F486069
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 932 | 330 | 932 | 68 |
Family's Representative Sequence
| Representative Sequence | 3300013105|Ga0157369_11861737|Ga0157369_118617372 |
| Length | 79 |
| Sequence | MTTAKTNTKTRAKAAKAAGPAGKLHLKYVRSVICTPVKHKLVVKGLGFTRLNQIIERPDTPAIRGMVAKVPHLVEIVET |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 8 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 9 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 80 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 98 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 99 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 100 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 117 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 137 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 138 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 206 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 207 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300031043 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 215 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 216 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 217 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 218 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 219 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 220 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 221 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 222 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 223 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 224 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 225 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 226 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 227 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 228 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 229 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 230 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 231 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 232 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 234 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 235 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 236 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 238 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 239 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 240 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 242 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 243 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 247 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 248 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 251 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 252 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 253 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 256 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 257 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 258 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 259 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 260 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 261 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 262 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 263 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 264 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 265 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 266 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 295 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 296 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 297 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 298 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 299 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 300 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 303 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 304 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 305 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 306 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 307 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 308 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 309 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 310 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 319 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 321 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.14 |
| Metatranscriptomes | 0.86 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.04 |
| Rhizosphere | 93.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1033502 | 3300001915 | Unclassified | 764 |
| 2 | JGI24752J21851_1000484 | 3300001976 | Bacteria | 5323 |
| 3 | JGI24740J21852_10091596 | 3300001979 | Bacteria | 783 |
| 4 | JGI24737J22298_10025233 | 3300001990 | Bacteria | 1880 |
| 5 | JGI24743J22301_10003249 | 3300001991 | Bacteria | 2556 |
| 6 | JGI24738J21930_10047296 | 3300002075 | Bacteria | 875 |
| 7 | JGI24033J26618_1039806 | 3300002155 | Bacteria | 653 |
| 8 | JGI24034J26672_10008468 | 3300002239 | Bacteria | 1504 |
| 9 | JGI24751J29686_10001356 | 3300002459 | Bacteria | 5148 |
| 10 | Ga0065704_10534439 | 3300005289 | Bacteria | 645 |
| 11 | Ga0065715_10104722 | 3300005293 | Bacteria | 2940 |
| 12 | Ga0065707_11036024 | 3300005295 | Unclassified | 530 |
| 13 | Ga0070658_10031905 | 3300005327 | Bacteria | 4233 |
| 14 | Ga0070658_10036784 | 3300005327 | Bacteria | 3946 |
| 15 | Ga0070658_10050557 | 3300005327 | Bacteria | 3369 |
| 16 | Ga0070658_10077132 | 3300005327 | Bacteria | 2733 |
| 17 | Ga0070676_10004776 | 3300005328 | Bacteria | 7163 |
| 18 | Ga0070683_100011087 | 3300005329 | Bacteria | 7771 |
| 19 | Ga0070683_100051474 | 3300005329 | Bacteria | 3813 |
| 20 | Ga0070683_100322780 | 3300005329 | Bacteria | 1469 |
| 21 | Ga0070690_100000550 | 3300005330 | Bacteria | 18744 |
| 22 | Ga0070690_100122080 | 3300005330 | Bacteria | 1749 |
| 23 | Ga0070690_100174565 | 3300005330 | Bacteria | 1481 |
| 24 | Ga0070690_100341478 | 3300005330 | Bacteria | 1084 |
| 25 | Ga0070670_100015559 | 3300005331 | Bacteria | 6534 |
| 26 | Ga0070670_100033183 | 3300005331 | Bacteria | 4447 |
| 27 | Ga0070670_100307148 | 3300005331 | Bacteria | 1388 |
| 28 | Ga0068869_100001846 | 3300005334 | Bacteria | 12731 |
| 29 | Ga0068869_100014372 | 3300005334 | Bacteria | 5286 |
| 30 | Ga0068869_100074090 | 3300005334 | Bacteria | 2526 |
| 31 | Ga0068869_100651889 | 3300005334 | Bacteria | 894 |
| 32 | Ga0068869_100689580 | 3300005334 | Unclassified | 870 |
| 33 | Ga0070666_10010107 | 3300005335 | Bacteria | 5893 |
| 34 | Ga0070666_10010510 | 3300005335 | Bacteria | 5791 |
| 35 | Ga0070666_10410582 | 3300005335 | Unclassified | 974 |
| 36 | Ga0070680_100014163 | 3300005336 | Bacteria | 6229 |
| 37 | Ga0070680_100061979 | 3300005336 | Bacteria | 3062 |
| 38 | Ga0070680_100830505 | 3300005336 | Bacteria | 796 |
| 39 | Ga0070680_101581496 | 3300005336 | Bacteria | 568 |
| 40 | Ga0070682_100141510 | 3300005337 | Bacteria | 1640 |
| 41 | Ga0070682_100196586 | 3300005337 | Bacteria | 1420 |
| 42 | Ga0070682_100392440 | 3300005337 | Bacteria | 1047 |
| 43 | Ga0070682_100590193 | 3300005337 | Bacteria | 875 |
| 44 | Ga0068868_100002791 | 3300005338 | Bacteria | 12099 |
| 45 | Ga0068868_100011852 | 3300005338 | Bacteria | 6357 |
| 46 | Ga0068868_100022874 | 3300005338 | Bacteria | 4724 |
| 47 | Ga0070660_100002901 | 3300005339 | Bacteria | 11803 |
| 48 | Ga0070660_100056691 | 3300005339 | Bacteria | 3032 |
| 49 | Ga0070660_100139461 | 3300005339 | Bacteria | 1944 |
| 50 | Ga0070689_100068823 | 3300005340 | Bacteria | 2761 |
| 51 | Ga0070689_100172754 | 3300005340 | Bacteria | 1752 |
| 52 | Ga0070689_100446957 | 3300005340 | Bacteria | 1099 |
| 53 | Ga0070687_100000493 | 3300005343 | Bacteria | 13161 |
| 54 | Ga0070687_100497232 | 3300005343 | Bacteria | 820 |
| 55 | Ga0070687_101109842 | 3300005343 | Unclassified | 579 |
| 56 | Ga0070661_100012073 | 3300005344 | Bacteria | 6037 |
| 57 | Ga0070661_100018897 | 3300005344 | Bacteria | 4907 |
| 58 | Ga0070661_100136525 | 3300005344 | Bacteria | 1846 |
| 59 | Ga0070661_100913112 | 3300005344 | Unclassified | 725 |
| 60 | Ga0070692_10910340 | 3300005345 | Bacteria | 609 |
| 61 | Ga0070668_100014649 | 3300005347 | Bacteria | 5860 |
| 62 | Ga0070668_100053030 | 3300005347 | Bacteria | 3127 |
| 63 | Ga0070669_100007500 | 3300005353 | Bacteria | 7813 |
| 64 | Ga0070669_100103748 | 3300005353 | Bacteria | 2149 |
| 65 | Ga0070675_100004817 | 3300005354 | Bacteria | 10298 |
| 66 | Ga0070675_100146387 | 3300005354 | Bacteria | 2023 |
| 67 | Ga0070675_101583510 | 3300005354 | Bacteria | 604 |
| 68 | Ga0070671_100255078 | 3300005355 | Bacteria | 1490 |
| 69 | Ga0070671_100451132 | 3300005355 | Bacteria | 1103 |
| 70 | Ga0070674_100010705 | 3300005356 | Bacteria | 5557 |
| 71 | Ga0070674_100236991 | 3300005356 | Bacteria | 1426 |
| 72 | Ga0070673_100073104 | 3300005364 | Bacteria | 2759 |
| 73 | Ga0070673_100297904 | 3300005364 | Bacteria | 1419 |
| 74 | Ga0070673_100944465 | 3300005364 | Bacteria | 801 |
| 75 | Ga0070688_100031729 | 3300005365 | Bacteria | 3180 |
| 76 | Ga0070688_100207210 | 3300005365 | Bacteria | 1375 |
| 77 | Ga0070688_100781848 | 3300005365 | Unclassified | 745 |
| 78 | Ga0070659_100023459 | 3300005366 | Bacteria | 4721 |
| 79 | Ga0070659_100149849 | 3300005366 | Bacteria | 1902 |
| 80 | Ga0070659_100182952 | 3300005366 | Bacteria | 1720 |
| 81 | Ga0070667_100066877 | 3300005367 | Bacteria | 3054 |
| 82 | Ga0070667_100289930 | 3300005367 | Bacteria | 1471 |
| 83 | Ga0070667_101685996 | 3300005367 | Bacteria | 596 |
| 84 | Ga0070667_102264942 | 3300005367 | Bacteria | 512 |
| 85 | Ga0070709_10031545 | 3300005434 | Bacteria | 3188 |
| 86 | Ga0070709_10232135 | 3300005434 | Bacteria | 1321 |
| 87 | Ga0070709_10647352 | 3300005434 | Bacteria | 818 |
| 88 | Ga0070709_10722261 | 3300005434 | Bacteria | 777 |
| 89 | Ga0070709_11338413 | 3300005434 | Bacteria | 578 |
| 90 | Ga0070714_100000096 | 3300005435 | Bacteria | 74616 |
| 91 | Ga0070714_100010335 | 3300005435 | Bacteria | 7376 |
| 92 | Ga0070714_100432677 | 3300005435 | Bacteria | 1248 |
| 93 | Ga0070714_102361963 | 3300005435 | Bacteria | 517 |
| 94 | Ga0070714_102385542 | 3300005435 | Bacteria | 514 |
| 95 | Ga0070713_100015219 | 3300005436 | Bacteria | 5738 |
| 96 | Ga0070713_100030142 | 3300005436 | Bacteria | 4304 |
| 97 | Ga0070713_100058153 | 3300005436 | Bacteria | 3223 |
| 98 | Ga0070713_100260906 | 3300005436 | Bacteria | 1583 |
| 99 | Ga0070713_100667440 | 3300005436 | Bacteria | 991 |
| 100 | Ga0070713_101546400 | 3300005436 | Bacteria | 644 |
| 101 | Ga0070713_101994857 | 3300005436 | Unclassified | 563 |
| 102 | Ga0070710_10132132 | 3300005437 | Bacteria | 1523 |
| 103 | Ga0070710_10377437 | 3300005437 | Bacteria | 945 |
| 104 | Ga0070710_11387037 | 3300005437 | Bacteria | 525 |
| 105 | Ga0070701_10964868 | 3300005438 | Unclassified | 592 |
| 106 | Ga0070711_100000191 | 3300005439 | Bacteria | 32562 |
| 107 | Ga0070711_100094452 | 3300005439 | Bacteria | 2162 |
| 108 | Ga0070711_100420861 | 3300005439 | Bacteria | 1088 |
| 109 | Ga0070711_100646646 | 3300005439 | Bacteria | 886 |
| 110 | Ga0070711_101221628 | 3300005439 | Bacteria | 650 |
| 111 | Ga0070711_101287725 | 3300005439 | Bacteria | 634 |
| 112 | Ga0070711_101627094 | 3300005439 | Bacteria | 565 |
| 113 | Ga0070705_100132317 | 3300005440 | Bacteria | 1629 |
| 114 | Ga0070705_101746208 | 3300005440 | Bacteria | 527 |
| 115 | Ga0070700_100068348 | 3300005441 | Bacteria | 2259 |
| 116 | Ga0070700_100657562 | 3300005441 | Bacteria | 828 |
| 117 | Ga0070694_100577378 | 3300005444 | Unclassified | 903 |
| 118 | Ga0070694_100938564 | 3300005444 | Bacteria | 716 |
| 119 | Ga0070708_100003510 | 3300005445 | Bacteria | 12276 |
| 120 | Ga0070708_100015435 | 3300005445 | Bacteria | 6309 |
| 121 | Ga0070708_100069047 | 3300005445 | Bacteria | 3177 |
| 122 | Ga0070708_100555134 | 3300005445 | Bacteria | 1083 |
| 123 | Ga0070708_100964934 | 3300005445 | Bacteria | 800 |
| 124 | Ga0070663_100012382 | 3300005455 | Bacteria | 5395 |
| 125 | Ga0070663_100012394 | 3300005455 | Bacteria | 5392 |
| 126 | Ga0070663_100121663 | 3300005455 | Bacteria | 1972 |
| 127 | Ga0070663_100274893 | 3300005455 | Bacteria | 1340 |
| 128 | Ga0070663_100325180 | 3300005455 | Bacteria | 1238 |
| 129 | Ga0070663_101360826 | 3300005455 | Bacteria | 628 |
| 130 | Ga0070678_100101422 | 3300005456 | Bacteria | 2231 |
| 131 | Ga0070678_100132369 | 3300005456 | Unclassified | 1983 |
| 132 | Ga0070662_100005784 | 3300005457 | Bacteria | 7923 |
| 133 | Ga0070662_100018068 | 3300005457 | Bacteria | 4765 |
| 134 | Ga0070681_10232825 | 3300005458 | Bacteria | 1756 |
| 135 | Ga0070681_10263683 | 3300005458 | Bacteria | 1635 |
| 136 | Ga0070681_10372053 | 3300005458 | Bacteria | 1339 |
| 137 | Ga0070681_10549485 | 3300005458 | Bacteria | 1069 |
| 138 | Ga0070681_11340808 | 3300005458 | Bacteria | 638 |
| 139 | Ga0070681_11389979 | 3300005458 | Unclassified | 625 |
| 140 | Ga0070681_11580077 | 3300005458 | Bacteria | 581 |
| 141 | Ga0068867_100009657 | 3300005459 | Bacteria | 6801 |
| 142 | Ga0068867_100090268 | 3300005459 | Bacteria | 2324 |
| 143 | Ga0070685_10001292 | 3300005466 | Bacteria | 13193 |
| 144 | Ga0070685_10044363 | 3300005466 | Bacteria | 2545 |
| 145 | Ga0070685_10201038 | 3300005466 | Bacteria | 1295 |
| 146 | Ga0070706_100000514 | 3300005467 | Bacteria | 45375 |
| 147 | Ga0070706_100014580 | 3300005467 | Bacteria | 7262 |
| 148 | Ga0070706_100811981 | 3300005467 | Bacteria | 866 |
| 149 | Ga0070706_102109245 | 3300005467 | Bacteria | 510 |
| 150 | Ga0070707_100000662 | 3300005468 | Bacteria | 34318 |
| 151 | Ga0070707_100005126 | 3300005468 | Bacteria | 12276 |
| 152 | Ga0070707_100033790 | 3300005468 | Bacteria | 4876 |
| 153 | Ga0070698_100002449 | 3300005471 | Bacteria | 20472 |
| 154 | Ga0070698_100004533 | 3300005471 | Bacteria | 15264 |
| 155 | Ga0070698_100169617 | 3300005471 | Bacteria | 2124 |
| 156 | Ga0070699_100000441 | 3300005518 | Bacteria | 39851 |
| 157 | Ga0070699_100003886 | 3300005518 | Bacteria | 13210 |
| 158 | Ga0070699_100089928 | 3300005518 | Bacteria | 2683 |
| 159 | Ga0070699_101428219 | 3300005518 | Bacteria | 635 |
| 160 | Ga0070699_102027579 | 3300005518 | Bacteria | 526 |
| 161 | Ga0070679_100113302 | 3300005530 | Bacteria | 2698 |
| 162 | Ga0070679_100378503 | 3300005530 | Bacteria | 1362 |
| 163 | Ga0070679_100479152 | 3300005530 | Bacteria | 1188 |
| 164 | Ga0070679_100895746 | 3300005530 | Bacteria | 831 |
| 165 | Ga0070679_100986095 | 3300005530 | Bacteria | 786 |
| 166 | Ga0070679_101990579 | 3300005530 | Bacteria | 530 |
| 167 | Ga0070684_100001423 | 3300005535 | Bacteria | 17232 |
| 168 | Ga0070684_100015104 | 3300005535 | Bacteria | 6277 |
| 169 | Ga0070684_100136427 | 3300005535 | Bacteria | 2217 |
| 170 | Ga0070684_102236594 | 3300005535 | Bacteria | 516 |
| 171 | Ga0070697_100000975 | 3300005536 | Bacteria | 21592 |
| 172 | Ga0070697_100001451 | 3300005536 | Bacteria | 18044 |
| 173 | Ga0070697_100005121 | 3300005536 | Bacteria | 10067 |
| 174 | Ga0070697_100008091 | 3300005536 | Bacteria | 8200 |
| 175 | Ga0070697_100231449 | 3300005536 | Bacteria | 1576 |
| 176 | Ga0070697_100556823 | 3300005536 | Bacteria | 1006 |
| 177 | Ga0070697_100567811 | 3300005536 | Bacteria | 996 |
| 178 | Ga0070697_101943627 | 3300005536 | Bacteria | 526 |
| 179 | Ga0068853_100008308 | 3300005539 | Bacteria | 8336 |
| 180 | Ga0068853_100081315 | 3300005539 | Bacteria | 2836 |
| 181 | Ga0068853_100135035 | 3300005539 | Bacteria | 2211 |
| 182 | Ga0070672_100134491 | 3300005543 | Bacteria | 2035 |
| 183 | Ga0070672_100322681 | 3300005543 | Bacteria | 1313 |
| 184 | Ga0070686_100005280 | 3300005544 | Bacteria | 7141 |
| 185 | Ga0070686_100033425 | 3300005544 | Bacteria | 3160 |
| 186 | Ga0070686_101011357 | 3300005544 | Unclassified | 682 |
| 187 | Ga0070695_100045508 | 3300005545 | Bacteria | 2797 |
| 188 | Ga0070695_100093115 | 3300005545 | Unclassified | 2016 |
| 189 | Ga0070695_100565960 | 3300005545 | Bacteria | 888 |
| 190 | Ga0070696_100089544 | 3300005546 | Bacteria | 2188 |
| 191 | Ga0070696_100107978 | 3300005546 | Bacteria | 2002 |
| 192 | Ga0070696_100554755 | 3300005546 | Bacteria | 921 |
| 193 | Ga0070693_100015931 | 3300005547 | Bacteria | 3880 |
| 194 | Ga0070693_100092826 | 3300005547 | Bacteria | 1823 |
| 195 | Ga0070693_100258541 | 3300005547 | Bacteria | 1157 |
| 196 | Ga0070665_100037358 | 3300005548 | Bacteria | 4884 |
| 197 | Ga0070665_100288347 | 3300005548 | Bacteria | 1644 |
| 198 | Ga0070704_100731609 | 3300005549 | Bacteria | 880 |
| 199 | Ga0068855_100003825 | 3300005563 | Bacteria | 18405 |
| 200 | Ga0068855_100025048 | 3300005563 | Bacteria | 7141 |
| 201 | Ga0068855_100035485 | 3300005563 | Bacteria | 5939 |
| 202 | Ga0068855_100084699 | 3300005563 | Bacteria | 3669 |
| 203 | Ga0068855_100345257 | 3300005563 | Bacteria | 1640 |
| 204 | Ga0068855_100751560 | 3300005563 | Bacteria | 1040 |
| 205 | Ga0068855_101230413 | 3300005563 | Bacteria | 777 |
| 206 | Ga0070664_100017663 | 3300005564 | Bacteria | 5858 |
| 207 | Ga0070664_100144991 | 3300005564 | Bacteria | 2093 |
| 208 | Ga0070664_100600895 | 3300005564 | Unclassified | 1020 |
| 209 | Ga0070664_101239338 | 3300005564 | Bacteria | 704 |
| 210 | Ga0068857_100001133 | 3300005577 | Bacteria | 20806 |
| 211 | Ga0068857_100097440 | 3300005577 | Bacteria | 2637 |
| 212 | Ga0068857_100103614 | 3300005577 | Bacteria | 2554 |
| 213 | Ga0068857_100944824 | 3300005577 | Bacteria | 828 |
| 214 | Ga0068857_101295819 | 3300005577 | Bacteria | 707 |
| 215 | Ga0068857_102465828 | 3300005577 | Unclassified | 511 |
| 216 | Ga0068854_100038966 | 3300005578 | Bacteria | 3345 |
| 217 | Ga0068854_100079731 | 3300005578 | Bacteria | 2414 |
| 218 | Ga0068854_101239939 | 3300005578 | Unclassified | 669 |
| 219 | Ga0068856_100060929 | 3300005614 | Bacteria | 3728 |
| 220 | Ga0068856_100309821 | 3300005614 | Bacteria | 1596 |
| 221 | Ga0068856_100481787 | 3300005614 | Bacteria | 1262 |
| 222 | Ga0068856_100995425 | 3300005614 | Bacteria | 857 |
| 223 | Ga0068856_101607101 | 3300005614 | Bacteria | 663 |
| 224 | Ga0070702_100151255 | 3300005615 | Bacteria | 1490 |
| 225 | Ga0070702_100260522 | 3300005615 | Bacteria | 1180 |
| 226 | Ga0068852_100001223 | 3300005616 | Bacteria | 17089 |
| 227 | Ga0068852_100018750 | 3300005616 | Bacteria | 5457 |
| 228 | Ga0068852_100884894 | 3300005616 | Bacteria | 910 |
| 229 | Ga0068859_100010649 | 3300005617 | Bacteria | 9255 |
| 230 | Ga0068859_100025042 | 3300005617 | Bacteria | 5990 |
| 231 | Ga0068859_100052886 | 3300005617 | Bacteria | 4084 |
| 232 | Ga0068864_100086394 | 3300005618 | Bacteria | 2759 |
| 233 | Ga0068864_100277958 | 3300005618 | Bacteria | 1562 |
| 234 | Ga0068864_100289329 | 3300005618 | Bacteria | 1531 |
| 235 | Ga0068866_10001380 | 3300005718 | Bacteria | 10468 |
| 236 | Ga0068866_10025064 | 3300005718 | Bacteria | 2799 |
| 237 | Ga0068861_100006422 | 3300005719 | Bacteria | 8008 |
| 238 | Ga0068861_100165678 | 3300005719 | Bacteria | 1827 |
| 239 | Ga0068861_100454185 | 3300005719 | Bacteria | 1149 |
| 240 | Ga0068851_10001352 | 3300005834 | Bacteria | 10700 |
| 241 | Ga0068851_10015057 | 3300005834 | Bacteria | 3681 |
| 242 | Ga0068851_10581704 | 3300005834 | Bacteria | 680 |
| 243 | Ga0068851_10702608 | 3300005834 | Bacteria | 622 |
| 244 | Ga0068870_10007394 | 3300005840 | Bacteria | 4892 |
| 245 | Ga0068870_10932203 | 3300005840 | Unclassified | 615 |
| 246 | Ga0068863_100020550 | 3300005841 | Bacteria | 6312 |
| 247 | Ga0068863_100169911 | 3300005841 | Bacteria | 2091 |
| 248 | Ga0068863_101911187 | 3300005841 | Bacteria | 603 |
| 249 | Ga0068858_100023794 | 3300005842 | Bacteria | 5707 |
| 250 | Ga0068858_100042739 | 3300005842 | Bacteria | 4202 |
| 251 | Ga0068858_100059426 | 3300005842 | Bacteria | 3533 |
| 252 | Ga0068858_100066188 | 3300005842 | Bacteria | 3345 |
| 253 | Ga0068858_100135922 | 3300005842 | Bacteria | 2307 |
| 254 | Ga0068858_101682143 | 3300005842 | Bacteria | 627 |
| 255 | Ga0068860_100018016 | 3300005843 | Bacteria | 6877 |
| 256 | Ga0068860_100036537 | 3300005843 | Bacteria | 4706 |
| 257 | Ga0068860_100073000 | 3300005843 | Bacteria | 3262 |
| 258 | Ga0068860_100253033 | 3300005843 | Bacteria | 1716 |
| 259 | Ga0068860_100525026 | 3300005843 | Bacteria | 1184 |
| 260 | Ga0068860_100564649 | 3300005843 | Bacteria | 1141 |
| 261 | Ga0068862_100010568 | 3300005844 | Bacteria | 7629 |
| 262 | Ga0068862_100027948 | 3300005844 | Bacteria | 4750 |
| 263 | Ga0068862_100031514 | 3300005844 | Bacteria | 4476 |
| 264 | Ga0068862_102020393 | 3300005844 | Bacteria | 587 |
| 265 | Ga0068862_102047875 | 3300005844 | Unclassified | 583 |
| 266 | Ga0070717_10002614 | 3300006028 | Bacteria | 12700 |
| 267 | Ga0070717_10006374 | 3300006028 | Bacteria | 8673 |
| 268 | Ga0070717_10094307 | 3300006028 | Bacteria | 2531 |
| 269 | Ga0070717_10118628 | 3300006028 | Bacteria | 2264 |
| 270 | Ga0070717_10120021 | 3300006028 | Bacteria | 2251 |
| 271 | Ga0070717_10491944 | 3300006028 | Bacteria | 1108 |
| 272 | Ga0070717_10982666 | 3300006028 | Bacteria | 769 |
| 273 | Ga0070717_11394051 | 3300006028 | Unclassified | 637 |
| 274 | Ga0070717_11840801 | 3300006028 | Bacteria | 547 |
| 275 | Ga0070717_11977549 | 3300006028 | Bacteria | 525 |
| 276 | Ga0070715_10019784 | 3300006163 | Bacteria | 2587 |
| 277 | Ga0070715_10494896 | 3300006163 | Bacteria | 699 |
| 278 | Ga0070715_10572066 | 3300006163 | Bacteria | 658 |
| 279 | Ga0070715_10815351 | 3300006163 | Bacteria | 568 |
| 280 | Ga0070716_100023941 | 3300006173 | Bacteria | 3245 |
| 281 | Ga0070716_100127708 | 3300006173 | Bacteria | 1602 |
| 282 | Ga0070716_100139392 | 3300006173 | Bacteria | 1544 |
| 283 | Ga0070716_100151070 | 3300006173 | Bacteria | 1494 |
| 284 | Ga0070716_100962603 | 3300006173 | Unclassified | 672 |
| 285 | Ga0070712_100002103 | 3300006175 | Bacteria | 12240 |
| 286 | Ga0070712_100042575 | 3300006175 | Bacteria | 3123 |
| 287 | Ga0070712_100587298 | 3300006175 | Bacteria | 942 |
| 288 | Ga0097621_100007525 | 3300006237 | Bacteria | 7797 |
| 289 | Ga0097621_100013773 | 3300006237 | Bacteria | 6038 |
| 290 | Ga0097621_100020695 | 3300006237 | Bacteria | 5073 |
| 291 | Ga0097621_100075555 | 3300006237 | Bacteria | 2793 |
| 292 | Ga0097621_100276146 | 3300006237 | Bacteria | 1478 |
| 293 | Ga0097621_101304847 | 3300006237 | Bacteria | 686 |
| 294 | Ga0097621_101895105 | 3300006237 | Bacteria | 569 |
| 295 | Ga0068871_100014064 | 3300006358 | Bacteria | 5952 |
| 296 | Ga0068871_100098154 | 3300006358 | Bacteria | 2450 |
| 297 | Ga0068871_100473609 | 3300006358 | Bacteria | 1125 |
| 298 | Ga0068871_100742892 | 3300006358 | Bacteria | 901 |
| 299 | Ga0075428_101476913 | 3300006844 | Unclassified | 712 |
| 300 | Ga0075433_10004383 | 3300006852 | Bacteria | 10975 |
| 301 | Ga0075433_11034281 | 3300006852 | Bacteria | 715 |
| 302 | Ga0075434_100000230 | 3300006871 | Bacteria | 38508 |
| 303 | Ga0075434_100792676 | 3300006871 | Bacteria | 964 |
| 304 | Ga0075434_100801380 | 3300006871 | Bacteria | 958 |
| 305 | Ga0075434_101160788 | 3300006871 | Bacteria | 785 |
| 306 | Ga0075434_101937085 | 3300006871 | Bacteria | 595 |
| 307 | Ga0068865_100016197 | 3300006881 | Bacteria | 4765 |
| 308 | Ga0068865_100044651 | 3300006881 | Bacteria | 3034 |
| 309 | Ga0068865_101556661 | 3300006881 | Unclassified | 593 |
| 310 | Ga0068865_101889644 | 3300006881 | Bacteria | 540 |
| 311 | Ga0075436_100000510 | 3300006914 | Bacteria | 25141 |
| 312 | Ga0075436_100029891 | 3300006914 | Bacteria | 3748 |
| 313 | Ga0075436_100415732 | 3300006914 | Bacteria | 976 |
| 314 | Ga0075436_100744057 | 3300006914 | Bacteria | 728 |
| 315 | Ga0097620_100010649 | 3300006931 | Bacteria | 9255 |
| 316 | Ga0097620_100025042 | 3300006931 | Bacteria | 5990 |
| 317 | Ga0097620_100052889 | 3300006931 | Bacteria | 4084 |
| 318 | Ga0075435_100000389 | 3300007076 | Bacteria | 26853 |
| 319 | Ga0075435_100055600 | 3300007076 | Bacteria | 3197 |
| 320 | Ga0075435_100150842 | 3300007076 | Bacteria | 1954 |
| 321 | Ga0075435_101510837 | 3300007076 | Bacteria | 589 |
| 322 | Ga0099794_10380592 | 3300007265 | Bacteria | 736 |
| 323 | Ga0099795_10581479 | 3300007788 | Bacteria | 531 |
| 324 | Ga0105250_10023011 | 3300009092 | Bacteria | 2510 |
| 325 | Ga0105240_10100771 | 3300009093 | Bacteria | 3514 |
| 326 | Ga0105240_10119015 | 3300009093 | Bacteria | 3182 |
| 327 | Ga0105240_10154500 | 3300009093 | Bacteria | 2730 |
| 328 | Ga0105240_10391623 | 3300009093 | Bacteria | 1567 |
| 329 | Ga0105240_10399065 | 3300009093 | Bacteria | 1549 |
| 330 | Ga0105240_10947580 | 3300009093 | Bacteria | 923 |
| 331 | Ga0105240_11067984 | 3300009093 | Bacteria | 861 |
| 332 | Ga0105240_12267497 | 3300009093 | Unclassified | 563 |
| 333 | Ga0111539_12687721 | 3300009094 | Unclassified | 577 |
| 334 | Ga0105245_10005029 | 3300009098 | Bacteria | 11625 |
| 335 | Ga0105245_10054232 | 3300009098 | Bacteria | 3600 |
| 336 | Ga0105245_10056662 | 3300009098 | Bacteria | 3523 |
| 337 | Ga0105245_10174848 | 3300009098 | Bacteria | 2047 |
| 338 | Ga0105245_10261930 | 3300009098 | Bacteria | 1683 |
| 339 | Ga0105245_11080508 | 3300009098 | Bacteria | 848 |
| 340 | Ga0105245_12751900 | 3300009098 | Bacteria | 545 |
| 341 | Ga0105245_13255067 | 3300009098 | Unclassified | 503 |
| 342 | Ga0105247_10028333 | 3300009101 | Bacteria | 3388 |
| 343 | Ga0105247_10037507 | 3300009101 | Bacteria | 2957 |
| 344 | Ga0105247_10052463 | 3300009101 | Bacteria | 2515 |
| 345 | Ga0114129_11223317 | 3300009147 | Bacteria | 934 |
| 346 | Ga0105243_11072228 | 3300009148 | Unclassified | 812 |
| 347 | Ga0105241_10014226 | 3300009174 | Bacteria | 5829 |
| 348 | Ga0105241_10104611 | 3300009174 | Bacteria | 2256 |
| 349 | Ga0105241_10127889 | 3300009174 | Bacteria | 2053 |
| 350 | Ga0105241_10342448 | 3300009174 | Bacteria | 1296 |
| 351 | Ga0105241_10503769 | 3300009174 | Bacteria | 1080 |
| 352 | Ga0105241_10546537 | 3300009174 | Bacteria | 1039 |
| 353 | Ga0105241_11693131 | 3300009174 | Bacteria | 614 |
| 354 | Ga0105242_10028689 | 3300009176 | Bacteria | 4432 |
| 355 | Ga0105242_10035557 | 3300009176 | Bacteria | 3994 |
| 356 | Ga0105242_10110302 | 3300009176 | Bacteria | 2344 |
| 357 | Ga0105248_10032147 | 3300009177 | Bacteria | 5865 |
| 358 | Ga0105248_10038960 | 3300009177 | Bacteria | 5321 |
| 359 | Ga0105248_10157464 | 3300009177 | Bacteria | 2563 |
| 360 | Ga0105248_10569718 | 3300009177 | Bacteria | 1278 |
| 361 | Ga0105248_10906466 | 3300009177 | Unclassified | 995 |
| 362 | Ga0105237_10054319 | 3300009545 | Bacteria | 4014 |
| 363 | Ga0105237_10065790 | 3300009545 | Bacteria | 3620 |
| 364 | Ga0105237_10143015 | 3300009545 | Bacteria | 2386 |
| 365 | Ga0105237_10189626 | 3300009545 | Bacteria | 2056 |
| 366 | Ga0105237_10191641 | 3300009545 | Bacteria | 2044 |
| 367 | Ga0105237_11286203 | 3300009545 | Bacteria | 738 |
| 368 | Ga0105237_11449041 | 3300009545 | Bacteria | 693 |
| 369 | Ga0105237_11714635 | 3300009545 | Bacteria | 635 |
| 370 | Ga0105238_10019367 | 3300009551 | Bacteria | 6931 |
| 371 | Ga0105238_10066071 | 3300009551 | Bacteria | 3618 |
| 372 | Ga0105238_10424409 | 3300009551 | Bacteria | 1325 |
| 373 | Ga0105238_11185071 | 3300009551 | Bacteria | 788 |
| 374 | Ga0105249_10017780 | 3300009553 | Bacteria | 6316 |
| 375 | Ga0105249_10111464 | 3300009553 | Bacteria | 2587 |
| 376 | Ga0105249_13515939 | 3300009553 | Bacteria | 505 |
| 377 | Ga0099796_10076584 | 3300010159 | Bacteria | 1218 |
| 378 | Ga0105239_10029298 | 3300010375 | Bacteria | 6053 |
| 379 | Ga0105239_10105513 | 3300010375 | Bacteria | 3121 |
| 380 | Ga0105239_10748483 | 3300010375 | Bacteria | 1118 |
| 381 | Ga0105239_12025667 | 3300010375 | Bacteria | 668 |
| 382 | Ga0105239_12396594 | 3300010375 | Bacteria | 615 |
| 383 | Ga0105239_13575427 | 3300010375 | Bacteria | 505 |
| 384 | Ga0105246_10002877 | 3300011119 | Bacteria | 10417 |
| 385 | Ga0105246_10302237 | 3300011119 | Bacteria | 1292 |
| 386 | Ga0157337_1025918 | 3300012483 | Bacteria | 572 |
| 387 | Ga0157342_1060785 | 3300012507 | Bacteria | 554 |
| 388 | Ga0157373_10001758 | 3300013100 | Bacteria | 16488 |
| 389 | Ga0157373_10182467 | 3300013100 | Bacteria | 1478 |
| 390 | Ga0157373_10952686 | 3300013100 | Bacteria | 639 |
| 391 | Ga0157371_10002134 | 3300013102 | Bacteria | 19252 |
| 392 | Ga0157371_10085091 | 3300013102 | Bacteria | 2240 |
| 393 | Ga0157371_10393943 | 3300013102 | Bacteria | 1013 |
| 394 | Ga0157371_11363521 | 3300013102 | Bacteria | 550 |
| 395 | Ga0157370_10052220 | 3300013104 | Bacteria | 3903 |
| 396 | Ga0157370_10139289 | 3300013104 | Bacteria | 2261 |
| 397 | Ga0157370_10182358 | 3300013104 | Bacteria | 1951 |
| 398 | Ga0157370_10263820 | 3300013104 | Bacteria | 1592 |
| 399 | Ga0157370_10983243 | 3300013104 | Bacteria | 764 |
| 400 | Ga0157370_11611145 | 3300013104 | Bacteria | 583 |
| 401 | Ga0157370_11712296 | 3300013104 | Bacteria | 564 |
| 402 | Ga0157369_10026263 | 3300013105 | Bacteria | 6461 |
| 403 | Ga0157369_10043759 | 3300013105 | Bacteria | 4879 |
| 404 | Ga0157369_10132317 | 3300013105 | Bacteria | 2643 |
| 405 | Ga0157369_10157533 | 3300013105 | Bacteria | 2398 |
| 406 | Ga0157369_11861737 | 3300013105 | Bacteria | 611 |
| 407 | Ga0157374_10012759 | 3300013296 | Bacteria | 7322 |
| 408 | Ga0157374_10014284 | 3300013296 | Bacteria | 6947 |
| 409 | Ga0157374_10024267 | 3300013296 | Bacteria | 5434 |
| 410 | Ga0157374_10029721 | 3300013296 | Bacteria | 4954 |
| 411 | Ga0157374_11990054 | 3300013296 | Bacteria | 607 |
| 412 | Ga0157374_12026807 | 3300013296 | Bacteria | 602 |
| 413 | Ga0157374_12080146 | 3300013296 | Bacteria | 594 |
| 414 | Ga0157378_10000411 | 3300013297 | Bacteria | 42281 |
| 415 | Ga0157378_10010748 | 3300013297 | Bacteria | 8001 |
| 416 | Ga0157378_10027505 | 3300013297 | Bacteria | 5018 |
| 417 | Ga0157378_10029365 | 3300013297 | Bacteria | 4854 |
| 418 | Ga0157378_10081386 | 3300013297 | Bacteria | 2927 |
| 419 | Ga0157378_10281747 | 3300013297 | Bacteria | 1602 |
| 420 | Ga0157378_10430415 | 3300013297 | Bacteria | 1306 |
| 421 | Ga0157378_10575701 | 3300013297 | Bacteria | 1134 |
| 422 | Ga0157378_11200688 | 3300013297 | Bacteria | 798 |
| 423 | Ga0163162_10015114 | 3300013306 | Bacteria | 7537 |
| 424 | Ga0163162_10020357 | 3300013306 | Bacteria | 6517 |
| 425 | Ga0163162_10053758 | 3300013306 | Bacteria | 4048 |
| 426 | Ga0163162_10296022 | 3300013306 | Bacteria | 1750 |
| 427 | Ga0163162_11253334 | 3300013306 | Bacteria | 842 |
| 428 | Ga0157372_10002154 | 3300013307 | Bacteria | 21421 |
| 429 | Ga0157372_10003780 | 3300013307 | Bacteria | 16254 |
| 430 | Ga0157372_10040130 | 3300013307 | Bacteria | 5168 |
| 431 | Ga0157372_10091572 | 3300013307 | Bacteria | 3458 |
| 432 | Ga0157372_10143192 | 3300013307 | Bacteria | 2756 |
| 433 | Ga0157372_10173185 | 3300013307 | Bacteria | 2497 |
| 434 | Ga0157372_10207483 | 3300013307 | Bacteria | 2270 |
| 435 | Ga0157372_10378037 | 3300013307 | Bacteria | 1651 |
| 436 | Ga0157372_11084067 | 3300013307 | Bacteria | 927 |
| 437 | Ga0157372_11156782 | 3300013307 | Bacteria | 895 |
| 438 | Ga0157372_11727945 | 3300013307 | Bacteria | 720 |
| 439 | Ga0157375_10067349 | 3300013308 | Bacteria | 3577 |
| 440 | Ga0157375_10150494 | 3300013308 | Bacteria | 2462 |
| 441 | Ga0157375_10583569 | 3300013308 | Bacteria | 1278 |
| 442 | Ga0157375_12491633 | 3300013308 | Bacteria | 618 |
| 443 | Ga0163163_10001073 | 3300014325 | Bacteria | 23224 |
| 444 | Ga0163163_10170068 | 3300014325 | Bacteria | 2226 |
| 445 | Ga0163163_12359656 | 3300014325 | Unclassified | 590 |
| 446 | Ga0163163_13072498 | 3300014325 | Bacteria | 520 |
| 447 | Ga0157380_10030441 | 3300014326 | Bacteria | 4133 |
| 448 | Ga0157377_10000768 | 3300014745 | Bacteria | 13272 |
| 449 | Ga0157377_10184811 | 3300014745 | Bacteria | 1313 |
| 450 | Ga0157377_10230324 | 3300014745 | Bacteria | 1191 |
| 451 | Ga0157377_11326298 | 3300014745 | Unclassified | 564 |
| 452 | Ga0157379_10004402 | 3300014968 | Bacteria | 12067 |
| 453 | Ga0157379_10005366 | 3300014968 | Bacteria | 11017 |
| 454 | Ga0157379_10063957 | 3300014968 | Bacteria | 3289 |
| 455 | Ga0157379_10127587 | 3300014968 | Bacteria | 2289 |
| 456 | Ga0157379_12653172 | 3300014968 | Bacteria | 502 |
| 457 | Ga0157376_10013365 | 3300014969 | Bacteria | 6123 |
| 458 | Ga0157376_10089966 | 3300014969 | Bacteria | 2655 |
| 459 | Ga0157376_10161074 | 3300014969 | Bacteria | 2034 |
| 460 | Ga0157376_10728258 | 3300014969 | Bacteria | 999 |
| 461 | Ga0182006_1040198 | 3300015261 | Bacteria | 1842 |
| 462 | Ga0182007_10081080 | 3300015262 | Bacteria | 1064 |
| 463 | Ga0163161_10001969 | 3300017792 | Bacteria | 14895 |
| 464 | Ga0197907_10857682 | 3300020069 | Bacteria | 621 |
| 465 | Ga0213874_10013367 | 3300021377 | Bacteria | 2126 |
| 466 | Ga0228598_1105815 | 3300024227 | Bacteria | 568 |
| 467 | Ga0207697_10022130 | 3300025315 | Bacteria | 2605 |
| 468 | Ga0207656_10007564 | 3300025321 | Bacteria | 3964 |
| 469 | Ga0207656_10018423 | 3300025321 | Bacteria | 2749 |
| 470 | Ga0207656_10693245 | 3300025321 | Unclassified | 521 |
| 471 | Ga0207696_1030544 | 3300025711 | Bacteria | 1636 |
| 472 | Ga0207696_1098767 | 3300025711 | Bacteria | 796 |
| 473 | Ga0207682_10254281 | 3300025893 | Bacteria | 818 |
| 474 | Ga0207692_10081189 | 3300025898 | Bacteria | 1734 |
| 475 | Ga0207692_10087703 | 3300025898 | Bacteria | 1680 |
| 476 | Ga0207642_10019526 | 3300025899 | Bacteria | 2626 |
| 477 | Ga0207642_10081086 | 3300025899 | Bacteria | 1576 |
| 478 | Ga0207642_10544436 | 3300025899 | Unclassified | 716 |
| 479 | Ga0207642_10591450 | 3300025899 | Bacteria | 690 |
| 480 | Ga0207710_10011254 | 3300025900 | Bacteria | 3767 |
| 481 | Ga0207710_10025129 | 3300025900 | Bacteria | 2569 |
| 482 | Ga0207688_10005204 | 3300025901 | Bacteria | 7069 |
| 483 | Ga0207680_10001756 | 3300025903 | Bacteria | 10229 |
| 484 | Ga0207680_10010187 | 3300025903 | Bacteria | 4693 |
| 485 | Ga0207647_10001343 | 3300025904 | Bacteria | 18910 |
| 486 | Ga0207647_10010629 | 3300025904 | Bacteria | 6492 |
| 487 | Ga0207647_10027808 | 3300025904 | Bacteria | 3683 |
| 488 | Ga0207685_10239727 | 3300025905 | Bacteria | 872 |
| 489 | Ga0207685_10337338 | 3300025905 | Bacteria | 756 |
| 490 | Ga0207699_10073645 | 3300025906 | Bacteria | 2096 |
| 491 | Ga0207699_10217781 | 3300025906 | Bacteria | 1302 |
| 492 | Ga0207699_10985932 | 3300025906 | Bacteria | 623 |
| 493 | Ga0207699_10986354 | 3300025906 | Bacteria | 623 |
| 494 | Ga0207645_10001180 | 3300025907 | Bacteria | 21585 |
| 495 | Ga0207645_10086495 | 3300025907 | Bacteria | 2014 |
| 496 | Ga0207643_10001067 | 3300025908 | Bacteria | 16207 |
| 497 | Ga0207643_10165810 | 3300025908 | Bacteria | 1331 |
| 498 | Ga0207705_10000048 | 3300025909 | Bacteria | 171848 |
| 499 | Ga0207705_10003420 | 3300025909 | Bacteria | 12069 |
| 500 | Ga0207705_10065077 | 3300025909 | Bacteria | 2635 |
| 501 | Ga0207705_10284805 | 3300025909 | Bacteria | 1265 |
| 502 | Ga0207705_11506803 | 3300025909 | Bacteria | 509 |
| 503 | Ga0207684_10000614 | 3300025910 | Bacteria | 42486 |
| 504 | Ga0207684_10001048 | 3300025910 | Bacteria | 30878 |
| 505 | Ga0207684_10051620 | 3300025910 | Bacteria | 3489 |
| 506 | Ga0207684_10383957 | 3300025910 | Bacteria | 1208 |
| 507 | Ga0207654_10028664 | 3300025911 | Bacteria | 3037 |
| 508 | Ga0207654_10041777 | 3300025911 | Bacteria | 2592 |
| 509 | Ga0207654_10217253 | 3300025911 | Bacteria | 1266 |
| 510 | Ga0207654_10482174 | 3300025911 | Bacteria | 873 |
| 511 | Ga0207654_11373958 | 3300025911 | Bacteria | 515 |
| 512 | Ga0207707_10015255 | 3300025912 | Bacteria | 6690 |
| 513 | Ga0207707_10212758 | 3300025912 | Bacteria | 1684 |
| 514 | Ga0207707_10232877 | 3300025912 | Bacteria | 1602 |
| 515 | Ga0207707_10353925 | 3300025912 | Bacteria | 1265 |
| 516 | Ga0207707_10682379 | 3300025912 | Bacteria | 864 |
| 517 | Ga0207707_11057736 | 3300025912 | Bacteria | 663 |
| 518 | Ga0207695_10000354 | 3300025913 | Bacteria | 105275 |
| 519 | Ga0207695_10007039 | 3300025913 | Bacteria | 14431 |
| 520 | Ga0207695_10212432 | 3300025913 | Bacteria | 1845 |
| 521 | Ga0207695_10332361 | 3300025913 | Bacteria | 1408 |
| 522 | Ga0207695_10383190 | 3300025913 | Bacteria | 1292 |
| 523 | Ga0207695_10568006 | 3300025913 | Bacteria | 1016 |
| 524 | Ga0207671_10042802 | 3300025914 | Bacteria | 3351 |
| 525 | Ga0207671_10091668 | 3300025914 | Bacteria | 2290 |
| 526 | Ga0207671_10104506 | 3300025914 | Bacteria | 2148 |
| 527 | Ga0207671_10144791 | 3300025914 | Bacteria | 1833 |
| 528 | Ga0207693_10000922 | 3300025915 | Bacteria | 26418 |
| 529 | Ga0207693_10004232 | 3300025915 | Bacteria | 12174 |
| 530 | Ga0207693_10026057 | 3300025915 | Bacteria | 4630 |
| 531 | Ga0207663_10018817 | 3300025916 | Bacteria | 3879 |
| 532 | Ga0207663_10078557 | 3300025916 | Bacteria | 2152 |
| 533 | Ga0207663_10160673 | 3300025916 | Bacteria | 1585 |
| 534 | Ga0207663_10531284 | 3300025916 | Bacteria | 917 |
| 535 | Ga0207663_10901261 | 3300025916 | Bacteria | 707 |
| 536 | Ga0207663_11205615 | 3300025916 | Bacteria | 609 |
| 537 | Ga0207663_11257856 | 3300025916 | Bacteria | 596 |
| 538 | Ga0207660_10048721 | 3300025917 | Bacteria | 2999 |
| 539 | Ga0207660_10077165 | 3300025917 | Bacteria | 2438 |
| 540 | Ga0207662_10014118 | 3300025918 | Bacteria | 4474 |
| 541 | Ga0207657_10000823 | 3300025919 | Bacteria | 32798 |
| 542 | Ga0207657_10004069 | 3300025919 | Bacteria | 15518 |
| 543 | Ga0207657_10006426 | 3300025919 | Bacteria | 12189 |
| 544 | Ga0207657_10403388 | 3300025919 | Bacteria | 1075 |
| 545 | Ga0207657_10943231 | 3300025919 | Bacteria | 664 |
| 546 | Ga0207649_10001087 | 3300025920 | Bacteria | 16517 |
| 547 | Ga0207649_10238356 | 3300025920 | Bacteria | 1305 |
| 548 | Ga0207649_10495557 | 3300025920 | Bacteria | 928 |
| 549 | Ga0207649_11165604 | 3300025920 | Unclassified | 609 |
| 550 | Ga0207652_10037568 | 3300025921 | Bacteria | 4099 |
| 551 | Ga0207652_10078648 | 3300025921 | Bacteria | 2880 |
| 552 | Ga0207652_10275621 | 3300025921 | Bacteria | 1517 |
| 553 | Ga0207652_10867502 | 3300025921 | Bacteria | 799 |
| 554 | Ga0207652_11399645 | 3300025921 | Bacteria | 603 |
| 555 | Ga0207646_10001230 | 3300025922 | Bacteria | 32163 |
| 556 | Ga0207646_10004899 | 3300025922 | Bacteria | 14334 |
| 557 | Ga0207646_10057056 | 3300025922 | Bacteria | 3489 |
| 558 | Ga0207646_10059790 | 3300025922 | Bacteria | 3403 |
| 559 | Ga0207646_11363734 | 3300025922 | Bacteria | 618 |
| 560 | Ga0207681_10009111 | 3300025923 | Bacteria | 6063 |
| 561 | Ga0207681_10043862 | 3300025923 | Bacteria | 2995 |
| 562 | Ga0207694_10038536 | 3300025924 | Bacteria | 3675 |
| 563 | Ga0207694_10118035 | 3300025924 | Bacteria | 2116 |
| 564 | Ga0207694_10200446 | 3300025924 | Bacteria | 1624 |
| 565 | Ga0207650_10000152 | 3300025925 | Bacteria | 83134 |
| 566 | Ga0207650_11032043 | 3300025925 | Bacteria | 700 |
| 567 | Ga0207650_11302802 | 3300025925 | Unclassified | 618 |
| 568 | Ga0207659_10003498 | 3300025926 | Bacteria | 9434 |
| 569 | Ga0207659_10141402 | 3300025926 | Bacteria | 1869 |
| 570 | Ga0207659_11310189 | 3300025926 | Bacteria | 622 |
| 571 | Ga0207687_10010238 | 3300025927 | Bacteria | 6126 |
| 572 | Ga0207687_10032442 | 3300025927 | Bacteria | 3537 |
| 573 | Ga0207687_10033504 | 3300025927 | Bacteria | 3485 |
| 574 | Ga0207687_10145758 | 3300025927 | Bacteria | 1801 |
| 575 | Ga0207687_10921378 | 3300025927 | Bacteria | 748 |
| 576 | Ga0207700_10003657 | 3300025928 | Bacteria | 8964 |
| 577 | Ga0207700_10042550 | 3300025928 | Bacteria | 3331 |
| 578 | Ga0207700_10137500 | 3300025928 | Bacteria | 2003 |
| 579 | Ga0207700_10238412 | 3300025928 | Bacteria | 1549 |
| 580 | Ga0207700_10592713 | 3300025928 | Bacteria | 986 |
| 581 | Ga0207700_11251637 | 3300025928 | Bacteria | 662 |
| 582 | Ga0207700_12023091 | 3300025928 | Unclassified | 503 |
| 583 | Ga0207664_10000087 | 3300025929 | Bacteria | 88607 |
| 584 | Ga0207664_10048949 | 3300025929 | Bacteria | 3326 |
| 585 | Ga0207664_10432327 | 3300025929 | Bacteria | 1173 |
| 586 | Ga0207664_10820419 | 3300025929 | Bacteria | 836 |
| 587 | Ga0207664_10899625 | 3300025929 | Bacteria | 795 |
| 588 | Ga0207664_11221340 | 3300025929 | Bacteria | 670 |
| 589 | Ga0207664_11535382 | 3300025929 | Bacteria | 588 |
| 590 | Ga0207644_10003335 | 3300025931 | Bacteria | 10358 |
| 591 | Ga0207644_10477872 | 3300025931 | Bacteria | 1026 |
| 592 | Ga0207644_11008921 | 3300025931 | Bacteria | 699 |
| 593 | Ga0207690_10007754 | 3300025932 | Bacteria | 6372 |
| 594 | Ga0207690_10025533 | 3300025932 | Bacteria | 3711 |
| 595 | Ga0207690_10087591 | 3300025932 | Bacteria | 2191 |
| 596 | Ga0207706_10000740 | 3300025933 | Bacteria | 34067 |
| 597 | Ga0207706_10005096 | 3300025933 | Bacteria | 12268 |
| 598 | Ga0207686_10088097 | 3300025934 | Bacteria | 2043 |
| 599 | Ga0207686_10234097 | 3300025934 | Bacteria | 1333 |
| 600 | Ga0207670_10003610 | 3300025936 | Bacteria | 8207 |
| 601 | Ga0207670_10035791 | 3300025936 | Bacteria | 3223 |
| 602 | Ga0207670_11370614 | 3300025936 | Unclassified | 600 |
| 603 | Ga0207669_11201146 | 3300025937 | Bacteria | 642 |
| 604 | Ga0207704_10009815 | 3300025938 | Bacteria | 4636 |
| 605 | Ga0207704_10012199 | 3300025938 | Bacteria | 4258 |
| 606 | Ga0207704_11392092 | 3300025938 | Unclassified | 601 |
| 607 | Ga0207665_10001798 | 3300025939 | Bacteria | 14443 |
| 608 | Ga0207665_10029689 | 3300025939 | Bacteria | 3613 |
| 609 | Ga0207665_10061976 | 3300025939 | Bacteria | 2537 |
| 610 | Ga0207665_10205212 | 3300025939 | Bacteria | 1438 |
| 611 | Ga0207665_10371403 | 3300025939 | Unclassified | 1084 |
| 612 | Ga0207665_10786959 | 3300025939 | Bacteria | 751 |
| 613 | Ga0207691_10000308 | 3300025940 | Bacteria | 48637 |
| 614 | Ga0207691_10273247 | 3300025940 | Bacteria | 1455 |
| 615 | Ga0207711_10003068 | 3300025941 | Bacteria | 14584 |
| 616 | Ga0207711_10013154 | 3300025941 | Bacteria | 6872 |
| 617 | Ga0207711_10114604 | 3300025941 | Bacteria | 2401 |
| 618 | Ga0207689_10000618 | 3300025942 | Bacteria | 33979 |
| 619 | Ga0207689_10005608 | 3300025942 | Bacteria | 11183 |
| 620 | Ga0207689_10063202 | 3300025942 | Bacteria | 3045 |
| 621 | Ga0207689_10203187 | 3300025942 | Bacteria | 1636 |
| 622 | Ga0207661_10007082 | 3300025944 | Bacteria | 7965 |
| 623 | Ga0207661_10027213 | 3300025944 | Bacteria | 4366 |
| 624 | Ga0207661_10398694 | 3300025944 | Bacteria | 1247 |
| 625 | Ga0207679_10000298 | 3300025945 | Bacteria | 37205 |
| 626 | Ga0207679_10098174 | 3300025945 | Bacteria | 2283 |
| 627 | Ga0207679_10327006 | 3300025945 | Bacteria | 1329 |
| 628 | Ga0207679_10588266 | 3300025945 | Unclassified | 1002 |
| 629 | Ga0207667_10008444 | 3300025949 | Bacteria | 12232 |
| 630 | Ga0207667_10051651 | 3300025949 | Bacteria | 4332 |
| 631 | Ga0207667_10055132 | 3300025949 | Bacteria | 4180 |
| 632 | Ga0207667_10086319 | 3300025949 | Bacteria | 3248 |
| 633 | Ga0207667_10125234 | 3300025949 | Bacteria | 2646 |
| 634 | Ga0207667_10636376 | 3300025949 | Bacteria | 1073 |
| 635 | Ga0207667_11957021 | 3300025949 | Bacteria | 547 |
| 636 | Ga0207651_10003558 | 3300025960 | Bacteria | 7657 |
| 637 | Ga0207651_11009711 | 3300025960 | Bacteria | 744 |
| 638 | Ga0207712_10026658 | 3300025961 | Bacteria | 3853 |
| 639 | Ga0207712_10063662 | 3300025961 | Bacteria | 2626 |
| 640 | Ga0207668_10022020 | 3300025972 | Bacteria | 4072 |
| 641 | Ga0207668_10069658 | 3300025972 | Bacteria | 2505 |
| 642 | Ga0207640_10032889 | 3300025981 | Bacteria | 3220 |
| 643 | Ga0207640_10063034 | 3300025981 | Bacteria | 2462 |
| 644 | Ga0207640_10094115 | 3300025981 | Bacteria | 2083 |
| 645 | Ga0207640_10613460 | 3300025981 | Bacteria | 922 |
| 646 | Ga0207658_10003391 | 3300025986 | Bacteria | 11277 |
| 647 | Ga0207658_10806143 | 3300025986 | Bacteria | 852 |
| 648 | Ga0207658_11893778 | 3300025986 | Bacteria | 543 |
| 649 | Ga0207677_10004281 | 3300026023 | Bacteria | 7637 |
| 650 | Ga0207677_10007921 | 3300026023 | Bacteria | 5908 |
| 651 | Ga0207677_10046591 | 3300026023 | Bacteria | 2904 |
| 652 | Ga0207703_10003490 | 3300026035 | Bacteria | 13160 |
| 653 | Ga0207703_10007555 | 3300026035 | Bacteria | 8621 |
| 654 | Ga0207703_10062375 | 3300026035 | Bacteria | 3054 |
| 655 | Ga0207703_10299661 | 3300026035 | Bacteria | 1466 |
| 656 | Ga0207703_10727815 | 3300026035 | Bacteria | 944 |
| 657 | Ga0207639_10003445 | 3300026041 | Bacteria | 10647 |
| 658 | Ga0207639_10078850 | 3300026041 | Bacteria | 2601 |
| 659 | Ga0207678_10001612 | 3300026067 | Bacteria | 20753 |
| 660 | Ga0207678_10001665 | 3300026067 | Bacteria | 20379 |
| 661 | Ga0207678_10003018 | 3300026067 | Bacteria | 15226 |
| 662 | Ga0207678_10004699 | 3300026067 | Bacteria | 12252 |
| 663 | Ga0207678_10009514 | 3300026067 | Bacteria | 8551 |
| 664 | Ga0207678_11060377 | 3300026067 | Bacteria | 717 |
| 665 | Ga0207708_10073017 | 3300026075 | Bacteria | 2629 |
| 666 | Ga0207708_10494453 | 3300026075 | Bacteria | 1024 |
| 667 | Ga0207702_10313960 | 3300026078 | Bacteria | 1491 |
| 668 | Ga0207702_10381932 | 3300026078 | Unclassified | 1355 |
| 669 | Ga0207702_10604602 | 3300026078 | Bacteria | 1076 |
| 670 | Ga0207702_10651855 | 3300026078 | Bacteria | 1035 |
| 671 | Ga0207702_11049392 | 3300026078 | Bacteria | 809 |
| 672 | Ga0207641_10000052 | 3300026088 | Bacteria | 173672 |
| 673 | Ga0207641_10020552 | 3300026088 | Bacteria | 5424 |
| 674 | Ga0207641_10243221 | 3300026088 | Bacteria | 1678 |
| 675 | Ga0207641_12338937 | 3300026088 | Bacteria | 534 |
| 676 | Ga0207648_10003962 | 3300026089 | Bacteria | 15393 |
| 677 | Ga0207648_10026519 | 3300026089 | Bacteria | 5148 |
| 678 | Ga0207648_10207128 | 3300026089 | Bacteria | 1740 |
| 679 | Ga0207676_10000176 | 3300026095 | Bacteria | 56110 |
| 680 | Ga0207676_10564199 | 3300026095 | Bacteria | 1089 |
| 681 | Ga0207674_10000532 | 3300026116 | Bacteria | 49916 |
| 682 | Ga0207674_10000561 | 3300026116 | Bacteria | 48618 |
| 683 | Ga0207674_10018522 | 3300026116 | Bacteria | 7566 |
| 684 | Ga0207674_11022583 | 3300026116 | Bacteria | 795 |
| 685 | Ga0207675_100005443 | 3300026118 | Bacteria | 12201 |
| 686 | Ga0207675_100029361 | 3300026118 | Bacteria | 5124 |
| 687 | Ga0207675_100180251 | 3300026118 | Bacteria | 2022 |
| 688 | Ga0207683_10001978 | 3300026121 | Bacteria | 18120 |
| 689 | Ga0207683_10091361 | 3300026121 | Bacteria | 2712 |
| 690 | Ga0207698_10130599 | 3300026142 | Bacteria | 2146 |
| 691 | Ga0207698_10170772 | 3300026142 | Bacteria | 1914 |
| 692 | Ga0207698_10639238 | 3300026142 | Bacteria | 1053 |
| 693 | Ga0207698_11746336 | 3300026142 | Bacteria | 637 |
| 694 | Ga0207428_11136042 | 3300027907 | Unclassified | 545 |
| 695 | Ga0265354_1009164 | 3300028016 | Bacteria | 952 |
| 696 | Ga0268266_10001266 | 3300028379 | Bacteria | 30870 |
| 697 | Ga0268266_10023242 | 3300028379 | Bacteria | 5278 |
| 698 | Ga0268266_10252417 | 3300028379 | Bacteria | 1632 |
| 699 | Ga0268265_10008088 | 3300028380 | Bacteria | 7106 |
| 700 | Ga0268265_10042137 | 3300028380 | Bacteria | 3385 |
| 701 | Ga0268265_10044241 | 3300028380 | Bacteria | 3315 |
| 702 | Ga0268265_10048846 | 3300028380 | Bacteria | 3179 |
| 703 | Ga0268265_11651110 | 3300028380 | Bacteria | 646 |
| 704 | Ga0268264_10005269 | 3300028381 | Bacteria | 10950 |
| 705 | Ga0268264_10032165 | 3300028381 | Bacteria | 4304 |
| 706 | Ga0268264_10099564 | 3300028381 | Bacteria | 2523 |
| 707 | Ga0268264_10641535 | 3300028381 | Bacteria | 1050 |
| 708 | Ga0265762_1049939 | 3300030760 | Bacteria | 837 |
| 709 | Ga0265770_1004221 | 3300030878 | Bacteria | 1958 |
| 710 | Ga0265770_1065249 | 3300030878 | Bacteria | 685 |
| 711 | Ga0265779_103065 | 3300031043 | Bacteria | 830 |
| 712 | Ga0265760_10004716 | 3300031090 | Bacteria | 3905 |
| 713 | Ga0265760_10008596 | 3300031090 | Bacteria | 2916 |
| 714 | Ga0265760_10376728 | 3300031090 | Bacteria | 510 |
| 715 | Ga0307405_10081873 | 3300031731 | Bacteria | 2111 |
| 716 | Ga0307410_10009896 | 3300031852 | Bacteria | 5375 |
| 717 | Ga0307410_10056095 | 3300031852 | Bacteria | 2677 |
| 718 | Ga0307406_10292192 | 3300031901 | Bacteria | 1248 |
| 719 | Ga0307406_10565806 | 3300031901 | Bacteria | 932 |
| 720 | Ga0307407_10222083 | 3300031903 | Bacteria | 1278 |
| 721 | Ga0307407_10460864 | 3300031903 | Bacteria | 924 |
| 722 | Ga0307412_10413758 | 3300031911 | Bacteria | 1101 |
| 723 | Ga0307409_100065689 | 3300031995 | Bacteria | 2856 |
| 724 | Ga0307409_100395128 | 3300031995 | Bacteria | 1319 |
| 725 | Ga0307416_100117099 | 3300032002 | Bacteria | 2364 |
| 726 | Ga0307416_103632177 | 3300032002 | Unclassified | 516 |
| 727 | Ga0307414_10305297 | 3300032004 | Bacteria | 1348 |
| 728 | Ga0307414_11901792 | 3300032004 | Bacteria | 555 |
| 729 | Ga0307411_10133285 | 3300032005 | Bacteria | 1819 |
| 730 | Ga0307415_100033737 | 3300032126 | Bacteria | 3324 |
| 731 | Ga0373930_0128935 | 3300034816 | Bacteria | 621 |
| 732 | Ga0373950_0051482 | 3300034818 | Bacteria | 810 |
| 733 | Ga0373958_0008489 | 3300034819 | Bacteria | 1666 |
| 734 | Ga0373938_0024859 | 3300034957 | Bacteria | 1242 |
| 735 | Ga0373926_0006641 | 3300035083 | Bacteria | 3840 |
| 736 | Ga0373926_0229018 | 3300035083 | Bacteria | 718 |
| 737 | Ga0373926_0293215 | 3300035083 | Bacteria | 634 |
| 738 | Ga0373934_0032445 | 3300035086 | Bacteria | 2048 |
| 739 | Ga0373934_0483607 | 3300035086 | Bacteria | 520 |
| 740 | Ga0373940_0133982 | 3300035088 | Bacteria | 778 |
| 741 | Ga0373940_0340897 | 3300035088 | Bacteria | 524 |
| 742 | Ga0373944_0059282 | 3300035089 | Bacteria | 1224 |
| 743 | Ga0373951_0133050 | 3300035091 | Bacteria | 685 |
| 744 | Ga0373923_0024330 | 3300035111 | Bacteria | 2389 |
| 745 | Ga0373923_0310216 | 3300035111 | Bacteria | 748 |
| 746 | Ga0373936_0002329 | 3300035113 | Bacteria | 7114 |
| 747 | Ga0373936_0057996 | 3300035113 | Bacteria | 1576 |
| 748 | Ga0373936_0084349 | 3300035113 | Bacteria | 1326 |
| 749 | Ga0373936_0108171 | 3300035113 | Bacteria | 1178 |
| 750 | Ga0373936_0447052 | 3300035113 | Bacteria | 597 |
| 751 | Ga0373936_0580978 | 3300035113 | Bacteria | 525 |
| 752 | Ga0373939_0025547 | 3300035114 | Bacteria | 1657 |
| 753 | Ga0373941_0098284 | 3300035115 | Bacteria | 1015 |
| 754 | Ga0373945_0026866 | 3300035116 | Bacteria | 2007 |
| 755 | Ga0373945_0154279 | 3300035116 | Bacteria | 932 |
| 756 | Ga0373953_0004886 | 3300035117 | Bacteria | 4312 |
| 757 | Ga0373954_0033288 | 3300035118 | Bacteria | 2384 |
| 758 | Ga0373956_0049629 | 3300035119 | Bacteria | 1882 |
| 759 | Ga0373957_0002069 | 3300035120 | Bacteria | 5626 |
| 760 | Ga0373943_0007759 | 3300035170 | Bacteria | 4819 |
| 761 | Ga0373943_0022407 | 3300035170 | Bacteria | 2927 |
| 762 | Ga0373943_0499492 | 3300035170 | Bacteria | 711 |
| 763 | Ga0373946_0007410 | 3300035171 | Bacteria | 4011 |
| 764 | Ga0373946_0044663 | 3300035171 | Bacteria | 1830 |
| 765 | Ga0373955_0058021 | 3300035172 | Bacteria | 2128 |
| 766 | Ga0373942_0007478 | 3300035207 | Bacteria | 2534 |
| 767 | Ga0373961_0007659 | 3300035241 | Bacteria | 2617 |
| 768 | Ga0373924_0104503 | 3300035410 | Bacteria | 1220 |
| 769 | Ga0373931_0038758 | 3300035691 | Bacteria | 2494 |
| 770 | Ga0373931_0502874 | 3300035691 | Bacteria | 782 |
| 771 | Ga0373935_0008518 | 3300035692 | Bacteria | 6138 |
| 772 | Ga0373935_0015830 | 3300035692 | Bacteria | 4563 |
| 773 | Ga0373935_0025614 | 3300035692 | Bacteria | 3635 |
| 774 | Ga0373935_0053155 | 3300035692 | Bacteria | 2577 |
| 775 | Ga0373935_0625622 | 3300035692 | Bacteria | 788 |
| 776 | Ga0373927_0000747 | 3300035695 | Bacteria | 24845 |
| 777 | Ga0373927_0357281 | 3300035695 | Bacteria | 963 |
| 778 | Ga0373927_0796417 | 3300035695 | Bacteria | 624 |
| 779 | Ga0373933_0007220 | 3300035724 | Bacteria | 6056 |
| 780 | Ga0373933_0398628 | 3300035724 | Bacteria | 897 |
| 781 | Ga0373933_0794002 | 3300035724 | Bacteria | 623 |
| 782 | Ga0373947_0004951 | 3300035725 | Bacteria | 7791 |
| 783 | Ga0373947_0070018 | 3300035725 | Bacteria | 2148 |
| 784 | Ga0373937_0080212 | 3300036401 | Bacteria | 3017 |
| 785 | Ga0373937_0522682 | 3300036401 | Bacteria | 1128 |
| 786 | Ga0373937_0535257 | 3300036401 | Bacteria | 1113 |
| 787 | Ga0373937_1856388 | 3300036401 | Unclassified | 549 |
| 788 | Ga0373925_0010801 | 3300037068 | Bacteria | 6620 |
| 789 | Ga0373925_0012340 | 3300037068 | Bacteria | 6185 |
| 790 | Ga0373925_0016522 | 3300037068 | Bacteria | 5347 |
| 791 | Ga0373925_0589476 | 3300037068 | Bacteria | 915 |
| 792 | Ga0395900_0666890 | 3300037418 | Bacteria | 976 |
| 793 | Ga0395898_1067496 | 3300037466 | Bacteria | 742 |
| 794 | Ga0436364_1058287 | 3300037853 | Bacteria | 1905 |
| 795 | Ga0395901_0719389 | 3300038443 | Bacteria | 994 |
| 796 | Ga0436365_1143939 | 3300039437 | Bacteria | 1784 |
| 797 | Ga0436365_1246521 | 3300039437 | Bacteria | 1504 |
| 798 | Ga0436365_1865271 | 3300039437 | Unclassified | 706 |
| 799 | Ga0436363_0216863 | 3300039450 | Bacteria | 882 |
| 800 | Ga0436363_0229397 | 3300039450 | Bacteria | 4283 |
| 801 | Ga0436363_0929382 | 3300039450 | Bacteria | 660 |
| 802 | Ga0436363_1116219 | 3300039450 | Bacteria | 1283 |
| 803 | Ga0466963_0109483 | 3300044694 | Bacteria | 1895 |
| 804 | Ga0466963_1138627 | 3300044694 | Bacteria | 549 |
| 805 | Ga0453684_1249722 | 3300044712 | Bacteria | 777 |
| 806 | Ga0466968_0617027 | 3300044735 | Bacteria | 549 |
| 807 | Ga0466957_0917972 | 3300044842 | Bacteria | 626 |
| 808 | Ga0466967_0047517 | 3300045976 | Bacteria | 3742 |
| 809 | Ga0466967_0566816 | 3300045976 | Bacteria | 1118 |
| 810 | Ga0466967_1605092 | 3300045976 | Unclassified | 648 |
| 811 | Ga0495590_0402543 | 3300046457 | Bacteria | 525 |
| 812 | Ga0495653_0132131 | 3300046463 | Bacteria | 1766 |
| 813 | Ga0495580_0001673 | 3300046472 | Bacteria | 19470 |
| 814 | Ga0495580_0016664 | 3300046472 | Bacteria | 5514 |
| 815 | Ga0495580_0039298 | 3300046472 | Bacteria | 3385 |
| 816 | Ga0495582_0000596 | 3300046473 | Bacteria | 19949 |
| 817 | Ga0495664_0255287 | 3300046477 | Bacteria | 1060 |
| 818 | Ga0495585_0277198 | 3300046492 | Bacteria | 830 |
| 819 | Ga0495628_0141274 | 3300046516 | Bacteria | 1838 |
| 820 | Ga0495628_0225731 | 3300046516 | Bacteria | 1405 |
| 821 | Ga0495630_0528840 | 3300046517 | Bacteria | 904 |
| 822 | Ga0495630_0903834 | 3300046517 | Bacteria | 672 |
| 823 | Ga0495642_0399567 | 3300046528 | Bacteria | 606 |
| 824 | Ga0495652_0378246 | 3300046529 | Bacteria | 1008 |
| 825 | Ga0495665_0000974 | 3300046531 | Bacteria | 15176 |
| 826 | Ga0495586_0201724 | 3300046535 | Bacteria | 1128 |
| 827 | Ga0495586_0491546 | 3300046535 | Bacteria | 708 |
| 828 | Ga0495587_0415791 | 3300046536 | Bacteria | 747 |
| 829 | Ga0495645_0006005 | 3300046543 | Bacteria | 8397 |
| 830 | Ga0495633_0104229 | 3300046558 | Bacteria | 1316 |
| 831 | Ga0495635_0138410 | 3300046663 | Bacteria | 1659 |
| 832 | Ga0495659_0296784 | 3300046664 | Unclassified | 682 |
| 833 | Ga0495623_0609464 | 3300046679 | Unclassified | 566 |
| 834 | Ga0495658_0040249 | 3300046683 | Bacteria | 2598 |
| 835 | Ga0495669_0033508 | 3300046684 | Bacteria | 2261 |
| 836 | Ga0495669_0262383 | 3300046684 | Bacteria | 830 |
| 837 | Ga0495669_0293526 | 3300046684 | Bacteria | 783 |
| 838 | Ga0495669_0303024 | 3300046684 | Bacteria | 770 |
| 839 | Ga0495624_0083349 | 3300046690 | Bacteria | 1977 |
| 840 | Ga0495624_0156645 | 3300046690 | Bacteria | 1392 |
| 841 | Ga0495624_0623569 | 3300046690 | Bacteria | 642 |
| 842 | Ga0495589_0316866 | 3300046794 | Bacteria | 721 |
| 843 | Ga0495581_0456823 | 3300047315 | Bacteria | 744 |
| 844 | Ga0495581_0580947 | 3300047315 | Bacteria | 649 |
| 845 | Ga0495674_0057042 | 3300047319 | Bacteria | 3419 |
| 846 | Ga0495674_0614348 | 3300047319 | Bacteria | 860 |
| 847 | Ga0495674_0710186 | 3300047319 | Bacteria | 788 |
| 848 | Ga0495676_0419087 | 3300047321 | Bacteria | 886 |
| 849 | Ga0495602_0106256 | 3300048088 | Bacteria | 2292 |
| 850 | Ga0495602_0151654 | 3300048088 | Bacteria | 1821 |
| 851 | Ga0496100_0028457 | 3300048903 | Bacteria | 3447 |
| 852 | Ga0496100_0034107 | 3300048903 | Bacteria | 3191 |
| 853 | Ga0496100_0243051 | 3300048903 | Bacteria | 1329 |
| 854 | Ga0496100_0965606 | 3300048903 | Bacteria | 670 |
| 855 | Ga0496101_0011221 | 3300048904 | Bacteria | 5935 |
| 856 | Ga0496101_0024487 | 3300048904 | Bacteria | 4178 |
| 857 | Ga0496101_0063740 | 3300048904 | Bacteria | 2684 |
| 858 | Ga0496101_1040896 | 3300048904 | Bacteria | 643 |
| 859 | Ga0496102_0003212 | 3300048905 | Bacteria | 13867 |
| 860 | Ga0496102_0021206 | 3300048905 | Bacteria | 5746 |
| 861 | Ga0496102_0082208 | 3300048905 | Bacteria | 2970 |
| 862 | Ga0496102_0283396 | 3300048905 | Bacteria | 1562 |
| 863 | Ga0496102_0576757 | 3300048905 | Bacteria | 1048 |
| 864 | Ga0496102_0733808 | 3300048905 | Bacteria | 910 |
| 865 | Ga0496103_0110851 | 3300048906 | Bacteria | 1743 |
| 866 | Ga0496103_0254260 | 3300048906 | Bacteria | 1131 |
| 867 | Ga0496103_0677472 | 3300048906 | Bacteria | 654 |
| 868 | Ga0496104_0025955 | 3300048907 | Bacteria | 5403 |
| 869 | Ga0496104_0076564 | 3300048907 | Bacteria | 3187 |
| 870 | Ga0496104_0233662 | 3300048907 | Bacteria | 1750 |
| 871 | Ga0496104_0416050 | 3300048907 | Bacteria | 1257 |
| 872 | Ga0496104_0637327 | 3300048907 | Bacteria | 975 |
| 873 | Ga0496105_0394699 | 3300048908 | Bacteria | 1099 |
| 874 | Ga0496106_0020191 | 3300048909 | Bacteria | 4943 |
| 875 | Ga0496106_0132634 | 3300048909 | Bacteria | 1954 |
| 876 | Ga0496106_0159342 | 3300048909 | Bacteria | 1784 |
| 877 | Ga0496106_0215487 | 3300048909 | Bacteria | 1530 |
| 878 | Ga0496107_0368605 | 3300048910 | Bacteria | 1068 |
| 879 | Ga0496108_0000242 | 3300048911 | Bacteria | 48793 |
| 880 | Ga0496109_0000120 | 3300048912 | Bacteria | 81828 |
| 881 | Ga0496109_0034010 | 3300048912 | Bacteria | 4588 |
| 882 | Ga0496109_0141665 | 3300048912 | Bacteria | 2248 |
| 883 | Ga0496109_0753661 | 3300048912 | Bacteria | 911 |
| 884 | Ga0496110_0000795 | 3300048913 | Bacteria | 22036 |
| 885 | Ga0496110_0063397 | 3300048913 | Bacteria | 3266 |
| 886 | Ga0496111_0341124 | 3300048914 | Bacteria | 1109 |
| 887 | Ga0496112_0000198 | 3300048915 | Bacteria | 39413 |
| 888 | Ga0496112_0051891 | 3300048915 | Bacteria | 4023 |
| 889 | Ga0496112_0086077 | 3300048915 | Bacteria | 3110 |
| 890 | Ga0496112_0184937 | 3300048915 | Bacteria | 2047 |
| 891 | Ga0496112_0478973 | 3300048915 | Bacteria | 1181 |
| 892 | Ga0496113_0000111 | 3300048916 | Bacteria | 35094 |
| 893 | Ga0496113_0009232 | 3300048916 | Bacteria | 6470 |
| 894 | Ga0496114_0332010 | 3300048917 | Bacteria | 1344 |
| 895 | Ga0496114_1362103 | 3300048917 | Bacteria | 597 |
| 896 | Ga0496115_0018551 | 3300048918 | Bacteria | 5344 |
| 897 | Ga0496115_0036914 | 3300048918 | Bacteria | 3870 |
| 898 | Ga0496126_0000209 | 3300048929 | Bacteria | 131440 |
| 899 | Ga0496126_0504148 | 3300048929 | Bacteria | 967 |
| 900 | Ga0501297_020717 | 3300049520 | Bacteria | 821 |
| 901 | Ga0501033_0303644 | 3300049570 | Bacteria | 1123 |
| 902 | Ga0501036_1287506 | 3300049572 | Bacteria | 594 |
| 903 | Ga0501037_0257028 | 3300049573 | Bacteria | 1221 |
| 904 | Ga0501038_0152997 | 3300049574 | Bacteria | 1880 |
| 905 | Ga0501043_0152835 | 3300049579 | Bacteria | 1806 |
| 906 | Ga0501047_0612288 | 3300049581 | Bacteria | 910 |
| 907 | Ga0501070_0042215 | 3300049586 | Bacteria | 3799 |
| 908 | Ga0501073_0105958 | 3300049589 | Bacteria | 1951 |
| 909 | Ga0501202_069189 | 3300049652 | Bacteria | 811 |
| 910 | Ga0501083_0089368 | 3300049744 | Bacteria | 2036 |
| 911 | Ga0501083_0305202 | 3300049744 | Bacteria | 1035 |
| 912 | Ga0501274_036137 | 3300049771 | Bacteria | 577 |
| 913 | Ga0501035_0248371 | 3300049822 | Bacteria | 1512 |
| 914 | Ga0501044_0296343 | 3300049823 | Bacteria | 1547 |
| 915 | Ga0501045_0459110 | 3300049824 | Bacteria | 947 |
| 916 | nmdc:mga0n895_1101194_c1 | 3300050512 | Bacteria | 772 |
| 917 | nmdc:mga0n895_133428_c1 | 3300050512 | Bacteria | 2509 |
| 918 | nmdc:mga0n895_1691134_c1 | 3300050512 | Bacteria | 595 |
| 919 | nmdc:mga0n895_344_c1 | 3300050512 | Bacteria | 31117 |
| 920 | nmdc:mga0n895_883053_c1 | 3300050512 | Bacteria | 880 |
| 921 | nmdc:mga0rr50_40640_c1 | 3300050513 | Bacteria | 3383 |
| 922 | nmdc:mga0rr50_548981_c1 | 3300050513 | Bacteria | 984 |
| 923 | nmdc:mga0rr50_775389_c1 | 3300050513 | Bacteria | 818 |
| 924 | nmdc:mga0rr50_872_c1 | 3300050513 | Bacteria | 16295 |
| 925 | nmdc:mga08x19_1025009_c1 | 3300050514 | Bacteria | 586 |
| 926 | nmdc:mga08x19_3391_c1 | 3300050514 | Bacteria | 9503 |
| 927 | nmdc:mga08x19_51227_c1 | 3300050514 | Bacteria | 2651 |
| 928 | nmdc:mga08x19_9637_c1 | 3300050514 | Bacteria | 5785 |
| 929 | nmdc:mga0a205_7367_c1 | 3300050515 | Bacteria | 9965 |
| 930 | Ga0495612_0444526 | 3300053078 | Bacteria | 592 |
| 931 | Ga0495595_0096836 | 3300053084 | Bacteria | 1421 |
| 932 | Ga0495619_0624095 | 3300053085 | Bacteria | 736 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025913 | Ga0207695_10000354 | Ga0207695_1000035496 | 61 |
| 2 | 3300001979 | JGI24740J21852_10091596 | JGI24740J21852_100915962 | 63 |
| 3 | 3300005327 | Ga0070658_10031905 | Ga0070658_100319053 | 63 |
| 4 | 3300005327 | Ga0070658_10050557 | Ga0070658_100505571 | 63 |
| 5 | 3300005327 | Ga0070658_10077132 | Ga0070658_100771322 | 63 |
| 6 | 3300005329 | Ga0070683_100051474 | Ga0070683_1000514747 | 63 |
| 7 | 3300005336 | Ga0070680_100014163 | Ga0070680_1000141636 | 63 |
| 8 | 3300005336 | Ga0070680_101581496 | Ga0070680_1015814962 | 63 |
| 9 | 3300005339 | Ga0070660_100056691 | Ga0070660_1000566914 | 63 |
| 10 | 3300005344 | Ga0070661_100136525 | Ga0070661_1001365253 | 63 |
| 11 | 3300005366 | Ga0070659_100182952 | Ga0070659_1001829524 | 63 |
| 12 | 3300005435 | Ga0070714_102361963 | Ga0070714_1023619631 | 63 |
| 13 | 3300005436 | Ga0070713_100058153 | Ga0070713_1000581533 | 63 |
| 14 | 3300005455 | Ga0070663_100012394 | Ga0070663_1000123944 | 63 |
| 15 | 3300005455 | Ga0070663_100121663 | Ga0070663_1001216633 | 63 |
| 16 | 3300005455 | Ga0070663_100274893 | Ga0070663_1002748933 | 63 |
| 17 | 3300005455 | Ga0070663_100325180 | Ga0070663_1003251803 | 63 |
| 18 | 3300005458 | Ga0070681_10232825 | Ga0070681_102328253 | 63 |
| 19 | 3300005458 | Ga0070681_10263683 | Ga0070681_102636832 | 63 |
| 20 | 3300005458 | Ga0070681_10549485 | Ga0070681_105494854 | 63 |
| 21 | 3300005458 | Ga0070681_11580077 | Ga0070681_115800771 | 63 |
| 22 | 3300005530 | Ga0070679_100113302 | Ga0070679_1001133022 | 63 |
| 23 | 3300005530 | Ga0070679_100479152 | Ga0070679_1004791522 | 63 |
| 24 | 3300005530 | Ga0070679_100895746 | Ga0070679_1008957462 | 63 |
| 25 | 3300005530 | Ga0070679_101990579 | Ga0070679_1019905792 | 63 |
| 26 | 3300005535 | Ga0070684_100136427 | Ga0070684_1001364273 | 63 |
| 27 | 3300005535 | Ga0070684_102236594 | Ga0070684_1022365941 | 63 |
| 28 | 3300005539 | Ga0068853_100135035 | Ga0068853_1001350351 | 63 |
| 29 | 3300005563 | Ga0068855_100003825 | Ga0068855_10000382516 | 63 |
| 30 | 3300005563 | Ga0068855_100035485 | Ga0068855_1000354854 | 63 |
| 31 | 3300005563 | Ga0068855_100084699 | Ga0068855_1000846994 | 63 |
| 32 | 3300005564 | Ga0070664_101239338 | Ga0070664_1012393382 | 63 |
| 33 | 3300005577 | Ga0068857_100103614 | Ga0068857_1001036145 | 63 |
| 34 | 3300005577 | Ga0068857_101295819 | Ga0068857_1012958192 | 63 |
| 35 | 3300005578 | Ga0068854_100038966 | Ga0068854_1000389663 | 63 |
| 36 | 3300005614 | Ga0068856_100995425 | Ga0068856_1009954252 | 63 |
| 37 | 3300006028 | Ga0070717_11840801 | Ga0070717_118408012 | 63 |
| 38 | 3300007788 | Ga0099795_10581479 | Ga0099795_105814791 | 63 |
| 39 | 3300009093 | Ga0105240_10100771 | Ga0105240_101007715 | 63 |
| 40 | 3300009093 | Ga0105240_10119015 | Ga0105240_101190153 | 63 |
| 41 | 3300009093 | Ga0105240_10947580 | Ga0105240_109475802 | 63 |
| 42 | 3300009093 | Ga0105240_11067984 | Ga0105240_110679842 | 63 |
| 43 | 3300009174 | Ga0105241_11693131 | Ga0105241_116931311 | 63 |
| 44 | 3300009545 | Ga0105237_10054319 | Ga0105237_100543192 | 63 |
| 45 | 3300009551 | Ga0105238_10066071 | Ga0105238_100660717 | 63 |
| 46 | 3300009551 | Ga0105238_11185071 | Ga0105238_111850712 | 63 |
| 47 | 3300013100 | Ga0157373_10182467 | Ga0157373_101824674 | 63 |
| 48 | 3300013102 | Ga0157371_10393943 | Ga0157371_103939432 | 63 |
| 49 | 3300013102 | Ga0157371_11363521 | Ga0157371_113635212 | 63 |
| 50 | 3300013104 | Ga0157370_10052220 | Ga0157370_100522202 | 63 |
| 51 | 3300013104 | Ga0157370_10139289 | Ga0157370_101392892 | 63 |
| 52 | 3300013104 | Ga0157370_10182358 | Ga0157370_101823581 | 63 |
| 53 | 3300013104 | Ga0157370_10263820 | Ga0157370_102638204 | 63 |
| 54 | 3300013104 | Ga0157370_10983243 | Ga0157370_109832432 | 63 |
| 55 | 3300013104 | Ga0157370_11611145 | Ga0157370_116111452 | 63 |
| 56 | 3300013105 | Ga0157369_10132317 | Ga0157369_101323175 | 63 |
| 57 | 3300013105 | Ga0157369_10157533 | Ga0157369_101575333 | 63 |
| 58 | 3300013307 | Ga0157372_10003780 | Ga0157372_100037808 | 63 |
| 59 | 3300013307 | Ga0157372_10143192 | Ga0157372_101431925 | 63 |
| 60 | 3300013307 | Ga0157372_10207483 | Ga0157372_102074833 | 63 |
| 61 | 3300013307 | Ga0157372_10378037 | Ga0157372_103780373 | 63 |
| 62 | 3300013307 | Ga0157372_11084067 | Ga0157372_110840672 | 63 |
| 63 | 3300013307 | Ga0157372_11727945 | Ga0157372_117279452 | 63 |
| 64 | 3300020069 | Ga0197907_10857682 | Ga0197907_108576821 | 63 |
| 65 | 3300025904 | Ga0207647_10027808 | Ga0207647_100278082 | 63 |
| 66 | 3300025906 | Ga0207699_10985932 | Ga0207699_109859321 | 63 |
| 67 | 3300025909 | Ga0207705_10000048 | Ga0207705_10000048151 | 63 |
| 68 | 3300025909 | Ga0207705_10003420 | Ga0207705_100034205 | 63 |
| 69 | 3300025909 | Ga0207705_10065077 | Ga0207705_100650772 | 63 |
| 70 | 3300025909 | Ga0207705_11506803 | Ga0207705_115068031 | 63 |
| 71 | 3300025911 | Ga0207654_11373958 | Ga0207654_113739581 | 63 |
| 72 | 3300025912 | Ga0207707_10212758 | Ga0207707_102127582 | 63 |
| 73 | 3300025912 | Ga0207707_10232877 | Ga0207707_102328773 | 63 |
| 74 | 3300025912 | Ga0207707_10682379 | Ga0207707_106823791 | 63 |
| 75 | 3300025913 | Ga0207695_10212432 | Ga0207695_102124324 | 63 |
| 76 | 3300025913 | Ga0207695_10383190 | Ga0207695_103831903 | 63 |
| 77 | 3300025913 | Ga0207695_10568006 | Ga0207695_105680062 | 63 |
| 78 | 3300025914 | Ga0207671_10104506 | Ga0207671_101045062 | 63 |
| 79 | 3300025917 | Ga0207660_10048721 | Ga0207660_100487212 | 63 |
| 80 | 3300025919 | Ga0207657_10000823 | Ga0207657_100008235 | 63 |
| 81 | 3300025919 | Ga0207657_10403388 | Ga0207657_104033883 | 63 |
| 82 | 3300025920 | Ga0207649_10238356 | Ga0207649_102383563 | 63 |
| 83 | 3300025921 | Ga0207652_10078648 | Ga0207652_100786482 | 63 |
| 84 | 3300025921 | Ga0207652_10275621 | Ga0207652_102756213 | 63 |
| 85 | 3300025921 | Ga0207652_11399645 | Ga0207652_113996452 | 63 |
| 86 | 3300025924 | Ga0207694_10200446 | Ga0207694_102004462 | 63 |
| 87 | 3300025928 | Ga0207700_10003657 | Ga0207700_100036577 | 63 |
| 88 | 3300025929 | Ga0207664_10899625 | Ga0207664_108996251 | 63 |
| 89 | 3300025932 | Ga0207690_10087591 | Ga0207690_100875915 | 63 |
| 90 | 3300025944 | Ga0207661_10027213 | Ga0207661_100272138 | 63 |
| 91 | 3300025945 | Ga0207679_10327006 | Ga0207679_103270062 | 63 |
| 92 | 3300025949 | Ga0207667_10008444 | Ga0207667_1000844412 | 63 |
| 93 | 3300025949 | Ga0207667_10086319 | Ga0207667_100863194 | 63 |
| 94 | 3300025949 | Ga0207667_10125234 | Ga0207667_101252345 | 63 |
| 95 | 3300025949 | Ga0207667_10636376 | Ga0207667_106363763 | 63 |
| 96 | 3300025981 | Ga0207640_10032889 | Ga0207640_100328894 | 63 |
| 97 | 3300026041 | Ga0207639_10078850 | Ga0207639_100788501 | 63 |
| 98 | 3300026067 | Ga0207678_10001665 | Ga0207678_100016655 | 63 |
| 99 | 3300026067 | Ga0207678_10004699 | Ga0207678_100046995 | 63 |
| 100 | 3300026067 | Ga0207678_10009514 | Ga0207678_1000951414 | 63 |
| 101 | 3300026078 | Ga0207702_10651855 | Ga0207702_106518551 | 63 |
| 102 | 3300026116 | Ga0207674_10000532 | Ga0207674_1000053221 | 63 |
| 103 | 3300031090 | Ga0265760_10376728 | Ga0265760_103767281 | 63 |
| 104 | 3300037418 | Ga0395900_0666890 | Ga0395900_0666890_217_411 | 63 |
| 105 | 3300044694 | Ga0466963_0109483 | Ga0466963_0109483_1015_1209 | 63 |
| 106 | 3300045976 | Ga0466967_0566816 | Ga0466967_0566816_827_1021 | 63 |
| 107 | 3300046477 | Ga0495664_0255287 | Ga0495664_0255287_696_890 | 63 |
| 108 | 3300046492 | Ga0495585_0277198 | Ga0495585_0277198_612_806 | 63 |
| 109 | 3300046516 | Ga0495628_0141274 | Ga0495628_0141274_587_781 | 63 |
| 110 | 3300046543 | Ga0495645_0006005 | Ga0495645_0006005_8078_8272 | 63 |
| 111 | 3300046558 | Ga0495633_0104229 | Ga0495633_0104229_132_326 | 63 |
| 112 | 3300048929 | Ga0496126_0000209 | Ga0496126_0000209_121004_121198 | 63 |
| 113 | 3300049570 | Ga0501033_0303644 | Ga0501033_0303644_319_513 | 63 |
| 114 | 3300049572 | Ga0501036_1287506 | Ga0501036_1287506_210_404 | 63 |
| 115 | 3300049573 | Ga0501037_0257028 | Ga0501037_0257028_420_614 | 63 |
| 116 | 3300049574 | Ga0501038_0152997 | Ga0501038_0152997_678_872 | 63 |
| 117 | 3300049579 | Ga0501043_0152835 | Ga0501043_0152835_560_754 | 63 |
| 118 | 3300049581 | Ga0501047_0612288 | Ga0501047_0612288_646_840 | 63 |
| 119 | 3300049586 | Ga0501070_0042215 | Ga0501070_0042215_889_1083 | 63 |
| 120 | 3300049589 | Ga0501073_0105958 | Ga0501073_0105958_89_283 | 63 |
| 121 | 3300049822 | Ga0501035_0248371 | Ga0501035_0248371_331_525 | 63 |
| 122 | 3300049823 | Ga0501044_0296343 | Ga0501044_0296343_94_288 | 63 |
| 123 | 3300049824 | Ga0501045_0459110 | Ga0501045_0459110_722_916 | 63 |
| 124 | 3300005435 | Ga0070714_100432677 | Ga0070714_1004326773 | 64 |
| 125 | 3300005445 | Ga0070708_100015435 | Ga0070708_1000154354 | 64 |
| 126 | 3300005445 | Ga0070708_100964934 | Ga0070708_1009649341 | 64 |
| 127 | 3300005536 | Ga0070697_100231449 | Ga0070697_1002314491 | 64 |
| 128 | 3300025910 | Ga0207684_10051620 | Ga0207684_100516202 | 64 |
| 129 | 3300025922 | Ga0207646_10057056 | Ga0207646_100570564 | 64 |
| 130 | 3300025929 | Ga0207664_11535382 | Ga0207664_115353821 | 64 |
| 131 | 3300005467 | Ga0070706_100000514 | Ga0070706_10000051420 | 65 |
| 132 | 3300005468 | Ga0070707_100000662 | Ga0070707_10000066212 | 65 |
| 133 | 3300005471 | Ga0070698_100004533 | Ga0070698_10000453315 | 65 |
| 134 | 3300005518 | Ga0070699_100003886 | Ga0070699_10000388616 | 65 |
| 135 | 3300005518 | Ga0070699_101428219 | Ga0070699_1014282192 | 65 |
| 136 | 3300005536 | Ga0070697_100008091 | Ga0070697_10000809112 | 65 |
| 137 | 3300005536 | Ga0070697_100567811 | Ga0070697_1005678112 | 65 |
| 138 | 3300005536 | Ga0070697_101943627 | Ga0070697_1019436271 | 65 |
| 139 | 3300005545 | Ga0070695_100093115 | Ga0070695_1000931152 | 65 |
| 140 | 3300006028 | Ga0070717_11977549 | Ga0070717_119775492 | 65 |
| 141 | 3300006237 | Ga0097621_100276146 | Ga0097621_1002761462 | 65 |
| 142 | 3300006852 | Ga0075433_11034281 | Ga0075433_110342811 | 65 |
| 143 | 3300025910 | Ga0207684_10000614 | Ga0207684_1000061438 | 65 |
| 144 | 3300025922 | Ga0207646_10004899 | Ga0207646_1000489912 | 65 |
| 145 | 3300035113 | Ga0373936_0057996 | Ga0373936_0057996_262_462 | 65 |
| 146 | 3300035692 | Ga0373935_0025614 | Ga0373935_0025614_333_533 | 65 |
| 147 | 3300037068 | Ga0373925_0010801 | Ga0373925_0010801_1700_1900 | 65 |
| 148 | 3300046664 | Ga0495659_0296784 | Ga0495659_0296784_43_246 | 65 |
| 149 | 3300048907 | Ga0496104_0025955 | Ga0496104_0025955_588_791 | 65 |
| 150 | 3300048915 | Ga0496112_0086077 | Ga0496112_0086077_257_460 | 65 |
| 151 | 3300005330 | Ga0070690_100174565 | Ga0070690_1001745653 | 66 |
| 152 | 3300005334 | Ga0068869_100001846 | Ga0068869_10000184612 | 66 |
| 153 | 3300005335 | Ga0070666_10410582 | Ga0070666_104105822 | 66 |
| 154 | 3300005337 | Ga0070682_100392440 | Ga0070682_1003924402 | 66 |
| 155 | 3300005338 | Ga0068868_100002791 | Ga0068868_1000027915 | 66 |
| 156 | 3300005338 | Ga0068868_100022874 | Ga0068868_1000228745 | 66 |
| 157 | 3300005354 | Ga0070675_101583510 | Ga0070675_1015835102 | 66 |
| 158 | 3300005364 | Ga0070673_100297904 | Ga0070673_1002979041 | 66 |
| 159 | 3300005367 | Ga0070667_101685996 | Ga0070667_1016859962 | 66 |
| 160 | 3300005367 | Ga0070667_102264942 | Ga0070667_1022649421 | 66 |
| 161 | 3300005434 | Ga0070709_11338413 | Ga0070709_113384131 | 66 |
| 162 | 3300005435 | Ga0070714_100000096 | Ga0070714_10000009664 | 66 |
| 163 | 3300005436 | Ga0070713_101994857 | Ga0070713_1019948571 | 66 |
| 164 | 3300005439 | Ga0070711_100094452 | Ga0070711_1000944523 | 66 |
| 165 | 3300005439 | Ga0070711_101287725 | Ga0070711_1012877252 | 66 |
| 166 | 3300005440 | Ga0070705_101746208 | Ga0070705_1017462082 | 66 |
| 167 | 3300005441 | Ga0070700_100657562 | Ga0070700_1006575622 | 66 |
| 168 | 3300005445 | Ga0070708_100003510 | Ga0070708_1000035103 | 66 |
| 169 | 3300005445 | Ga0070708_100069047 | Ga0070708_1000690474 | 66 |
| 170 | 3300005445 | Ga0070708_100555134 | Ga0070708_1005551342 | 66 |
| 171 | 3300005466 | Ga0070685_10201038 | Ga0070685_102010382 | 66 |
| 172 | 3300005467 | Ga0070706_100014580 | Ga0070706_1000145801 | 66 |
| 173 | 3300005467 | Ga0070706_100811981 | Ga0070706_1008119811 | 66 |
| 174 | 3300005468 | Ga0070707_100005126 | Ga0070707_1000051263 | 66 |
| 175 | 3300005468 | Ga0070707_100033790 | Ga0070707_1000337905 | 66 |
| 176 | 3300005471 | Ga0070698_100002449 | Ga0070698_10000244921 | 66 |
| 177 | 3300005471 | Ga0070698_100169617 | Ga0070698_1001696173 | 66 |
| 178 | 3300005518 | Ga0070699_100000441 | Ga0070699_10000044116 | 66 |
| 179 | 3300005518 | Ga0070699_100089928 | Ga0070699_1000899285 | 66 |
| 180 | 3300005536 | Ga0070697_100001451 | Ga0070697_10000145113 | 66 |
| 181 | 3300005536 | Ga0070697_100005121 | Ga0070697_1000051218 | 66 |
| 182 | 3300005536 | Ga0070697_100556823 | Ga0070697_1005568231 | 66 |
| 183 | 3300005548 | Ga0070665_100288347 | Ga0070665_1002883473 | 66 |
| 184 | 3300005563 | Ga0068855_100751560 | Ga0068855_1007515602 | 66 |
| 185 | 3300005614 | Ga0068856_100481787 | Ga0068856_1004817873 | 66 |
| 186 | 3300005614 | Ga0068856_101607101 | Ga0068856_1016071012 | 66 |
| 187 | 3300005616 | Ga0068852_100884894 | Ga0068852_1008848942 | 66 |
| 188 | 3300005617 | Ga0068859_100025042 | Ga0068859_10002504210 | 66 |
| 189 | 3300005719 | Ga0068861_100165678 | Ga0068861_1001656783 | 66 |
| 190 | 3300005834 | Ga0068851_10581704 | Ga0068851_105817042 | 66 |
| 191 | 3300005834 | Ga0068851_10702608 | Ga0068851_107026082 | 66 |
| 192 | 3300005841 | Ga0068863_100169911 | Ga0068863_1001699113 | 66 |
| 193 | 3300005842 | Ga0068858_100042739 | Ga0068858_1000427394 | 66 |
| 194 | 3300005842 | Ga0068858_100066188 | Ga0068858_1000661883 | 66 |
| 195 | 3300005842 | Ga0068858_101682143 | Ga0068858_1016821432 | 66 |
| 196 | 3300005843 | Ga0068860_100018016 | Ga0068860_1000180166 | 66 |
| 197 | 3300005843 | Ga0068860_100253033 | Ga0068860_1002530332 | 66 |
| 198 | 3300005844 | Ga0068862_102020393 | Ga0068862_1020203931 | 66 |
| 199 | 3300006028 | Ga0070717_10002614 | Ga0070717_1000261411 | 66 |
| 200 | 3300006028 | Ga0070717_10118628 | Ga0070717_101186282 | 66 |
| 201 | 3300006163 | Ga0070715_10572066 | Ga0070715_105720661 | 66 |
| 202 | 3300006237 | Ga0097621_100007525 | Ga0097621_1000075259 | 66 |
| 203 | 3300006237 | Ga0097621_100013773 | Ga0097621_1000137733 | 66 |
| 204 | 3300006358 | Ga0068871_100014064 | Ga0068871_1000140648 | 66 |
| 205 | 3300006358 | Ga0068871_100473609 | Ga0068871_1004736093 | 66 |
| 206 | 3300006871 | Ga0075434_100792676 | Ga0075434_1007926762 | 66 |
| 207 | 3300006881 | Ga0068865_100044651 | Ga0068865_1000446515 | 66 |
| 208 | 3300006881 | Ga0068865_101556661 | Ga0068865_1015566611 | 66 |
| 209 | 3300006881 | Ga0068865_101889644 | Ga0068865_1018896442 | 66 |
| 210 | 3300006914 | Ga0075436_100744057 | Ga0075436_1007440572 | 66 |
| 211 | 3300006931 | Ga0097620_100025042 | Ga0097620_10002504210 | 66 |
| 212 | 3300007076 | Ga0075435_101510837 | Ga0075435_1015108372 | 66 |
| 213 | 3300007265 | Ga0099794_10380592 | Ga0099794_103805922 | 66 |
| 214 | 3300009093 | Ga0105240_10154500 | Ga0105240_101545003 | 66 |
| 215 | 3300009098 | Ga0105245_10056662 | Ga0105245_100566623 | 66 |
| 216 | 3300009098 | Ga0105245_10174848 | Ga0105245_101748484 | 66 |
| 217 | 3300009098 | Ga0105245_10261930 | Ga0105245_102619301 | 66 |
| 218 | 3300009174 | Ga0105241_10127889 | Ga0105241_101278892 | 66 |
| 219 | 3300009174 | Ga0105241_10546537 | Ga0105241_105465372 | 66 |
| 220 | 3300009177 | Ga0105248_10157464 | Ga0105248_101574644 | 66 |
| 221 | 3300009545 | Ga0105237_10065790 | Ga0105237_100657907 | 66 |
| 222 | 3300009545 | Ga0105237_10189626 | Ga0105237_101896263 | 66 |
| 223 | 3300009545 | Ga0105237_11714635 | Ga0105237_117146351 | 66 |
| 224 | 3300010375 | Ga0105239_10105513 | Ga0105239_101055135 | 66 |
| 225 | 3300010375 | Ga0105239_12025667 | Ga0105239_120256672 | 66 |
| 226 | 3300013296 | Ga0157374_10012759 | Ga0157374_100127594 | 66 |
| 227 | 3300013296 | Ga0157374_11990054 | Ga0157374_119900541 | 66 |
| 228 | 3300013296 | Ga0157374_12026807 | Ga0157374_120268072 | 66 |
| 229 | 3300013297 | Ga0157378_10000411 | Ga0157378_1000041135 | 66 |
| 230 | 3300013297 | Ga0157378_10010748 | Ga0157378_1001074815 | 66 |
| 231 | 3300013297 | Ga0157378_10575701 | Ga0157378_105757012 | 66 |
| 232 | 3300013306 | Ga0163162_10020357 | Ga0163162_1002035710 | 66 |
| 233 | 3300013306 | Ga0163162_11253334 | Ga0163162_112533342 | 66 |
| 234 | 3300013307 | Ga0157372_11156782 | Ga0157372_111567823 | 66 |
| 235 | 3300013308 | Ga0157375_10583569 | Ga0157375_105835692 | 66 |
| 236 | 3300013308 | Ga0157375_12491633 | Ga0157375_124916332 | 66 |
| 237 | 3300014325 | Ga0163163_13072498 | Ga0163163_130724982 | 66 |
| 238 | 3300014745 | Ga0157377_11326298 | Ga0157377_113262982 | 66 |
| 239 | 3300014968 | Ga0157379_10127587 | Ga0157379_101275871 | 66 |
| 240 | 3300014969 | Ga0157376_10161074 | Ga0157376_101610741 | 66 |
| 241 | 3300021377 | Ga0213874_10013367 | Ga0213874_100133673 | 66 |
| 242 | 3300025321 | Ga0207656_10693245 | Ga0207656_106932451 | 66 |
| 243 | 3300025899 | Ga0207642_10544436 | Ga0207642_105444362 | 66 |
| 244 | 3300025899 | Ga0207642_10591450 | Ga0207642_105914502 | 66 |
| 245 | 3300025904 | Ga0207647_10010629 | Ga0207647_100106292 | 66 |
| 246 | 3300025910 | Ga0207684_10001048 | Ga0207684_1000104819 | 66 |
| 247 | 3300025910 | Ga0207684_10383957 | Ga0207684_103839572 | 66 |
| 248 | 3300025911 | Ga0207654_10217253 | Ga0207654_102172533 | 66 |
| 249 | 3300025911 | Ga0207654_10482174 | Ga0207654_104821742 | 66 |
| 250 | 3300025913 | Ga0207695_10332361 | Ga0207695_103323612 | 66 |
| 251 | 3300025914 | Ga0207671_10042802 | Ga0207671_100428022 | 66 |
| 252 | 3300025916 | Ga0207663_10078557 | Ga0207663_100785573 | 66 |
| 253 | 3300025916 | Ga0207663_11205615 | Ga0207663_112056151 | 66 |
| 254 | 3300025922 | Ga0207646_10001230 | Ga0207646_1000123021 | 66 |
| 255 | 3300025922 | Ga0207646_10059790 | Ga0207646_100597903 | 66 |
| 256 | 3300025924 | Ga0207694_10038536 | Ga0207694_100385363 | 66 |
| 257 | 3300025926 | Ga0207659_11310189 | Ga0207659_113101892 | 66 |
| 258 | 3300025927 | Ga0207687_10032442 | Ga0207687_100324427 | 66 |
| 259 | 3300025927 | Ga0207687_10145758 | Ga0207687_101457583 | 66 |
| 260 | 3300025929 | Ga0207664_10000087 | Ga0207664_1000008773 | 66 |
| 261 | 3300025938 | Ga0207704_10012199 | Ga0207704_100121996 | 66 |
| 262 | 3300025938 | Ga0207704_11392092 | Ga0207704_113920922 | 66 |
| 263 | 3300025941 | Ga0207711_10114604 | Ga0207711_101146041 | 66 |
| 264 | 3300025942 | Ga0207689_10005608 | Ga0207689_1000560818 | 66 |
| 265 | 3300025949 | Ga0207667_11957021 | Ga0207667_119570212 | 66 |
| 266 | 3300025981 | Ga0207640_10613460 | Ga0207640_106134603 | 66 |
| 267 | 3300025986 | Ga0207658_11893778 | Ga0207658_118937782 | 66 |
| 268 | 3300026023 | Ga0207677_10004281 | Ga0207677_100042819 | 66 |
| 269 | 3300026023 | Ga0207677_10046591 | Ga0207677_100465913 | 66 |
| 270 | 3300026035 | Ga0207703_10003490 | Ga0207703_100034906 | 66 |
| 271 | 3300026035 | Ga0207703_10062375 | Ga0207703_100623753 | 66 |
| 272 | 3300026035 | Ga0207703_10299661 | Ga0207703_102996612 | 66 |
| 273 | 3300026075 | Ga0207708_10494453 | Ga0207708_104944532 | 66 |
| 274 | 3300026078 | Ga0207702_10604602 | Ga0207702_106046023 | 66 |
| 275 | 3300026078 | Ga0207702_11049392 | Ga0207702_110493922 | 66 |
| 276 | 3300026088 | Ga0207641_10020552 | Ga0207641_100205525 | 66 |
| 277 | 3300026088 | Ga0207641_12338937 | Ga0207641_123389372 | 66 |
| 278 | 3300026089 | Ga0207648_10207128 | Ga0207648_102071282 | 66 |
| 279 | 3300026118 | Ga0207675_100180251 | Ga0207675_1001802513 | 66 |
| 280 | 3300026142 | Ga0207698_10639238 | Ga0207698_106392383 | 66 |
| 281 | 3300026142 | Ga0207698_11746336 | Ga0207698_117463362 | 66 |
| 282 | 3300028379 | Ga0268266_10252417 | Ga0268266_102524173 | 66 |
| 283 | 3300028380 | Ga0268265_10042137 | Ga0268265_100421374 | 66 |
| 284 | 3300028381 | Ga0268264_10032165 | Ga0268264_100321654 | 66 |
| 285 | 3300035083 | Ga0373926_0293215 | Ga0373926_0293215_18_218 | 66 |
| 286 | 3300035086 | Ga0373934_0032445 | Ga0373934_0032445_181_381 | 66 |
| 287 | 3300035089 | Ga0373944_0059282 | Ga0373944_0059282_661_861 | 66 |
| 288 | 3300035111 | Ga0373923_0024330 | Ga0373923_0024330_846_1046 | 66 |
| 289 | 3300035113 | Ga0373936_0002329 | Ga0373936_0002329_5943_6143 | 66 |
| 290 | 3300035113 | Ga0373936_0084349 | Ga0373936_0084349_979_1191 | 66 |
| 291 | 3300035116 | Ga0373945_0154279 | Ga0373945_0154279_529_729 | 66 |
| 292 | 3300035117 | Ga0373953_0004886 | Ga0373953_0004886_1022_1222 | 66 |
| 293 | 3300035118 | Ga0373954_0033288 | Ga0373954_0033288_183_383 | 66 |
| 294 | 3300035119 | Ga0373956_0049629 | Ga0373956_0049629_536_736 | 66 |
| 295 | 3300035120 | Ga0373957_0002069 | Ga0373957_0002069_2602_2802 | 66 |
| 296 | 3300035170 | Ga0373943_0007759 | Ga0373943_0007759_2578_2778 | 66 |
| 297 | 3300035170 | Ga0373943_0499492 | Ga0373943_0499492_253_465 | 66 |
| 298 | 3300035171 | Ga0373946_0007410 | Ga0373946_0007410_1145_1345 | 66 |
| 299 | 3300035172 | Ga0373955_0058021 | Ga0373955_0058021_846_1046 | 66 |
| 300 | 3300035410 | Ga0373924_0104503 | Ga0373924_0104503_458_658 | 66 |
| 301 | 3300035692 | Ga0373935_0008518 | Ga0373935_0008518_3984_4184 | 66 |
| 302 | 3300035692 | Ga0373935_0053155 | Ga0373935_0053155_199_411 | 66 |
| 303 | 3300035692 | Ga0373935_0625622 | Ga0373935_0625622_562_762 | 66 |
| 304 | 3300035695 | Ga0373927_0000747 | Ga0373927_0000747_21655_21855 | 66 |
| 305 | 3300035695 | Ga0373927_0357281 | Ga0373927_0357281_656_868 | 66 |
| 306 | 3300035724 | Ga0373933_0007220 | Ga0373933_0007220_3950_4150 | 66 |
| 307 | 3300035724 | Ga0373933_0794002 | Ga0373933_0794002_370_582 | 66 |
| 308 | 3300035725 | Ga0373947_0004951 | Ga0373947_0004951_524_724 | 66 |
| 309 | 3300036401 | Ga0373937_0080212 | Ga0373937_0080212_1714_1914 | 66 |
| 310 | 3300036401 | Ga0373937_0522682 | Ga0373937_0522682_601_813 | 66 |
| 311 | 3300036401 | Ga0373937_1856388 | Ga0373937_1856388_220_420 | 66 |
| 312 | 3300037068 | Ga0373925_0016522 | Ga0373925_0016522_2157_2357 | 66 |
| 313 | 3300037068 | Ga0373925_0589476 | Ga0373925_0589476_76_288 | 66 |
| 314 | 3300037853 | Ga0436364_1058287 | Ga0436364_1058287_832_1032 | 66 |
| 315 | 3300039437 | Ga0436365_1143939 | Ga0436365_1143939_1183_1383 | 66 |
| 316 | 3300039437 | Ga0436365_1865271 | Ga0436365_1865271_417_623 | 66 |
| 317 | 3300039450 | Ga0436363_0229397 | Ga0436363_0229397_1271_1471 | 66 |
| 318 | 3300044842 | Ga0466957_0917972 | Ga0466957_0917972_205_423 | 66 |
| 319 | 3300046463 | Ga0495653_0132131 | Ga0495653_0132131_1133_1333 | 66 |
| 320 | 3300046516 | Ga0495628_0225731 | Ga0495628_0225731_557_757 | 66 |
| 321 | 3300046517 | Ga0495630_0903834 | Ga0495630_0903834_244_444 | 66 |
| 322 | 3300046529 | Ga0495652_0378246 | Ga0495652_0378246_528_728 | 66 |
| 323 | 3300046536 | Ga0495587_0415791 | Ga0495587_0415791_177_389 | 66 |
| 324 | 3300046663 | Ga0495635_0138410 | Ga0495635_0138410_1405_1605 | 66 |
| 325 | 3300046679 | Ga0495623_0609464 | Ga0495623_0609464_153_353 | 66 |
| 326 | 3300046684 | Ga0495669_0262383 | Ga0495669_0262383_332_544 | 66 |
| 327 | 3300046690 | Ga0495624_0083349 | Ga0495624_0083349_1185_1385 | 66 |
| 328 | 3300046690 | Ga0495624_0623569 | Ga0495624_0623569_97_309 | 66 |
| 329 | 3300046794 | Ga0495589_0316866 | Ga0495589_0316866_403_615 | 66 |
| 330 | 3300047315 | Ga0495581_0456823 | Ga0495581_0456823_131_331 | 66 |
| 331 | 3300047319 | Ga0495674_0710186 | Ga0495674_0710186_170_370 | 66 |
| 332 | 3300047321 | Ga0495676_0419087 | Ga0495676_0419087_497_697 | 66 |
| 333 | 3300048088 | Ga0495602_0151654 | Ga0495602_0151654_771_971 | 66 |
| 334 | 3300048903 | Ga0496100_0028457 | Ga0496100_0028457_3160_3372 | 66 |
| 335 | 3300048904 | Ga0496101_0024487 | Ga0496101_0024487_2842_3054 | 66 |
| 336 | 3300048905 | Ga0496102_0283396 | Ga0496102_0283396_482_694 | 66 |
| 337 | 3300048906 | Ga0496103_0677472 | Ga0496103_0677472_411_614 | 66 |
| 338 | 3300048908 | Ga0496105_0394699 | Ga0496105_0394699_309_521 | 66 |
| 339 | 3300048909 | Ga0496106_0215487 | Ga0496106_0215487_1111_1323 | 66 |
| 340 | 3300048912 | Ga0496109_0753661 | Ga0496109_0753661_215_427 | 66 |
| 341 | 3300048915 | Ga0496112_0184937 | Ga0496112_0184937_246_449 | 66 |
| 342 | 3300048917 | Ga0496114_0332010 | Ga0496114_0332010_28_240 | 66 |
| 343 | 3300048917 | Ga0496114_1362103 | Ga0496114_1362103_261_464 | 66 |
| 344 | 3300048918 | Ga0496115_0036914 | Ga0496115_0036914_200_412 | 66 |
| 345 | 3300048929 | Ga0496126_0504148 | Ga0496126_0504148_255_467 | 66 |
| 346 | 3300050514 | nmdc:mga08x19_1025009_c1 | nmdc:mga08x19_1025009_c1_105_305 | 66 |
| 347 | 3300053084 | Ga0495595_0096836 | Ga0495595_0096836_724_936 | 66 |
| 348 | 3300053085 | Ga0495619_0624095 | Ga0495619_0624095_112_324 | 66 |
| 349 | 3300005295 | Ga0065707_11036024 | Ga0065707_110360242 | 67 |
| 350 | 3300005328 | Ga0070676_10004776 | Ga0070676_100047765 | 67 |
| 351 | 3300005329 | Ga0070683_100322780 | Ga0070683_1003227803 | 67 |
| 352 | 3300005330 | Ga0070690_100122080 | Ga0070690_1001220802 | 67 |
| 353 | 3300005330 | Ga0070690_100341478 | Ga0070690_1003414782 | 67 |
| 354 | 3300005331 | Ga0070670_100307148 | Ga0070670_1003071483 | 67 |
| 355 | 3300005334 | Ga0068869_100014372 | Ga0068869_1000143722 | 67 |
| 356 | 3300005334 | Ga0068869_100689580 | Ga0068869_1006895802 | 67 |
| 357 | 3300005335 | Ga0070666_10010107 | Ga0070666_100101077 | 67 |
| 358 | 3300005336 | Ga0070680_100061979 | Ga0070680_1000619793 | 67 |
| 359 | 3300005336 | Ga0070680_100830505 | Ga0070680_1008305052 | 67 |
| 360 | 3300005337 | Ga0070682_100141510 | Ga0070682_1001415102 | 67 |
| 361 | 3300005337 | Ga0070682_100590193 | Ga0070682_1005901932 | 67 |
| 362 | 3300005339 | Ga0070660_100139461 | Ga0070660_1001394611 | 67 |
| 363 | 3300005340 | Ga0070689_100172754 | Ga0070689_1001727542 | 67 |
| 364 | 3300005340 | Ga0070689_100446957 | Ga0070689_1004469573 | 67 |
| 365 | 3300005343 | Ga0070687_100497232 | Ga0070687_1004972322 | 67 |
| 366 | 3300005343 | Ga0070687_101109842 | Ga0070687_1011098422 | 67 |
| 367 | 3300005344 | Ga0070661_100018897 | Ga0070661_1000188976 | 67 |
| 368 | 3300005344 | Ga0070661_100913112 | Ga0070661_1009131122 | 67 |
| 369 | 3300005345 | Ga0070692_10910340 | Ga0070692_109103402 | 67 |
| 370 | 3300005347 | Ga0070668_100053030 | Ga0070668_1000530302 | 67 |
| 371 | 3300005353 | Ga0070669_100103748 | Ga0070669_1001037483 | 67 |
| 372 | 3300005354 | Ga0070675_100146387 | Ga0070675_1001463872 | 67 |
| 373 | 3300005355 | Ga0070671_100255078 | Ga0070671_1002550783 | 67 |
| 374 | 3300005356 | Ga0070674_100236991 | Ga0070674_1002369912 | 67 |
| 375 | 3300005364 | Ga0070673_100944465 | Ga0070673_1009444652 | 67 |
| 376 | 3300005365 | Ga0070688_100207210 | Ga0070688_1002072102 | 67 |
| 377 | 3300005365 | Ga0070688_100781848 | Ga0070688_1007818482 | 67 |
| 378 | 3300005366 | Ga0070659_100149849 | Ga0070659_1001498492 | 67 |
| 379 | 3300005367 | Ga0070667_100066877 | Ga0070667_1000668772 | 67 |
| 380 | 3300005434 | Ga0070709_10031545 | Ga0070709_100315454 | 67 |
| 381 | 3300005434 | Ga0070709_10232135 | Ga0070709_102321353 | 67 |
| 382 | 3300005434 | Ga0070709_10647352 | Ga0070709_106473522 | 67 |
| 383 | 3300005434 | Ga0070709_10722261 | Ga0070709_107222612 | 67 |
| 384 | 3300005435 | Ga0070714_100010335 | Ga0070714_10001033512 | 67 |
| 385 | 3300005435 | Ga0070714_102385542 | Ga0070714_1023855421 | 67 |
| 386 | 3300005436 | Ga0070713_100015219 | Ga0070713_1000152193 | 67 |
| 387 | 3300005436 | Ga0070713_100030142 | Ga0070713_1000301423 | 67 |
| 388 | 3300005436 | Ga0070713_100260906 | Ga0070713_1002609063 | 67 |
| 389 | 3300005436 | Ga0070713_100667440 | Ga0070713_1006674402 | 67 |
| 390 | 3300005436 | Ga0070713_101546400 | Ga0070713_1015464002 | 67 |
| 391 | 3300005437 | Ga0070710_10132132 | Ga0070710_101321322 | 67 |
| 392 | 3300005437 | Ga0070710_10377437 | Ga0070710_103774373 | 67 |
| 393 | 3300005437 | Ga0070710_11387037 | Ga0070710_113870371 | 67 |
| 394 | 3300005438 | Ga0070701_10964868 | Ga0070701_109648682 | 67 |
| 395 | 3300005439 | Ga0070711_100000191 | Ga0070711_10000019123 | 67 |
| 396 | 3300005439 | Ga0070711_100420861 | Ga0070711_1004208611 | 67 |
| 397 | 3300005439 | Ga0070711_100646646 | Ga0070711_1006466461 | 67 |
| 398 | 3300005439 | Ga0070711_101221628 | Ga0070711_1012216282 | 67 |
| 399 | 3300005439 | Ga0070711_101627094 | Ga0070711_1016270942 | 67 |
| 400 | 3300005440 | Ga0070705_100132317 | Ga0070705_1001323173 | 67 |
| 401 | 3300005444 | Ga0070694_100938564 | Ga0070694_1009385642 | 67 |
| 402 | 3300005456 | Ga0070678_100101422 | Ga0070678_1001014223 | 67 |
| 403 | 3300005457 | Ga0070662_100005784 | Ga0070662_10000578415 | 67 |
| 404 | 3300005458 | Ga0070681_10372053 | Ga0070681_103720532 | 67 |
| 405 | 3300005458 | Ga0070681_11340808 | Ga0070681_113408082 | 67 |
| 406 | 3300005458 | Ga0070681_11389979 | Ga0070681_113899792 | 67 |
| 407 | 3300005459 | Ga0068867_100090268 | Ga0068867_1000902681 | 67 |
| 408 | 3300005466 | Ga0070685_10044363 | Ga0070685_100443632 | 67 |
| 409 | 3300005467 | Ga0070706_102109245 | Ga0070706_1021092451 | 67 |
| 410 | 3300005518 | Ga0070699_102027579 | Ga0070699_1020275791 | 67 |
| 411 | 3300005530 | Ga0070679_100378503 | Ga0070679_1003785032 | 67 |
| 412 | 3300005530 | Ga0070679_100986095 | Ga0070679_1009860952 | 67 |
| 413 | 3300005535 | Ga0070684_100015104 | Ga0070684_10001510412 | 67 |
| 414 | 3300005536 | Ga0070697_100000975 | Ga0070697_10000097520 | 67 |
| 415 | 3300005539 | Ga0068853_100081315 | Ga0068853_1000813154 | 67 |
| 416 | 3300005543 | Ga0070672_100322681 | Ga0070672_1003226813 | 67 |
| 417 | 3300005544 | Ga0070686_100033425 | Ga0070686_1000334255 | 67 |
| 418 | 3300005544 | Ga0070686_101011357 | Ga0070686_1010113572 | 67 |
| 419 | 3300005545 | Ga0070695_100045508 | Ga0070695_1000455082 | 67 |
| 420 | 3300005545 | Ga0070695_100565960 | Ga0070695_1005659602 | 67 |
| 421 | 3300005546 | Ga0070696_100089544 | Ga0070696_1000895442 | 67 |
| 422 | 3300005546 | Ga0070696_100107978 | Ga0070696_1001079783 | 67 |
| 423 | 3300005546 | Ga0070696_100554755 | Ga0070696_1005547552 | 67 |
| 424 | 3300005547 | Ga0070693_100015931 | Ga0070693_1000159314 | 67 |
| 425 | 3300005548 | Ga0070665_100037358 | Ga0070665_1000373585 | 67 |
| 426 | 3300005549 | Ga0070704_100731609 | Ga0070704_1007316091 | 67 |
| 427 | 3300005563 | Ga0068855_100345257 | Ga0068855_1003452574 | 67 |
| 428 | 3300005563 | Ga0068855_101230413 | Ga0068855_1012304132 | 67 |
| 429 | 3300005564 | Ga0070664_100144991 | Ga0070664_1001449913 | 67 |
| 430 | 3300005564 | Ga0070664_100600895 | Ga0070664_1006008952 | 67 |
| 431 | 3300005577 | Ga0068857_100097440 | Ga0068857_1000974404 | 67 |
| 432 | 3300005577 | Ga0068857_100944824 | Ga0068857_1009448242 | 67 |
| 433 | 3300005577 | Ga0068857_102465828 | Ga0068857_1024658282 | 67 |
| 434 | 3300005578 | Ga0068854_100079731 | Ga0068854_1000797315 | 67 |
| 435 | 3300005614 | Ga0068856_100309821 | Ga0068856_1003098212 | 67 |
| 436 | 3300005615 | Ga0070702_100151255 | Ga0070702_1001512552 | 67 |
| 437 | 3300005616 | Ga0068852_100018750 | Ga0068852_1000187507 | 67 |
| 438 | 3300005617 | Ga0068859_100010649 | Ga0068859_10001064916 | 67 |
| 439 | 3300005618 | Ga0068864_100277958 | Ga0068864_1002779583 | 67 |
| 440 | 3300005718 | Ga0068866_10025064 | Ga0068866_100250646 | 67 |
| 441 | 3300005719 | Ga0068861_100454185 | Ga0068861_1004541852 | 67 |
| 442 | 3300005834 | Ga0068851_10015057 | Ga0068851_100150572 | 67 |
| 443 | 3300005840 | Ga0068870_10932203 | Ga0068870_109322032 | 67 |
| 444 | 3300005842 | Ga0068858_100059426 | Ga0068858_1000594261 | 67 |
| 445 | 3300005842 | Ga0068858_100135922 | Ga0068858_1001359225 | 67 |
| 446 | 3300005843 | Ga0068860_100073000 | Ga0068860_1000730003 | 67 |
| 447 | 3300005843 | Ga0068860_100564649 | Ga0068860_1005646492 | 67 |
| 448 | 3300005844 | Ga0068862_100031514 | Ga0068862_1000315143 | 67 |
| 449 | 3300005844 | Ga0068862_102047875 | Ga0068862_1020478751 | 67 |
| 450 | 3300006028 | Ga0070717_10006374 | Ga0070717_100063744 | 67 |
| 451 | 3300006028 | Ga0070717_10094307 | Ga0070717_100943073 | 67 |
| 452 | 3300006028 | Ga0070717_10120021 | Ga0070717_101200213 | 67 |
| 453 | 3300006028 | Ga0070717_10491944 | Ga0070717_104919442 | 67 |
| 454 | 3300006028 | Ga0070717_10982666 | Ga0070717_109826662 | 67 |
| 455 | 3300006028 | Ga0070717_11394051 | Ga0070717_113940511 | 67 |
| 456 | 3300006163 | Ga0070715_10019784 | Ga0070715_100197844 | 67 |
| 457 | 3300006163 | Ga0070715_10494896 | Ga0070715_104948962 | 67 |
| 458 | 3300006163 | Ga0070715_10815351 | Ga0070715_108153512 | 67 |
| 459 | 3300006173 | Ga0070716_100023941 | Ga0070716_1000239413 | 67 |
| 460 | 3300006173 | Ga0070716_100127708 | Ga0070716_1001277083 | 67 |
| 461 | 3300006173 | Ga0070716_100139392 | Ga0070716_1001393922 | 67 |
| 462 | 3300006173 | Ga0070716_100151070 | Ga0070716_1001510703 | 67 |
| 463 | 3300006173 | Ga0070716_100962603 | Ga0070716_1009626032 | 67 |
| 464 | 3300006175 | Ga0070712_100002103 | Ga0070712_1000021033 | 67 |
| 465 | 3300006175 | Ga0070712_100042575 | Ga0070712_1000425754 | 67 |
| 466 | 3300006175 | Ga0070712_100587298 | Ga0070712_1005872982 | 67 |
| 467 | 3300006237 | Ga0097621_100020695 | Ga0097621_1000206954 | 67 |
| 468 | 3300006237 | Ga0097621_101304847 | Ga0097621_1013048472 | 67 |
| 469 | 3300006358 | Ga0068871_100742892 | Ga0068871_1007428922 | 67 |
| 470 | 3300006844 | Ga0075428_101476913 | Ga0075428_1014769132 | 67 |
| 471 | 3300006852 | Ga0075433_10004383 | Ga0075433_1000438315 | 67 |
| 472 | 3300006871 | Ga0075434_100000230 | Ga0075434_10000023020 | 67 |
| 473 | 3300006871 | Ga0075434_100801380 | Ga0075434_1008013802 | 67 |
| 474 | 3300006871 | Ga0075434_101160788 | Ga0075434_1011607882 | 67 |
| 475 | 3300006914 | Ga0075436_100000510 | Ga0075436_10000051018 | 67 |
| 476 | 3300006914 | Ga0075436_100029891 | Ga0075436_1000298912 | 67 |
| 477 | 3300006914 | Ga0075436_100415732 | Ga0075436_1004157322 | 67 |
| 478 | 3300006931 | Ga0097620_100010649 | Ga0097620_10001064916 | 67 |
| 479 | 3300007076 | Ga0075435_100000389 | Ga0075435_10000038920 | 67 |
| 480 | 3300007076 | Ga0075435_100055600 | Ga0075435_1000556005 | 67 |
| 481 | 3300007076 | Ga0075435_100150842 | Ga0075435_1001508423 | 67 |
| 482 | 3300009093 | Ga0105240_10391623 | Ga0105240_103916232 | 67 |
| 483 | 3300009093 | Ga0105240_12267497 | Ga0105240_122674971 | 67 |
| 484 | 3300009098 | Ga0105245_10054232 | Ga0105245_100542326 | 67 |
| 485 | 3300009098 | Ga0105245_11080508 | Ga0105245_110805082 | 67 |
| 486 | 3300009098 | Ga0105245_12751900 | Ga0105245_127519002 | 67 |
| 487 | 3300009098 | Ga0105245_13255067 | Ga0105245_132550672 | 67 |
| 488 | 3300009101 | Ga0105247_10028333 | Ga0105247_100283333 | 67 |
| 489 | 3300009101 | Ga0105247_10037507 | Ga0105247_100375076 | 67 |
| 490 | 3300009147 | Ga0114129_11223317 | Ga0114129_112233173 | 67 |
| 491 | 3300009174 | Ga0105241_10104611 | Ga0105241_101046114 | 67 |
| 492 | 3300009174 | Ga0105241_10342448 | Ga0105241_103424483 | 67 |
| 493 | 3300009174 | Ga0105241_10503769 | Ga0105241_105037693 | 67 |
| 494 | 3300009176 | Ga0105242_10028689 | Ga0105242_100286895 | 67 |
| 495 | 3300009176 | Ga0105242_10110302 | Ga0105242_101103025 | 67 |
| 496 | 3300009177 | Ga0105248_10032147 | Ga0105248_100321476 | 67 |
| 497 | 3300009177 | Ga0105248_10569718 | Ga0105248_105697183 | 67 |
| 498 | 3300009177 | Ga0105248_10906466 | Ga0105248_109064662 | 67 |
| 499 | 3300009545 | Ga0105237_11286203 | Ga0105237_112862032 | 67 |
| 500 | 3300009545 | Ga0105237_11449041 | Ga0105237_114490412 | 67 |
| 501 | 3300009551 | Ga0105238_10019367 | Ga0105238_1001936712 | 67 |
| 502 | 3300009553 | Ga0105249_10017780 | Ga0105249_100177805 | 67 |
| 503 | 3300009553 | Ga0105249_13515939 | Ga0105249_135159391 | 67 |
| 504 | 3300010159 | Ga0099796_10076584 | Ga0099796_100765843 | 67 |
| 505 | 3300010375 | Ga0105239_10748483 | Ga0105239_107484833 | 67 |
| 506 | 3300010375 | Ga0105239_12396594 | Ga0105239_123965942 | 67 |
| 507 | 3300010375 | Ga0105239_13575427 | Ga0105239_135754271 | 67 |
| 508 | 3300011119 | Ga0105246_10302237 | Ga0105246_103022372 | 67 |
| 509 | 3300012507 | Ga0157342_1060785 | Ga0157342_10607851 | 67 |
| 510 | 3300013100 | Ga0157373_10952686 | Ga0157373_109526862 | 67 |
| 511 | 3300013102 | Ga0157371_10085091 | Ga0157371_100850913 | 67 |
| 512 | 3300013104 | Ga0157370_11712296 | Ga0157370_117122962 | 67 |
| 513 | 3300013105 | Ga0157369_10043759 | Ga0157369_100437592 | 67 |
| 514 | 3300013105 | Ga0157369_11861737 | Ga0157369_118617372 | 67 |
| 515 | 3300013296 | Ga0157374_10024267 | Ga0157374_100242675 | 67 |
| 516 | 3300013296 | Ga0157374_12080146 | Ga0157374_120801462 | 67 |
| 517 | 3300013297 | Ga0157378_10027505 | Ga0157378_100275053 | 67 |
| 518 | 3300013297 | Ga0157378_10281747 | Ga0157378_102817474 | 67 |
| 519 | 3300013297 | Ga0157378_10430415 | Ga0157378_104304152 | 67 |
| 520 | 3300013297 | Ga0157378_11200688 | Ga0157378_112006882 | 67 |
| 521 | 3300013306 | Ga0163162_10053758 | Ga0163162_100537583 | 67 |
| 522 | 3300013307 | Ga0157372_10040130 | Ga0157372_100401305 | 67 |
| 523 | 3300013307 | Ga0157372_10173185 | Ga0157372_101731855 | 67 |
| 524 | 3300013308 | Ga0157375_10150494 | Ga0157375_101504942 | 67 |
| 525 | 3300014325 | Ga0163163_10170068 | Ga0163163_101700682 | 67 |
| 526 | 3300014745 | Ga0157377_10184811 | Ga0157377_101848113 | 67 |
| 527 | 3300014745 | Ga0157377_10230324 | Ga0157377_102303242 | 67 |
| 528 | 3300014968 | Ga0157379_10004402 | Ga0157379_100044028 | 67 |
| 529 | 3300014968 | Ga0157379_10063957 | Ga0157379_100639573 | 67 |
| 530 | 3300014969 | Ga0157376_10089966 | Ga0157376_100899664 | 67 |
| 531 | 3300014969 | Ga0157376_10728258 | Ga0157376_107282582 | 67 |
| 532 | 3300024227 | Ga0228598_1105815 | Ga0228598_11058151 | 67 |
| 533 | 3300025321 | Ga0207656_10018423 | Ga0207656_100184233 | 67 |
| 534 | 3300025711 | Ga0207696_1098767 | Ga0207696_10987671 | 67 |
| 535 | 3300025898 | Ga0207692_10081189 | Ga0207692_100811893 | 67 |
| 536 | 3300025898 | Ga0207692_10087703 | Ga0207692_100877031 | 67 |
| 537 | 3300025899 | Ga0207642_10081086 | Ga0207642_100810862 | 67 |
| 538 | 3300025900 | Ga0207710_10025129 | Ga0207710_100251293 | 67 |
| 539 | 3300025903 | Ga0207680_10010187 | Ga0207680_100101873 | 67 |
| 540 | 3300025905 | Ga0207685_10239727 | Ga0207685_102397272 | 67 |
| 541 | 3300025905 | Ga0207685_10337338 | Ga0207685_103373382 | 67 |
| 542 | 3300025906 | Ga0207699_10073645 | Ga0207699_100736453 | 67 |
| 543 | 3300025906 | Ga0207699_10217781 | Ga0207699_102177812 | 67 |
| 544 | 3300025906 | Ga0207699_10986354 | Ga0207699_109863541 | 67 |
| 545 | 3300025907 | Ga0207645_10086495 | Ga0207645_100864953 | 67 |
| 546 | 3300025908 | Ga0207643_10165810 | Ga0207643_101658102 | 67 |
| 547 | 3300025911 | Ga0207654_10041777 | Ga0207654_100417775 | 67 |
| 548 | 3300025912 | Ga0207707_10015255 | Ga0207707_1001525511 | 67 |
| 549 | 3300025912 | Ga0207707_10353925 | Ga0207707_103539253 | 67 |
| 550 | 3300025912 | Ga0207707_11057736 | Ga0207707_110577362 | 67 |
| 551 | 3300025913 | Ga0207695_10007039 | Ga0207695_1000703915 | 67 |
| 552 | 3300025914 | Ga0207671_10144791 | Ga0207671_101447911 | 67 |
| 553 | 3300025915 | Ga0207693_10000922 | Ga0207693_1000092225 | 67 |
| 554 | 3300025915 | Ga0207693_10004232 | Ga0207693_100042329 | 67 |
| 555 | 3300025915 | Ga0207693_10026057 | Ga0207693_100260573 | 67 |
| 556 | 3300025916 | Ga0207663_10018817 | Ga0207663_100188174 | 67 |
| 557 | 3300025916 | Ga0207663_10531284 | Ga0207663_105312842 | 67 |
| 558 | 3300025916 | Ga0207663_10901261 | Ga0207663_109012612 | 67 |
| 559 | 3300025916 | Ga0207663_11257856 | Ga0207663_112578561 | 67 |
| 560 | 3300025917 | Ga0207660_10077165 | Ga0207660_100771654 | 67 |
| 561 | 3300025919 | Ga0207657_10006426 | Ga0207657_100064266 | 67 |
| 562 | 3300025919 | Ga0207657_10943231 | Ga0207657_109432312 | 67 |
| 563 | 3300025920 | Ga0207649_10495557 | Ga0207649_104955573 | 67 |
| 564 | 3300025920 | Ga0207649_11165604 | Ga0207649_111656042 | 67 |
| 565 | 3300025921 | Ga0207652_10037568 | Ga0207652_100375683 | 67 |
| 566 | 3300025921 | Ga0207652_10867502 | Ga0207652_108675022 | 67 |
| 567 | 3300025922 | Ga0207646_11363734 | Ga0207646_113637342 | 67 |
| 568 | 3300025923 | Ga0207681_10043862 | Ga0207681_100438623 | 67 |
| 569 | 3300025924 | Ga0207694_10118035 | Ga0207694_101180354 | 67 |
| 570 | 3300025925 | Ga0207650_11302802 | Ga0207650_113028022 | 67 |
| 571 | 3300025926 | Ga0207659_10141402 | Ga0207659_101414023 | 67 |
| 572 | 3300025927 | Ga0207687_10033504 | Ga0207687_100335043 | 67 |
| 573 | 3300025927 | Ga0207687_10921378 | Ga0207687_109213782 | 67 |
| 574 | 3300025928 | Ga0207700_10042550 | Ga0207700_100425505 | 67 |
| 575 | 3300025928 | Ga0207700_10137500 | Ga0207700_101375003 | 67 |
| 576 | 3300025928 | Ga0207700_10238412 | Ga0207700_102384123 | 67 |
| 577 | 3300025928 | Ga0207700_10592713 | Ga0207700_105927132 | 67 |
| 578 | 3300025928 | Ga0207700_11251637 | Ga0207700_112516372 | 67 |
| 579 | 3300025928 | Ga0207700_12023091 | Ga0207700_120230912 | 67 |
| 580 | 3300025929 | Ga0207664_10048949 | Ga0207664_100489497 | 67 |
| 581 | 3300025929 | Ga0207664_10432327 | Ga0207664_104323272 | 67 |
| 582 | 3300025929 | Ga0207664_10820419 | Ga0207664_108204192 | 67 |
| 583 | 3300025929 | Ga0207664_11221340 | Ga0207664_112213402 | 67 |
| 584 | 3300025931 | Ga0207644_10477872 | Ga0207644_104778723 | 67 |
| 585 | 3300025931 | Ga0207644_11008921 | Ga0207644_110089212 | 67 |
| 586 | 3300025932 | Ga0207690_10025533 | Ga0207690_100255334 | 67 |
| 587 | 3300025933 | Ga0207706_10005096 | Ga0207706_1000509620 | 67 |
| 588 | 3300025934 | Ga0207686_10088097 | Ga0207686_100880972 | 67 |
| 589 | 3300025936 | Ga0207670_10035791 | Ga0207670_100357912 | 67 |
| 590 | 3300025936 | Ga0207670_11370614 | Ga0207670_113706142 | 67 |
| 591 | 3300025939 | Ga0207665_10001798 | Ga0207665_1000179817 | 67 |
| 592 | 3300025939 | Ga0207665_10029689 | Ga0207665_100296893 | 67 |
| 593 | 3300025939 | Ga0207665_10061976 | Ga0207665_100619762 | 67 |
| 594 | 3300025939 | Ga0207665_10205212 | Ga0207665_102052123 | 67 |
| 595 | 3300025939 | Ga0207665_10371403 | Ga0207665_103714033 | 67 |
| 596 | 3300025939 | Ga0207665_10786959 | Ga0207665_107869592 | 67 |
| 597 | 3300025940 | Ga0207691_10273247 | Ga0207691_102732473 | 67 |
| 598 | 3300025941 | Ga0207711_10013154 | Ga0207711_100131546 | 67 |
| 599 | 3300025942 | Ga0207689_10063202 | Ga0207689_100632022 | 67 |
| 600 | 3300025942 | Ga0207689_10203187 | Ga0207689_102031873 | 67 |
| 601 | 3300025944 | Ga0207661_10398694 | Ga0207661_103986943 | 67 |
| 602 | 3300025945 | Ga0207679_10098174 | Ga0207679_100981744 | 67 |
| 603 | 3300025945 | Ga0207679_10588266 | Ga0207679_105882662 | 67 |
| 604 | 3300025949 | Ga0207667_10051651 | Ga0207667_100516516 | 67 |
| 605 | 3300025960 | Ga0207651_11009711 | Ga0207651_110097112 | 67 |
| 606 | 3300025961 | Ga0207712_10026658 | Ga0207712_100266582 | 67 |
| 607 | 3300025972 | Ga0207668_10022020 | Ga0207668_100220206 | 67 |
| 608 | 3300025981 | Ga0207640_10094115 | Ga0207640_100941155 | 67 |
| 609 | 3300025986 | Ga0207658_10806143 | Ga0207658_108061432 | 67 |
| 610 | 3300026035 | Ga0207703_10727815 | Ga0207703_107278152 | 67 |
| 611 | 3300026067 | Ga0207678_10001612 | Ga0207678_100016127 | 67 |
| 612 | 3300026078 | Ga0207702_10381932 | Ga0207702_103819323 | 67 |
| 613 | 3300026088 | Ga0207641_10243221 | Ga0207641_102432212 | 67 |
| 614 | 3300026089 | Ga0207648_10026519 | Ga0207648_100265195 | 67 |
| 615 | 3300026116 | Ga0207674_10018522 | Ga0207674_100185226 | 67 |
| 616 | 3300026116 | Ga0207674_11022583 | Ga0207674_110225831 | 67 |
| 617 | 3300026118 | Ga0207675_100029361 | Ga0207675_1000293615 | 67 |
| 618 | 3300026121 | Ga0207683_10091361 | Ga0207683_100913613 | 67 |
| 619 | 3300026142 | Ga0207698_10130599 | Ga0207698_101305994 | 67 |
| 620 | 3300028016 | Ga0265354_1009164 | Ga0265354_10091643 | 67 |
| 621 | 3300028379 | Ga0268266_10023242 | Ga0268266_100232427 | 67 |
| 622 | 3300028380 | Ga0268265_10048846 | Ga0268265_100488465 | 67 |
| 623 | 3300028380 | Ga0268265_11651110 | Ga0268265_116511101 | 67 |
| 624 | 3300028381 | Ga0268264_10099564 | Ga0268264_100995644 | 67 |
| 625 | 3300028381 | Ga0268264_10641535 | Ga0268264_106415352 | 67 |
| 626 | 3300030760 | Ga0265762_1049939 | Ga0265762_10499392 | 67 |
| 627 | 3300030878 | Ga0265770_1004221 | Ga0265770_10042213 | 67 |
| 628 | 3300030878 | Ga0265770_1065249 | Ga0265770_10652491 | 67 |
| 629 | 3300031043 | Ga0265779_103065 | Ga0265779_1030652 | 67 |
| 630 | 3300031090 | Ga0265760_10004716 | Ga0265760_100047167 | 67 |
| 631 | 3300031090 | Ga0265760_10008596 | Ga0265760_100085966 | 67 |
| 632 | 3300031731 | Ga0307405_10081873 | Ga0307405_100818733 | 67 |
| 633 | 3300031852 | Ga0307410_10009896 | Ga0307410_1000989611 | 67 |
| 634 | 3300031852 | Ga0307410_10056095 | Ga0307410_100560953 | 67 |
| 635 | 3300031901 | Ga0307406_10292192 | Ga0307406_102921923 | 67 |
| 636 | 3300031901 | Ga0307406_10565806 | Ga0307406_105658062 | 67 |
| 637 | 3300031903 | Ga0307407_10222083 | Ga0307407_102220832 | 67 |
| 638 | 3300031903 | Ga0307407_10460864 | Ga0307407_104608642 | 67 |
| 639 | 3300031911 | Ga0307412_10413758 | Ga0307412_104137582 | 67 |
| 640 | 3300031995 | Ga0307409_100065689 | Ga0307409_1000656893 | 67 |
| 641 | 3300031995 | Ga0307409_100395128 | Ga0307409_1003951283 | 67 |
| 642 | 3300032002 | Ga0307416_100117099 | Ga0307416_1001170992 | 67 |
| 643 | 3300032002 | Ga0307416_103632177 | Ga0307416_1036321772 | 67 |
| 644 | 3300032004 | Ga0307414_10305297 | Ga0307414_103052972 | 67 |
| 645 | 3300032004 | Ga0307414_11901792 | Ga0307414_119017922 | 67 |
| 646 | 3300032005 | Ga0307411_10133285 | Ga0307411_101332853 | 67 |
| 647 | 3300032126 | Ga0307415_100033737 | Ga0307415_1000337374 | 67 |
| 648 | 3300034816 | Ga0373930_0128935 | Ga0373930_0128935_207_425 | 67 |
| 649 | 3300034818 | Ga0373950_0051482 | Ga0373950_0051482_333_551 | 67 |
| 650 | 3300034819 | Ga0373958_0008489 | Ga0373958_0008489_885_1103 | 67 |
| 651 | 3300034957 | Ga0373938_0024859 | Ga0373938_0024859_186_404 | 67 |
| 652 | 3300035083 | Ga0373926_0006641 | Ga0373926_0006641_2641_2844 | 67 |
| 653 | 3300035083 | Ga0373926_0229018 | Ga0373926_0229018_257_475 | 67 |
| 654 | 3300035086 | Ga0373934_0483607 | Ga0373934_0483607_45_248 | 67 |
| 655 | 3300035088 | Ga0373940_0133982 | Ga0373940_0133982_446_664 | 67 |
| 656 | 3300035088 | Ga0373940_0340897 | Ga0373940_0340897_227_445 | 67 |
| 657 | 3300035091 | Ga0373951_0133050 | Ga0373951_0133050_351_569 | 67 |
| 658 | 3300035111 | Ga0373923_0310216 | Ga0373923_0310216_293_496 | 67 |
| 659 | 3300035113 | Ga0373936_0108171 | Ga0373936_0108171_124_327 | 67 |
| 660 | 3300035113 | Ga0373936_0447052 | Ga0373936_0447052_379_582 | 67 |
| 661 | 3300035113 | Ga0373936_0580978 | Ga0373936_0580978_263_466 | 67 |
| 662 | 3300035114 | Ga0373939_0025547 | Ga0373939_0025547_1347_1565 | 67 |
| 663 | 3300035115 | Ga0373941_0098284 | Ga0373941_0098284_17_235 | 67 |
| 664 | 3300035116 | Ga0373945_0026866 | Ga0373945_0026866_761_964 | 67 |
| 665 | 3300035170 | Ga0373943_0022407 | Ga0373943_0022407_1555_1758 | 67 |
| 666 | 3300035171 | Ga0373946_0044663 | Ga0373946_0044663_222_425 | 67 |
| 667 | 3300035207 | Ga0373942_0007478 | Ga0373942_0007478_1924_2142 | 67 |
| 668 | 3300035241 | Ga0373961_0007659 | Ga0373961_0007659_1283_1501 | 67 |
| 669 | 3300035691 | Ga0373931_0038758 | Ga0373931_0038758_1554_1772 | 67 |
| 670 | 3300035692 | Ga0373935_0015830 | Ga0373935_0015830_2860_3063 | 67 |
| 671 | 3300035695 | Ga0373927_0796417 | Ga0373927_0796417_102_305 | 67 |
| 672 | 3300035724 | Ga0373933_0398628 | Ga0373933_0398628_328_531 | 67 |
| 673 | 3300035725 | Ga0373947_0070018 | Ga0373947_0070018_473_676 | 67 |
| 674 | 3300036401 | Ga0373937_0535257 | Ga0373937_0535257_595_798 | 67 |
| 675 | 3300037068 | Ga0373925_0012340 | Ga0373925_0012340_1795_1998 | 67 |
| 676 | 3300037466 | Ga0395898_1067496 | Ga0395898_1067496_15_257 | 67 |
| 677 | 3300038443 | Ga0395901_0719389 | Ga0395901_0719389_234_437 | 67 |
| 678 | 3300039437 | Ga0436365_1246521 | Ga0436365_1246521_361_564 | 67 |
| 679 | 3300039450 | Ga0436363_0216863 | Ga0436363_0216863_175_378 | 67 |
| 680 | 3300039450 | Ga0436363_0929382 | Ga0436363_0929382_257_460 | 67 |
| 681 | 3300039450 | Ga0436363_1116219 | Ga0436363_1116219_725_928 | 67 |
| 682 | 3300044694 | Ga0466963_1138627 | Ga0466963_1138627_278_484 | 67 |
| 683 | 3300044735 | Ga0466968_0617027 | Ga0466968_0617027_200_403 | 67 |
| 684 | 3300045976 | Ga0466967_0047517 | Ga0466967_0047517_2945_3151 | 67 |
| 685 | 3300045976 | Ga0466967_1605092 | Ga0466967_1605092_90_293 | 67 |
| 686 | 3300046472 | Ga0495580_0001673 | Ga0495580_0001673_18919_19122 | 67 |
| 687 | 3300046472 | Ga0495580_0016664 | Ga0495580_0016664_843_1058 | 67 |
| 688 | 3300046473 | Ga0495582_0000596 | Ga0495582_0000596_18072_18275 | 67 |
| 689 | 3300046517 | Ga0495630_0528840 | Ga0495630_0528840_176_379 | 67 |
| 690 | 3300046531 | Ga0495665_0000974 | Ga0495665_0000974_4542_4745 | 67 |
| 691 | 3300046535 | Ga0495586_0201724 | Ga0495586_0201724_67_270 | 67 |
| 692 | 3300046535 | Ga0495586_0491546 | Ga0495586_0491546_351_554 | 67 |
| 693 | 3300046683 | Ga0495658_0040249 | Ga0495658_0040249_1564_1767 | 67 |
| 694 | 3300046684 | Ga0495669_0293526 | Ga0495669_0293526_277_480 | 67 |
| 695 | 3300046684 | Ga0495669_0303024 | Ga0495669_0303024_204_407 | 67 |
| 696 | 3300046690 | Ga0495624_0156645 | Ga0495624_0156645_1156_1359 | 67 |
| 697 | 3300047315 | Ga0495581_0580947 | Ga0495581_0580947_213_416 | 67 |
| 698 | 3300047319 | Ga0495674_0057042 | Ga0495674_0057042_2518_2721 | 67 |
| 699 | 3300047319 | Ga0495674_0614348 | Ga0495674_0614348_274_477 | 67 |
| 700 | 3300048088 | Ga0495602_0106256 | Ga0495602_0106256_53_292 | 67 |
| 701 | 3300048903 | Ga0496100_0034107 | Ga0496100_0034107_2895_3113 | 67 |
| 702 | 3300048903 | Ga0496100_0965606 | Ga0496100_0965606_434_652 | 67 |
| 703 | 3300048904 | Ga0496101_0011221 | Ga0496101_0011221_2918_3136 | 67 |
| 704 | 3300048904 | Ga0496101_0063740 | Ga0496101_0063740_1433_1651 | 67 |
| 705 | 3300048905 | Ga0496102_0003212 | Ga0496102_0003212_3265_3483 | 67 |
| 706 | 3300048905 | Ga0496102_0082208 | Ga0496102_0082208_2573_2791 | 67 |
| 707 | 3300048905 | Ga0496102_0733808 | Ga0496102_0733808_195_413 | 67 |
| 708 | 3300048906 | Ga0496103_0110851 | Ga0496103_0110851_694_912 | 67 |
| 709 | 3300048907 | Ga0496104_0076564 | Ga0496104_0076564_2060_2278 | 67 |
| 710 | 3300048907 | Ga0496104_0233662 | Ga0496104_0233662_1287_1505 | 67 |
| 711 | 3300048907 | Ga0496104_0637327 | Ga0496104_0637327_143_346 | 67 |
| 712 | 3300048909 | Ga0496106_0020191 | Ga0496106_0020191_1659_1877 | 67 |
| 713 | 3300048909 | Ga0496106_0132634 | Ga0496106_0132634_1069_1287 | 67 |
| 714 | 3300048910 | Ga0496107_0368605 | Ga0496107_0368605_768_986 | 67 |
| 715 | 3300048912 | Ga0496109_0034010 | Ga0496109_0034010_1931_2149 | 67 |
| 716 | 3300048913 | Ga0496110_0063397 | Ga0496110_0063397_2133_2351 | 67 |
| 717 | 3300048914 | Ga0496111_0341124 | Ga0496111_0341124_551_769 | 67 |
| 718 | 3300048915 | Ga0496112_0051891 | Ga0496112_0051891_2235_2453 | 67 |
| 719 | 3300048916 | Ga0496113_0009232 | Ga0496113_0009232_4286_4504 | 67 |
| 720 | 3300049520 | Ga0501297_020717 | Ga0501297_020717_333_557 | 67 |
| 721 | 3300049652 | Ga0501202_069189 | Ga0501202_069189_461_685 | 67 |
| 722 | 3300049771 | Ga0501274_036137 | Ga0501274_036137_68_292 | 67 |
| 723 | 3300050512 | nmdc:mga0n895_1101194_c1 | nmdc:mga0n895_1101194_c1_290_508 | 67 |
| 724 | 3300050512 | nmdc:mga0n895_133428_c1 | nmdc:mga0n895_133428_c1_429_647 | 67 |
| 725 | 3300050512 | nmdc:mga0n895_344_c1 | nmdc:mga0n895_344_c1_7049_7252 | 67 |
| 726 | 3300050512 | nmdc:mga0n895_883053_c1 | nmdc:mga0n895_883053_c1_581_787 | 67 |
| 727 | 3300050513 | nmdc:mga0rr50_40640_c1 | nmdc:mga0rr50_40640_c1_1076_1279 | 67 |
| 728 | 3300050513 | nmdc:mga0rr50_548981_c1 | nmdc:mga0rr50_548981_c1_578_796 | 67 |
| 729 | 3300050513 | nmdc:mga0rr50_775389_c1 | nmdc:mga0rr50_775389_c1_48_254 | 67 |
| 730 | 3300050513 | nmdc:mga0rr50_872_c1 | nmdc:mga0rr50_872_c1_6449_6652 | 67 |
| 731 | 3300050514 | nmdc:mga08x19_3391_c1 | nmdc:mga08x19_3391_c1_3330_3533 | 67 |
| 732 | 3300050514 | nmdc:mga08x19_51227_c1 | nmdc:mga08x19_51227_c1_1077_1295 | 67 |
| 733 | 3300050514 | nmdc:mga08x19_9637_c1 | nmdc:mga08x19_9637_c1_3577_3780 | 67 |
| 734 | 3300050515 | nmdc:mga0a205_7367_c1 | nmdc:mga0a205_7367_c1_4230_4433 | 67 |
| 735 | 3300053078 | Ga0495612_0444526 | Ga0495612_0444526_114_317 | 67 |
| 736 | 3300001915 | JGI24741J21665_1033502 | JGI24741J21665_10335022 | 68 |
| 737 | 3300001976 | JGI24752J21851_1000484 | JGI24752J21851_10004841 | 68 |
| 738 | 3300001990 | JGI24737J22298_10025233 | JGI24737J22298_100252333 | 68 |
| 739 | 3300001991 | JGI24743J22301_10003249 | JGI24743J22301_100032494 | 68 |
| 740 | 3300002075 | JGI24738J21930_10047296 | JGI24738J21930_100472962 | 68 |
| 741 | 3300002155 | JGI24033J26618_1039806 | JGI24033J26618_10398062 | 68 |
| 742 | 3300002239 | JGI24034J26672_10008468 | JGI24034J26672_100084683 | 68 |
| 743 | 3300002459 | JGI24751J29686_10001356 | JGI24751J29686_1000135611 | 68 |
| 744 | 3300005289 | Ga0065704_10534439 | Ga0065704_105344392 | 68 |
| 745 | 3300005293 | Ga0065715_10104722 | Ga0065715_101047223 | 68 |
| 746 | 3300005327 | Ga0070658_10036784 | Ga0070658_100367844 | 68 |
| 747 | 3300005329 | Ga0070683_100011087 | Ga0070683_1000110873 | 68 |
| 748 | 3300005330 | Ga0070690_100000550 | Ga0070690_10000055021 | 68 |
| 749 | 3300005331 | Ga0070670_100015559 | Ga0070670_1000155593 | 68 |
| 750 | 3300005331 | Ga0070670_100033183 | Ga0070670_1000331839 | 68 |
| 751 | 3300005334 | Ga0068869_100074090 | Ga0068869_1000740903 | 68 |
| 752 | 3300005334 | Ga0068869_100651889 | Ga0068869_1006518891 | 68 |
| 753 | 3300005335 | Ga0070666_10010510 | Ga0070666_100105103 | 68 |
| 754 | 3300005337 | Ga0070682_100196586 | Ga0070682_1001965862 | 68 |
| 755 | 3300005338 | Ga0068868_100011852 | Ga0068868_10001185210 | 68 |
| 756 | 3300005339 | Ga0070660_100002901 | Ga0070660_10000290114 | 68 |
| 757 | 3300005340 | Ga0070689_100068823 | Ga0070689_1000688233 | 68 |
| 758 | 3300005343 | Ga0070687_100000493 | Ga0070687_1000004936 | 68 |
| 759 | 3300005344 | Ga0070661_100012073 | Ga0070661_1000120733 | 68 |
| 760 | 3300005347 | Ga0070668_100014649 | Ga0070668_1000146494 | 68 |
| 761 | 3300005353 | Ga0070669_100007500 | Ga0070669_1000075006 | 68 |
| 762 | 3300005354 | Ga0070675_100004817 | Ga0070675_1000048179 | 68 |
| 763 | 3300005355 | Ga0070671_100451132 | Ga0070671_1004511323 | 68 |
| 764 | 3300005356 | Ga0070674_100010705 | Ga0070674_1000107051 | 68 |
| 765 | 3300005364 | Ga0070673_100073104 | Ga0070673_1000731043 | 68 |
| 766 | 3300005365 | Ga0070688_100031729 | Ga0070688_1000317293 | 68 |
| 767 | 3300005366 | Ga0070659_100023459 | Ga0070659_1000234593 | 68 |
| 768 | 3300005367 | Ga0070667_100289930 | Ga0070667_1002899302 | 68 |
| 769 | 3300005441 | Ga0070700_100068348 | Ga0070700_1000683483 | 68 |
| 770 | 3300005444 | Ga0070694_100577378 | Ga0070694_1005773782 | 68 |
| 771 | 3300005455 | Ga0070663_100012382 | Ga0070663_1000123823 | 68 |
| 772 | 3300005455 | Ga0070663_101360826 | Ga0070663_1013608261 | 68 |
| 773 | 3300005456 | Ga0070678_100132369 | Ga0070678_1001323694 | 68 |
| 774 | 3300005457 | Ga0070662_100018068 | Ga0070662_1000180682 | 68 |
| 775 | 3300005459 | Ga0068867_100009657 | Ga0068867_1000096579 | 68 |
| 776 | 3300005466 | Ga0070685_10001292 | Ga0070685_100012924 | 68 |
| 777 | 3300005535 | Ga0070684_100001423 | Ga0070684_1000014239 | 68 |
| 778 | 3300005539 | Ga0068853_100008308 | Ga0068853_1000083089 | 68 |
| 779 | 3300005543 | Ga0070672_100134491 | Ga0070672_1001344913 | 68 |
| 780 | 3300005544 | Ga0070686_100005280 | Ga0070686_1000052807 | 68 |
| 781 | 3300005547 | Ga0070693_100092826 | Ga0070693_1000928263 | 68 |
| 782 | 3300005547 | Ga0070693_100258541 | Ga0070693_1002585412 | 68 |
| 783 | 3300005563 | Ga0068855_100025048 | Ga0068855_1000250487 | 68 |
| 784 | 3300005564 | Ga0070664_100017663 | Ga0070664_1000176634 | 68 |
| 785 | 3300005577 | Ga0068857_100001133 | Ga0068857_10000113313 | 68 |
| 786 | 3300005578 | Ga0068854_101239939 | Ga0068854_1012399392 | 68 |
| 787 | 3300005614 | Ga0068856_100060929 | Ga0068856_1000609293 | 68 |
| 788 | 3300005615 | Ga0070702_100260522 | Ga0070702_1002605222 | 68 |
| 789 | 3300005616 | Ga0068852_100001223 | Ga0068852_10000122311 | 68 |
| 790 | 3300005617 | Ga0068859_100052886 | Ga0068859_1000528863 | 68 |
| 791 | 3300005618 | Ga0068864_100086394 | Ga0068864_1000863943 | 68 |
| 792 | 3300005618 | Ga0068864_100289329 | Ga0068864_1002893292 | 68 |
| 793 | 3300005718 | Ga0068866_10001380 | Ga0068866_100013804 | 68 |
| 794 | 3300005719 | Ga0068861_100006422 | Ga0068861_1000064225 | 68 |
| 795 | 3300005834 | Ga0068851_10001352 | Ga0068851_1000135210 | 68 |
| 796 | 3300005840 | Ga0068870_10007394 | Ga0068870_100073945 | 68 |
| 797 | 3300005841 | Ga0068863_100020550 | Ga0068863_1000205505 | 68 |
| 798 | 3300005841 | Ga0068863_101911187 | Ga0068863_1019111872 | 68 |
| 799 | 3300005842 | Ga0068858_100023794 | Ga0068858_1000237944 | 68 |
| 800 | 3300005843 | Ga0068860_100036537 | Ga0068860_1000365372 | 68 |
| 801 | 3300005843 | Ga0068860_100525026 | Ga0068860_1005250263 | 68 |
| 802 | 3300005844 | Ga0068862_100010568 | Ga0068862_1000105689 | 68 |
| 803 | 3300005844 | Ga0068862_100027948 | Ga0068862_1000279486 | 68 |
| 804 | 3300006237 | Ga0097621_100075555 | Ga0097621_1000755553 | 68 |
| 805 | 3300006237 | Ga0097621_101895105 | Ga0097621_1018951052 | 68 |
| 806 | 3300006358 | Ga0068871_100098154 | Ga0068871_1000981543 | 68 |
| 807 | 3300006871 | Ga0075434_101937085 | Ga0075434_1019370852 | 68 |
| 808 | 3300006881 | Ga0068865_100016197 | Ga0068865_1000161975 | 68 |
| 809 | 3300006931 | Ga0097620_100052889 | Ga0097620_1000528893 | 68 |
| 810 | 3300009092 | Ga0105250_10023011 | Ga0105250_100230114 | 68 |
| 811 | 3300009093 | Ga0105240_10399065 | Ga0105240_103990653 | 68 |
| 812 | 3300009094 | Ga0111539_12687721 | Ga0111539_126877212 | 68 |
| 813 | 3300009098 | Ga0105245_10005029 | Ga0105245_1000502911 | 68 |
| 814 | 3300009101 | Ga0105247_10052463 | Ga0105247_100524633 | 68 |
| 815 | 3300009148 | Ga0105243_11072228 | Ga0105243_110722282 | 68 |
| 816 | 3300009174 | Ga0105241_10014226 | Ga0105241_100142268 | 68 |
| 817 | 3300009176 | Ga0105242_10035557 | Ga0105242_100355572 | 68 |
| 818 | 3300009177 | Ga0105248_10038960 | Ga0105248_100389602 | 68 |
| 819 | 3300009545 | Ga0105237_10143015 | Ga0105237_101430153 | 68 |
| 820 | 3300009545 | Ga0105237_10191641 | Ga0105237_101916412 | 68 |
| 821 | 3300009551 | Ga0105238_10424409 | Ga0105238_104244093 | 68 |
| 822 | 3300009553 | Ga0105249_10111464 | Ga0105249_101114642 | 68 |
| 823 | 3300010375 | Ga0105239_10029298 | Ga0105239_100292988 | 68 |
| 824 | 3300011119 | Ga0105246_10002877 | Ga0105246_1000287713 | 68 |
| 825 | 3300012483 | Ga0157337_1025918 | Ga0157337_10259181 | 68 |
| 826 | 3300013100 | Ga0157373_10001758 | Ga0157373_1000175821 | 68 |
| 827 | 3300013102 | Ga0157371_10002134 | Ga0157371_1000213412 | 68 |
| 828 | 3300013105 | Ga0157369_10026263 | Ga0157369_100262634 | 68 |
| 829 | 3300013296 | Ga0157374_10014284 | Ga0157374_100142842 | 68 |
| 830 | 3300013296 | Ga0157374_10029721 | Ga0157374_100297218 | 68 |
| 831 | 3300013297 | Ga0157378_10029365 | Ga0157378_100293654 | 68 |
| 832 | 3300013297 | Ga0157378_10081386 | Ga0157378_100813862 | 68 |
| 833 | 3300013306 | Ga0163162_10015114 | Ga0163162_1001511413 | 68 |
| 834 | 3300013306 | Ga0163162_10296022 | Ga0163162_102960224 | 68 |
| 835 | 3300013307 | Ga0157372_10002154 | Ga0157372_1000215413 | 68 |
| 836 | 3300013307 | Ga0157372_10091572 | Ga0157372_100915727 | 68 |
| 837 | 3300013308 | Ga0157375_10067349 | Ga0157375_100673494 | 68 |
| 838 | 3300014325 | Ga0163163_10001073 | Ga0163163_1000107321 | 68 |
| 839 | 3300014325 | Ga0163163_12359656 | Ga0163163_123596562 | 68 |
| 840 | 3300014326 | Ga0157380_10030441 | Ga0157380_100304415 | 68 |
| 841 | 3300014745 | Ga0157377_10000768 | Ga0157377_1000076817 | 68 |
| 842 | 3300014968 | Ga0157379_10005366 | Ga0157379_1000536612 | 68 |
| 843 | 3300014968 | Ga0157379_12653172 | Ga0157379_126531722 | 68 |
| 844 | 3300014969 | Ga0157376_10013365 | Ga0157376_100133652 | 68 |
| 845 | 3300015261 | Ga0182006_1040198 | Ga0182006_10401982 | 68 |
| 846 | 3300015262 | Ga0182007_10081080 | Ga0182007_100810802 | 68 |
| 847 | 3300017792 | Ga0163161_10001969 | Ga0163161_1000196920 | 68 |
| 848 | 3300025315 | Ga0207697_10022130 | Ga0207697_100221305 | 68 |
| 849 | 3300025321 | Ga0207656_10007564 | Ga0207656_100075645 | 68 |
| 850 | 3300025711 | Ga0207696_1030544 | Ga0207696_10305443 | 68 |
| 851 | 3300025893 | Ga0207682_10254281 | Ga0207682_102542812 | 68 |
| 852 | 3300025899 | Ga0207642_10019526 | Ga0207642_100195263 | 68 |
| 853 | 3300025900 | Ga0207710_10011254 | Ga0207710_100112543 | 68 |
| 854 | 3300025901 | Ga0207688_10005204 | Ga0207688_100052042 | 68 |
| 855 | 3300025903 | Ga0207680_10001756 | Ga0207680_1000175612 | 68 |
| 856 | 3300025904 | Ga0207647_10001343 | Ga0207647_100013434 | 68 |
| 857 | 3300025907 | Ga0207645_10001180 | Ga0207645_1000118014 | 68 |
| 858 | 3300025908 | Ga0207643_10001067 | Ga0207643_1000106711 | 68 |
| 859 | 3300025909 | Ga0207705_10284805 | Ga0207705_102848052 | 68 |
| 860 | 3300025911 | Ga0207654_10028664 | Ga0207654_100286643 | 68 |
| 861 | 3300025914 | Ga0207671_10091668 | Ga0207671_100916684 | 68 |
| 862 | 3300025916 | Ga0207663_10160673 | Ga0207663_101606731 | 68 |
| 863 | 3300025918 | Ga0207662_10014118 | Ga0207662_100141186 | 68 |
| 864 | 3300025919 | Ga0207657_10004069 | Ga0207657_1000406921 | 68 |
| 865 | 3300025920 | Ga0207649_10001087 | Ga0207649_1000108721 | 68 |
| 866 | 3300025923 | Ga0207681_10009111 | Ga0207681_100091119 | 68 |
| 867 | 3300025925 | Ga0207650_10000152 | Ga0207650_1000015260 | 68 |
| 868 | 3300025925 | Ga0207650_11032043 | Ga0207650_110320431 | 68 |
| 869 | 3300025926 | Ga0207659_10003498 | Ga0207659_1000349811 | 68 |
| 870 | 3300025927 | Ga0207687_10010238 | Ga0207687_100102383 | 68 |
| 871 | 3300025931 | Ga0207644_10003335 | Ga0207644_1000333512 | 68 |
| 872 | 3300025932 | Ga0207690_10007754 | Ga0207690_100077543 | 68 |
| 873 | 3300025933 | Ga0207706_10000740 | Ga0207706_1000074021 | 68 |
| 874 | 3300025934 | Ga0207686_10234097 | Ga0207686_102340973 | 68 |
| 875 | 3300025936 | Ga0207670_10003610 | Ga0207670_1000361014 | 68 |
| 876 | 3300025937 | Ga0207669_11201146 | Ga0207669_112011462 | 68 |
| 877 | 3300025938 | Ga0207704_10009815 | Ga0207704_100098154 | 68 |
| 878 | 3300025940 | Ga0207691_10000308 | Ga0207691_1000030835 | 68 |
| 879 | 3300025941 | Ga0207711_10003068 | Ga0207711_1000306811 | 68 |
| 880 | 3300025942 | Ga0207689_10000618 | Ga0207689_1000061821 | 68 |
| 881 | 3300025944 | Ga0207661_10007082 | Ga0207661_1000708211 | 68 |
| 882 | 3300025945 | Ga0207679_10000298 | Ga0207679_1000029821 | 68 |
| 883 | 3300025949 | Ga0207667_10055132 | Ga0207667_100551328 | 68 |
| 884 | 3300025960 | Ga0207651_10003558 | Ga0207651_1000355813 | 68 |
| 885 | 3300025961 | Ga0207712_10063662 | Ga0207712_100636622 | 68 |
| 886 | 3300025972 | Ga0207668_10069658 | Ga0207668_100696583 | 68 |
| 887 | 3300025981 | Ga0207640_10063034 | Ga0207640_100630343 | 68 |
| 888 | 3300025986 | Ga0207658_10003391 | Ga0207658_1000339110 | 68 |
| 889 | 3300026023 | Ga0207677_10007921 | Ga0207677_100079219 | 68 |
| 890 | 3300026035 | Ga0207703_10007555 | Ga0207703_100075555 | 68 |
| 891 | 3300026041 | Ga0207639_10003445 | Ga0207639_100034459 | 68 |
| 892 | 3300026067 | Ga0207678_10003018 | Ga0207678_100030189 | 68 |
| 893 | 3300026067 | Ga0207678_11060377 | Ga0207678_110603772 | 68 |
| 894 | 3300026075 | Ga0207708_10073017 | Ga0207708_100730174 | 68 |
| 895 | 3300026078 | Ga0207702_10313960 | Ga0207702_103139603 | 68 |
| 896 | 3300026088 | Ga0207641_10000052 | Ga0207641_1000005220 | 68 |
| 897 | 3300026089 | Ga0207648_10003962 | Ga0207648_1000396221 | 68 |
| 898 | 3300026095 | Ga0207676_10000176 | Ga0207676_1000017641 | 68 |
| 899 | 3300026095 | Ga0207676_10564199 | Ga0207676_105641992 | 68 |
| 900 | 3300026116 | Ga0207674_10000561 | Ga0207674_1000056135 | 68 |
| 901 | 3300026118 | Ga0207675_100005443 | Ga0207675_10000544311 | 68 |
| 902 | 3300026121 | Ga0207683_10001978 | Ga0207683_1000197812 | 68 |
| 903 | 3300026142 | Ga0207698_10170772 | Ga0207698_101707723 | 68 |
| 904 | 3300027907 | Ga0207428_11136042 | Ga0207428_111360422 | 68 |
| 905 | 3300028379 | Ga0268266_10001266 | Ga0268266_1000126626 | 68 |
| 906 | 3300028380 | Ga0268265_10008088 | Ga0268265_100080888 | 68 |
| 907 | 3300028380 | Ga0268265_10044241 | Ga0268265_100442413 | 68 |
| 908 | 3300028381 | Ga0268264_10005269 | Ga0268264_1000526912 | 68 |
| 909 | 3300035691 | Ga0373931_0502874 | Ga0373931_0502874_92_304 | 68 |
| 910 | 3300044712 | Ga0453684_1249722 | Ga0453684_1249722_288_494 | 68 |
| 911 | 3300046457 | Ga0495590_0402543 | Ga0495590_0402543_260_466 | 68 |
| 912 | 3300046472 | Ga0495580_0039298 | Ga0495580_0039298_72_278 | 68 |
| 913 | 3300046528 | Ga0495642_0399567 | Ga0495642_0399567_54_260 | 68 |
| 914 | 3300046684 | Ga0495669_0033508 | Ga0495669_0033508_1300_1506 | 68 |
| 915 | 3300048903 | Ga0496100_0243051 | Ga0496100_0243051_856_1062 | 68 |
| 916 | 3300048904 | Ga0496101_1040896 | Ga0496101_1040896_304_510 | 68 |
| 917 | 3300048905 | Ga0496102_0021206 | Ga0496102_0021206_5406_5612 | 68 |
| 918 | 3300048905 | Ga0496102_0576757 | Ga0496102_0576757_218_424 | 68 |
| 919 | 3300048906 | Ga0496103_0254260 | Ga0496103_0254260_444_650 | 68 |
| 920 | 3300048907 | Ga0496104_0416050 | Ga0496104_0416050_648_854 | 68 |
| 921 | 3300048909 | Ga0496106_0159342 | Ga0496106_0159342_1330_1536 | 68 |
| 922 | 3300048911 | Ga0496108_0000242 | Ga0496108_0000242_9977_10183 | 68 |
| 923 | 3300048912 | Ga0496109_0000120 | Ga0496109_0000120_8602_8808 | 68 |
| 924 | 3300048912 | Ga0496109_0141665 | Ga0496109_0141665_73_285 | 68 |
| 925 | 3300048913 | Ga0496110_0000795 | Ga0496110_0000795_9838_10044 | 68 |
| 926 | 3300048915 | Ga0496112_0000198 | Ga0496112_0000198_28363_28569 | 68 |
| 927 | 3300048915 | Ga0496112_0478973 | Ga0496112_0478973_964_1170 | 68 |
| 928 | 3300048916 | Ga0496113_0000111 | Ga0496113_0000111_25084_25290 | 68 |
| 929 | 3300048918 | Ga0496115_0018551 | Ga0496115_0018551_5055_5261 | 68 |
| 930 | 3300049744 | Ga0501083_0089368 | Ga0501083_0089368_455_661 | 68 |
| 931 | 3300049744 | Ga0501083_0305202 | Ga0501083_0305202_541_747 | 68 |
| 932 | 3300050512 | nmdc:mga0n895_1691134_c1 | nmdc:mga0n895_1691134_c1_251_457 | 68 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5hl7-assembly1.cif.gz_W | the crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with lefamulin | 0.9073 | 12 | 68 |
| 4wf9-assembly1.cif.gz_W | the crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with telithromycin | 0.9049 | 12 | 68 |
| 8qpp-assembly1.cif.gz_x | bacillus subtilis muts2-collided disome complex (stalled 70s) | 0.9018 | 12 | 68 |
| 6fxc-assembly1.cif.gz_AX | the cryo-em structure of hibernating 100s ribosome dimer from pathogenic staphylococcus aureus | 0.8997 | 12 | 68 |
| 7s9u-assembly1.cif.gz_Z | 44sr3c ribosomal particle | 0.8975 | 12 | 68 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5hl7W00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 | 0.9073 | 12 | 68 | 3.30.1390.20 |
| 4wfbW00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 | 0.9036 | 12 | 68 | 3.30.1390.20 |
| 5hl7W00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 | 0.8926 | 12 | 68 | 3.30.1390.20 |
| 1vw4U00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 | 0.8904 | 13 | 68 | 3.30.1390.20 |
| af_P9WHA3_1_65_3.30.1390.20 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 | 0.8902 | 13 | 67 | 3.30.1390.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-C7LKI6-F1-model_v4 | Multifunctional fusion protein [Includes: Small ribosomal subunit protein uS5; Large ribosomal subunit protein uL30] | 0.9417 | 13 | 68 |
GO:0003735
GO:0006412 GO:0015934 GO:0015935 GO:0019843 |
| AF-A0A3D0FPQ4-F1-model_v4 | Multifunctional fusion protein [Includes: Large ribosomal subunit protein uL15; Large ribosomal subunit protein uL30] | 0.9386 | 13 | 66 |
GO:0003735
GO:0006412 GO:0019843 GO:0022625 |
| AF-A0A5B9EEZ4-F1-model_v4 | Large ribosomal subunit protein uL30 | 0.919 | 10 | 68 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A7V4ZQE1-F1-model_v4 | 50S ribosomal protein L30 | 0.9175 | 12 | 67 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A1V5FZK5-F1-model_v4 | Large ribosomal subunit protein uL30 | 0.9164 | 12 | 68 |
GO:0003735
GO:0006412 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar