2287
367 Ga0451577_0127737 3300042876 Bacteria 2279
368 Ga0466986_0125542 3300044650 Bacteria 1752
369 Ga0466969_0031299 3300044656 Bacteria 2709
370 Ga0466972_0000111 3300044658 Bacteria 70764
371 Ga0466972_0023033 3300044658 Bacteria 3099
372 Ga0466982_0121209 3300044672 Bacteria 1613
373 Ga0466965_0006859 3300044683 Bacteria 5205
374 Ga0466965_0053064 3300044683 Bacteria 2014
375 Ga0466965_0135414 3300044683 Bacteria 1279
376 Ga0466961_0000456 3300044693 Bacteria 25995
377 Ga0466964_0001262 3300044706 Bacteria 8611
378 Ga0466964_0003758 3300044706 Bacteria 5563
379 Ga0453684_0000280 3300044712 Bacteria 219955
380 Ga0466968_0001055 3300044735 Bacteria 9764
381 Ga0466968_0010840 3300044735 Bacteria 3541
382 Ga0466970_0014919 3300044765 Bacteria 3994
383 Ga0466957_0010145 3300044842 Bacteria 5390
384 Ga0466960_0027620 3300044901 Bacteria 2590
385 Ga0466959_0013895 3300045049 Bacteria 5845
386 Ga0466959_0015430 3300045049 Bacteria 5564
387 Ga0451576_0021037 3300045051 Bacteria 7097
388 Ga0451576_0100429 3300045051 Bacteria 3009
389 Ga0495617_000167 3300046452 Bacteria 41872
390 Ga0495617_001375 3300046452 Bacteria 10746
391 Ga0495617_017658 3300046452 Bacteria 2411
392 Ga0495617_028103 3300046452 Bacteria 1891
393 Ga0495627_000102 3300046453 Bacteria 104889
394 Ga0495627_000333 3300046453 Bacteria 45231
395 Ga0495627_001226 3300046453 Bacteria 16000
396 Ga0495627_002838 3300046453 Bacteria 8012
397 Ga0495627_011045 3300046453 Bacteria 3253
398 Ga0495590_0003982 3300046457 Bacteria 5998
399 Ga0495590_0048576 3300046457 Bacteria 1480
400 Ga0495591_000105 3300046458 Bacteria 97199
401 Ga0495591_000463 3300046458 Bacteria 32629
402 Ga0495591_001494 3300046458 Bacteria 14433
403 Ga0495591_007001 3300046458 Bacteria 4867
404 Ga0495591_024875 3300046458 Bacteria 1888
405 Ga0495591_031369 3300046458 Bacteria 1595
406 Ga0495591_044177 3300046458 Bacteria 1249
407 Ga0495638_0020892 3300046460 Bacteria 4322
408 Ga0495638_0046756 3300046460 Bacteria 2717
409 Ga0495638_0056461 3300046460 Bacteria 2436
410 Ga0495653_0004797 3300046463 Bacteria 10964
411 Ga0495653_0034075 3300046463 Bacteria 4030
412 Ga0495653_0162455 3300046463 Bacteria 1549
413 Ga0495650_0009035 3300046471 Bacteria 5719
414 Ga0495650_0034108 3300046471 Bacteria 2257
415 Ga0495650_0055864 3300046471 Bacteria 1605
416 Ga0495650_0056548 3300046471 Bacteria 1591
417 Ga0495580_0051756 3300046472 Bacteria 2902
418 Ga0495582_0003854 3300046473 Bacteria 8443
419 Ga0495605_0000064 3300046474 Bacteria 140769
420 Ga0495605_0000255 3300046474 Bacteria 62826
421 Ga0495605_0000620 3300046474 Bacteria 27429
422 Ga0495605_0000714 3300046474 Bacteria 24495
423 Ga0495605_0002506 3300046474 Bacteria 11361
424 Ga0495605_0002791 3300046474 Bacteria 10633
425 Ga0495605_0044799 3300046474 Bacteria 2184
426 Ga0495605_0053349 3300046474 Bacteria 1961
427 Ga0495605_0114829 3300046474 Bacteria 1225
428 Ga0495639_0024724 3300046475 Bacteria 2645
429 Ga0495584_0001930 3300046491 Bacteria 11930
430 Ga0495584_0010251 3300046491 Bacteria 4814
431 Ga0495584_0010587 3300046491 Bacteria 4737
432 Ga0495584_0035444 3300046491 Bacteria 2522
433 Ga0495585_0002921 3300046492 Bacteria 11833
434 Ga0495585_0004927 3300046492 Bacteria 8540
435 Ga0495585_0005380 3300046492 Bacteria 8077
436 Ga0495585_0008461 3300046492 Bacteria 6236
437 Ga0495585_0012191 3300046492 Bacteria 5066
438 Ga0495585_0014826 3300046492 Bacteria 4533
439 Ga0495585_0016202 3300046492 Bacteria 4318
440 Ga0495585_0038452 3300046492 Bacteria 2693
441 Ga0495594_0004681 3300046499 Bacteria 7052
442 Ga0495594_0163553 3300046499 Bacteria 1265
443 Ga0495596_0003229 3300046500 Bacteria 8349
444 Ga0495596_0005753 3300046500 Bacteria 5817
445 Ga0495596_0056131 3300046500 Bacteria 1538
446 Ga0495607_0001049 3300046501 Bacteria 25238
447 Ga0495607_0001370 3300046501 Bacteria 21666
448 Ga0495607_0003022 3300046501 Bacteria 13121
449 Ga0495607_0003939 3300046501 Bacteria 11172
450 Ga0495607_0005722 3300046501 Bacteria 8848
451 Ga0495607_0006981 3300046501 Bacteria 7863
452 Ga0495607_0007583 3300046501 Bacteria 7488
453 Ga0495607_0014419 3300046501 Bacteria 5143
454 Ga0495607_0014785 3300046501 Bacteria 5074
455 Ga0495607_0027621 3300046501 Bacteria 3506
456 Ga0495607_0110750 3300046501 Bacteria 1456
457 Ga0495583_0000015 3300046506 Bacteria 316392
458 Ga0495583_0003590 3300046506 Bacteria 11654
459 Ga0495583_0004202 3300046506 Bacteria 10483
460 Ga0495583_0005217 3300046506 Bacteria 8922
461 Ga0495583_0007640 3300046506 Bacteria 6745
462 Ga0495606_0000177 3300046507 Bacteria 112843
463 Ga0495606_0001016 3300046507 Bacteria 40685
464 Ga0495606_0009604 3300046507 Bacteria 8153
465 Ga0495606_0009768 3300046507 Bacteria 8067
466 Ga0495606_0011424 3300046507 Bacteria 7242
467 Ga0495606_0016424 3300046507 Bacteria 5643
468 Ga0495606_0021409 3300046507 Bacteria 4735
469 Ga0495610_0003101 3300046512 Bacteria 13241
470 Ga0495610_0015192 3300046512 Bacteria 4486
471 Ga0495610_0042477 3300046512 Bacteria 2273
472 Ga0495610_0059364 3300046512 Bacteria 1826
473 Ga0495610_0071757 3300046512 Bacteria 1613
474 Ga0495610_0117880 3300046512 Bacteria 1167
475 Ga0495616_0007584 3300046513 Bacteria 6493
476 Ga0495616_0018417 3300046513 Bacteria 3833
477 Ga0495616_0023813 3300046513 Bacteria 3290
478 Ga0495616_0035147 3300046513 Bacteria 2595
479 Ga0495620_0000039 3300046515 Bacteria 112877
480 Ga0495620_0000301 3300046515 Bacteria 35173
481 Ga0495620_0002335 3300046515 Bacteria 11001
482 Ga0495620_0004177 3300046515 Bacteria 8176
483 Ga0495620_0034967 3300046515 Bacteria 2265
484 Ga0495631_0001929 3300046518 Bacteria 12184
485 Ga0495631_0002026 3300046518 Bacteria 11793
486 Ga0495631_0007430 3300046518 Bacteria 5570
487 Ga0495631_0064891 3300046518 Bacteria 1580
488 Ga0495632_0001966 3300046519 Bacteria 16344
489 Ga0495632_0002219 3300046519 Bacteria 14975
490 Ga0495632_0003351 3300046519 Bacteria 11416
491 Ga0495632_0003817 3300046519 Bacteria 10487
492 Ga0495632_0006873 3300046519 Bacteria 7242
493 Ga0495632_0037285 3300046519 Bacteria 2467
494 Ga0495632_0057031 3300046519 Bacteria 1907
495 Ga0495632_0059774 3300046519 Bacteria 1853
496 Ga0495637_0000393 3300046520 Bacteria 32465
497 Ga0495637_0001586 3300046520 Bacteria 13195
498 Ga0495637_0002084 3300046520 Bacteria 11247
499 Ga0495637_0003136 3300046520 Bacteria 8823
500 Ga0495637_0003862 3300046520 Bacteria 7862
501 Ga0495637_0005606 3300046520 Bacteria 6373
502 Ga0495637_0014306 3300046520 Bacteria 3743
503 Ga0495637_0015516 3300046520 Bacteria 3573
504 Ga0495637_0024098 3300046520 Bacteria 2754
505 Ga0495637_0047894 3300046520 Bacteria 1802
506 Ga0495637_0054723 3300046520 Bacteria 1656
507 Ga0495643_0001673 3300046522 Bacteria 19405
508 Ga0495643_0002515 3300046522 Bacteria 14383
509 Ga0495643_0009122 3300046522 Bacteria 6205
510 Ga0495643_0009672 3300046522 Bacteria 5968
511 Ga0495643_0015413 3300046522 Bacteria 4517
512 Ga0495643_0020423 3300046522 Bacteria 3817
513 Ga0495643_0042615 3300046522 Bacteria 2472
514 Ga0495644_0000975 3300046523 Bacteria 11863
515 Ga0495648_0005114 3300046524 Bacteria 10994
516 Ga0495648_0008794 3300046524 Bacteria 7900
517 Ga0495648_0019560 3300046524 Bacteria 4757
518 Ga0495648_0028082 3300046524 Bacteria 3752
519 Ga0495648_0041508 3300046524 Bacteria 2904
520 Ga0495648_0091576 3300046524 Bacteria 1700
521 Ga0495666_0006845 3300046526 Bacteria 5724
522 Ga0495666_0046014 3300046526 Bacteria 2104
523 Ga0495642_0000237 3300046528 Bacteria 31221
524 Ga0495642_0001374 3300046528 Bacteria 10885
525 Ga0495654_0002801 3300046530 Bacteria 10991
526 Ga0495654_0007639 3300046530 Bacteria 6019
527 Ga0495654_0008960 3300046530 Bacteria 5497
528 Ga0495654_0016049 3300046530 Bacteria 3967
529 Ga0495654_0019909 3300046530 Bacteria 3503
530 Ga0495654_0020989 3300046530 Bacteria 3401
531 Ga0495654_0045704 3300046530 Bacteria 2159
532 Ga0495665_0063814 3300046531 Bacteria 1944
533 Ga0495587_0029373 3300046536 Bacteria 3337
534 Ga0495587_0133165 3300046536 Bacteria 1420
535 Ga0495609_0000192 3300046538 Bacteria 61042
536 Ga0495609_0000773 3300046538 Bacteria 23957
537 Ga0495609_0006042 3300046538 Bacteria 6240
538 Ga0495609_0013995 3300046538 Bacteria 3780
539 Ga0495609_0019412 3300046538 Bacteria 3145
540 Ga0495597_0001180 3300046542 Bacteria 19588
541 Ga0495597_0008969 3300046542 Bacteria 4983
542 Ga0495597_0022069 3300046542 Bacteria 2954
543 Ga0495597_0033827 3300046542 Bacteria 2311
544 Ga0495597_0060014 3300046542 Bacteria 1660
545 Ga0495622_0011141 3300046557 Bacteria 4150
546 Ga0495633_0000373 3300046558 Bacteria 47781
547 Ga0495633_0009466 3300046558 Bacteria 5376
548 Ga0495633_0057255 3300046558 Bacteria 1831
549 Ga0495656_0024359 3300046615 Bacteria 2389
550 Ga0495668_0002371 3300046616 Bacteria 15670
551 Ga0495668_0002528 3300046616 Bacteria 14911
552 Ga0495668_0004160 3300046616 Bacteria 10447
553 Ga0495668_0120154 3300046616 Bacteria 1437
554 Ga0495668_0158061 3300046616 Bacteria 1241
555 Ga0495611_0000749 3300046648 Bacteria 18315
556 Ga0495611_0002123 3300046648 Bacteria 9279
557 Ga0495611_0002529 3300046648 Bacteria 8315
558 Ga0495611_0006971 3300046648 Bacteria 4801
559 Ga0495625_0029129 3300046660 Bacteria 4133
560 Ga0495625_0044451 3300046660 Bacteria 3215
561 Ga0495625_0045572 3300046660 Bacteria 3168
562 Ga0495625_0054046 3300046660 Bacteria 2869
563 Ga0495625_0172462 3300046660 Bacteria 1443
564 Ga0495635_0011428 3300046663 Bacteria 6226
565 Ga0495659_0001738 3300046664 Bacteria 7248
566 Ga0495661_0000061 3300046665 Bacteria 130811
567 Ga0495661_0000097 3300046665 Bacteria 107784
568 Ga0495661_0016216 3300046665 Bacteria 4946
569 Ga0495661_0022508 3300046665 Bacteria 4100
570 Ga0495661_0074765 3300046665 Bacteria 1971
571 Ga0495588_0016999 3300046674 Bacteria 3524
572 Ga0495646_0003313 3300046680 Bacteria 10017
573 Ga0495669_0004664 3300046684 Bacteria 5681
574 Ga0495669_0019373 3300046684 Bacteria 2936
575 Ga0495670_0001123 3300046691 Bacteria 12976
576 Ga0495670_0007368 3300046691 Bacteria 5407
577 Ga0495670_0010430 3300046691 Bacteria 4565
578 Ga0495670_0012881 3300046691 Bacteria 4110
579 Ga0495670_0028928 3300046691 Bacteria 2748
580 Ga0495670_0046550 3300046691 Bacteria 2166
581 Ga0495671_0000805 3300046692 Bacteria 22397
582 Ga0495671_0001452 3300046692 Bacteria 15924
583 Ga0495671_0002987 3300046692 Bacteria 10508
584 Ga0495671_0006866 3300046692 Bacteria 6535
585 Ga0495671_0009698 3300046692 Bacteria 5369
586 Ga0495671_0016307 3300046692 Bacteria 3968
587 Ga0495671_0017994 3300046692 Bacteria 3757
588 Ga0495671_0019232 3300046692 Bacteria 3614
589 Ga0495671_0032565 3300046692 Bacteria 2662
590 Ga0495671_0080538 3300046692 Bacteria 1595
591 Ga0495649_0000531 3300046694 Bacteria 32369
592 Ga0495649_0001245 3300046694 Bacteria 19590
593 Ga0495649_0003048 3300046694 Bacteria 11493
594 Ga0495649_0003710 3300046694 Bacteria 10160
595 Ga0495649_0007703 3300046694 Bacteria 6540
596 Ga0495649_0012604 3300046694 Bacteria 4908
597 Ga0495649_0088630 3300046694 Bacteria 1650
598 Ga0495589_0002695 3300046794 Bacteria 9817
599 Ga0495589_0003948 3300046794 Bacteria 7959
600 Ga0495589_0013142 3300046794 Bacteria 4273
601 Ga0495589_0013949 3300046794 Bacteria 4142
602 Ga0495589_0019206 3300046794 Bacteria 3506
603 Ga0495600_0021373 3300046809 Bacteria 4143
604 Ga0495660_0000492 3300046810 Bacteria 32646
605 Ga0495660_0001739 3300046810 Bacteria 14532
606 Ga0495660_0028240 3300046810 Bacteria 3171
607 Ga0495660_0051239 3300046810 Bacteria 2246
608 Ga0495660_0094337 3300046810 Bacteria 1549
609 Ga0495581_0054175 3300047315 Bacteria 2315
610 Ga0495604_0026614 3300047317 Bacteria 4604
611 Ga0495604_0109386 3300047317 Bacteria 2017
612 Ga0495636_0002667 3300047318 Bacteria 6887
613 Ga0495672_0004415 3300047320 Bacteria 11531
614 Ga0495672_0005033 3300047320 Bacteria 10571
615 Ga0495672_0022119 3300047320 Bacteria 4138
616 Ga0495672_0027434 3300047320 Bacteria 3618
617 Ga0495672_0033562 3300047320 Bacteria 3178
618 Ga0495680_0016523 3300047322 Bacteria 6336
619 Ga0495680_0048546 3300047322 Bacteria 3332
620 Ga0495683_0000106 3300047323 Bacteria 86579
621 Ga0495683_0000207 3300047323 Bacteria 55998
622 Ga0495683_0002916 3300047323 Bacteria 10128
623 Ga0495683_0017999 3300047323 Bacteria 3657
624 Ga0495683_0020899 3300047323 Bacteria 3374
625 Ga0495687_005908 3300047443 Bacteria 7654
626 Ga0495687_012488 3300047443 Bacteria 4486
627 Ga0495675_0004892 3300047444 Bacteria 8157
628 Ga0495677_0009101 3300047445 Bacteria 3671
629 Ga0495679_000274 3300047446 Bacteria 43056
630 Ga0495679_000371 3300047446 Bacteria 34489
631 Ga0495679_007752 3300047446 Bacteria 4438
632 Ga0495673_0000222 3300047469 Bacteria 84272
633 Ga0495673_0002875 3300047469 Bacteria 11711
634 Ga0495673_0012077 3300047469 Bacteria 4601
635 Ga0495673_0020102 3300047469 Bacteria 3330
636 Ga0495673_0022627 3300047469 Bacteria 3077
637 Ga0495673_0024472 3300047469 Bacteria 2917
638 Ga0495673_0024620 3300047469 Bacteria 2903
639 Ga0495673_0031313 3300047469 Bacteria 2491
640 Ga0495673_0059705 3300047469 Bacteria 1638
641 Ga0495673_0089911 3300047469 Bacteria 1256
642 Ga0495681_0005234 3300047470 Bacteria 8713
643 Ga0495681_0007728 3300047470 Bacteria 6819
644 Ga0495681_0007812 3300047470 Bacteria 6773
645 Ga0495681_0035532 3300047470 Bacteria 2473
646 Ga0495681_0040939 3300047470 Bacteria 2252
647 Ga0495681_0045081 3300047470 Bacteria 2113
648 Ga0495686_0008819 3300047472 Bacteria 7342
649 Ga0495686_0164410 3300047472 Bacteria 1294
650 Ga0495593_0009346 3300047673 Bacteria 5690
651 Ga0495626_0000068 3300048091 Bacteria 139126
652 Ga0495626_0000678 3300048091 Bacteria 32578
653 Ga0495626_0011126 3300048091 Bacteria 4770
654 Ga0495626_0020358 3300048091 Bacteria 3307
655 Ga0496100_0263647 3300048903 Bacteria 1279
656 Ga0496102_0002251 3300048905 Bacteria 16528
657 Ga0496102_0005434 3300048905 Bacteria 10809
658 Ga0496110_0091238 3300048913 Bacteria 2725
659 Ga0496111_0129354 3300048914 Bacteria 1868
660 Ga0496114_0007131 3300048917 Bacteria 8815
661 Ga0496114_0057734 3300048917 Bacteria 3240
662 Ga0496116_0000670 3300048919 Bacteria 44682
663 Ga0496116_0009294 3300048919 Bacteria 8398
664 Ga0496116_0043932 3300048919 Bacteria 3040
665 Ga0496117_0002093 3300048920 Bacteria 26276
666 Ga0496117_0003858 3300048920 Bacteria 17058
667 Ga0496117_0006799 3300048920 Bacteria 11402
668 Ga0496117_0013238 3300048920 Bacteria 7210
669 Ga0496117_0019912 3300048920 Bacteria 5491
670 Ga0496117_0061670 3300048920 Bacteria 2575
671 Ga0496117_0115643 3300048920 Bacteria 1660
672 Ga0496117_0118294 3300048920 Bacteria 1634
673 Ga0496118_0001842 3300048921 Bacteria 30363
674 Ga0496118_0010904 3300048921 Bacteria 8939
675 Ga0496118_0030939 3300048921 Bacteria 4452
676 Ga0496118_0032955 3300048921 Bacteria 4258
677 Ga0496118_0041256 3300048921 Bacteria 3657
678 Ga0496119_0000229 3300048922 Bacteria 78634
679 Ga0496120_0001476 3300048923 Bacteria 27987
680 Ga0496121_0001246 3300048924 Bacteria 44184
681 Ga0496121_0002966 3300048924 Bacteria 24708
682 Ga0496121_0031786 3300048924 Bacteria 4814
683 Ga0496121_0098579 3300048924 Bacteria 2261
684 Ga0496122_0000590 3300048925 Bacteria 74565
685 Ga0496122_0001707 3300048925 Bacteria 34056
686 Ga0496122_0009159 3300048925 Bacteria 10484
687 Ga0496122_0017946 3300048925 Bacteria 6567
688 Ga0496122_0040719 3300048925 Bacteria 3686
689 Ga0496123_0000088 3300048926 Bacteria 180478
690 Ga0496123_0000607 3300048926 Bacteria 60365
691 Ga0496123_0012377 3300048926 Bacteria 7282
692 Ga0496123_0018999 3300048926 Bacteria 5433
693 Ga0496123_0062843 3300048926 Bacteria 2375
694 Ga0496124_0000073 3300048927 Bacteria 219306
695 Ga0496124_0001393 3300048927 Bacteria 36270
696 Ga0496124_0003431 3300048927 Bacteria 19406
697 Ga0496124_0005436 3300048927 Bacteria 14331
698 Ga0496124_0005945 3300048927 Bacteria 13489
699 Ga0496124_0033385 3300048927 Bacteria 4527
700 Ga0496124_0062468 3300048927 Bacteria 3116
701 Ga0496124_0120201 3300048927 Bacteria 2100
702 Ga0496124_0259154 3300048927 Bacteria 1281
703 Ga0496125_0001017 3300048928 Bacteria 43607
704 Ga0496125_0014635 3300048928 Bacteria 7626
705 Ga0496125_0015703 3300048928 Bacteria 7304
706 Ga0496125_0041485 3300048928 Bacteria 3932
707 Ga0496125_0060372 3300048928 Bacteria 3048
708 Ga0496125_0178965 3300048928 Bacteria 1415
709 Ga0496126_0109965 3300048929 Bacteria 2401
710 Ga0496126_0267834 3300048929 Bacteria 1418
711 Ga0495678_000404 3300049459 Bacteria 43644
712 Ga0495678_003668 3300049459 Bacteria 9311
713 Ga0495678_005047 3300049459 Bacteria 7423
714 Ga0495678_010232 3300049459 Bacteria 4570
715 Ga0495678_015508 3300049459 Bacteria 3502
716 Ga0495678_022316 3300049459 Bacteria 2770
717 Ga0495678_030790 3300049459 Bacteria 2242
718 Ga0495682_0000681 3300049460 Bacteria 22388
719 Ga0501034_0000101 3300049571 Bacteria 158656
720 Ga0501037_0036053 3300049573 Bacteria 3646
721 nmdc:mga0yw44_193846_c1 3300050492 Bacteria 1341
722 nmdc:mga0yw44_279683_c1 3300050492 Bacteria 1115
723 nmdc:mga06z11_8429_c1 3300050494 Bacteria 4298
724 Ga0500641_0000779 3300053096 Bacteria 11551
725 Ga0500650_0053694 3300053098 Bacteria 1875
726 Ga0500659_0002113 3300053135 Bacteria 12131
727 Ga0500561_0015366 3300053137 Bacteria 1697
728 Ga0500604_0003366 3300053151 Bacteria 4301
729 Ga0500622_0003764 3300053156 Bacteria 9907
730 Ga0500636_0009771 3300053177 Bacteria 5588
731 Ga0500609_007306 3300053731 Bacteria 1492

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2885266251 2885267076 300
2 3300013102 Ga0157371_10000068 Ga0157371_1000006892 302
3 3300037418 Ga0395900_0030607 Ga0395900_0030607_2314_3276 302
4 3300044650 Ga0466986_0125542 Ga0466986_0125542_487_1449 302
5 3300048928 Ga0496125_0015703 Ga0496125_0015703_2059_3021 302
6 3300033545 Ga0316214_1000796 Ga0316214_10007962 304
7 iso_pu_bacteria 2643221683 2644468144 305
8 3300046474 Ga0495605_0053349 Ga0495605_0053349_905_1897 307
9 3300048091 Ga0495626_0011126 Ga0495626_0011126_54_1046 307
10 3300048920 Ga0496117_0019912 Ga0496117_0019912_2759_3724 307
11 3300048921 Ga0496118_0032955 Ga0496118_0032955_1680_2645 307
12 3300024225 Ga0224572_1007229 Ga0224572_10072292 308
13 3300031090 Ga0265760_10004209 Ga0265760_100042092 308
14 3300048927 Ga0496124_0259154 Ga0496124_0259154_18_959 308
15 iso_pu_bacteria 2596583598 2597028581 308
16 iso_pu_bacteria 2599185178 2599444603 308
17 iso_pu_bacteria 2900577576 2900581615 308
18 iso_pu_bacteria 2928058823 2928062598 308
19 iso_pu_bacteria 2831864461 2831865031 309
20 3300001979 JGI24740J21852_10000827 JGI24740J21852_100008274 310
21 3300002705 JGI25156J39149_1006414 JGI25156J39149_10064143 310
22 3300003751 Ga0055538_1004396 Ga0055538_10043962 310
23 3300003752 Ga0055539_1000123 Ga0055539_100012327 310
24 3300003756 Ga0055533_1003373 Ga0055533_10033732 310
25 3300003756 Ga0055533_1004209 Ga0055533_10042092 310
26 3300003758 Ga0055532_1000029 Ga0055532_100002945 310
27 3300003759 Ga0055525_1000345 Ga0055525_100034516 310
28 3300003760 Ga0055527_1000127 Ga0055527_100012726 310
29 3300003761 Ga0055535_1000137 Ga0055535_100013746 310
30 3300003762 Ga0055542_1009505 Ga0055542_10095051 310
31 3300003763 Ga0055529_1000062 Ga0055529_100006214 310
32 3300003763 Ga0055529_1000376 Ga0055529_100037645 310
33 3300005327 Ga0070658_10184415 Ga0070658_101844151 310
34 3300005337 Ga0070682_100052508 Ga0070682_1000525082 310
35 3300005344 Ga0070661_100004017 Ga0070661_1000040173 310
36 3300005455 Ga0070663_100000011 Ga0070663_100000011110 310
37 3300005455 Ga0070663_100000690 Ga0070663_1000006901 310
38 3300005564 Ga0070664_100000008 Ga0070664_10000000854 310
39 3300005577 Ga0068857_100002038 Ga0068857_10000203813 310
40 3300005578 Ga0068854_100000072 Ga0068854_10000007265 310
41 3300005614 Ga0068856_100000009 Ga0068856_10000000987 310
42 3300009093 Ga0105240_10055439 Ga0105240_100554392 310
43 3300013100 Ga0157373_10005361 Ga0157373_1000536111 310
44 3300013104 Ga0157370_10000200 Ga0157370_1000020068 310
45 3300013105 Ga0157369_10005953 Ga0157369_1000595315 310
46 3300013307 Ga0157372_10002606 Ga0157372_1000260619 310
47 3300020069 Ga0197907_10647456 Ga0197907_106474562 310
48 3300020077 Ga0206351_10300647 Ga0206351_103006472 310
49 3300020082 Ga0206353_10328413 Ga0206353_103284132 310
50 3300020610 Ga0154015_1082437 Ga0154015_10824374 310
51 3300025224 Ga0209784_100003 Ga0209784_100003880 310
52 3300025224 Ga0209784_100482 Ga0209784_10048214 310
53 3300025225 Ga0209566_100002 Ga0209566_1000021834 310
54 3300025226 Ga0209674_100008 Ga0209674_100008351 310
55 3300025226 Ga0209674_101455 Ga0209674_1014556 310
56 3300025228 Ga0209672_100015 Ga0209672_100015364 310
57 3300025229 Ga0209147_100002 Ga0209147_1000021531 310
58 3300025229 Ga0209147_100016 Ga0209147_100016100 310
59 3300025230 Ga0209563_100004 Ga0209563_1000041251 310
60 3300025230 Ga0209563_108111 Ga0209563_1081112 310
61 3300025242 Ga0209258_100002 Ga0209258_1000021531 310
62 3300025242 Ga0209258_100026 Ga0209258_100026364 310
63 3300025253 Ga0209677_100009 Ga0209677_100009381 310
64 3300025254 Ga0209148_1004936 Ga0209148_10049362 310
65 3300025256 Ga0209759_1003731 Ga0209759_10037313 310
66 3300025256 Ga0209759_1004724 Ga0209759_10047245 310
67 3300025256 Ga0209759_1013200 Ga0209759_10132003 310
68 3300025272 Ga0209455_1000021 Ga0209455_1000021118 310
69 3300025272 Ga0209455_1000321 Ga0209455_100032147 310
70 3300025909 Ga0207705_10022744 Ga0207705_100227442 310
71 3300025913 Ga0207695_10000729 Ga0207695_100007292 310
72 3300025920 Ga0207649_10000334 Ga0207649_1000033436 310
73 3300025945 Ga0207679_10000001 Ga0207679_10000001122 310
74 3300025981 Ga0207640_10000088 Ga0207640_100000884 310
75 3300026067 Ga0207678_10000001 Ga0207678_10000001309 310
76 3300026067 Ga0207678_10002593 Ga0207678_1000259315 310
77 3300026078 Ga0207702_10039638 Ga0207702_100396382 310
78 3300026116 Ga0207674_10198448 Ga0207674_101984482 310
79 3300049573 Ga0501037_0036053 Ga0501037_0036053_1907_2896 310
80 3300053137 Ga0500561_0015366 Ga0500561_0015366_732_1679 310
81 3300053177 Ga0500636_0009771 Ga0500636_0009771_1541_2488 310
82 iso_pu_bacteria 2582581311 2585293740 310
83 iso_pu_bacteria 2816332286 2817453473 310
84 iso_pu_bacteria 2870068957 2870072968 310
85 iso_pu_bacteria 2928157003 2928157417 310
86 iso_pu_bacteria 8020938398 8020944118 310
87 iso_pu_bacteria 8020945358 8020948296 310
88 iso_pu_bacteria 8020953355 8020954071 310
89 3300003215 JGI25153J46596_10000049 JGI25153J46596_10000049113 311
90 3300005262 Ga0065165_1000006 Ga0065165_1000006110 311
91 3300021388 Ga0213875_10007177 Ga0213875_100071774 311
92 3300025295 Ga0209564_1000003 Ga0209564_10000031002 311
93 3300025297 Ga0209758_1000029 Ga0209758_1000029136 311
94 3300046507 Ga0495606_0009604 Ga0495606_0009604_2538_3521 311
95 3300046691 Ga0495670_0010430 Ga0495670_0010430_1665_2648 311
96 3300046694 Ga0495649_0007703 Ga0495649_0007703_4701_5684 311
97 3300048903 Ga0496100_0263647 Ga0496100_0263647_264_1214 311
98 3300050492 nmdc:mga0yw44_193846_c1 nmdc:mga0yw44_193846_c1_271_1221 311
99 3300050492 nmdc:mga0yw44_279683_c1 nmdc:mga0yw44_279683_c1_65_1015 311
100 3300053096 Ga0500641_0000779 Ga0500641_0000779_10233_11183 311
101 3300053098 Ga0500650_0053694 Ga0500650_0053694_885_1835 311
102 3300053151 Ga0500604_0003366 Ga0500604_0003366_89_1039 311
103 3300053156 Ga0500622_0003764 Ga0500622_0003764_6425_7408 311
104 3300053731 Ga0500609_007306 Ga0500609_007306_123_1073 311
105 iso_pu_bacteria 2738541337 2739055620 311
106 3300002738 JGI25154J39366_1000255 JGI25154J39366_100025531 313
107 3300003756 Ga0055533_1001539 Ga0055533_10015395 313
108 3300003762 Ga0055542_1001189 Ga0055542_100118913 313
109 3300003841 Ga0055541_1000208 Ga0055541_100020824 313
110 3300005366 Ga0070659_100002881 Ga0070659_1000028813 313
111 3300006051 Ga0075364_10231431 Ga0075364_102314311 313
112 3300015261 Ga0182006_1006450 Ga0182006_10064503 313
113 3300015262 Ga0182007_10013025 Ga0182007_100130252 313
114 3300025224 Ga0209784_100539 Ga0209784_1005397 313
115 3300025225 Ga0209566_100970 Ga0209566_10097011 313
116 3300025226 Ga0209674_100229 Ga0209674_10022910 313
117 3300025246 Ga0209646_1000059 Ga0209646_100005992 313
118 3300025250 Ga0209026_1001981 Ga0209026_10019813 313
119 3300025253 Ga0209677_103507 Ga0209677_1035075 313
120 3300025254 Ga0209148_1000021 Ga0209148_1000021207 313
121 3300025256 Ga0209759_1012125 Ga0209759_10121252 313
122 3300025932 Ga0207690_10001324 Ga0207690_1000132411 313
123 3300031456 Ga0307513_10204655 Ga0307513_102046552 313
124 3300048920 Ga0496117_0115643 Ga0496117_0115643_193_1197 313
125 3300044658 Ga0466972_0000111 Ga0466972_0000111_21813_22793 314
126 3300046460 Ga0495638_0056461 Ga0495638_0056461_591_1589 314
127 3300046472 Ga0495580_0051756 Ga0495580_0051756_152_1201 314
128 3300046499 Ga0495594_0163553 Ga0495594_0163553_13_1062 314
129 3300046507 Ga0495606_0011424 Ga0495606_0011424_2318_3295 314
130 3300046526 Ga0495666_0046014 Ga0495666_0046014_511_1560 314
131 3300046531 Ga0495665_0063814 Ga0495665_0063814_604_1653 314
132 3300047317 Ga0495604_0109386 Ga0495604_0109386_856_1905 314
133 3300047472 Ga0495686_0164410 Ga0495686_0164410_118_1113 314
134 iso_pu_bacteria 2511231023 2511370995 314
135 iso_pu_bacteria 2511231031 2511413467 314
136 iso_pu_bacteria 2738543025 2739312507 314
137 iso_pu_bacteria 2917832318 2917835130 314
138 iso_pu_bacteria 2919125081 2919130026 314
139 iso_pu_bacteria 2969304461 2969310172 314
140 iso_pu_bacteria 3007614139 3007618530 314
141 3300003316 rootH1_10014519 rootH1_100145193 315
142 3300006948 Ga0099826_10000012 Ga0099826_10000012233 315
143 3300031901 Ga0307406_10281375 Ga0307406_102813751 315
144 3300042000 Ga0439437_000374 Ga0439437_000374_723_1682 315
145 3300042126 Ga0450888_001329 Ga0450888_001329_248_1207 315
146 3300042127 Ga0450890_004100 Ga0450890_004100_408_1367 315
147 3300042130 Ga0450892_001104 Ga0450892_001104_179_1138 315
148 3300042532 Ga0450893_0005070 Ga0450893_0005070_996_1955 315
149 3300042533 Ga0450901_001959 Ga0450901_001959_437_1396 315
150 3300042876 Ga0451577_0127737 Ga0451577_0127737_956_1954 315
151 3300044683 Ga0466965_0135414 Ga0466965_0135414_13_1104 315
152 3300044712 Ga0453684_0000280 Ga0453684_0000280_14048_15046 315
153 3300044901 Ga0466960_0027620 Ga0466960_0027620_743_1834 315
154 3300045051 Ga0451576_0021037 Ga0451576_0021037_164_1162 315
155 3300045051 Ga0451576_0100429 Ga0451576_0100429_967_1959 315
156 3300046452 Ga0495617_000167 Ga0495617_000167_32956_33933 315
157 3300046458 Ga0495591_024875 Ga0495591_024875_833_1810 315
158 3300046474 Ga0495605_0000064 Ga0495605_0000064_8051_9028 315
159 3300046492 Ga0495585_0016202 Ga0495585_0016202_1083_2060 315
160 3300046501 Ga0495607_0014419 Ga0495607_0014419_525_1502 315
161 3300046524 Ga0495648_0008794 Ga0495648_0008794_360_1337 315
162 3300046616 Ga0495668_0004160 Ga0495668_0004160_1883_2860 315
163 3300046692 Ga0495671_0001452 Ga0495671_0001452_7144_8121 315
164 3300047320 Ga0495672_0022119 Ga0495672_0022119_596_1636 315
165 3300050494 nmdc:mga06z11_8429_c1 nmdc:mga06z11_8429_c1_1660_2646 315
166 iso_pu_bacteria 2718217725 2718636611 315
167 iso_pu_bacteria 2928108538 2928111949 315
168 iso_pu_bacteria 2928135762 2928139507 315
169 3300031251 Ga0265327_10000008 Ga0265327_10000008473 316
170 3300046457 Ga0495590_0003982 Ga0495590_0003982_194_1192 316
171 3300046538 Ga0495609_0013995 Ga0495609_0013995_2255_3253 316
172 3300046616 Ga0495668_0002371 Ga0495668_0002371_7736_8734 316
173 3300046692 Ga0495671_0019232 Ga0495671_0019232_1874_2872 316
174 3300047470 Ga0495681_0035532 Ga0495681_0035532_982_1980 316
175 iso_pu_bacteria 2808606373 2808905757 316
176 3300044656 Ga0466969_0031299 Ga0466969_0031299_1089_2177 317
177 3300044658 Ga0466972_0023033 Ga0466972_0023033_996_1991 317
178 3300044672 Ga0466982_0121209 Ga0466982_0121209_310_1326 317
179 3300044683 Ga0466965_0006859 Ga0466965_0006859_168_1163 317
180 3300044683 Ga0466965_0053064 Ga0466965_0053064_471_1559 317
181 3300044693 Ga0466961_0000456 Ga0466961_0000456_22090_23265 317
182 3300044706 Ga0466964_0001262 Ga0466964_0001262_2880_3875 317
183 3300044706 Ga0466964_0003758 Ga0466964_0003758_1889_2905 317
184 3300044735 Ga0466968_0001055 Ga0466968_0001055_1176_2171 317
185 3300044735 Ga0466968_0010840 Ga0466968_0010840_1921_3009 317
186 3300044765 Ga0466970_0014919 Ga0466970_0014919_1363_2379 317
187 3300044842 Ga0466957_0010145 Ga0466957_0010145_1627_2715 317
188 3300045049 Ga0466959_0013895 Ga0466959_0013895_2055_3143 317
189 3300045049 Ga0466959_0015430 Ga0466959_0015430_1236_2231 317
190 3300046453 Ga0495627_001226 Ga0495627_001226_7100_8089 317
191 3300046492 Ga0495585_0012191 Ga0495585_0012191_2543_3529 317
192 3300046500 Ga0495596_0003229 Ga0495596_0003229_1555_2544 317
193 3300046506 Ga0495583_0004202 Ga0495583_0004202_2263_3252 317
194 3300046518 Ga0495631_0007430 Ga0495631_0007430_2699_3688 317
195 3300046518 Ga0495631_0064891 Ga0495631_0064891_435_1424 317
196 3300046519 Ga0495632_0002219 Ga0495632_0002219_6865_7854 317
197 3300046522 Ga0495643_0009122 Ga0495643_0009122_3990_4991 317
198 3300046528 Ga0495642_0001374 Ga0495642_0001374_7983_8972 317
199 3300046558 Ga0495633_0057255 Ga0495633_0057255_684_1670 317
200 3300046616 Ga0495668_0120154 Ga0495668_0120154_397_1386 317
201 3300046660 Ga0495625_0029129 Ga0495625_0029129_1726_2727 317
202 3300046674 Ga0495588_0016999 Ga0495588_0016999_168_1154 317
203 3300046684 Ga0495669_0004664 Ga0495669_0004664_730_1719 317
204 3300046694 Ga0495649_0012604 Ga0495649_0012604_670_1659 317
205 3300048905 Ga0496102_0002251 Ga0496102_0002251_7497_8486 317
206 3300048914 Ga0496111_0129354 Ga0496111_0129354_452_1453 317
207 3300049459 Ga0495678_003668 Ga0495678_003668_6765_7754 317
208 iso_pu_bacteria 2511231004 2511254855 317
209 iso_pu_bacteria 2511231008 2511275093 317
210 iso_pu_bacteria 2511231010 2511289403 317
211 iso_pu_bacteria 2511231012 2511302817 317
212 iso_pu_bacteria 2511231014 2511314411 317
213 iso_pu_bacteria 2511231015 2511317231 317
214 iso_pu_bacteria 2511231016 2511328010 317
215 iso_pu_bacteria 2511231018 2511336834 317
216 iso_pu_bacteria 2511231019 2511344796 317
217 iso_pu_bacteria 2511231020 2511349561 317
218 iso_pu_bacteria 2511231021 2511359288 317
219 iso_pu_bacteria 2511231022 2511360898 317
220 iso_pu_bacteria 2511231024 2511375655 317
221 iso_pu_bacteria 2554235231 2555245588 317
222 iso_pu_bacteria 2554235341 2555672835 317
223 iso_pu_bacteria 2599185160 2599355960 317
224 iso_pu_bacteria 2599185161 2599362638 317
225 iso_pu_bacteria 2599185162 2599369056 317
226 iso_pu_bacteria 2599185163 2599375747 317
227 iso_pu_bacteria 2599185164 2599381066 317
228 iso_pu_bacteria 2599185165 2599387418 317
229 iso_pu_bacteria 2599185166 2599394605 317
230 iso_pu_bacteria 2599185168 2599406370 317
231 iso_pu_bacteria 2599185181 2599462794 317
232 iso_pu_bacteria 2599185182 2599467783 317
233 iso_pu_bacteria 2599185186 2599491811 317
234 iso_pu_bacteria 2599185188 2599500260 317
235 iso_pu_bacteria 2599185248 2599768148 317
236 iso_pu_bacteria 2599185289 2599885583 317
237 iso_pu_bacteria 2599185291 2599897297 317
238 iso_pu_bacteria 2599185302 2599942350 317
239 iso_pu_bacteria 2599185304 2599954237 317
240 iso_pu_bacteria 2599185305 2599961915 317
241 iso_pu_bacteria 2599185307 2599972226 317
242 iso_pu_bacteria 2599185309 2599982920 317
243 iso_pu_bacteria 2599185310 2599988330 317
244 iso_pu_bacteria 2599185312 2599999125 317
245 iso_pu_bacteria 2599185313 2600004311 317
246 iso_pu_bacteria 2599185315 2600020400 317
247 iso_pu_bacteria 2599185321 2600054922 317
248 iso_pu_bacteria 2599185324 2600071866 317
249 iso_pu_bacteria 2599185356 2600215420 317
250 iso_pu_bacteria 2600255283 2601627310 317
251 iso_pu_bacteria 2600255313 2601775586 317
252 iso_pu_bacteria 2600255318 2601798561 317
253 iso_pu_bacteria 2600255389 2602011083 317
254 iso_pu_bacteria 2603880185 2606077455 317
255 iso_pu_bacteria 2603880199 2606129299 317
256 iso_pu_bacteria 2623620443 2624483410 317
257 iso_pu_bacteria 2643221565 2643842962 317
258 iso_pu_bacteria 2643221633 2644184484 317
259 iso_pu_bacteria 2651869719 2652545893 317
260 iso_pu_bacteria 2667528170 2671089553 317
261 iso_pu_bacteria 2667528171 2671099278 317
262 iso_pu_bacteria 2713897149 2715754849 317
263 iso_pu_bacteria 2738541271 2738691938 317
264 iso_pu_bacteria 2738543004 2739199057 317
265 iso_pu_bacteria 2738543015 2739258998 317
266 iso_pu_bacteria 2738543016 2739263312 317
267 iso_pu_bacteria 2738543020 2739289600 317
268 iso_pu_bacteria 2738543021 2739294912 317
269 iso_pu_bacteria 2765235841 2765586556 317
270 iso_pu_bacteria 2773857673 2774135570 317
271 iso_pu_bacteria 2784132063 2784261820 317
272 iso_pu_bacteria 2791355520 2794593840 317
273 iso_pu_bacteria 2806310737 2807410791 317
274 iso_pu_bacteria 2806310745 2807459132 317
275 iso_pu_bacteria 2808606377 2808928444 317
276 iso_pu_bacteria 2808606381 2808950373 317
277 iso_pu_bacteria 2808606382 2808959845 317
278 iso_pu_bacteria 2808606445 2809217184 317
279 iso_pu_bacteria 2811994881 2812369982 317
280 iso_pu_bacteria 2818991456 2819655129 317
281 iso_pu_bacteria 2818991464 2819704400 317
282 iso_pu_bacteria 2823421272 2823421596 317
283 iso_pu_bacteria 2842843487 2842845688 317
284 iso_pu_bacteria 2842854478 2842855620 317
285 iso_pu_bacteria 2844665904 2844667087 317
286 iso_pu_bacteria 2852657418 2852659675 317
287 iso_pu_bacteria 2860339153 2860341712 317
288 iso_pu_bacteria 2878029506 2878035352 317
289 iso_pu_bacteria 2880230671 2880235993 317
290 iso_pu_bacteria 2904518522 2904518959 317
291 iso_pu_bacteria 2904550169 2904551330 317
292 iso_pu_bacteria 2912963787 2912968856 317
293 iso_pu_bacteria 2917070673 2917076732 317
294 iso_pu_bacteria 2919063839 2919065518 317
295 iso_pu_bacteria 2919155634 2919159587 317
296 iso_pu_bacteria 2919385768 2919389191 317
297 iso_pu_bacteria 2923519811 2923524068 317
298 iso_pu_bacteria 2923586266 2923588998 317
299 iso_pu_bacteria 2931369376 2931372641 317
300 iso_pu_bacteria 2931396565 2931398077 317
301 iso_pu_bacteria 2935353572 2935358301 317
302 iso_pu_bacteria 2939636861 2939640807 317
303 iso_pu_bacteria 2939651529 2939654196 317
304 iso_pu_bacteria 2974289157 2974294080 317
305 iso_pu_bacteria 2998139840 2998145396 317
306 iso_pu_bacteria 3007419365 3007419815 317
307 iso_pu_bacteria 3007511990 3007517178 317
308 iso_pu_bacteria 3007619802 3007622520 317
309 iso_pu_bacteria 3007718800 3007721754 317
310 iso_pu_bacteria 3007803356 3007805024 317
311 iso_pu_bacteria 637000220 637323272 317
312 iso_pu_bacteria 8052494512 8052499744 317
313 iso_pu_bacteria 8054929484 8054934079 317
314 iso_pu_bacteria 8055878733 8055881246 317
315 iso_pu_bacteria 8056115690 8056116522 317
316 iso_pu_bacteria 8056120720 8056125702 317
317 iso_pu_bacteria 8056125926 8056131603 317
318 iso_pu_bacteria 8056137416 8056142772 317
319 iso_pu_bacteria 8056143049 8056148769 317
320 iso_pu_bacteria 8056177738 8056181998 317
321 iso_pu_bacteria 8057798959 8057801940 317
322 3300001979 JGI24740J21852_10004627 JGI24740J21852_100046277 318
323 3300005548 Ga0070665_100136876 Ga0070665_1001368762 318
324 3300012498 Ga0157345_1000031 Ga0157345_100003131 318
325 3300013100 Ga0157373_10033054 Ga0157373_100330543 318
326 3300013306 Ga0163162_10000591 Ga0163162_100005917 318
327 3300017792 Ga0163161_10026201 Ga0163161_100262013 318
328 3300025711 Ga0207696_1002362 Ga0207696_10023627 318
329 3300025728 Ga0207655_1036805 Ga0207655_10368052 318
330 3300028379 Ga0268266_10122719 Ga0268266_101227192 318
331 3300031730 Ga0307516_10095864 Ga0307516_100958642 318
332 3300033180 Ga0307510_10017092 Ga0307510_100170927 318
333 3300041407 Ga0439447_019583 Ga0439447_019583_781_1758 318
334 3300046453 Ga0495627_002838 Ga0495627_002838_2283_3248 318
335 3300046463 Ga0495653_0162455 Ga0495653_0162455_28_993 318
336 3300046471 Ga0495650_0056548 Ga0495650_0056548_365_1330 318
337 3300046492 Ga0495585_0038452 Ga0495585_0038452_309_1274 318
338 3300046500 Ga0495596_0056131 Ga0495596_0056131_539_1504 318
339 3300046507 Ga0495606_0016424 Ga0495606_0016424_4542_5507 318
340 3300046512 Ga0495610_0003101 Ga0495610_0003101_9440_10405 318
341 3300046515 Ga0495620_0004177 Ga0495620_0004177_4628_5593 318
342 3300046519 Ga0495632_0006873 Ga0495632_0006873_4676_5641 318
343 3300046520 Ga0495637_0001586 Ga0495637_0001586_7682_8647 318
344 3300046524 Ga0495648_0019560 Ga0495648_0019560_2266_3231 318
345 3300046538 Ga0495609_0019412 Ga0495609_0019412_1450_2415 318
346 3300046542 Ga0495597_0022069 Ga0495597_0022069_1313_2278 318
347 3300046557 Ga0495622_0011141 Ga0495622_0011141_2006_2971 318
348 3300046648 Ga0495611_0006971 Ga0495611_0006971_1549_2514 318
349 3300046660 Ga0495625_0045572 Ga0495625_0045572_45_1010 318
350 3300046660 Ga0495625_0172462 Ga0495625_0172462_424_1389 318
351 3300046691 Ga0495670_0012881 Ga0495670_0012881_1652_2617 318
352 3300046692 Ga0495671_0017994 Ga0495671_0017994_1531_2496 318
353 3300046794 Ga0495589_0003948 Ga0495589_0003948_2216_3181 318
354 3300047469 Ga0495673_0022627 Ga0495673_0022627_458_1423 318
355 3300047470 Ga0495681_0040939 Ga0495681_0040939_35_1000 318
356 3300047472 Ga0495686_0008819 Ga0495686_0008819_1756_2721 318
357 3300048919 Ga0496116_0009294 Ga0496116_0009294_2653_3618 318
358 iso_pu_bacteria 2511231006 2511266841 318
359 iso_pu_bacteria 2511231017 2511329669 318
360 iso_pu_bacteria 2512047018 2512329493 318
361 iso_pu_bacteria 2582580891 2583795725 318
362 iso_pu_bacteria 2597489887 2597860880 318
363 iso_pu_bacteria 2597489888 2597866629 318
364 iso_pu_bacteria 2597489889 2597872485 318
365 iso_pu_bacteria 2599185167 2599400541 318
366 iso_pu_bacteria 2599185179 2599449865 318
367 iso_pu_bacteria 2599185185 2599485885 318
368 iso_pu_bacteria 2599185189 2599505750 318
369 iso_pu_bacteria 2599185190 2599511939 318
370 iso_pu_bacteria 2599185191 2599516923 318
371 iso_pu_bacteria 2599185257 2599804667 318
372 iso_pu_bacteria 2599185288 2599879035 318
373 iso_pu_bacteria 2599185290 2599892699 318
374 iso_pu_bacteria 2599185303 2599951449 318
375 iso_pu_bacteria 2600254931 2600363549 318
376 iso_pu_bacteria 2600255296 2601693447 318
377 iso_pu_bacteria 2619619299 2621296848 318
378 iso_pu_bacteria 2643221571 2643872262 318
379 iso_pu_bacteria 2643221713 2644620166 318
380 iso_pu_bacteria 2671180172 2671771674 318
381 iso_pu_bacteria 2675903420 2677897129 318
382 iso_pu_bacteria 2721755607 2723251364 318
383 iso_pu_bacteria 2738541265 2738671668 318
384 iso_pu_bacteria 2738541282 2738750062 318
385 iso_pu_bacteria 2738541294 2738807251 318
386 iso_pu_bacteria 2738541303 2738859102 318
387 iso_pu_bacteria 2738541309 2738894611 318
388 iso_pu_bacteria 2740892503 2743740421 318
389 iso_pu_bacteria 2808606385 2808976147 318
390 iso_pu_bacteria 2808606388 2808993247 318
391 iso_pu_bacteria 2816332298 2817494039 318
392 iso_pu_bacteria 2834028612 2834030948 318
393 iso_pu_bacteria 2842826826 2842831287 318
394 iso_pu_bacteria 2842837860 2842837897 318
395 iso_pu_bacteria 2852612431 2852616349 318
396 iso_pu_bacteria 2852667396 2852671317 318
397 iso_pu_bacteria 2860867994 2860873026 318
398 iso_pu_bacteria 2908446538 2908452579 318
399 iso_pu_bacteria 2919456309 2919457546 318
400 iso_pu_bacteria 2923153595 2923159514 318
401 iso_pu_bacteria 2929189879 2929195149 318
402 iso_pu_bacteria 2931390751 2931396408 318
403 iso_pu_bacteria 2945961074 2945966854 318
404 iso_pu_bacteria 2946006987 2946013287 318
405 iso_pu_bacteria 2946027586 2946027901 318
406 iso_pu_bacteria 2947233263 2947234421 318
407 iso_pu_bacteria 2984286254 2984286602 318
408 iso_pu_bacteria 3007395558 3007399400 318
409 iso_pu_bacteria 8015687852 8015693613 318
410 iso_pu_bacteria 8054285046 8054285729 318
411 iso_pu_bacteria 8054347763 8054349584 318
412 iso_pu_bacteria 8054503363 8054508931 318
413 iso_pu_bacteria 8055770955 8055776859 318
414 iso_pu_bacteria 8055817908 8055823900 318
415 iso_pu_bacteria 8056131705 8056137307 318
416 iso_pu_bacteria 8056148874 8056151496 318
417 iso_pu_bacteria 8056155041 8056160849 318
418 iso_pu_bacteria 8056161164 8056163630 318
419 3300041404 Ga0439436_0001261 Ga0439436_0001261_3844_4806 320
420 3300041407 Ga0439447_000185 Ga0439447_000185_9288_10250 320
421 3300041411 Ga0439466_0005241 Ga0439466_0005241_33_995 320
422 3300042006 Ga0439432_003848 Ga0439432_003848_88_1050 320
423 3300042156 Ga0439446_0000162 Ga0439446_0000162_261_1223 320
424 3300046492 Ga0495585_0008461 Ga0495585_0008461_4934_5899 320
425 3300046507 Ga0495606_0009768 Ga0495606_0009768_1875_2840 320
426 3300046665 Ga0495661_0000061 Ga0495661_0000061_77974_78939 320
427 3300002737 JGI25162J39368_1000319 JGI25162J39368_10003198 321
428 3300002771 JGI25163J39215_1000691 JGI25163J39215_10006918 321
429 3300002772 JGI25164J39214_1000236 JGI25164J39214_10002368 321
430 3300003214 JGI25165J46597_1000434 JGI25165J46597_10004348 321
431 3300003781 Ga0055536_1005342 Ga0055536_10053421 321
432 3300003791 Ga0055530_10000658 Ga0055530_1000065824 321
433 3300003791 Ga0055530_10002203 Ga0055530_100022038 321
434 3300003792 Ga0055540_1000506 Ga0055540_100050624 321
435 3300003792 Ga0055540_1001504 Ga0055540_10015047 321
436 3300003794 Ga0055531_10000483 Ga0055531_100004838 321
437 3300005288 Ga0065714_10065219 Ga0065714_100652196 321
438 3300005288 Ga0065714_10094760 Ga0065714_100947602 321
439 3300005289 Ga0065704_10074610 Ga0065704_100746106 321
440 3300005353 Ga0070669_100001507 Ga0070669_1000015077 321
441 3300006058 Ga0075432_10004620 Ga0075432_100046203 321
442 3300006058 Ga0075432_10007556 Ga0075432_100075563 321
443 3300006058 Ga0075432_10061212 Ga0075432_100612121 321
444 3300006914 Ga0075436_100141875 Ga0075436_1001418752 321
445 3300006914 Ga0075436_100227520 Ga0075436_1002275202 321
446 3300006944 Ga0099823_1000086 Ga0099823_100008625 321
447 3300006944 Ga0099823_1036036 Ga0099823_10360365 321
448 3300006946 Ga0079104_1000718 Ga0079104_100071823 321
449 3300006948 Ga0099826_10016562 Ga0099826_100165626 321
450 3300009011 Ga0105251_10000027 Ga0105251_100000276 321
451 3300009011 Ga0105251_10000274 Ga0105251_1000027414 321
452 3300009011 Ga0105251_10001027 Ga0105251_1000102716 321
453 3300009011 Ga0105251_10008916 Ga0105251_100089163 321
454 3300009011 Ga0105251_10131130 Ga0105251_101311301 321
455 3300009036 Ga0105244_10002564 Ga0105244_100025648 321
456 3300009036 Ga0105244_10009575 Ga0105244_100095754 321
457 3300009036 Ga0105244_10026014 Ga0105244_100260142 321
458 3300009036 Ga0105244_10053920 Ga0105244_100539202 321
459 3300009036 Ga0105244_10117284 Ga0105244_101172842 321
460 3300009092 Ga0105250_10000191 Ga0105250_1000019116 321
461 3300009092 Ga0105250_10033566 Ga0105250_100335662 321
462 3300009092 Ga0105250_10092144 Ga0105250_100921441 321
463 3300009148 Ga0105243_10000418 Ga0105243_100004188 321
464 3300009148 Ga0105243_10002911 Ga0105243_100029118 321
465 3300009148 Ga0105243_10003724 Ga0105243_100037246 321
466 3300009148 Ga0105243_10005562 Ga0105243_100055624 321
467 3300009148 Ga0105243_10010759 Ga0105243_100107598 321
468 3300009553 Ga0105249_10006152 Ga0105249_100061525 321
469 3300011119 Ga0105246_10000446 Ga0105246_100004461 321
470 3300011119 Ga0105246_10021610 Ga0105246_100216103 321
471 3300013100 Ga0157373_10040572 Ga0157373_100405723 321
472 3300013102 Ga0157371_10000609 Ga0157371_1000060933 321
473 3300013102 Ga0157371_10003267 Ga0157371_100032677 321
474 3300013104 Ga0157370_10064044 Ga0157370_100640443 321
475 3300013104 Ga0157370_10196182 Ga0157370_101961822 321
476 3300013307 Ga0157372_10009606 Ga0157372_100096065 321
477 3300013307 Ga0157372_10109564 Ga0157372_101095642 321
478 3300014497 Ga0182008_10000293 Ga0182008_1000029335 321
479 3300014497 Ga0182008_10005460 Ga0182008_100054608 321
480 3300015261 Ga0182006_1066241 Ga0182006_10662412 321
481 3300015262 Ga0182007_10000284 Ga0182007_100002847 321
482 3300015265 Ga0182005_1002545 Ga0182005_10025452 321
483 3300015265 Ga0182005_1013344 Ga0182005_10133442 321
484 3300015265 Ga0182005_1023817 Ga0182005_10238172 321
485 3300017792 Ga0163161_10017835 Ga0163161_100178354 321
486 3300017792 Ga0163161_10022215 Ga0163161_100222152 321
487 3300025207 Ga0209760_100149 Ga0209760_10014934 321
488 3300025231 Ga0207427_100005 Ga0207427_100005330 321
489 3300025233 Ga0209437_100018 Ga0209437_100018240 321
490 3300025261 Ga0209233_1000021 Ga0209233_1000021330 321
491 3300025291 Ga0209675_1002099 Ga0209675_10020991 321
492 3300025292 Ga0209676_1000015 Ga0209676_1000015412 321
493 3300025292 Ga0209676_1000041 Ga0209676_1000041174 321
494 3300025292 Ga0209676_1000510 Ga0209676_10005109 321
495 3300025292 Ga0209676_1002546 Ga0209676_10025467 321
496 3300025292 Ga0209676_1003117 Ga0209676_10031172 321
497 3300025298 Ga0209050_1000024 Ga0209050_1000024173 321
498 3300025298 Ga0209050_1000030 Ga0209050_100003026 321
499 3300025298 Ga0209050_1000518 Ga0209050_100051837 321
500 3300025303 Ga0209051_1000012 Ga0209051_1000012268 321
501 3300025303 Ga0209051_1000023 Ga0209051_100002389 321
502 3300025304 Ga0209257_1001245 Ga0209257_100124524 321
503 3300025304 Ga0209257_1008821 Ga0209257_10088216 321
504 3300025711 Ga0207696_1000031 Ga0207696_1000031231 321
505 3300025711 Ga0207696_1000078 Ga0207696_1000078187 321
506 3300025711 Ga0207696_1000145 Ga0207696_100014575 321
507 3300025711 Ga0207696_1005520 Ga0207696_10055207 321
508 3300025711 Ga0207696_1010267 Ga0207696_10102672 321
509 3300025711 Ga0207696_1010392 Ga0207696_10103922 321
510 3300025711 Ga0207696_1046628 Ga0207696_10466281 321
511 3300025728 Ga0207655_1000014 Ga0207655_1000014435 321
512 3300025728 Ga0207655_1000202 Ga0207655_100020243 321
513 3300025728 Ga0207655_1000309 Ga0207655_100030966 321
514 3300025728 Ga0207655_1001315 Ga0207655_10013159 321
515 3300025728 Ga0207655_1005067 Ga0207655_10050672 321
516 3300025728 Ga0207655_1008795 Ga0207655_10087957 321
517 3300025728 Ga0207655_1015714 Ga0207655_10157144 321
518 3300025728 Ga0207655_1016904 Ga0207655_10169042 321
519 3300025728 Ga0207655_1030074 Ga0207655_10300743 321
520 3300025728 Ga0207655_1079939 Ga0207655_10799392 321
521 3300025735 Ga0207713_1000010 Ga0207713_1000010317 321
522 3300025735 Ga0207713_1000077 Ga0207713_100007750 321
523 3300025735 Ga0207713_1001109 Ga0207713_10011097 321
524 3300025735 Ga0207713_1001462 Ga0207713_10014629 321
525 3300025735 Ga0207713_1003196 Ga0207713_10031968 321
526 3300025735 Ga0207713_1003335 Ga0207713_10033357 321
527 3300025735 Ga0207713_1005980 Ga0207713_10059803 321
528 3300025735 Ga0207713_1012141 Ga0207713_10121414 321
529 3300025735 Ga0207713_1037259 Ga0207713_10372592 321
530 3300025735 Ga0207713_1037522 Ga0207713_10375221 321
531 3300025923 Ga0207681_10003206 Ga0207681_100032062 321
532 3300025935 Ga0207709_10000071 Ga0207709_1000007124 321
533 3300025935 Ga0207709_10000337 Ga0207709_1000033732 321
534 3300025935 Ga0207709_10003583 Ga0207709_100035838 321
535 3300025935 Ga0207709_10021142 Ga0207709_100211424 321
536 3300025935 Ga0207709_10061947 Ga0207709_100619471 321
537 3300025972 Ga0207668_10026463 Ga0207668_100264633 321
538 3300026067 Ga0207678_10091364 Ga0207678_100913643 321
539 3300027111 Ga0209281_1000019 Ga0209281_1000019222 321
540 3300027296 Ga0209389_1000049 Ga0209389_100004944 321
541 3300027312 Ga0209371_1000106 Ga0209371_100010663 321
542 3300027907 Ga0207428_10064067 Ga0207428_100640672 321
543 3300027907 Ga0207428_10110118 Ga0207428_101101182 321
544 3300028786 Ga0307517_10125821 Ga0307517_101258212 321
545 3300030500 Ga0268256_1000077 Ga0268256_100007763 321
546 3300030521 Ga0307511_10061910 Ga0307511_100619103 321
547 3300030731 Ga0316177_1038918 Ga0316177_10389182 321
548 3300030734 Ga0316179_1012631 Ga0316179_10126313 321
549 3300030744 Ga0316181_1237161 Ga0316181_12371611 321
550 3300031548 Ga0307408_100001975 Ga0307408_1000019757 321
551 3300031901 Ga0307406_10153558 Ga0307406_101535582 321
552 3300031911 Ga0307412_10007211 Ga0307412_100072111 321
553 3300031911 Ga0307412_10010029 Ga0307412_100100297 321
554 3300031911 Ga0307412_10093995 Ga0307412_100939952 321
555 3300031995 Ga0307409_100313276 Ga0307409_1003132762 321
556 3300032004 Ga0307414_10292647 Ga0307414_102926471 321
557 3300038705 Ga0237819_01092 Ga0237819_01092_5346_6326 321
558 3300041405 Ga0439438_003418 Ga0439438_003418_4593_5558 321
559 3300041405 Ga0439438_026980 Ga0439438_026980_488_1459 321
560 3300041407 Ga0439447_001317 Ga0439447_001317_7491_8456 321
561 3300041407 Ga0439447_006479 Ga0439447_006479_2693_3658 321
562 3300041411 Ga0439466_0007030 Ga0439466_0007030_1166_2137 321
563 3300041413 Ga0439465_0015721 Ga0439465_0015721_1308_2273 321
564 3300042006 Ga0439432_002776 Ga0439432_002776_2220_3185 321
565 3300042006 Ga0439432_028919 Ga0439432_028919_101_1072 321
566 3300042009 Ga0439451_001405 Ga0439451_001405_1229_2194 321
567 3300042009 Ga0439451_021998 Ga0439451_021998_220_1185 321
568 3300042010 Ga0439452_000354 Ga0439452_000354_25789_26763 321
569 3300042010 Ga0439452_000769 Ga0439452_000769_9576_10541 321
570 3300042010 Ga0439452_004376 Ga0439452_004376_2593_3558 321
571 3300042010 Ga0439452_007020 Ga0439452_007020_496_1461 321
572 3300042010 Ga0439452_011548 Ga0439452_011548_1166_2131 321
573 3300042013 Ga0439456_000043 Ga0439456_000043_15085_16050 321
574 3300042013 Ga0439456_000444 Ga0439456_000444_7132_8097 321
575 3300042016 Ga0439463_000538 Ga0439463_000538_1776_2741 321
576 3300042016 Ga0439463_002794 Ga0439463_002794_918_1883 321
577 3300042137 Ga0450902_005290 Ga0450902_005290_449_1414 321
578 3300042142 Ga0450905_000396 Ga0450905_000396_1191_2156 321
579 3300042142 Ga0450905_001922 Ga0450905_001922_1170_2135 321
580 3300042142 Ga0450905_006590 Ga0450905_006590_262_1227 321
581 3300042145 Ga0450906_000802 Ga0450906_000802_1944_2909 321
582 3300042146 Ga0450907_000322 Ga0450907_000322_5232_6197 321
583 3300042146 Ga0450907_001362 Ga0450907_001362_119_1084 321
584 3300042146 Ga0450907_014591 Ga0450907_014591_270_1235 321
585 3300042184 Ga0450908_001252 Ga0450908_001252_1830_2795 321
586 3300042185 Ga0450909_001520 Ga0450909_001520_1269_2234 321
587 3300042435 Ga0439434_0000151 Ga0439434_0000151_5404_6369 321
588 3300042435 Ga0439434_0016456 Ga0439434_0016456_254_1219 321
589 3300042461 Ga0439460_0000441 Ga0439460_0000441_367_1332 321
590 3300042461 Ga0439460_0015363 Ga0439460_0015363_612_1577 321
591 3300046452 Ga0495617_001375 Ga0495617_001375_9478_10443 321
592 3300046452 Ga0495617_017658 Ga0495617_017658_73_1038 321
593 3300046452 Ga0495617_028103 Ga0495617_028103_581_1546 321
594 3300046453 Ga0495627_000102 Ga0495627_000102_76538_77590 321
595 3300046453 Ga0495627_000333 Ga0495627_000333_10209_11174 321
596 3300046453 Ga0495627_011045 Ga0495627_011045_311_1276 321
597 3300046457 Ga0495590_0048576 Ga0495590_0048576_321_1286 321
598 3300046458 Ga0495591_000105 Ga0495591_000105_37857_38822 321
599 3300046458 Ga0495591_000463 Ga0495591_000463_26915_27880 321
600 3300046458 Ga0495591_001494 Ga0495591_001494_9347_10312 321
601 3300046458 Ga0495591_007001 Ga0495591_007001_2357_3337 321
602 3300046458 Ga0495591_031369 Ga0495591_031369_55_1035 321
603 3300046458 Ga0495591_044177 Ga0495591_044177_181_1146 321
604 3300046460 Ga0495638_0020892 Ga0495638_0020892_1544_2524 321
605 3300046460 Ga0495638_0046756 Ga0495638_0046756_160_1125 321
606 3300046463 Ga0495653_0004797 Ga0495653_0004797_3680_4645 321
607 3300046463 Ga0495653_0034075 Ga0495653_0034075_1379_2344 321
608 3300046471 Ga0495650_0009035 Ga0495650_0009035_4653_5618 321
609 3300046471 Ga0495650_0034108 Ga0495650_0034108_921_1886 321
610 3300046471 Ga0495650_0055864 Ga0495650_0055864_64_1029 321
611 3300046473 Ga0495582_0003854 Ga0495582_0003854_1300_2265 321
612 3300046474 Ga0495605_0000255 Ga0495605_0000255_56568_57533 321
613 3300046474 Ga0495605_0000620 Ga0495605_0000620_22086_23051 321
614 3300046474 Ga0495605_0000714 Ga0495605_0000714_18082_19047 321
615 3300046474 Ga0495605_0002506 Ga0495605_0002506_6492_7457 321
616 3300046474 Ga0495605_0002791 Ga0495605_0002791_5188_6153 321
617 3300046474 Ga0495605_0044799 Ga0495605_0044799_1054_2019 321
618 3300046474 Ga0495605_0114829 Ga0495605_0114829_29_994 321
619 3300046475 Ga0495639_0024724 Ga0495639_0024724_1348_2313 321
620 3300046491 Ga0495584_0001930 Ga0495584_0001930_1548_2528 321
621 3300046491 Ga0495584_0010587 Ga0495584_0010587_2285_3250 321
622 3300046491 Ga0495584_0035444 Ga0495584_0035444_61_1026 321
623 3300046492 Ga0495585_0002921 Ga0495585_0002921_1549_2514 321
624 3300046492 Ga0495585_0004927 Ga0495585_0004927_96_1061 321
625 3300046492 Ga0495585_0005380 Ga0495585_0005380_2484_3449 321
626 3300046492 Ga0495585_0014826 Ga0495585_0014826_3540_4505 321
627 3300046499 Ga0495594_0004681 Ga0495594_0004681_381_1346 321
628 3300046500 Ga0495596_0005753 Ga0495596_0005753_4751_5716 321
629 3300046501 Ga0495607_0001049 Ga0495607_0001049_20615_21580 321
630 3300046501 Ga0495607_0001370 Ga0495607_0001370_3790_4758 321
631 3300046501 Ga0495607_0003022 Ga0495607_0003022_5933_6898 321
632 3300046501 Ga0495607_0003939 Ga0495607_0003939_2825_3790 321
633 3300046501 Ga0495607_0005722 Ga0495607_0005722_5082_6047 321
634 3300046501 Ga0495607_0006981 Ga0495607_0006981_5252_6217 321
635 3300046501 Ga0495607_0007583 Ga0495607_0007583_6153_7118 321
636 3300046501 Ga0495607_0014785 Ga0495607_0014785_2525_3490 321
637 3300046501 Ga0495607_0027621 Ga0495607_0027621_1439_2407 321
638 3300046501 Ga0495607_0110750 Ga0495607_0110750_474_1439 321
639 3300046506 Ga0495583_0000015 Ga0495583_0000015_28683_29648 321
640 3300046506 Ga0495583_0003590 Ga0495583_0003590_3478_4521 321
641 3300046506 Ga0495583_0005217 Ga0495583_0005217_7522_8502 321
642 3300046506 Ga0495583_0007640 Ga0495583_0007640_5263_6228 321
643 3300046507 Ga0495606_0000177 Ga0495606_0000177_60494_61459 321
644 3300046507 Ga0495606_0001016 Ga0495606_0001016_36343_37308 321
645 3300046507 Ga0495606_0021409 Ga0495606_0021409_1213_2178 321
646 3300046512 Ga0495610_0015192 Ga0495610_0015192_335_1300 321
647 3300046512 Ga0495610_0042477 Ga0495610_0042477_1209_2189 321
648 3300046512 Ga0495610_0059364 Ga0495610_0059364_128_1108 321
649 3300046512 Ga0495610_0071757 Ga0495610_0071757_29_994 321
650 3300046512 Ga0495610_0117880 Ga0495610_0117880_85_1050 321
651 3300046513 Ga0495616_0007584 Ga0495616_0007584_5235_6200 321
652 3300046513 Ga0495616_0018417 Ga0495616_0018417_356_1321 321
653 3300046513 Ga0495616_0023813 Ga0495616_0023813_98_1078 321
654 3300046513 Ga0495616_0035147 Ga0495616_0035147_1450_2415 321
655 3300046515 Ga0495620_0000039 Ga0495620_0000039_20475_21440 321
656 3300046515 Ga0495620_0000301 Ga0495620_0000301_4566_5531 321
657 3300046515 Ga0495620_0002335 Ga0495620_0002335_1289_2254 321
658 3300046515 Ga0495620_0034967 Ga0495620_0034967_928_1893 321
659 3300046518 Ga0495631_0001929 Ga0495631_0001929_459_1424 321
660 3300046518 Ga0495631_0002026 Ga0495631_0002026_1471_2436 321
661 3300046519 Ga0495632_0001966 Ga0495632_0001966_1588_2553 321
662 3300046519 Ga0495632_0003351 Ga0495632_0003351_8862_9827 321
663 3300046519 Ga0495632_0037285 Ga0495632_0037285_875_1840 321
664 3300046519 Ga0495632_0057031 Ga0495632_0057031_145_1110 321
665 3300046519 Ga0495632_0059774 Ga0495632_0059774_504_1469 321
666 3300046520 Ga0495637_0000393 Ga0495637_0000393_4651_5616 321
667 3300046520 Ga0495637_0002084 Ga0495637_0002084_2027_2992 321
668 3300046520 Ga0495637_0003136 Ga0495637_0003136_131_1096 321
669 3300046520 Ga0495637_0003862 Ga0495637_0003862_1685_2653 321
670 3300046520 Ga0495637_0005606 Ga0495637_0005606_4566_5531 321
671 3300046520 Ga0495637_0014306 Ga0495637_0014306_1662_2627 321
672 3300046520 Ga0495637_0015516 Ga0495637_0015516_1347_2312 321
673 3300046520 Ga0495637_0024098 Ga0495637_0024098_1339_2304 321
674 3300046520 Ga0495637_0047894 Ga0495637_0047894_206_1171 321
675 3300046520 Ga0495637_0054723 Ga0495637_0054723_480_1445 321
676 3300046522 Ga0495643_0001673 Ga0495643_0001673_2463_3428 321
677 3300046522 Ga0495643_0002515 Ga0495643_0002515_13325_14290 321
678 3300046522 Ga0495643_0009672 Ga0495643_0009672_1540_2505 321
679 3300046522 Ga0495643_0015413 Ga0495643_0015413_3403_4368 321
680 3300046522 Ga0495643_0020423 Ga0495643_0020423_2120_3085 321
681 3300046522 Ga0495643_0042615 Ga0495643_0042615_1327_2292 321
682 3300046523 Ga0495644_0000975 Ga0495644_0000975_9379_10344 321
683 3300046524 Ga0495648_0005114 Ga0495648_0005114_6572_7537 321
684 3300046524 Ga0495648_0028082 Ga0495648_0028082_1617_2582 321
685 3300046524 Ga0495648_0041508 Ga0495648_0041508_1564_2529 321
686 3300046524 Ga0495648_0091576 Ga0495648_0091576_101_1081 321
687 3300046526 Ga0495666_0006845 Ga0495666_0006845_2654_3619 321
688 3300046528 Ga0495642_0000237 Ga0495642_0000237_1579_2544 321
689 3300046530 Ga0495654_0002801 Ga0495654_0002801_9543_10508 321
690 3300046530 Ga0495654_0007639 Ga0495654_0007639_4725_5690 321
691 3300046530 Ga0495654_0008960 Ga0495654_0008960_863_1828 321
692 3300046530 Ga0495654_0016049 Ga0495654_0016049_151_1116 321
693 3300046530 Ga0495654_0019909 Ga0495654_0019909_795_1775 321
694 3300046530 Ga0495654_0020989 Ga0495654_0020989_101_1081 321
695 3300046530 Ga0495654_0045704 Ga0495654_0045704_344_1309 321
696 3300046536 Ga0495587_0029373 Ga0495587_0029373_1032_1997 321
697 3300046536 Ga0495587_0133165 Ga0495587_0133165_197_1162 321
698 3300046538 Ga0495609_0000192 Ga0495609_0000192_55209_56174 321
699 3300046538 Ga0495609_0000773 Ga0495609_0000773_4313_5278 321
700 3300046542 Ga0495597_0001180 Ga0495597_0001180_4320_5285 321
701 3300046542 Ga0495597_0008969 Ga0495597_0008969_1510_2475 321
702 3300046542 Ga0495597_0033827 Ga0495597_0033827_98_1063 321
703 3300046542 Ga0495597_0060014 Ga0495597_0060014_364_1329 321
704 3300046558 Ga0495633_0000373 Ga0495633_0000373_41538_42503 321
705 3300046558 Ga0495633_0009466 Ga0495633_0009466_2891_3856 321
706 3300046615 Ga0495656_0024359 Ga0495656_0024359_799_1764 321
707 3300046616 Ga0495668_0002528 Ga0495668_0002528_9280_10245 321
708 3300046616 Ga0495668_0158061 Ga0495668_0158061_86_1051 321
709 3300046648 Ga0495611_0000749 Ga0495611_0000749_9465_10430 321
710 3300046648 Ga0495611_0002123 Ga0495611_0002123_5052_6017 321
711 3300046648 Ga0495611_0002529 Ga0495611_0002529_6880_7845 321
712 3300046660 Ga0495625_0044451 Ga0495625_0044451_209_1174 321
713 3300046660 Ga0495625_0054046 Ga0495625_0054046_1547_2512 321
714 3300046663 Ga0495635_0011428 Ga0495635_0011428_3887_4852 321
715 3300046664 Ga0495659_0001738 Ga0495659_0001738_181_1146 321
716 3300046665 Ga0495661_0000097 Ga0495661_0000097_101533_102498 321
717 3300046665 Ga0495661_0016216 Ga0495661_0016216_3117_4082 321
718 3300046665 Ga0495661_0022508 Ga0495661_0022508_2341_3306 321
719 3300046680 Ga0495646_0003313 Ga0495646_0003313_7736_8701 321
720 3300046684 Ga0495669_0019373 Ga0495669_0019373_730_1695 321
721 3300046691 Ga0495670_0001123 Ga0495670_0001123_8258_9223 321
722 3300046691 Ga0495670_0007368 Ga0495670_0007368_309_1274 321
723 3300046691 Ga0495670_0028928 Ga0495670_0028928_539_1504 321
724 3300046691 Ga0495670_0046550 Ga0495670_0046550_1085_2050 321
725 3300046692 Ga0495671_0000805 Ga0495671_0000805_1519_2484 321
726 3300046692 Ga0495671_0002987 Ga0495671_0002987_9443_10408 321
727 3300046692 Ga0495671_0006866 Ga0495671_0006866_2515_3480 321
728 3300046692 Ga0495671_0009698 Ga0495671_0009698_73_1038 321
729 3300046692 Ga0495671_0016307 Ga0495671_0016307_859_1824 321
730 3300046692 Ga0495671_0032565 Ga0495671_0032565_669_1634 321
731 3300046692 Ga0495671_0080538 Ga0495671_0080538_318_1298 321
732 3300046694 Ga0495649_0000531 Ga0495649_0000531_25426_26391 321
733 3300046694 Ga0495649_0001245 Ga0495649_0001245_16830_17798 321
734 3300046694 Ga0495649_0003048 Ga0495649_0003048_9396_10376 321
735 3300046694 Ga0495649_0088630 Ga0495649_0088630_29_994 321
736 3300046794 Ga0495589_0002695 Ga0495589_0002695_7410_8375 321
737 3300046794 Ga0495589_0013142 Ga0495589_0013142_187_1152 321
738 3300046794 Ga0495589_0013949 Ga0495589_0013949_294_1259 321
739 3300046794 Ga0495589_0019206 Ga0495589_0019206_1565_2530 321
740 3300046809 Ga0495600_0021373 Ga0495600_0021373_333_1298 321
741 3300046810 Ga0495660_0000492 Ga0495660_0000492_5140_6105 321
742 3300046810 Ga0495660_0001739 Ga0495660_0001739_13041_14006 321
743 3300046810 Ga0495660_0028240 Ga0495660_0028240_1571_2536 321
744 3300046810 Ga0495660_0051239 Ga0495660_0051239_385_1350 321
745 3300046810 Ga0495660_0094337 Ga0495660_0094337_72_1052 321
746 3300047315 Ga0495581_0054175 Ga0495581_0054175_972_1937 321
747 3300047317 Ga0495604_0026614 Ga0495604_0026614_416_1381 321
748 3300047318 Ga0495636_0002667 Ga0495636_0002667_5697_6662 321
749 3300047320 Ga0495672_0004415 Ga0495672_0004415_5288_6253 321
750 3300047320 Ga0495672_0005033 Ga0495672_0005033_158_1138 321
751 3300047320 Ga0495672_0027434 Ga0495672_0027434_1403_2368 321
752 3300047320 Ga0495672_0033562 Ga0495672_0033562_499_1464 321
753 3300047322 Ga0495680_0016523 Ga0495680_0016523_2718_3683 321
754 3300047322 Ga0495680_0048546 Ga0495680_0048546_2311_3276 321
755 3300047323 Ga0495683_0000106 Ga0495683_0000106_56526_57491 321
756 3300047323 Ga0495683_0000207 Ga0495683_0000207_50168_51136 321
757 3300047323 Ga0495683_0002916 Ga0495683_0002916_1809_2774 321
758 3300047323 Ga0495683_0017999 Ga0495683_0017999_968_1933 321
759 3300047323 Ga0495683_0020899 Ga0495683_0020899_963_1928 321
760 3300047443 Ga0495687_005908 Ga0495687_005908_6163_7128 321
761 3300047443 Ga0495687_012488 Ga0495687_012488_1528_2493 321
762 3300047444 Ga0495675_0004892 Ga0495675_0004892_3913_4878 321
763 3300047445 Ga0495677_0009101 Ga0495677_0009101_1679_2644 321
764 3300047446 Ga0495679_000274 Ga0495679_000274_15900_16865 321
765 3300047446 Ga0495679_000371 Ga0495679_000371_28944_29909 321
766 3300047469 Ga0495673_0000222 Ga0495673_0000222_5532_6497 321
767 3300047469 Ga0495673_0002875 Ga0495673_0002875_1458_2423 321
768 3300047469 Ga0495673_0012077 Ga0495673_0012077_2125_3090 321
769 3300047469 Ga0495673_0020102 Ga0495673_0020102_129_1109 321
770 3300047469 Ga0495673_0024472 Ga0495673_0024472_1856_2821 321
771 3300047469 Ga0495673_0024620 Ga0495673_0024620_918_1883 321
772 3300047469 Ga0495673_0031313 Ga0495673_0031313_887_1852 321
773 3300047469 Ga0495673_0059705 Ga0495673_0059705_657_1622 321
774 3300047469 Ga0495673_0089911 Ga0495673_0089911_151_1116 321
775 3300047470 Ga0495681_0005234 Ga0495681_0005234_7320_8285 321
776 3300047470 Ga0495681_0007728 Ga0495681_0007728_782_1747 321
777 3300047470 Ga0495681_0007812 Ga0495681_0007812_166_1131 321
778 3300047470 Ga0495681_0045081 Ga0495681_0045081_379_1359 321
779 3300047673 Ga0495593_0009346 Ga0495593_0009346_117_1082 321
780 3300048091 Ga0495626_0000068 Ga0495626_0000068_120589_121554 321
781 3300048091 Ga0495626_0000678 Ga0495626_0000678_26960_27925 321
782 3300048091 Ga0495626_0020358 Ga0495626_0020358_74_1054 321
783 3300048905 Ga0496102_0005434 Ga0496102_0005434_9763_10728 321
784 3300048913 Ga0496110_0091238 Ga0496110_0091238_411_1376 321
785 3300048917 Ga0496114_0007131 Ga0496114_0007131_4712_5677 321
786 3300048917 Ga0496114_0057734 Ga0496114_0057734_789_1754 321
787 3300048919 Ga0496116_0000670 Ga0496116_0000670_6104_7069 321
788 3300048919 Ga0496116_0043932 Ga0496116_0043932_371_1336 321
789 3300048920 Ga0496117_0002093 Ga0496117_0002093_6105_7070 321
790 3300048920 Ga0496117_0003858 Ga0496117_0003858_2600_3565 321
791 3300048920 Ga0496117_0006799 Ga0496117_0006799_7900_8865 321
792 3300048920 Ga0496117_0013238 Ga0496117_0013238_3153_4118 321
793 3300048920 Ga0496117_0061670 Ga0496117_0061670_215_1195 321
794 3300048920 Ga0496117_0118294 Ga0496117_0118294_286_1251 321
795 3300048921 Ga0496118_0001842 Ga0496118_0001842_1491_2456 321
796 3300048921 Ga0496118_0010904 Ga0496118_0010904_6562_7527 321
797 3300048921 Ga0496118_0030939 Ga0496118_0030939_2231_3211 321
798 3300048921 Ga0496118_0041256 Ga0496118_0041256_2598_3563 321
799 3300048922 Ga0496119_0000229 Ga0496119_0000229_63693_64658 321
800 3300048923 Ga0496120_0001476 Ga0496120_0001476_9981_10946 321
801 3300048924 Ga0496121_0001246 Ga0496121_0001246_37665_38630 321
802 3300048924 Ga0496121_0002966 Ga0496121_0002966_20049_21014 321
803 3300048924 Ga0496121_0031786 Ga0496121_0031786_251_1216 321
804 3300048924 Ga0496121_0098579 Ga0496121_0098579_34_999 321
805 3300048925 Ga0496122_0000590 Ga0496122_0000590_60656_61621 321
806 3300048925 Ga0496122_0001707 Ga0496122_0001707_19651_20616 321
807 3300048925 Ga0496122_0009159 Ga0496122_0009159_558_1523 321
808 3300048925 Ga0496122_0017946 Ga0496122_0017946_5464_6429 321
809 3300048925 Ga0496122_0040719 Ga0496122_0040719_1451_2416 321
810 3300048926 Ga0496123_0000088 Ga0496123_0000088_88803_89768 321
811 3300048926 Ga0496123_0000607 Ga0496123_0000607_20904_21869 321
812 3300048926 Ga0496123_0012377 Ga0496123_0012377_1480_2445 321
813 3300048926 Ga0496123_0018999 Ga0496123_0018999_1608_2573 321
814 3300048926 Ga0496123_0062843 Ga0496123_0062843_1325_2290 321
815 3300048927 Ga0496124_0000073 Ga0496124_0000073_20721_21686 321
816 3300048927 Ga0496124_0001393 Ga0496124_0001393_10115_11080 321
817 3300048927 Ga0496124_0003431 Ga0496124_0003431_3552_4517 321
818 3300048927 Ga0496124_0005436 Ga0496124_0005436_3722_4687 321
819 3300048927 Ga0496124_0005945 Ga0496124_0005945_9376_10341 321
820 3300048927 Ga0496124_0033385 Ga0496124_0033385_236_1201 321
821 3300048927 Ga0496124_0062468 Ga0496124_0062468_1145_2125 321
822 3300048928 Ga0496125_0001017 Ga0496125_0001017_14893_15858 321
823 3300048928 Ga0496125_0041485 Ga0496125_0041485_1276_2241 321
824 3300048928 Ga0496125_0060372 Ga0496125_0060372_1590_2555 321
825 3300048929 Ga0496126_0109965 Ga0496126_0109965_1409_2374 321
826 3300048929 Ga0496126_0267834 Ga0496126_0267834_104_1069 321
827 3300049459 Ga0495678_000404 Ga0495678_000404_19389_20354 321
828 3300049459 Ga0495678_005047 Ga0495678_005047_131_1096 321
829 3300049459 Ga0495678_010232 Ga0495678_010232_828_1793 321
830 3300049459 Ga0495678_022316 Ga0495678_022316_1034_1999 321
831 3300049459 Ga0495678_030790 Ga0495678_030790_1097_2077 321
832 3300049460 Ga0495682_0000681 Ga0495682_0000681_4182_5159 321
833 3300049571 Ga0501034_0000101 Ga0501034_0000101_76704_77669 321
834 3300053135 Ga0500659_0002113 Ga0500659_0002113_8685_9650 321
835 2162886007 SwRhRL2b_contig_1108591 SwRhRL2b_0799.00000790 322
836 3300002737 JGI25162J39368_1000474 JGI25162J39368_10004747 322
837 3300002771 JGI25163J39215_1001488 JGI25163J39215_10014882 322
838 3300002772 JGI25164J39214_1000674 JGI25164J39214_10006747 322
839 3300003214 JGI25165J46597_1000600 JGI25165J46597_10006007 322
840 3300003751 Ga0055538_1000032 Ga0055538_1000032134 322
841 3300003752 Ga0055539_1000043 Ga0055539_1000043134 322
842 3300003756 Ga0055533_1000052 Ga0055533_1000052134 322
843 3300003758 Ga0055532_1000047 Ga0055532_1000047114 322
844 3300003759 Ga0055525_1000062 Ga0055525_1000062134 322
845 3300003781 Ga0055536_1001726 Ga0055536_10017267 322
846 3300003791 Ga0055530_10002392 Ga0055530_100023926 322
847 3300003792 Ga0055540_1001654 Ga0055540_10016546 322
848 3300003841 Ga0055541_1000030 Ga0055541_1000030134 322
849 3300005288 Ga0065714_10003312 Ga0065714_100033128 322
850 3300005288 Ga0065714_10098794 Ga0065714_100987942 322
851 3300005289 Ga0065704_10012375 Ga0065704_100123752 322
852 3300005290 Ga0065712_10071153 Ga0065712_100711531 322
853 3300005331 Ga0070670_100002144 Ga0070670_10000214412 322
854 3300005344 Ga0070661_100000126 Ga0070661_1000001266 322
855 3300005353 Ga0070669_100000481 Ga0070669_1000004817 322
856 3300005457 Ga0070662_100000101 Ga0070662_10000010142 322
857 3300005539 Ga0068853_100000187 Ga0068853_10000018712 322
858 3300005564 Ga0070664_100000491 Ga0070664_10000049126 322
859 3300005834 Ga0068851_10000007 Ga0068851_1000000736 322
860 3300009011 Ga0105251_10000828 Ga0105251_100008285 322
861 3300009011 Ga0105251_10007236 Ga0105251_100072363 322
862 3300009036 Ga0105244_10004785 Ga0105244_100047854 322
863 3300009036 Ga0105244_10008881 Ga0105244_100088817 322
864 3300009092 Ga0105250_10010893 Ga0105250_100108933 322
865 3300009092 Ga0105250_10013949 Ga0105250_100139492 322
866 3300009092 Ga0105250_10043742 Ga0105250_100437422 322
867 3300009148 Ga0105243_10030328 Ga0105243_100303282 322
868 3300009176 Ga0105242_10001499 Ga0105242_1000149915 322
869 3300009545 Ga0105237_10001509 Ga0105237_1000150925 322
870 3300011119 Ga0105246_10001749 Ga0105246_100017497 322
871 3300013102 Ga0157371_10040665 Ga0157371_100406652 322
872 3300013104 Ga0157370_10218524 Ga0157370_102185242 322
873 3300013105 Ga0157369_10020339 Ga0157369_100203397 322
874 3300013105 Ga0157369_10028400 Ga0157369_100284006 322
875 3300013308 Ga0157375_10024520 Ga0157375_100245201 322
876 3300014497 Ga0182008_10032172 Ga0182008_100321723 322
877 3300015261 Ga0182006_1001907 Ga0182006_10019077 322
878 3300025206 Ga0209435_100821 Ga0209435_1008215 322
879 3300025207 Ga0209760_100027 Ga0209760_100027110 322
880 3300025224 Ga0209784_100007 Ga0209784_100007382 322
881 3300025225 Ga0209566_100009 Ga0209566_100009382 322
882 3300025226 Ga0209674_100021 Ga0209674_100021382 322
883 3300025229 Ga0209147_100009 Ga0209147_100009382 322
884 3300025230 Ga0209563_100018 Ga0209563_100018382 322
885 3300025231 Ga0207427_100006 Ga0207427_100006442 322
886 3300025233 Ga0209437_100013 Ga0209437_100013442 322
887 3300025233 Ga0209437_112834 Ga0209437_1128342 322
888 3300025242 Ga0209258_100169 Ga0209258_100169101 322
889 3300025246 Ga0209646_1000184 Ga0209646_100018417 322
890 3300025253 Ga0209677_100012 Ga0209677_100012382 322
891 3300025261 Ga0209233_1000022 Ga0209233_1000022442 322
892 3300025292 Ga0209676_1000030 Ga0209676_1000030267 322
893 3300025298 Ga0209050_1000647 Ga0209050_100064724 322
894 3300025303 Ga0209051_1000721 Ga0209051_10007217 322
895 3300025321 Ga0207656_10000006 Ga0207656_1000000666 322
896 3300025711 Ga0207696_1000357 Ga0207696_100035739 322
897 3300025711 Ga0207696_1019672 Ga0207696_10196722 322
898 3300025711 Ga0207696_1039493 Ga0207696_10394932 322
899 3300025728 Ga0207655_1000388 Ga0207655_100038843 322
900 3300025728 Ga0207655_1007643 Ga0207655_10076433 322
901 3300025728 Ga0207655_1066298 Ga0207655_10662982 322
902 3300025735 Ga0207713_1000815 Ga0207713_10008157 322
903 3300025735 Ga0207713_1006691 Ga0207713_10066917 322
904 3300025735 Ga0207713_1006845 Ga0207713_10068457 322
905 3300025914 Ga0207671_10000131 Ga0207671_1000013139 322
906 3300025920 Ga0207649_10000012 Ga0207649_10000012104 322
907 3300025923 Ga0207681_10000099 Ga0207681_1000009938 322
908 3300025925 Ga0207650_10000518 Ga0207650_100005187 322
909 3300025925 Ga0207650_10000571 Ga0207650_1000057124 322
910 3300025933 Ga0207706_10000580 Ga0207706_1000058035 322
911 3300025934 Ga0207686_10000319 Ga0207686_1000031927 322
912 3300025935 Ga0207709_10017354 Ga0207709_100173543 322
913 3300025945 Ga0207679_10000015 Ga0207679_10000015104 322
914 3300025981 Ga0207640_10011005 Ga0207640_100110056 322
915 3300026041 Ga0207639_10000775 Ga0207639_100007758 322
916 3300041407 Ga0439447_005893 Ga0439447_005893_2619_3599 322
917 3300041411 Ga0439466_0000460 Ga0439466_0000460_4515_5519 322
918 3300041411 Ga0439466_0002029 Ga0439466_0002029_534_1514 322
919 3300042006 Ga0439432_000797 Ga0439432_000797_6539_7507 322
920 3300042006 Ga0439432_022369 Ga0439432_022369_184_1164 322
921 3300042009 Ga0439451_005530 Ga0439451_005530_434_1414 322
922 3300042016 Ga0439463_000618 Ga0439463_000618_4440_5444 322
923 3300046491 Ga0495584_0010251 Ga0495584_0010251_1536_2516 322
924 3300046519 Ga0495632_0003817 Ga0495632_0003817_1528_2508 322
925 3300046538 Ga0495609_0006042 Ga0495609_0006042_3693_4673 322
926 3300046665 Ga0495661_0074765 Ga0495661_0074765_668_1651 322
927 3300046694 Ga0495649_0003710 Ga0495649_0003710_1530_2510 322
928 3300047446 Ga0495679_007752 Ga0495679_007752_2802_3770 322
929 3300048927 Ga0496124_0120201 Ga0496124_0120201_78_1046 322
930 3300048928 Ga0496125_0014635 Ga0496125_0014635_6635_7603 322
931 3300048928 Ga0496125_0178965 Ga0496125_0178965_294_1262 322
932 3300049459 Ga0495678_015508 Ga0495678_015508_189_1169 322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09084

NMT1

NMT1/THI5 like

70

271

0.86

PF04069

OpuAC

Substrate binding domain of ABC-type glycine betaine transport system

46

277

0.85

PF12974

Phosphonate-bd

ABC transporter, phosphonate, periplasmic substrate-binding protein

63

225

0.78

PF13379

NMT1_2

NMT1-like family

40

277

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2x26-assembly2.cif.gz_B crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.9298 30 312
2x26-assembly1.cif.gz_A crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.9222 30 315
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.9222 28 312
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.907 28 312
2x26-assembly2.cif.gz_B crystal structure of the periplasmic aliphatic sulphonate binding protein ssua from escherichia coli 0.9024 30 312
ID Description Score Start End Superfamily
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.972 112 208 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9343 112 208 3.40.190.10
3uifA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8979 115 205 3.40.190.10
3e4rA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8959 30 315 3.40.190.10
2x26A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8725 30 312 3.40.190.10
ID Description Score Start End GO Terms
AF-X1F4P9-F1-model_v4 SsuA/THI5-like domain-containing protein 0.972 112 206
AF-A0A838R042-F1-model_v4 Aliphatic sulfonate ABC transporter substrate-binding protein 0.9673 29 317 GO:0016020
GO:0042597
GO:0042626
AF-A0A6B3TU84-F1-model_v4 ABC transporter substrate-binding protein 0.9664 94 239
AF-A0A653S803-F1-model_v4 ABC transporter substrate-binding protein 0.9648 82 312
AF-A0A3S1ZSK7-F1-model_v4 Transporter substrate-binding domain-containing protein 0.9619 115 297

Feature Viewer

pLDDT pTM Quality
89.52 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map