F486069

General Info

Members Datasets Scaffolds Average Seq Length
932 330 932 68

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_11861737|Ga0157369_118617372
Length 79
Sequence MTTAKTNTKTRAKAAKAAGPAGKLHLKYVRSVICTPVKHKLVVKGLGFTRLNQIIERPDTPAIRGMVAKVPHLVEIVET

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
99 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
100 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
117 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
133 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
137 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
138 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
206 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
207 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
215 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
216 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
217 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
218 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
219 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
220 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
221 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
222 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
223 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
224 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
225 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
226 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
227 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
228 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
229 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
230 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
231 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
232 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
233 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
234 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
235 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
236 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
237 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
238 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
239 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
240 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
241 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
242 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
243 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
244 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
245 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
246 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
247 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
248 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
249 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
251 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
252 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
253 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
254 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
255 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
256 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
257 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
258 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
259 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
260 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
261 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
262 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
263 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
264 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
265 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
266 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
267 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
268 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
269 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
270 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
271 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
272 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
273 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
274 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
275 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
276 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
277 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
278 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
279 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
280 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
281 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
282 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
283 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
284 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
285 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
286 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
287 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
288 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
289 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
290 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
291 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
292 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
293 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
294 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
295 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
296 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
297 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
298 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
299 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
300 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
301 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
302 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
303 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
304 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
305 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
306 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
307 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
308 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
309 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
310 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
317 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
318 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
319 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
320 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
321 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
324 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
325 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
326 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
327 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
328 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
329 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
330 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.14
Metatranscriptomes 0.86
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.04
Rhizosphere 93.78
Stem 0
Stem Tuber 0
Unclassified 1.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1033502 3300001915 Unclassified 764
2 JGI24752J21851_1000484 3300001976 Bacteria 5323
3 JGI24740J21852_10091596 3300001979 Bacteria 783
4 JGI24737J22298_10025233 3300001990 Bacteria 1880
5 JGI24743J22301_10003249 3300001991 Bacteria 2556
6 JGI24738J21930_10047296 3300002075 Bacteria 875
7 JGI24033J26618_1039806 3300002155 Bacteria 653
8 JGI24034J26672_10008468 3300002239 Bacteria 1504
9 JGI24751J29686_10001356 3300002459 Bacteria 5148
10 Ga0065704_10534439 3300005289 Bacteria 645
11 Ga0065715_10104722 3300005293 Bacteria 2940
12 Ga0065707_11036024 3300005295 Unclassified 530
13 Ga0070658_10031905 3300005327 Bacteria 4233
14 Ga0070658_10036784 3300005327 Bacteria 3946
15 Ga0070658_10050557 3300005327 Bacteria 3369
16 Ga0070658_10077132 3300005327 Bacteria 2733
17 Ga0070676_10004776 3300005328 Bacteria 7163
18 Ga0070683_100011087 3300005329 Bacteria 7771
19 Ga0070683_100051474 3300005329 Bacteria 3813
20 Ga0070683_100322780 3300005329 Bacteria 1469
21 Ga0070690_100000550 3300005330 Bacteria 18744
22 Ga0070690_100122080 3300005330 Bacteria 1749
23 Ga0070690_100174565 3300005330 Bacteria 1481
24 Ga0070690_100341478 3300005330 Bacteria 1084
25 Ga0070670_100015559 3300005331 Bacteria 6534
26 Ga0070670_100033183 3300005331 Bacteria 4447
27 Ga0070670_100307148 3300005331 Bacteria 1388
28 Ga0068869_100001846 3300005334 Bacteria 12731
29 Ga0068869_100014372 3300005334 Bacteria 5286
30 Ga0068869_100074090 3300005334 Bacteria 2526
31 Ga0068869_100651889 3300005334 Bacteria 894
32 Ga0068869_100689580 3300005334 Unclassified 870
33 Ga0070666_10010107 3300005335 Bacteria 5893
34 Ga0070666_10010510 3300005335 Bacteria 5791
35 Ga0070666_10410582 3300005335 Unclassified 974
36 Ga0070680_100014163 3300005336 Bacteria 6229
37 Ga0070680_100061979 3300005336 Bacteria 3062
38 Ga0070680_100830505 3300005336 Bacteria 796
39 Ga0070680_101581496 3300005336 Bacteria 568
40 Ga0070682_100141510 3300005337 Bacteria 1640
41 Ga0070682_100196586 3300005337 Bacteria 1420
42 Ga0070682_100392440 3300005337 Bacteria 1047
43 Ga0070682_100590193 3300005337 Bacteria 875
44 Ga0068868_100002791 3300005338 Bacteria 12099
45 Ga0068868_100011852 3300005338 Bacteria 6357
46 Ga0068868_100022874 3300005338 Bacteria 4724
47 Ga0070660_100002901 3300005339 Bacteria 11803
48 Ga0070660_100056691 3300005339 Bacteria 3032
49 Ga0070660_100139461 3300005339 Bacteria 1944
50 Ga0070689_100068823 3300005340 Bacteria 2761
51 Ga0070689_100172754 3300005340 Bacteria 1752
52 Ga0070689_100446957 3300005340 Bacteria 1099
53 Ga0070687_100000493 3300005343 Bacteria 13161
54 Ga0070687_100497232 3300005343 Bacteria 820
55 Ga0070687_101109842 3300005343 Unclassified 579
56 Ga0070661_100012073 3300005344 Bacteria 6037
57 Ga0070661_100018897 3300005344 Bacteria 4907
58 Ga0070661_100136525 3300005344 Bacteria 1846
59 Ga0070661_100913112 3300005344 Unclassified 725
60 Ga0070692_10910340 3300005345 Bacteria 609
61 Ga0070668_100014649 3300005347 Bacteria 5860
62 Ga0070668_100053030 3300005347 Bacteria 3127
63 Ga0070669_100007500 3300005353 Bacteria 7813
64 Ga0070669_100103748 3300005353 Bacteria 2149
65 Ga0070675_100004817 3300005354 Bacteria 10298
66 Ga0070675_100146387 3300005354 Bacteria 2023
67 Ga0070675_101583510 3300005354 Bacteria 604
68 Ga0070671_100255078 3300005355 Bacteria 1490
69 Ga0070671_100451132 3300005355 Bacteria 1103
70 Ga0070674_100010705 3300005356 Bacteria 5557
71 Ga0070674_100236991 3300005356 Bacteria 1426
72 Ga0070673_100073104 3300005364 Bacteria 2759
73 Ga0070673_100297904 3300005364 Bacteria 1419
74 Ga0070673_100944465 3300005364 Bacteria 801
75 Ga0070688_100031729 3300005365 Bacteria 3180
76 Ga0070688_100207210 3300005365 Bacteria 1375
77 Ga0070688_100781848 3300005365 Unclassified 745
78 Ga0070659_100023459 3300005366 Bacteria 4721
79 Ga0070659_100149849 3300005366 Bacteria 1902
80 Ga0070659_100182952 3300005366 Bacteria 1720
81 Ga0070667_100066877 3300005367 Bacteria 3054
82 Ga0070667_100289930 3300005367 Bacteria 1471
83 Ga0070667_101685996 3300005367 Bacteria 596
84 Ga0070667_102264942 3300005367 Bacteria 512
85 Ga0070709_10031545 3300005434 Bacteria 3188
86 Ga0070709_10232135 3300005434 Bacteria 1321
87 Ga0070709_10647352 3300005434 Bacteria 818
88 Ga0070709_10722261 3300005434 Bacteria 777
89 Ga0070709_11338413 3300005434 Bacteria 578
90 Ga0070714_100000096 3300005435 Bacteria 74616
91 Ga0070714_100010335 3300005435 Bacteria 7376
92 Ga0070714_100432677 3300005435 Bacteria 1248
93 Ga0070714_102361963 3300005435 Bacteria 517
94 Ga0070714_102385542 3300005435 Bacteria 514
95 Ga0070713_100015219 3300005436 Bacteria 5738
96 Ga0070713_100030142 3300005436 Bacteria 4304
97 Ga0070713_100058153 3300005436 Bacteria 3223
98 Ga0070713_100260906 3300005436 Bacteria 1583
99 Ga0070713_100667440 3300005436 Bacteria 991
100 Ga0070713_101546400 3300005436 Bacteria 644
101 Ga0070713_101994857 3300005436 Unclassified 563
102 Ga0070710_10132132 3300005437 Bacteria 1523
103 Ga0070710_10377437 3300005437 Bacteria 945
104 Ga0070710_11387037 3300005437 Bacteria 525
105 Ga0070701_10964868 3300005438 Unclassified 592
106 Ga0070711_100000191 3300005439 Bacteria 32562
107 Ga0070711_100094452 3300005439 Bacteria 2162
108 Ga0070711_100420861 3300005439 Bacteria 1088
109 Ga0070711_100646646 3300005439 Bacteria 886
110 Ga0070711_101221628 3300005439 Bacteria 650
111 Ga0070711_101287725 3300005439 Bacteria 634
112 Ga0070711_101627094 3300005439 Bacteria 565
113 Ga0070705_100132317 3300005440 Bacteria 1629
114 Ga0070705_101746208 3300005440 Bacteria 527
115 Ga0070700_100068348 3300005441 Bacteria 2259
116 Ga0070700_100657562 3300005441 Bacteria 828
117 Ga0070694_100577378 3300005444 Unclassified 903
118 Ga0070694_100938564 3300005444 Bacteria 716
119 Ga0070708_100003510 3300005445 Bacteria 12276
120 Ga0070708_100015435 3300005445 Bacteria 6309
121 Ga0070708_100069047 3300005445 Bacteria 3177
122 Ga0070708_100555134 3300005445 Bacteria 1083
123 Ga0070708_100964934 3300005445 Bacteria 800
124 Ga0070663_100012382 3300005455 Bacteria 5395
125 Ga0070663_100012394 3300005455 Bacteria 5392
126 Ga0070663_100121663 3300005455 Bacteria 1972
127 Ga0070663_100274893 3300005455 Bacteria 1340
128 Ga0070663_100325180 3300005455 Bacteria 1238
129 Ga0070663_101360826 3300005455 Bacteria 628
130 Ga0070678_100101422 3300005456 Bacteria 2231
131 Ga0070678_100132369 3300005456 Unclassified 1983
132 Ga0070662_100005784 3300005457 Bacteria 7923
133 Ga0070662_100018068 3300005457 Bacteria 4765
134 Ga0070681_10232825 3300005458 Bacteria 1756
135 Ga0070681_10263683 3300005458 Bacteria 1635
136 Ga0070681_10372053 3300005458 Bacteria 1339
137 Ga0070681_10549485 3300005458 Bacteria 1069
138 Ga0070681_11340808 3300005458 Bacteria 638
139 Ga0070681_11389979 3300005458 Unclassified 625
140 Ga0070681_11580077 3300005458 Bacteria 581
141 Ga0068867_100009657 3300005459 Bacteria 6801
142 Ga0068867_100090268 3300005459 Bacteria 2324
143 Ga0070685_10001292 3300005466 Bacteria 13193
144 Ga0070685_10044363 3300005466 Bacteria 2545
145 Ga0070685_10201038 3300005466 Bacteria 1295
146 Ga0070706_100000514 3300005467 Bacteria 45375
147 Ga0070706_100014580 3300005467 Bacteria 7262
148 Ga0070706_100811981 3300005467 Bacteria 866
149 Ga0070706_102109245 3300005467 Bacteria 510
150 Ga0070707_100000662 3300005468 Bacteria 34318
151 Ga0070707_100005126 3300005468 Bacteria 12276
152 Ga0070707_100033790 3300005468 Bacteria 4876
153 Ga0070698_100002449 3300005471 Bacteria 20472
154 Ga0070698_100004533 3300005471 Bacteria 15264
155 Ga0070698_100169617 3300005471 Bacteria 2124
156 Ga0070699_100000441 3300005518 Bacteria 39851
157 Ga0070699_100003886 3300005518 Bacteria 13210
158 Ga0070699_100089928 3300005518 Bacteria 2683
159 Ga0070699_101428219 3300005518 Bacteria 635
160 Ga0070699_102027579 3300005518 Bacteria 526
161 Ga0070679_100113302 3300005530 Bacteria 2698
162 Ga0070679_100378503 3300005530 Bacteria 1362
163 Ga0070679_100479152 3300005530 Bacteria 1188
164 Ga0070679_100895746 3300005530 Bacteria 831
165 Ga0070679_100986095 3300005530 Bacteria 786
166 Ga0070679_101990579 3300005530 Bacteria 530
167 Ga0070684_100001423 3300005535 Bacteria 17232
168 Ga0070684_100015104 3300005535 Bacteria 6277
169 Ga0070684_100136427 3300005535 Bacteria 2217
170 Ga0070684_102236594 3300005535 Bacteria 516
171 Ga0070697_100000975 3300005536 Bacteria 21592
172 Ga0070697_100001451 3300005536 Bacteria 18044
173 Ga0070697_100005121 3300005536 Bacteria 10067
174 Ga0070697_100008091 3300005536 Bacteria 8200
175 Ga0070697_100231449 3300005536 Bacteria 1576
176 Ga0070697_100556823 3300005536 Bacteria 1006
177 Ga0070697_100567811 3300005536 Bacteria 996
178 Ga0070697_101943627 3300005536 Bacteria 526
179 Ga0068853_100008308 3300005539 Bacteria 8336
180 Ga0068853_100081315 3300005539 Bacteria 2836
181 Ga0068853_100135035 3300005539 Bacteria 2211
182 Ga0070672_100134491 3300005543 Bacteria 2035
183 Ga0070672_100322681 3300005543 Bacteria 1313
184 Ga0070686_100005280 3300005544 Bacteria 7141
185 Ga0070686_100033425 3300005544 Bacteria 3160
186 Ga0070686_101011357 3300005544 Unclassified 682
187 Ga0070695_100045508 3300005545 Bacteria 2797
188 Ga0070695_100093115 3300005545 Unclassified 2016
189 Ga0070695_100565960 3300005545 Bacteria 888
190 Ga0070696_100089544 3300005546 Bacteria 2188
191 Ga0070696_100107978 3300005546 Bacteria 2002
192 Ga0070696_100554755 3300005546 Bacteria 921
193 Ga0070693_100015931 3300005547 Bacteria 3880
194 Ga0070693_100092826 3300005547 Bacteria 1823
195 Ga0070693_100258541 3300005547 Bacteria 1157
196 Ga0070665_100037358 3300005548 Bacteria 4884
197 Ga0070665_100288347 3300005548 Bacteria 1644
198 Ga0070704_100731609 3300005549 Bacteria 880
199 Ga0068855_100003825 3300005563 Bacteria 18405
200 Ga0068855_100025048 3300005563 Bacteria 7141
201 Ga0068855_100035485 3300005563 Bacteria 5939
202 Ga0068855_100084699 3300005563 Bacteria 3669
203 Ga0068855_100345257 3300005563 Bacteria 1640
204 Ga0068855_100751560 3300005563 Bacteria 1040
205 Ga0068855_101230413 3300005563 Bacteria 777
206 Ga0070664_100017663 3300005564 Bacteria 5858
207 Ga0070664_100144991 3300005564 Bacteria 2093
208 Ga0070664_100600895 3300005564 Unclassified 1020
209 Ga0070664_101239338 3300005564 Bacteria 704
210 Ga0068857_100001133 3300005577 Bacteria 20806
211 Ga0068857_100097440 3300005577 Bacteria 2637
212 Ga0068857_100103614 3300005577 Bacteria 2554
213 Ga0068857_100944824 3300005577 Bacteria 828
214 Ga0068857_101295819 3300005577 Bacteria 707
215 Ga0068857_102465828 3300005577 Unclassified 511
216 Ga0068854_100038966 3300005578 Bacteria 3345
217 Ga0068854_100079731 3300005578 Bacteria 2414
218 Ga0068854_101239939 3300005578 Unclassified 669
219 Ga0068856_100060929 3300005614 Bacteria 3728
220 Ga0068856_100309821 3300005614 Bacteria 1596
221 Ga0068856_100481787 3300005614 Bacteria 1262
222 Ga0068856_100995425 3300005614 Bacteria 857
223 Ga0068856_101607101 3300005614 Bacteria 663
224 Ga0070702_100151255 3300005615 Bacteria 1490
225 Ga0070702_100260522 3300005615 Bacteria 1180
226 Ga0068852_100001223 3300005616 Bacteria 17089
227 Ga0068852_100018750 3300005616 Bacteria 5457
228 Ga0068852_100884894 3300005616 Bacteria 910
229 Ga0068859_100010649 3300005617 Bacteria 9255
230 Ga0068859_100025042 3300005617 Bacteria 5990
231 Ga0068859_100052886 3300005617 Bacteria 4084
232 Ga0068864_100086394 3300005618 Bacteria 2759
233 Ga0068864_100277958 3300005618 Bacteria 1562
234 Ga0068864_100289329 3300005618 Bacteria 1531
235 Ga0068866_10001380 3300005718 Bacteria 10468
236 Ga0068866_10025064 3300005718 Bacteria 2799
237 Ga0068861_100006422 3300005719 Bacteria 8008
238 Ga0068861_100165678 3300005719 Bacteria 1827
239 Ga0068861_100454185 3300005719 Bacteria 1149
240 Ga0068851_10001352 3300005834 Bacteria 10700
241 Ga0068851_10015057 3300005834 Bacteria 3681
242 Ga0068851_10581704 3300005834 Bacteria 680
243 Ga0068851_10702608 3300005834 Bacteria 622
244 Ga0068870_10007394 3300005840 Bacteria 4892
245 Ga0068870_10932203 3300005840 Unclassified 615
246 Ga0068863_100020550 3300005841 Bacteria 6312
247 Ga0068863_100169911 3300005841 Bacteria 2091
248 Ga0068863_101911187 3300005841 Bacteria 603
249 Ga0068858_100023794 3300005842 Bacteria 5707
250 Ga0068858_100042739 3300005842 Bacteria 4202
251 Ga0068858_100059426 3300005842 Bacteria 3533
252 Ga0068858_100066188 3300005842 Bacteria 3345
253 Ga0068858_100135922 3300005842 Bacteria 2307
254 Ga0068858_101682143 3300005842 Bacteria 627
255 Ga0068860_100018016 3300005843 Bacteria 6877
256 Ga0068860_100036537 3300005843 Bacteria 4706
257 Ga0068860_100073000 3300005843 Bacteria 3262
258 Ga0068860_100253033 3300005843 Bacteria 1716
259 Ga0068860_100525026 3300005843 Bacteria 1184
260 Ga0068860_100564649 3300005843 Bacteria 1141
261 Ga0068862_100010568 3300005844 Bacteria 7629
262 Ga0068862_100027948 3300005844 Bacteria 4750
263 Ga0068862_100031514 3300005844 Bacteria 4476
264 Ga0068862_102020393 3300005844 Bacteria 587
265 Ga0068862_102047875 3300005844 Unclassified 583
266 Ga0070717_10002614 3300006028 Bacteria 12700
267 Ga0070717_10006374 3300006028 Bacteria 8673
268 Ga0070717_10094307 3300006028 Bacteria 2531
269 Ga0070717_10118628 3300006028 Bacteria 2264
270 Ga0070717_10120021 3300006028 Bacteria 2251
271 Ga0070717_10491944 3300006028 Bacteria 1108
272 Ga0070717_10982666 3300006028 Bacteria 769
273 Ga0070717_11394051 3300006028 Unclassified 637
274 Ga0070717_11840801 3300006028 Bacteria 547
275 Ga0070717_11977549 3300006028 Bacteria 525
276 Ga0070715_10019784 3300006163 Bacteria 2587
277 Ga0070715_10494896 3300006163 Bacteria 699
278 Ga0070715_10572066 3300006163 Bacteria 658
279 Ga0070715_10815351 3300006163 Bacteria 568
280 Ga0070716_100023941 3300006173 Bacteria 3245
281 Ga0070716_100127708 3300006173 Bacteria 1602
282 Ga0070716_100139392 3300006173 Bacteria 1544
283 Ga0070716_100151070 3300006173 Bacteria 1494
284 Ga0070716_100962603 3300006173 Unclassified 672
285 Ga0070712_100002103 3300006175 Bacteria 12240
286 Ga0070712_100042575 3300006175 Bacteria 3123
287 Ga0070712_100587298 3300006175 Bacteria 942
288 Ga0097621_100007525 3300006237 Bacteria 7797
289 Ga0097621_100013773 3300006237 Bacteria 6038
290 Ga0097621_100020695 3300006237 Bacteria 5073
291 Ga0097621_100075555 3300006237 Bacteria 2793
292 Ga0097621_100276146 3300006237 Bacteria 1478
293 Ga0097621_101304847 3300006237 Bacteria 686
294 Ga0097621_101895105 3300006237 Bacteria 569
295 Ga0068871_100014064 3300006358 Bacteria 5952
296 Ga0068871_100098154 3300006358 Bacteria 2450
297 Ga0068871_100473609 3300006358 Bacteria 1125
298 Ga0068871_100742892 3300006358 Bacteria 901
299 Ga0075428_101476913 3300006844 Unclassified 712
300 Ga0075433_10004383 3300006852 Bacteria 10975
301 Ga0075433_11034281 3300006852 Bacteria 715
302 Ga0075434_100000230 3300006871 Bacteria 38508
303 Ga0075434_100792676 3300006871 Bacteria 964
304 Ga0075434_100801380 3300006871 Bacteria 958
305 Ga0075434_101160788 3300006871 Bacteria 785
306 Ga0075434_101937085 3300006871 Bacteria 595
307 Ga0068865_100016197 3300006881 Bacteria 4765
308 Ga0068865_100044651 3300006881 Bacteria 3034
309 Ga0068865_101556661 3300006881 Unclassified 593
310 Ga0068865_101889644 3300006881 Bacteria 540
311 Ga0075436_100000510 3300006914 Bacteria 25141
312 Ga0075436_100029891 3300006914 Bacteria 3748
313 Ga0075436_100415732 3300006914 Bacteria 976
314 Ga0075436_100744057 3300006914 Bacteria 728
315 Ga0097620_100010649 3300006931 Bacteria 9255
316 Ga0097620_100025042 3300006931 Bacteria 5990
317 Ga0097620_100052889 3300006931 Bacteria 4084
318 Ga0075435_100000389 3300007076 Bacteria 26853
319 Ga0075435_100055600 3300007076 Bacteria 3197
320 Ga0075435_100150842 3300007076 Bacteria 1954
321 Ga0075435_101510837 3300007076 Bacteria 589
322 Ga0099794_10380592 3300007265 Bacteria 736
323 Ga0099795_10581479 3300007788 Bacteria 531
324 Ga0105250_10023011 3300009092 Bacteria 2510
325 Ga0105240_10100771 3300009093 Bacteria 3514
326 Ga0105240_10119015 3300009093 Bacteria 3182
327 Ga0105240_10154500 3300009093 Bacteria 2730
328 Ga0105240_10391623 3300009093 Bacteria 1567
329 Ga0105240_10399065 3300009093 Bacteria 1549
330 Ga0105240_10947580 3300009093 Bacteria 923
331 Ga0105240_11067984 3300009093 Bacteria 861
332 Ga0105240_12267497 3300009093 Unclassified 563
333 Ga0111539_12687721 3300009094 Unclassified 577
334 Ga0105245_10005029 3300009098 Bacteria 11625
335 Ga0105245_10054232 3300009098 Bacteria 3600
336 Ga0105245_10056662 3300009098 Bacteria 3523
337 Ga0105245_10174848 3300009098 Bacteria 2047
338 Ga0105245_10261930 3300009098 Bacteria 1683
339 Ga0105245_11080508 3300009098 Bacteria 848
340 Ga0105245_12751900 3300009098 Bacteria 545
341 Ga0105245_13255067 3300009098 Unclassified 503
342 Ga0105247_10028333 3300009101 Bacteria 3388
343 Ga0105247_10037507 3300009101 Bacteria 2957
344 Ga0105247_10052463 3300009101 Bacteria 2515
345 Ga0114129_11223317 3300009147 Bacteria 934
346 Ga0105243_11072228 3300009148 Unclassified 812
347 Ga0105241_10014226 3300009174 Bacteria 5829
348 Ga0105241_10104611 3300009174 Bacteria 2256
349 Ga0105241_10127889 3300009174 Bacteria 2053
350 Ga0105241_10342448 3300009174 Bacteria 1296
351 Ga0105241_10503769 3300009174 Bacteria 1080
352 Ga0105241_10546537 3300009174 Bacteria 1039
353 Ga0105241_11693131 3300009174 Bacteria 614
354 Ga0105242_10028689 3300009176 Bacteria 4432
355 Ga0105242_10035557 3300009176 Bacteria 3994
356 Ga0105242_10110302 3300009176 Bacteria 2344
357 Ga0105248_10032147 3300009177 Bacteria 5865
358 Ga0105248_10038960 3300009177 Bacteria 5321
359 Ga0105248_10157464 3300009177 Bacteria 2563
360 Ga0105248_10569718 3300009177 Bacteria 1278
361 Ga0105248_10906466 3300009177 Unclassified 995
362 Ga0105237_10054319 3300009545 Bacteria 4014
363 Ga0105237_10065790 3300009545 Bacteria 3620
364 Ga0105237_10143015 3300009545 Bacteria 2386
365 Ga0105237_10189626 3300009545 Bacteria 2056
366 Ga0105237_10191641 3300009545 Bacteria 2044
367 Ga0105237_11286203 3300009545 Bacteria 738
368 Ga0105237_11449041 3300009545 Bacteria 693
369 Ga0105237_11714635 3300009545 Bacteria 635
370 Ga0105238_10019367 3300009551 Bacteria 6931
371 Ga0105238_10066071 3300009551 Bacteria 3618
372 Ga0105238_10424409 3300009551 Bacteria 1325
373 Ga0105238_11185071 3300009551 Bacteria 788
374 Ga0105249_10017780 3300009553 Bacteria 6316
375 Ga0105249_10111464 3300009553 Bacteria 2587
376 Ga0105249_13515939 3300009553 Bacteria 505
377 Ga0099796_10076584 3300010159 Bacteria 1218
378 Ga0105239_10029298 3300010375 Bacteria 6053
379 Ga0105239_10105513 3300010375 Bacteria 3121
380 Ga0105239_10748483 3300010375 Bacteria 1118
381 Ga0105239_12025667 3300010375 Bacteria 668
382 Ga0105239_12396594 3300010375 Bacteria 615
383 Ga0105239_13575427 3300010375 Bacteria 505
384 Ga0105246_10002877 3300011119 Bacteria 10417
385 Ga0105246_10302237 3300011119 Bacteria 1292
386 Ga0157337_1025918 3300012483 Bacteria 572
387 Ga0157342_1060785 3300012507 Bacteria 554
388 Ga0157373_10001758 3300013100 Bacteria 16488
389 Ga0157373_10182467 3300013100 Bacteria 1478
390 Ga0157373_10952686 3300013100 Bacteria 639
391 Ga0157371_10002134 3300013102 Bacteria 19252
392 Ga0157371_10085091 3300013102 Bacteria 2240
393 Ga0157371_10393943 3300013102 Bacteria 1013
394 Ga0157371_11363521 3300013102 Bacteria 550
395 Ga0157370_10052220 3300013104 Bacteria 3903
396 Ga0157370_10139289 3300013104 Bacteria 2261
397 Ga0157370_10182358 3300013104 Bacteria 1951
398 Ga0157370_10263820 3300013104 Bacteria 1592
399 Ga0157370_10983243 3300013104 Bacteria 764
400 Ga0157370_11611145 3300013104 Bacteria 583
401 Ga0157370_11712296 3300013104 Bacteria 564
402 Ga0157369_10026263 3300013105 Bacteria 6461
403 Ga0157369_10043759 3300013105 Bacteria 4879
404 Ga0157369_10132317 3300013105 Bacteria 2643
405 Ga0157369_10157533 3300013105 Bacteria 2398
406 Ga0157369_11861737 3300013105 Bacteria 611
407 Ga0157374_10012759 3300013296 Bacteria 7322
408 Ga0157374_10014284 3300013296 Bacteria 6947
409 Ga0157374_10024267 3300013296 Bacteria 5434
410 Ga0157374_10029721 3300013296 Bacteria 4954
411 Ga0157374_11990054 3300013296 Bacteria 607
412 Ga0157374_12026807 3300013296 Bacteria 602
413 Ga0157374_12080146 3300013296 Bacteria 594
414 Ga0157378_10000411 3300013297 Bacteria 42281
415 Ga0157378_10010748 3300013297 Bacteria 8001
416 Ga0157378_10027505 3300013297 Bacteria 5018
417 Ga0157378_10029365 3300013297 Bacteria 4854
418 Ga0157378_10081386 3300013297 Bacteria 2927
419 Ga0157378_10281747 3300013297 Bacteria 1602
420 Ga0157378_10430415 3300013297 Bacteria 1306
421 Ga0157378_10575701 3300013297 Bacteria 1134
422 Ga0157378_11200688 3300013297 Bacteria 798
423 Ga0163162_10015114 3300013306 Bacteria 7537
424 Ga0163162_10020357 3300013306 Bacteria 6517
425 Ga0163162_10053758 3300013306 Bacteria 4048
426 Ga0163162_10296022 3300013306 Bacteria 1750
427 Ga0163162_11253334 3300013306 Bacteria 842
428 Ga0157372_10002154 3300013307 Bacteria 21421
429 Ga0157372_10003780 3300013307 Bacteria 16254
430 Ga0157372_10040130 3300013307 Bacteria 5168
431 Ga0157372_10091572 3300013307 Bacteria 3458
432 Ga0157372_10143192 3300013307 Bacteria 2756
433 Ga0157372_10173185 3300013307 Bacteria 2497
434 Ga0157372_10207483 3300013307 Bacteria 2270
435 Ga0157372_10378037 3300013307 Bacteria 1651
436 Ga0157372_11084067 3300013307 Bacteria 927
437 Ga0157372_11156782 3300013307 Bacteria 895
438 Ga0157372_11727945 3300013307 Bacteria 720
439 Ga0157375_10067349 3300013308 Bacteria 3577
440 Ga0157375_10150494 3300013308 Bacteria 2462
441 Ga0157375_10583569 3300013308 Bacteria 1278
442 Ga0157375_12491633 3300013308 Bacteria 618
443 Ga0163163_10001073 3300014325 Bacteria 23224
444 Ga0163163_10170068 3300014325 Bacteria 2226
445 Ga0163163_12359656 3300014325 Unclassified 590
446 Ga0163163_13072498 3300014325 Bacteria 520
447 Ga0157380_10030441 3300014326 Bacteria 4133
448 Ga0157377_10000768 3300014745 Bacteria 13272
449 Ga0157377_10184811 3300014745 Bacteria 1313
450 Ga0157377_10230324 3300014745 Bacteria 1191
451 Ga0157377_11326298 3300014745 Unclassified 564
452 Ga0157379_10004402 3300014968 Bacteria 12067
453 Ga0157379_10005366 3300014968 Bacteria 11017
454 Ga0157379_10063957 3300014968 Bacteria 3289
455 Ga0157379_10127587 3300014968 Bacteria 2289
456 Ga0157379_12653172 3300014968 Bacteria 502
457 Ga0157376_10013365 3300014969 Bacteria 6123
458 Ga0157376_10089966 3300014969 Bacteria 2655
459 Ga0157376_10161074 3300014969 Bacteria 2034
460 Ga0157376_10728258 3300014969 Bacteria 999
461 Ga0182006_1040198 3300015261 Bacteria 1842
462 Ga0182007_10081080 3300015262 Bacteria 1064
463 Ga0163161_10001969 3300017792 Bacteria 14895
464 Ga0197907_10857682 3300020069 Bacteria 621
465 Ga0213874_10013367 3300021377 Bacteria 2126
466 Ga0228598_1105815 3300024227 Bacteria 568
467 Ga0207697_10022130 3300025315 Bacteria 2605
468 Ga0207656_10007564 3300025321 Bacteria 3964
469 Ga0207656_10018423 3300025321 Bacteria 2749
470 Ga0207656_10693245 3300025321 Unclassified 521
471 Ga0207696_1030544 3300025711 Bacteria 1636
472 Ga0207696_1098767 3300025711 Bacteria 796
473 Ga0207682_10254281 3300025893 Bacteria 818
474 Ga0207692_10081189 3300025898 Bacteria 1734
475 Ga0207692_10087703 3300025898 Bacteria 1680
476 Ga0207642_10019526 3300025899 Bacteria 2626
477 Ga0207642_10081086 3300025899 Bacteria 1576
478 Ga0207642_10544436 3300025899 Unclassified 716
479 Ga0207642_10591450 3300025899 Bacteria 690
480 Ga0207710_10011254 3300025900 Bacteria 3767
481 Ga0207710_10025129 3300025900 Bacteria 2569
482 Ga0207688_10005204 3300025901 Bacteria 7069
483 Ga0207680_10001756 3300025903 Bacteria 10229
484 Ga0207680_10010187 3300025903 Bacteria 4693
485 Ga0207647_10001343 3300025904 Bacteria 18910
486 Ga0207647_10010629 3300025904 Bacteria 6492
487 Ga0207647_10027808 3300025904 Bacteria 3683
488 Ga0207685_10239727 3300025905 Bacteria 872
489 Ga0207685_10337338 3300025905 Bacteria 756
490 Ga0207699_10073645 3300025906 Bacteria 2096
491 Ga0207699_10217781 3300025906 Bacteria 1302
492 Ga0207699_10985932 3300025906 Bacteria 623
493 Ga0207699_10986354 3300025906 Bacteria 623
494 Ga0207645_10001180 3300025907 Bacteria 21585
495 Ga0207645_10086495 3300025907 Bacteria 2014
496 Ga0207643_10001067 3300025908 Bacteria 16207
497 Ga0207643_10165810 3300025908 Bacteria 1331
498 Ga0207705_10000048 3300025909 Bacteria 171848
499 Ga0207705_10003420 3300025909 Bacteria 12069
500 Ga0207705_10065077 3300025909 Bacteria 2635
501 Ga0207705_10284805 3300025909 Bacteria 1265
502 Ga0207705_11506803 3300025909 Bacteria 509
503 Ga0207684_10000614 3300025910 Bacteria 42486
504 Ga0207684_10001048 3300025910 Bacteria 30878
505 Ga0207684_10051620 3300025910 Bacteria 3489
506 Ga0207684_10383957 3300025910 Bacteria 1208
507 Ga0207654_10028664 3300025911 Bacteria 3037
508 Ga0207654_10041777 3300025911 Bacteria 2592
509 Ga0207654_10217253 3300025911 Bacteria 1266
510 Ga0207654_10482174 3300025911 Bacteria 873
511 Ga0207654_11373958 3300025911 Bacteria 515
512 Ga0207707_10015255 3300025912 Bacteria 6690
513 Ga0207707_10212758 3300025912 Bacteria 1684
514 Ga0207707_10232877 3300025912 Bacteria 1602
515 Ga0207707_10353925 3300025912 Bacteria 1265
516 Ga0207707_10682379 3300025912 Bacteria 864
517 Ga0207707_11057736 3300025912 Bacteria 663
518 Ga0207695_10000354 3300025913 Bacteria 105275
519 Ga0207695_10007039 3300025913 Bacteria 14431
520 Ga0207695_10212432 3300025913 Bacteria 1845
521 Ga0207695_10332361 3300025913 Bacteria 1408
522 Ga0207695_10383190 3300025913 Bacteria 1292
523 Ga0207695_10568006 3300025913 Bacteria 1016
524 Ga0207671_10042802 3300025914 Bacteria 3351
525 Ga0207671_10091668 3300025914 Bacteria 2290
526 Ga0207671_10104506 3300025914 Bacteria 2148
527 Ga0207671_10144791 3300025914 Bacteria 1833
528 Ga0207693_10000922 3300025915 Bacteria 26418
529 Ga0207693_10004232 3300025915 Bacteria 12174
530 Ga0207693_10026057 3300025915 Bacteria 4630
531 Ga0207663_10018817 3300025916 Bacteria 3879
532 Ga0207663_10078557 3300025916 Bacteria 2152
533 Ga0207663_10160673 3300025916 Bacteria 1585
534 Ga0207663_10531284 3300025916 Bacteria 917
535 Ga0207663_10901261 3300025916 Bacteria 707
536 Ga0207663_11205615 3300025916 Bacteria 609
537 Ga0207663_11257856 3300025916 Bacteria 596
538 Ga0207660_10048721 3300025917 Bacteria 2999
539 Ga0207660_10077165 3300025917 Bacteria 2438
540 Ga0207662_10014118 3300025918 Bacteria 4474
541 Ga0207657_10000823 3300025919 Bacteria 32798
542 Ga0207657_10004069 3300025919 Bacteria 15518
543 Ga0207657_10006426 3300025919 Bacteria 12189
544 Ga0207657_10403388 3300025919 Bacteria 1075
545 Ga0207657_10943231 3300025919 Bacteria 664
546 Ga0207649_10001087 3300025920 Bacteria 16517
547 Ga0207649_10238356 3300025920 Bacteria 1305
548 Ga0207649_10495557 3300025920 Bacteria 928
549 Ga0207649_11165604 3300025920 Unclassified 609
550 Ga0207652_10037568 3300025921 Bacteria 4099
551 Ga0207652_10078648 3300025921 Bacteria 2880
552 Ga0207652_10275621 3300025921 Bacteria 1517
553 Ga0207652_10867502 3300025921 Bacteria 799
554 Ga0207652_11399645 3300025921 Bacteria 603
555 Ga0207646_10001230 3300025922 Bacteria 32163
556 Ga0207646_10004899 3300025922 Bacteria 14334
557 Ga0207646_10057056 3300025922 Bacteria 3489
558 Ga0207646_10059790 3300025922 Bacteria 3403
559 Ga0207646_11363734 3300025922 Bacteria 618
560 Ga0207681_10009111 3300025923 Bacteria 6063
561 Ga0207681_10043862 3300025923 Bacteria 2995
562 Ga0207694_10038536 3300025924 Bacteria 3675
563 Ga0207694_10118035 3300025924 Bacteria 2116
564 Ga0207694_10200446 3300025924 Bacteria 1624
565 Ga0207650_10000152 3300025925 Bacteria 83134
566 Ga0207650_11032043 3300025925 Bacteria 700
567 Ga0207650_11302802 3300025925 Unclassified 618
568 Ga0207659_10003498 3300025926 Bacteria 9434
569 Ga0207659_10141402 3300025926 Bacteria 1869
570 Ga0207659_11310189 3300025926 Bacteria 622
571 Ga0207687_10010238 3300025927 Bacteria 6126
572 Ga0207687_10032442 3300025927 Bacteria 3537
573 Ga0207687_10033504 3300025927 Bacteria 3485
574 Ga0207687_10145758 3300025927 Bacteria 1801
575 Ga0207687_10921378 3300025927 Bacteria 748
576 Ga0207700_10003657 3300025928 Bacteria 8964
577 Ga0207700_10042550 3300025928 Bacteria 3331
578 Ga0207700_10137500 3300025928 Bacteria 2003
579 Ga0207700_10238412 3300025928 Bacteria 1549
580 Ga0207700_10592713 3300025928 Bacteria 986
581 Ga0207700_11251637 3300025928 Bacteria 662
582 Ga0207700_12023091 3300025928 Unclassified 503
583 Ga0207664_10000087 3300025929 Bacteria 88607
584 Ga0207664_10048949 3300025929 Bacteria 3326
585 Ga0207664_10432327 3300025929 Bacteria 1173
586 Ga0207664_10820419 3300025929 Bacteria 836
587 Ga0207664_10899625 3300025929 Bacteria 795
588 Ga0207664_11221340 3300025929 Bacteria 670
589 Ga0207664_11535382 3300025929 Bacteria 588
590 Ga0207644_10003335 3300025931 Bacteria 10358
591 Ga0207644_10477872 3300025931 Bacteria 1026
592 Ga0207644_11008921 3300025931 Bacteria 699
593 Ga0207690_10007754 3300025932 Bacteria 6372
594 Ga0207690_10025533 3300025932 Bacteria 3711
595 Ga0207690_10087591 3300025932 Bacteria 2191
596 Ga0207706_10000740 3300025933 Bacteria 34067
597 Ga0207706_10005096 3300025933 Bacteria 12268
598 Ga0207686_10088097 3300025934 Bacteria 2043
599 Ga0207686_10234097 3300025934 Bacteria 1333
600 Ga0207670_10003610 3300025936 Bacteria 8207
601 Ga0207670_10035791 3300025936 Bacteria 3223
602 Ga0207670_11370614 3300025936 Unclassified 600
603 Ga0207669_11201146 3300025937 Bacteria 642
604 Ga0207704_10009815 3300025938 Bacteria 4636
605 Ga0207704_10012199 3300025938 Bacteria 4258
606 Ga0207704_11392092 3300025938 Unclassified 601
607 Ga0207665_10001798 3300025939 Bacteria 14443
608 Ga0207665_10029689 3300025939 Bacteria 3613
609 Ga0207665_10061976 3300025939 Bacteria 2537
610 Ga0207665_10205212 3300025939 Bacteria 1438
611 Ga0207665_10371403 3300025939 Unclassified 1084
612 Ga0207665_10786959 3300025939 Bacteria 751
613 Ga0207691_10000308 3300025940 Bacteria 48637
614 Ga0207691_10273247 3300025940 Bacteria 1455
615 Ga0207711_10003068 3300025941 Bacteria 14584
616 Ga0207711_10013154 3300025941 Bacteria 6872
617 Ga0207711_10114604 3300025941 Bacteria 2401
618 Ga0207689_10000618 3300025942 Bacteria 33979
619 Ga0207689_10005608 3300025942 Bacteria 11183
620 Ga0207689_10063202 3300025942 Bacteria 3045
621 Ga0207689_10203187 3300025942 Bacteria 1636
622 Ga0207661_10007082 3300025944 Bacteria 7965
623 Ga0207661_10027213 3300025944 Bacteria 4366
624 Ga0207661_10398694 3300025944 Bacteria 1247
625 Ga0207679_10000298 3300025945 Bacteria 37205
626 Ga0207679_10098174 3300025945 Bacteria 2283
627 Ga0207679_10327006 3300025945 Bacteria 1329
628 Ga0207679_10588266 3300025945 Unclassified 1002
629 Ga0207667_10008444 3300025949 Bacteria 12232
630 Ga0207667_10051651 3300025949 Bacteria 4332
631 Ga0207667_10055132 3300025949 Bacteria 4180
632 Ga0207667_10086319 3300025949 Bacteria 3248
633 Ga0207667_10125234 3300025949 Bacteria 2646
634 Ga0207667_10636376 3300025949 Bacteria 1073
635 Ga0207667_11957021 3300025949 Bacteria 547
636 Ga0207651_10003558 3300025960 Bacteria 7657
637 Ga0207651_11009711 3300025960 Bacteria 744
638 Ga0207712_10026658 3300025961 Bacteria 3853
639 Ga0207712_10063662 3300025961 Bacteria 2626
640 Ga0207668_10022020 3300025972 Bacteria 4072
641 Ga0207668_10069658 3300025972 Bacteria 2505
642 Ga0207640_10032889 3300025981 Bacteria 3220
643 Ga0207640_10063034 3300025981 Bacteria 2462
644 Ga0207640_10094115 3300025981 Bacteria 2083
645 Ga0207640_10613460 3300025981 Bacteria 922
646 Ga0207658_10003391 3300025986 Bacteria 11277
647 Ga0207658_10806143 3300025986 Bacteria 852
648 Ga0207658_11893778 3300025986 Bacteria 543
649 Ga0207677_10004281 3300026023 Bacteria 7637
650 Ga0207677_10007921 3300026023 Bacteria 5908
651 Ga0207677_10046591 3300026023 Bacteria 2904
652 Ga0207703_10003490 3300026035 Bacteria 13160
653 Ga0207703_10007555 3300026035 Bacteria 8621
654 Ga0207703_10062375 3300026035 Bacteria 3054
655 Ga0207703_10299661 3300026035 Bacteria 1466
656 Ga0207703_10727815 3300026035 Bacteria 944
657 Ga0207639_10003445 3300026041 Bacteria 10647
658 Ga0207639_10078850 3300026041 Bacteria 2601
659 Ga0207678_10001612 3300026067 Bacteria 20753
660 Ga0207678_10001665 3300026067 Bacteria 20379
661 Ga0207678_10003018 3300026067 Bacteria 15226
662 Ga0207678_10004699 3300026067 Bacteria 12252
663 Ga0207678_10009514 3300026067 Bacteria 8551
664 Ga0207678_11060377 3300026067 Bacteria 717
665 Ga0207708_10073017 3300026075 Bacteria 2629
666 Ga0207708_10494453 3300026075 Bacteria 1024
667 Ga0207702_10313960 3300026078 Bacteria 1491
668 Ga0207702_10381932 3300026078 Unclassified 1355
669 Ga0207702_10604602 3300026078 Bacteria 1076
670 Ga0207702_10651855 3300026078 Bacteria 1035
671 Ga0207702_11049392 3300026078 Bacteria 809
672 Ga0207641_10000052 3300026088 Bacteria 173672
673 Ga0207641_10020552 3300026088 Bacteria 5424
674 Ga0207641_10243221 3300026088 Bacteria 1678
675 Ga0207641_12338937 3300026088 Bacteria 534
676 Ga0207648_10003962 3300026089 Bacteria 15393
677 Ga0207648_10026519 3300026089 Bacteria 5148
678 Ga0207648_10207128 3300026089 Bacteria 1740
679 Ga0207676_10000176 3300026095 Bacteria 56110
680 Ga0207676_10564199 3300026095 Bacteria 1089
681 Ga0207674_10000532 3300026116 Bacteria 49916
682 Ga0207674_10000561 3300026116 Bacteria 48618
683 Ga0207674_10018522 3300026116 Bacteria 7566
684 Ga0207674_11022583 3300026116 Bacteria 795
685 Ga0207675_100005443 3300026118 Bacteria 12201
686 Ga0207675_100029361 3300026118 Bacteria 5124
687 Ga0207675_100180251 3300026118 Bacteria 2022
688 Ga0207683_10001978 3300026121 Bacteria 18120
689 Ga0207683_10091361 3300026121 Bacteria 2712
690 Ga0207698_10130599 3300026142 Bacteria 2146
691 Ga0207698_10170772 3300026142 Bacteria 1914
692 Ga0207698_10639238 3300026142 Bacteria 1053
693 Ga0207698_11746336 3300026142 Bacteria 637
694 Ga0207428_11136042 3300027907 Unclassified 545
695 Ga0265354_1009164 3300028016 Bacteria 952
696 Ga0268266_10001266 3300028379 Bacteria 30870
697 Ga0268266_10023242 3300028379 Bacteria 5278
698 Ga0268266_10252417 3300028379 Bacteria 1632
699 Ga0268265_10008088 3300028380 Bacteria 7106
700 Ga0268265_10042137 3300028380 Bacteria 3385
701 Ga0268265_10044241 3300028380 Bacteria 3315
702 Ga0268265_10048846 3300028380 Bacteria 3179
703 Ga0268265_11651110 3300028380 Bacteria 646
704 Ga0268264_10005269 3300028381 Bacteria 10950
705 Ga0268264_10032165 3300028381 Bacteria 4304
706 Ga0268264_10099564 3300028381 Bacteria 2523
707 Ga0268264_10641535 3300028381 Bacteria 1050
708 Ga0265762_1049939 3300030760 Bacteria 837
709 Ga0265770_1004221 3300030878 Bacteria 1958
710 Ga0265770_1065249 3300030878 Bacteria 685
711 Ga0265779_103065 3300031043 Bacteria 830
712 Ga0265760_10004716 3300031090 Bacteria 3905
713 Ga0265760_10008596 3300031090 Bacteria 2916
714 Ga0265760_10376728 3300031090 Bacteria 510
715 Ga0307405_10081873 3300031731 Bacteria 2111
716 Ga0307410_10009896 3300031852 Bacteria 5375
717 Ga0307410_10056095 3300031852 Bacteria 2677
718 Ga0307406_10292192 3300031901 Bacteria 1248
719 Ga0307406_10565806 3300031901 Bacteria 932
720 Ga0307407_10222083 3300031903 Bacteria 1278
721 Ga0307407_10460864 3300031903 Bacteria 924
722 Ga0307412_10413758 3300031911 Bacteria 1101
723 Ga0307409_100065689 3300031995 Bacteria 2856
724 Ga0307409_100395128 3300031995 Bacteria 1319
725 Ga0307416_100117099 3300032002 Bacteria 2364
726 Ga0307416_103632177 3300032002 Unclassified 516
727 Ga0307414_10305297 3300032004 Bacteria 1348
728 Ga0307414_11901792 3300032004 Bacteria 555
729 Ga0307411_10133285 3300032005 Bacteria 1819
730 Ga0307415_100033737 3300032126 Bacteria 3324
731 Ga0373930_0128935 3300034816 Bacteria 621
732 Ga0373950_0051482 3300034818 Bacteria 810
733 Ga0373958_0008489 3300034819 Bacteria 1666
734 Ga0373938_0024859 3300034957 Bacteria 1242
735 Ga0373926_0006641 3300035083 Bacteria 3840
736 Ga0373926_0229018 3300035083 Bacteria 718
737 Ga0373926_0293215 3300035083 Bacteria 634
738 Ga0373934_0032445 3300035086 Bacteria 2048
739 Ga0373934_0483607 3300035086 Bacteria 520
740 Ga0373940_0133982 3300035088 Bacteria 778
741 Ga0373940_0340897 3300035088 Bacteria 524
742 Ga0373944_0059282 3300035089 Bacteria 1224
743 Ga0373951_0133050 3300035091 Bacteria 685
744 Ga0373923_0024330 3300035111 Bacteria 2389
745 Ga0373923_0310216 3300035111 Bacteria 748
746 Ga0373936_0002329 3300035113 Bacteria 7114
747 Ga0373936_0057996 3300035113 Bacteria 1576
748 Ga0373936_0084349 3300035113 Bacteria 1326
749 Ga0373936_0108171 3300035113 Bacteria 1178
750 Ga0373936_0447052 3300035113 Bacteria 597
751 Ga0373936_0580978 3300035113 Bacteria 525
752 Ga0373939_0025547 3300035114 Bacteria 1657
753 Ga0373941_0098284 3300035115 Bacteria 1015
754 Ga0373945_0026866 3300035116 Bacteria 2007
755 Ga0373945_0154279 3300035116 Bacteria 932
756 Ga0373953_0004886 3300035117 Bacteria 4312
757 Ga0373954_0033288 3300035118 Bacteria 2384
758 Ga0373956_0049629 3300035119 Bacteria 1882
759 Ga0373957_0002069 3300035120 Bacteria 5626
760 Ga0373943_0007759 3300035170 Bacteria 4819
761 Ga0373943_0022407 3300035170 Bacteria 2927
762 Ga0373943_0499492 3300035170 Bacteria 711
763 Ga0373946_0007410 3300035171 Bacteria 4011
764 Ga0373946_0044663 3300035171 Bacteria 1830
765 Ga0373955_0058021 3300035172 Bacteria 2128
766 Ga0373942_0007478 3300035207 Bacteria 2534
767 Ga0373961_0007659 3300035241 Bacteria 2617
768 Ga0373924_0104503 3300035410 Bacteria 1220
769 Ga0373931_0038758 3300035691 Bacteria 2494
770 Ga0373931_0502874 3300035691 Bacteria 782
771 Ga0373935_0008518 3300035692 Bacteria 6138
772 Ga0373935_0015830 3300035692 Bacteria 4563
773 Ga0373935_0025614 3300035692 Bacteria 3635
774 Ga0373935_0053155 3300035692 Bacteria 2577
775 Ga0373935_0625622 3300035692 Bacteria 788
776 Ga0373927_0000747 3300035695 Bacteria 24845
777 Ga0373927_0357281 3300035695 Bacteria 963
778 Ga0373927_0796417 3300035695 Bacteria 624
779 Ga0373933_0007220 3300035724 Bacteria 6056
780 Ga0373933_0398628 3300035724 Bacteria 897
781 Ga0373933_0794002 3300035724 Bacteria 623
782 Ga0373947_0004951 3300035725 Bacteria 7791
783 Ga0373947_0070018 3300035725 Bacteria 2148
784 Ga0373937_0080212 3300036401 Bacteria 3017
785 Ga0373937_0522682 3300036401 Bacteria 1128
786 Ga0373937_0535257 3300036401 Bacteria 1113
787 Ga0373937_1856388 3300036401 Unclassified 549
788 Ga0373925_0010801 3300037068 Bacteria 6620
789 Ga0373925_0012340 3300037068 Bacteria 6185
790 Ga0373925_0016522 3300037068 Bacteria 5347
791 Ga0373925_0589476 3300037068 Bacteria 915
792 Ga0395900_0666890 3300037418 Bacteria 976
793 Ga0395898_1067496 3300037466 Bacteria 742
794 Ga0436364_1058287 3300037853 Bacteria 1905
795 Ga0395901_0719389 3300038443 Bacteria 994
796 Ga0436365_1143939 3300039437 Bacteria 1784
797 Ga0436365_1246521 3300039437 Bacteria 1504
798 Ga0436365_1865271 3300039437 Unclassified 706
799 Ga0436363_0216863 3300039450 Bacteria 882
800 Ga0436363_0229397 3300039450 Bacteria 4283
801 Ga0436363_0929382 3300039450 Bacteria 660
802 Ga0436363_1116219 3300039450 Bacteria 1283
803 Ga0466963_0109483 3300044694 Bacteria 1895
804 Ga0466963_1138627 3300044694 Bacteria 549
805 Ga0453684_1249722 3300044712 Bacteria 777
806 Ga0466968_0617027 3300044735 Bacteria 549
807 Ga0466957_0917972 3300044842 Bacteria 626
808 Ga0466967_0047517 3300045976 Bacteria 3742
809 Ga0466967_0566816 3300045976 Bacteria 1118
810 Ga0466967_1605092 3300045976 Unclassified 648
811 Ga0495590_0402543 3300046457 Bacteria 525
812 Ga0495653_0132131 3300046463 Bacteria 1766
813 Ga0495580_0001673 3300046472 Bacteria 19470
814 Ga0495580_0016664 3300046472 Bacteria 5514
815 Ga0495580_0039298 3300046472 Bacteria 3385
816 Ga0495582_0000596 3300046473 Bacteria 19949
817 Ga0495664_0255287 3300046477 Bacteria 1060
818 Ga0495585_0277198 3300046492 Bacteria 830
819 Ga0495628_0141274 3300046516 Bacteria 1838
820 Ga0495628_0225731 3300046516 Bacteria 1405
821 Ga0495630_0528840 3300046517 Bacteria 904
822 Ga0495630_0903834 3300046517 Bacteria 672
823 Ga0495642_0399567 3300046528 Bacteria 606
824 Ga0495652_0378246 3300046529 Bacteria 1008
825 Ga0495665_0000974 3300046531 Bacteria 15176
826 Ga0495586_0201724 3300046535 Bacteria 1128
827 Ga0495586_0491546 3300046535 Bacteria 708
828 Ga0495587_0415791 3300046536 Bacteria 747
829 Ga0495645_0006005 3300046543 Bacteria 8397
830 Ga0495633_0104229 3300046558 Bacteria 1316
831 Ga0495635_0138410 3300046663 Bacteria 1659
832 Ga0495659_0296784 3300046664 Unclassified 682
833 Ga0495623_0609464 3300046679 Unclassified 566
834 Ga0495658_0040249 3300046683 Bacteria 2598
835 Ga0495669_0033508 3300046684 Bacteria 2261
836 Ga0495669_0262383 3300046684 Bacteria 830
837 Ga0495669_0293526 3300046684 Bacteria 783
838 Ga0495669_0303024 3300046684 Bacteria 770
839 Ga0495624_0083349 3300046690 Bacteria 1977
840 Ga0495624_0156645 3300046690 Bacteria 1392
841 Ga0495624_0623569 3300046690 Bacteria 642
842 Ga0495589_0316866 3300046794 Bacteria 721
843 Ga0495581_0456823 3300047315 Bacteria 744
844 Ga0495581_0580947 3300047315 Bacteria 649
845 Ga0495674_0057042 3300047319 Bacteria 3419
846 Ga0495674_0614348 3300047319 Bacteria 860
847 Ga0495674_0710186 3300047319 Bacteria 788
848 Ga0495676_0419087 3300047321 Bacteria 886
849 Ga0495602_0106256 3300048088 Bacteria 2292
850 Ga0495602_0151654 3300048088 Bacteria 1821
851 Ga0496100_0028457 3300048903 Bacteria 3447
852 Ga0496100_0034107 3300048903 Bacteria 3191
853 Ga0496100_0243051 3300048903 Bacteria 1329
854 Ga0496100_0965606 3300048903 Bacteria 670
855 Ga0496101_0011221 3300048904 Bacteria 5935
856 Ga0496101_0024487 3300048904 Bacteria 4178
857 Ga0496101_0063740 3300048904 Bacteria 2684
858 Ga0496101_1040896 3300048904 Bacteria 643
859 Ga0496102_0003212 3300048905 Bacteria 13867
860 Ga0496102_0021206 3300048905 Bacteria 5746
861 Ga0496102_0082208 3300048905 Bacteria 2970
862 Ga0496102_0283396 3300048905 Bacteria 1562
863 Ga0496102_0576757 3300048905 Bacteria 1048
864 Ga0496102_0733808 3300048905 Bacteria 910
865 Ga0496103_0110851 3300048906 Bacteria 1743
866 Ga0496103_0254260 3300048906 Bacteria 1131
867 Ga0496103_0677472 3300048906 Bacteria 654
868 Ga0496104_0025955 3300048907 Bacteria 5403
869 Ga0496104_0076564 3300048907 Bacteria 3187
870 Ga0496104_0233662 3300048907 Bacteria 1750
871 Ga0496104_0416050 3300048907 Bacteria 1257
872 Ga0496104_0637327 3300048907 Bacteria 975
873 Ga0496105_0394699 3300048908 Bacteria 1099
874 Ga0496106_0020191 3300048909 Bacteria 4943
875 Ga0496106_0132634 3300048909 Bacteria 1954
876 Ga0496106_0159342 3300048909 Bacteria 1784
877 Ga0496106_0215487 3300048909 Bacteria 1530
878 Ga0496107_0368605 3300048910 Bacteria 1068
879 Ga0496108_0000242 3300048911 Bacteria 48793
880 Ga0496109_0000120 3300048912 Bacteria 81828
881 Ga0496109_0034010 3300048912 Bacteria 4588
882 Ga0496109_0141665 3300048912 Bacteria 2248
883 Ga0496109_0753661 3300048912 Bacteria 911
884 Ga0496110_0000795 3300048913 Bacteria 22036
885 Ga0496110_0063397 3300048913 Bacteria 3266
886 Ga0496111_0341124 3300048914 Bacteria 1109
887 Ga0496112_0000198 3300048915 Bacteria 39413
888 Ga0496112_0051891 3300048915 Bacteria 4023
889 Ga0496112_0086077 3300048915 Bacteria 3110
890 Ga0496112_0184937 3300048915 Bacteria 2047
891 Ga0496112_0478973 3300048915 Bacteria 1181
892 Ga0496113_0000111 3300048916 Bacteria 35094
893 Ga0496113_0009232 3300048916 Bacteria 6470
894 Ga0496114_0332010 3300048917 Bacteria 1344
895 Ga0496114_1362103 3300048917 Bacteria 597
896 Ga0496115_0018551 3300048918 Bacteria 5344
897 Ga0496115_0036914 3300048918 Bacteria 3870
898 Ga0496126_0000209 3300048929 Bacteria 131440
899 Ga0496126_0504148 3300048929 Bacteria 967
900 Ga0501297_020717 3300049520 Bacteria 821
901 Ga0501033_0303644 3300049570 Bacteria 1123
902 Ga0501036_1287506 3300049572 Bacteria 594
903 Ga0501037_0257028 3300049573 Bacteria 1221
904 Ga0501038_0152997 3300049574 Bacteria 1880
905 Ga0501043_0152835 3300049579 Bacteria 1806
906 Ga0501047_0612288 3300049581 Bacteria 910
907 Ga0501070_0042215 3300049586 Bacteria 3799
908 Ga0501073_0105958 3300049589 Bacteria 1951
909 Ga0501202_069189 3300049652 Bacteria 811
910 Ga0501083_0089368 3300049744 Bacteria 2036
911 Ga0501083_0305202 3300049744 Bacteria 1035
912 Ga0501274_036137 3300049771 Bacteria 577
913 Ga0501035_0248371 3300049822 Bacteria 1512
914 Ga0501044_0296343 3300049823 Bacteria 1547
915 Ga0501045_0459110 3300049824 Bacteria 947
916 nmdc:mga0n895_1101194_c1 3300050512 Bacteria 772
917 nmdc:mga0n895_133428_c1 3300050512 Bacteria 2509
918 nmdc:mga0n895_1691134_c1 3300050512 Bacteria 595
919 nmdc:mga0n895_344_c1 3300050512 Bacteria 31117
920 nmdc:mga0n895_883053_c1 3300050512 Bacteria 880
921 nmdc:mga0rr50_40640_c1 3300050513 Bacteria 3383
922 nmdc:mga0rr50_548981_c1 3300050513 Bacteria 984
923 nmdc:mga0rr50_775389_c1 3300050513 Bacteria 818
924 nmdc:mga0rr50_872_c1 3300050513 Bacteria 16295
925 nmdc:mga08x19_1025009_c1 3300050514 Bacteria 586
926 nmdc:mga08x19_3391_c1 3300050514 Bacteria 9503
927 nmdc:mga08x19_51227_c1 3300050514 Bacteria 2651
928 nmdc:mga08x19_9637_c1 3300050514 Bacteria 5785
929 nmdc:mga0a205_7367_c1 3300050515 Bacteria 9965
930 Ga0495612_0444526 3300053078 Bacteria 592
931 Ga0495595_0096836 3300053084 Bacteria 1421
932 Ga0495619_0624095 3300053085 Bacteria 736

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025913 Ga0207695_10000354 Ga0207695_1000035496 61
2 3300001979 JGI24740J21852_10091596 JGI24740J21852_100915962 63
3 3300005327 Ga0070658_10031905 Ga0070658_100319053 63
4 3300005327 Ga0070658_10050557 Ga0070658_100505571 63
5 3300005327 Ga0070658_10077132 Ga0070658_100771322 63
6 3300005329 Ga0070683_100051474 Ga0070683_1000514747 63
7 3300005336 Ga0070680_100014163 Ga0070680_1000141636 63
8 3300005336 Ga0070680_101581496 Ga0070680_1015814962 63
9 3300005339 Ga0070660_100056691 Ga0070660_1000566914 63
10 3300005344 Ga0070661_100136525 Ga0070661_1001365253 63
11 3300005366 Ga0070659_100182952 Ga0070659_1001829524 63
12 3300005435 Ga0070714_102361963 Ga0070714_1023619631 63
13 3300005436 Ga0070713_100058153 Ga0070713_1000581533 63
14 3300005455 Ga0070663_100012394 Ga0070663_1000123944 63
15 3300005455 Ga0070663_100121663 Ga0070663_1001216633 63
16 3300005455 Ga0070663_100274893 Ga0070663_1002748933 63
17 3300005455 Ga0070663_100325180 Ga0070663_1003251803 63
18 3300005458 Ga0070681_10232825 Ga0070681_102328253 63
19 3300005458 Ga0070681_10263683 Ga0070681_102636832 63
20 3300005458 Ga0070681_10549485 Ga0070681_105494854 63
21 3300005458 Ga0070681_11580077 Ga0070681_115800771 63
22 3300005530 Ga0070679_100113302 Ga0070679_1001133022 63
23 3300005530 Ga0070679_100479152 Ga0070679_1004791522 63
24 3300005530 Ga0070679_100895746 Ga0070679_1008957462 63
25 3300005530 Ga0070679_101990579 Ga0070679_1019905792 63
26 3300005535 Ga0070684_100136427 Ga0070684_1001364273 63
27 3300005535 Ga0070684_102236594 Ga0070684_1022365941 63
28 3300005539 Ga0068853_100135035 Ga0068853_1001350351 63
29 3300005563 Ga0068855_100003825 Ga0068855_10000382516 63
30 3300005563 Ga0068855_100035485 Ga0068855_1000354854 63
31 3300005563 Ga0068855_100084699 Ga0068855_1000846994 63
32 3300005564 Ga0070664_101239338 Ga0070664_1012393382 63
33 3300005577 Ga0068857_100103614 Ga0068857_1001036145 63
34 3300005577 Ga0068857_101295819 Ga0068857_1012958192 63
35 3300005578 Ga0068854_100038966 Ga0068854_1000389663 63
36 3300005614 Ga0068856_100995425 Ga0068856_1009954252 63
37 3300006028 Ga0070717_11840801 Ga0070717_118408012 63
38 3300007788 Ga0099795_10581479 Ga0099795_105814791 63
39 3300009093 Ga0105240_10100771 Ga0105240_101007715 63
40 3300009093 Ga0105240_10119015 Ga0105240_101190153 63
41 3300009093 Ga0105240_10947580 Ga0105240_109475802 63
42 3300009093 Ga0105240_11067984 Ga0105240_110679842 63
43 3300009174 Ga0105241_11693131 Ga0105241_116931311 63
44 3300009545 Ga0105237_10054319 Ga0105237_100543192 63
45 3300009551 Ga0105238_10066071 Ga0105238_100660717 63
46 3300009551 Ga0105238_11185071 Ga0105238_111850712 63
47 3300013100 Ga0157373_10182467 Ga0157373_101824674 63
48 3300013102 Ga0157371_10393943 Ga0157371_103939432 63
49 3300013102 Ga0157371_11363521 Ga0157371_113635212 63
50 3300013104 Ga0157370_10052220 Ga0157370_100522202 63
51 3300013104 Ga0157370_10139289 Ga0157370_101392892 63
52 3300013104 Ga0157370_10182358 Ga0157370_101823581 63
53 3300013104 Ga0157370_10263820 Ga0157370_102638204 63
54 3300013104 Ga0157370_10983243 Ga0157370_109832432 63
55 3300013104 Ga0157370_11611145 Ga0157370_116111452 63
56 3300013105 Ga0157369_10132317 Ga0157369_101323175 63
57 3300013105 Ga0157369_10157533 Ga0157369_101575333 63
58 3300013307 Ga0157372_10003780 Ga0157372_100037808 63
59 3300013307 Ga0157372_10143192 Ga0157372_101431925 63
60 3300013307 Ga0157372_10207483 Ga0157372_102074833 63
61 3300013307 Ga0157372_10378037 Ga0157372_103780373 63
62 3300013307 Ga0157372_11084067 Ga0157372_110840672 63
63 3300013307 Ga0157372_11727945 Ga0157372_117279452 63
64 3300020069 Ga0197907_10857682 Ga0197907_108576821 63
65 3300025904 Ga0207647_10027808 Ga0207647_100278082 63
66 3300025906 Ga0207699_10985932 Ga0207699_109859321 63
67 3300025909 Ga0207705_10000048 Ga0207705_10000048151 63
68 3300025909 Ga0207705_10003420 Ga0207705_100034205 63
69 3300025909 Ga0207705_10065077 Ga0207705_100650772 63
70 3300025909 Ga0207705_11506803 Ga0207705_115068031 63
71 3300025911 Ga0207654_11373958 Ga0207654_113739581 63
72 3300025912 Ga0207707_10212758 Ga0207707_102127582 63
73 3300025912 Ga0207707_10232877 Ga0207707_102328773 63
74 3300025912 Ga0207707_10682379 Ga0207707_106823791 63
75 3300025913 Ga0207695_10212432 Ga0207695_102124324 63
76 3300025913 Ga0207695_10383190 Ga0207695_103831903 63
77 3300025913 Ga0207695_10568006 Ga0207695_105680062 63
78 3300025914 Ga0207671_10104506 Ga0207671_101045062 63
79 3300025917 Ga0207660_10048721 Ga0207660_100487212 63
80 3300025919 Ga0207657_10000823 Ga0207657_100008235 63
81 3300025919 Ga0207657_10403388 Ga0207657_104033883 63
82 3300025920 Ga0207649_10238356 Ga0207649_102383563 63
83 3300025921 Ga0207652_10078648 Ga0207652_100786482 63
84 3300025921 Ga0207652_10275621 Ga0207652_102756213 63
85 3300025921 Ga0207652_11399645 Ga0207652_113996452 63
86 3300025924 Ga0207694_10200446 Ga0207694_102004462 63
87 3300025928 Ga0207700_10003657 Ga0207700_100036577 63
88 3300025929 Ga0207664_10899625 Ga0207664_108996251 63
89 3300025932 Ga0207690_10087591 Ga0207690_100875915 63
90 3300025944 Ga0207661_10027213 Ga0207661_100272138 63
91 3300025945 Ga0207679_10327006 Ga0207679_103270062 63
92 3300025949 Ga0207667_10008444 Ga0207667_1000844412 63
93 3300025949 Ga0207667_10086319 Ga0207667_100863194 63
94 3300025949 Ga0207667_10125234 Ga0207667_101252345 63
95 3300025949 Ga0207667_10636376 Ga0207667_106363763 63
96 3300025981 Ga0207640_10032889 Ga0207640_100328894 63
97 3300026041 Ga0207639_10078850 Ga0207639_100788501 63
98 3300026067 Ga0207678_10001665 Ga0207678_100016655 63
99 3300026067 Ga0207678_10004699 Ga0207678_100046995 63
100 3300026067 Ga0207678_10009514 Ga0207678_1000951414 63
101 3300026078 Ga0207702_10651855 Ga0207702_106518551 63
102 3300026116 Ga0207674_10000532 Ga0207674_1000053221 63
103 3300031090 Ga0265760_10376728 Ga0265760_103767281 63
104 3300037418 Ga0395900_0666890 Ga0395900_0666890_217_411 63
105 3300044694 Ga0466963_0109483 Ga0466963_0109483_1015_1209 63
106 3300045976 Ga0466967_0566816 Ga0466967_0566816_827_1021 63
107 3300046477 Ga0495664_0255287 Ga0495664_0255287_696_890 63
108 3300046492 Ga0495585_0277198 Ga0495585_0277198_612_806 63
109 3300046516 Ga0495628_0141274 Ga0495628_0141274_587_781 63
110 3300046543 Ga0495645_0006005 Ga0495645_0006005_8078_8272 63
111 3300046558 Ga0495633_0104229 Ga0495633_0104229_132_326 63
112 3300048929 Ga0496126_0000209 Ga0496126_0000209_121004_121198 63
113 3300049570 Ga0501033_0303644 Ga0501033_0303644_319_513 63
114 3300049572 Ga0501036_1287506 Ga0501036_1287506_210_404 63
115 3300049573 Ga0501037_0257028 Ga0501037_0257028_420_614 63
116 3300049574 Ga0501038_0152997 Ga0501038_0152997_678_872 63
117 3300049579 Ga0501043_0152835 Ga0501043_0152835_560_754 63
118 3300049581 Ga0501047_0612288 Ga0501047_0612288_646_840 63
119 3300049586 Ga0501070_0042215 Ga0501070_0042215_889_1083 63
120 3300049589 Ga0501073_0105958 Ga0501073_0105958_89_283 63
121 3300049822 Ga0501035_0248371 Ga0501035_0248371_331_525 63
122 3300049823 Ga0501044_0296343 Ga0501044_0296343_94_288 63
123 3300049824 Ga0501045_0459110 Ga0501045_0459110_722_916 63
124 3300005435 Ga0070714_100432677 Ga0070714_1004326773 64
125 3300005445 Ga0070708_100015435 Ga0070708_1000154354 64
126 3300005445 Ga0070708_100964934 Ga0070708_1009649341 64
127 3300005536 Ga0070697_100231449 Ga0070697_1002314491 64
128 3300025910 Ga0207684_10051620 Ga0207684_100516202 64
129 3300025922 Ga0207646_10057056 Ga0207646_100570564 64
130 3300025929 Ga0207664_11535382 Ga0207664_115353821 64
131 3300005467 Ga0070706_100000514 Ga0070706_10000051420 65
132 3300005468 Ga0070707_100000662 Ga0070707_10000066212 65
133 3300005471 Ga0070698_100004533 Ga0070698_10000453315 65
134 3300005518 Ga0070699_100003886 Ga0070699_10000388616 65
135 3300005518 Ga0070699_101428219 Ga0070699_1014282192 65
136 3300005536 Ga0070697_100008091 Ga0070697_10000809112 65
137 3300005536 Ga0070697_100567811 Ga0070697_1005678112 65
138 3300005536 Ga0070697_101943627 Ga0070697_1019436271 65
139 3300005545 Ga0070695_100093115 Ga0070695_1000931152 65
140 3300006028 Ga0070717_11977549 Ga0070717_119775492 65
141 3300006237 Ga0097621_100276146 Ga0097621_1002761462 65
142 3300006852 Ga0075433_11034281 Ga0075433_110342811 65
143 3300025910 Ga0207684_10000614 Ga0207684_1000061438 65
144 3300025922 Ga0207646_10004899 Ga0207646_1000489912 65
145 3300035113 Ga0373936_0057996 Ga0373936_0057996_262_462 65
146 3300035692 Ga0373935_0025614 Ga0373935_0025614_333_533 65
147 3300037068 Ga0373925_0010801 Ga0373925_0010801_1700_1900 65
148 3300046664 Ga0495659_0296784 Ga0495659_0296784_43_246 65
149 3300048907 Ga0496104_0025955 Ga0496104_0025955_588_791 65
150 3300048915 Ga0496112_0086077 Ga0496112_0086077_257_460 65
151 3300005330 Ga0070690_100174565 Ga0070690_1001745653 66
152 3300005334 Ga0068869_100001846 Ga0068869_10000184612 66
153 3300005335 Ga0070666_10410582 Ga0070666_104105822 66
154 3300005337 Ga0070682_100392440 Ga0070682_1003924402 66
155 3300005338 Ga0068868_100002791 Ga0068868_1000027915 66
156 3300005338 Ga0068868_100022874 Ga0068868_1000228745 66
157 3300005354 Ga0070675_101583510 Ga0070675_1015835102 66
158 3300005364 Ga0070673_100297904 Ga0070673_1002979041 66
159 3300005367 Ga0070667_101685996 Ga0070667_1016859962 66
160 3300005367 Ga0070667_102264942 Ga0070667_1022649421 66
161 3300005434 Ga0070709_11338413 Ga0070709_113384131 66
162 3300005435 Ga0070714_100000096 Ga0070714_10000009664 66
163 3300005436 Ga0070713_101994857 Ga0070713_1019948571 66
164 3300005439 Ga0070711_100094452 Ga0070711_1000944523 66
165 3300005439 Ga0070711_101287725 Ga0070711_1012877252 66
166 3300005440 Ga0070705_101746208 Ga0070705_1017462082 66
167 3300005441 Ga0070700_100657562 Ga0070700_1006575622 66
168 3300005445 Ga0070708_100003510 Ga0070708_1000035103 66
169 3300005445 Ga0070708_100069047 Ga0070708_1000690474 66
170 3300005445 Ga0070708_100555134 Ga0070708_1005551342 66
171 3300005466 Ga0070685_10201038 Ga0070685_102010382 66
172 3300005467 Ga0070706_100014580 Ga0070706_1000145801 66
173 3300005467 Ga0070706_100811981 Ga0070706_1008119811 66
174 3300005468 Ga0070707_100005126 Ga0070707_1000051263 66
175 3300005468 Ga0070707_100033790 Ga0070707_1000337905 66
176 3300005471 Ga0070698_100002449 Ga0070698_10000244921 66
177 3300005471 Ga0070698_100169617 Ga0070698_1001696173 66
178 3300005518 Ga0070699_100000441 Ga0070699_10000044116 66
179 3300005518 Ga0070699_100089928 Ga0070699_1000899285 66
180 3300005536 Ga0070697_100001451 Ga0070697_10000145113 66
181 3300005536 Ga0070697_100005121 Ga0070697_1000051218 66
182 3300005536 Ga0070697_100556823 Ga0070697_1005568231 66
183 3300005548 Ga0070665_100288347 Ga0070665_1002883473 66
184 3300005563 Ga0068855_100751560 Ga0068855_1007515602 66
185 3300005614 Ga0068856_100481787 Ga0068856_1004817873 66
186 3300005614 Ga0068856_101607101 Ga0068856_1016071012 66
187 3300005616 Ga0068852_100884894 Ga0068852_1008848942 66
188 3300005617 Ga0068859_100025042 Ga0068859_10002504210 66
189 3300005719 Ga0068861_100165678 Ga0068861_1001656783 66
190 3300005834 Ga0068851_10581704 Ga0068851_105817042 66
191 3300005834 Ga0068851_10702608 Ga0068851_107026082 66
192 3300005841 Ga0068863_100169911 Ga0068863_1001699113 66
193 3300005842 Ga0068858_100042739 Ga0068858_1000427394 66
194 3300005842 Ga0068858_100066188 Ga0068858_1000661883 66
195 3300005842 Ga0068858_101682143 Ga0068858_1016821432 66
196 3300005843 Ga0068860_100018016 Ga0068860_1000180166 66
197 3300005843 Ga0068860_100253033 Ga0068860_1002530332 66
198 3300005844 Ga0068862_102020393 Ga0068862_1020203931 66
199 3300006028 Ga0070717_10002614 Ga0070717_1000261411 66
200 3300006028 Ga0070717_10118628 Ga0070717_101186282 66
201 3300006163 Ga0070715_10572066 Ga0070715_105720661 66
202 3300006237 Ga0097621_100007525 Ga0097621_1000075259 66
203 3300006237 Ga0097621_100013773 Ga0097621_1000137733 66
204 3300006358 Ga0068871_100014064 Ga0068871_1000140648 66
205 3300006358 Ga0068871_100473609 Ga0068871_1004736093 66
206 3300006871 Ga0075434_100792676 Ga0075434_1007926762 66
207 3300006881 Ga0068865_100044651 Ga0068865_1000446515 66
208 3300006881 Ga0068865_101556661 Ga0068865_1015566611 66
209 3300006881 Ga0068865_101889644 Ga0068865_1018896442 66
210 3300006914 Ga0075436_100744057 Ga0075436_1007440572 66
211 3300006931 Ga0097620_100025042 Ga0097620_10002504210 66
212 3300007076 Ga0075435_101510837 Ga0075435_1015108372 66
213 3300007265 Ga0099794_10380592 Ga0099794_103805922 66
214 3300009093 Ga0105240_10154500 Ga0105240_101545003 66
215 3300009098 Ga0105245_10056662 Ga0105245_100566623 66
216 3300009098 Ga0105245_10174848 Ga0105245_101748484 66
217 3300009098 Ga0105245_10261930 Ga0105245_102619301 66
218 3300009174 Ga0105241_10127889 Ga0105241_101278892 66
219 3300009174 Ga0105241_10546537 Ga0105241_105465372 66
220 3300009177 Ga0105248_10157464 Ga0105248_101574644 66
221 3300009545 Ga0105237_10065790 Ga0105237_100657907 66
222 3300009545 Ga0105237_10189626 Ga0105237_101896263 66
223 3300009545 Ga0105237_11714635 Ga0105237_117146351 66
224 3300010375 Ga0105239_10105513 Ga0105239_101055135 66
225 3300010375 Ga0105239_12025667 Ga0105239_120256672 66
226 3300013296 Ga0157374_10012759 Ga0157374_100127594 66
227 3300013296 Ga0157374_11990054 Ga0157374_119900541 66
228 3300013296 Ga0157374_12026807 Ga0157374_120268072 66
229 3300013297 Ga0157378_10000411 Ga0157378_1000041135 66
230 3300013297 Ga0157378_10010748 Ga0157378_1001074815 66
231 3300013297 Ga0157378_10575701 Ga0157378_105757012 66
232 3300013306 Ga0163162_10020357 Ga0163162_1002035710 66
233 3300013306 Ga0163162_11253334 Ga0163162_112533342 66
234 3300013307 Ga0157372_11156782 Ga0157372_111567823 66
235 3300013308 Ga0157375_10583569 Ga0157375_105835692 66
236 3300013308 Ga0157375_12491633 Ga0157375_124916332 66
237 3300014325 Ga0163163_13072498 Ga0163163_130724982 66
238 3300014745 Ga0157377_11326298 Ga0157377_113262982 66
239 3300014968 Ga0157379_10127587 Ga0157379_101275871 66
240 3300014969 Ga0157376_10161074 Ga0157376_101610741 66
241 3300021377 Ga0213874_10013367 Ga0213874_100133673 66
242 3300025321 Ga0207656_10693245 Ga0207656_106932451 66
243 3300025899 Ga0207642_10544436 Ga0207642_105444362 66
244 3300025899 Ga0207642_10591450 Ga0207642_105914502 66
245 3300025904 Ga0207647_10010629 Ga0207647_100106292 66
246 3300025910 Ga0207684_10001048 Ga0207684_1000104819 66
247 3300025910 Ga0207684_10383957 Ga0207684_103839572 66
248 3300025911 Ga0207654_10217253 Ga0207654_102172533 66
249 3300025911 Ga0207654_10482174 Ga0207654_104821742 66
250 3300025913 Ga0207695_10332361 Ga0207695_103323612 66
251 3300025914 Ga0207671_10042802 Ga0207671_100428022 66
252 3300025916 Ga0207663_10078557 Ga0207663_100785573 66
253 3300025916 Ga0207663_11205615 Ga0207663_112056151 66
254 3300025922 Ga0207646_10001230 Ga0207646_1000123021 66
255 3300025922 Ga0207646_10059790 Ga0207646_100597903 66
256 3300025924 Ga0207694_10038536 Ga0207694_100385363 66
257 3300025926 Ga0207659_11310189 Ga0207659_113101892 66
258 3300025927 Ga0207687_10032442 Ga0207687_100324427 66
259 3300025927 Ga0207687_10145758 Ga0207687_101457583 66
260 3300025929 Ga0207664_10000087 Ga0207664_1000008773 66
261 3300025938 Ga0207704_10012199 Ga0207704_100121996 66
262 3300025938 Ga0207704_11392092 Ga0207704_113920922 66
263 3300025941 Ga0207711_10114604 Ga0207711_101146041 66
264 3300025942 Ga0207689_10005608 Ga0207689_1000560818 66
265 3300025949 Ga0207667_11957021 Ga0207667_119570212 66
266 3300025981 Ga0207640_10613460 Ga0207640_106134603 66
267 3300025986 Ga0207658_11893778 Ga0207658_118937782 66
268 3300026023 Ga0207677_10004281 Ga0207677_100042819 66
269 3300026023 Ga0207677_10046591 Ga0207677_100465913 66
270 3300026035 Ga0207703_10003490 Ga0207703_100034906 66
271 3300026035 Ga0207703_10062375 Ga0207703_100623753 66
272 3300026035 Ga0207703_10299661 Ga0207703_102996612 66
273 3300026075 Ga0207708_10494453 Ga0207708_104944532 66
274 3300026078 Ga0207702_10604602 Ga0207702_106046023 66
275 3300026078 Ga0207702_11049392 Ga0207702_110493922 66
276 3300026088 Ga0207641_10020552 Ga0207641_100205525 66
277 3300026088 Ga0207641_12338937 Ga0207641_123389372 66
278 3300026089 Ga0207648_10207128 Ga0207648_102071282 66
279 3300026118 Ga0207675_100180251 Ga0207675_1001802513 66
280 3300026142 Ga0207698_10639238 Ga0207698_106392383 66
281 3300026142 Ga0207698_11746336 Ga0207698_117463362 66
282 3300028379 Ga0268266_10252417 Ga0268266_102524173 66
283 3300028380 Ga0268265_10042137 Ga0268265_100421374 66
284 3300028381 Ga0268264_10032165 Ga0268264_100321654 66
285 3300035083 Ga0373926_0293215 Ga0373926_0293215_18_218 66
286 3300035086 Ga0373934_0032445 Ga0373934_0032445_181_381 66
287 3300035089 Ga0373944_0059282 Ga0373944_0059282_661_861 66
288 3300035111 Ga0373923_0024330 Ga0373923_0024330_846_1046 66
289 3300035113 Ga0373936_0002329 Ga0373936_0002329_5943_6143 66
290 3300035113 Ga0373936_0084349 Ga0373936_0084349_979_1191 66
291 3300035116 Ga0373945_0154279 Ga0373945_0154279_529_729 66
292 3300035117 Ga0373953_0004886 Ga0373953_0004886_1022_1222 66
293 3300035118 Ga0373954_0033288 Ga0373954_0033288_183_383 66
294 3300035119 Ga0373956_0049629 Ga0373956_0049629_536_736 66
295 3300035120 Ga0373957_0002069 Ga0373957_0002069_2602_2802 66
296 3300035170 Ga0373943_0007759 Ga0373943_0007759_2578_2778 66
297 3300035170 Ga0373943_0499492 Ga0373943_0499492_253_465 66
298 3300035171 Ga0373946_0007410 Ga0373946_0007410_1145_1345 66
299 3300035172 Ga0373955_0058021 Ga0373955_0058021_846_1046 66
300 3300035410 Ga0373924_0104503 Ga0373924_0104503_458_658 66
301 3300035692 Ga0373935_0008518 Ga0373935_0008518_3984_4184 66
302 3300035692 Ga0373935_0053155 Ga0373935_0053155_199_411 66
303 3300035692 Ga0373935_0625622 Ga0373935_0625622_562_762 66
304 3300035695 Ga0373927_0000747 Ga0373927_0000747_21655_21855 66
305 3300035695 Ga0373927_0357281 Ga0373927_0357281_656_868 66
306 3300035724 Ga0373933_0007220 Ga0373933_0007220_3950_4150 66
307 3300035724 Ga0373933_0794002 Ga0373933_0794002_370_582 66
308 3300035725 Ga0373947_0004951 Ga0373947_0004951_524_724 66
309 3300036401 Ga0373937_0080212 Ga0373937_0080212_1714_1914 66
310 3300036401 Ga0373937_0522682 Ga0373937_0522682_601_813 66
311 3300036401 Ga0373937_1856388 Ga0373937_1856388_220_420 66
312 3300037068 Ga0373925_0016522 Ga0373925_0016522_2157_2357 66
313 3300037068 Ga0373925_0589476 Ga0373925_0589476_76_288 66
314 3300037853 Ga0436364_1058287 Ga0436364_1058287_832_1032 66
315 3300039437 Ga0436365_1143939 Ga0436365_1143939_1183_1383 66
316 3300039437 Ga0436365_1865271 Ga0436365_1865271_417_623 66
317 3300039450 Ga0436363_0229397 Ga0436363_0229397_1271_1471 66
318 3300044842 Ga0466957_0917972 Ga0466957_0917972_205_423 66
319 3300046463 Ga0495653_0132131 Ga0495653_0132131_1133_1333 66
320 3300046516 Ga0495628_0225731 Ga0495628_0225731_557_757 66
321 3300046517 Ga0495630_0903834 Ga0495630_0903834_244_444 66
322 3300046529 Ga0495652_0378246 Ga0495652_0378246_528_728 66
323 3300046536 Ga0495587_0415791 Ga0495587_0415791_177_389 66
324 3300046663 Ga0495635_0138410 Ga0495635_0138410_1405_1605 66
325 3300046679 Ga0495623_0609464 Ga0495623_0609464_153_353 66
326 3300046684 Ga0495669_0262383 Ga0495669_0262383_332_544 66
327 3300046690 Ga0495624_0083349 Ga0495624_0083349_1185_1385 66
328 3300046690 Ga0495624_0623569 Ga0495624_0623569_97_309 66
329 3300046794 Ga0495589_0316866 Ga0495589_0316866_403_615 66
330 3300047315 Ga0495581_0456823 Ga0495581_0456823_131_331 66
331 3300047319 Ga0495674_0710186 Ga0495674_0710186_170_370 66
332 3300047321 Ga0495676_0419087 Ga0495676_0419087_497_697 66
333 3300048088 Ga0495602_0151654 Ga0495602_0151654_771_971 66
334 3300048903 Ga0496100_0028457 Ga0496100_0028457_3160_3372 66
335 3300048904 Ga0496101_0024487 Ga0496101_0024487_2842_3054 66
336 3300048905 Ga0496102_0283396 Ga0496102_0283396_482_694 66
337 3300048906 Ga0496103_0677472 Ga0496103_0677472_411_614 66
338 3300048908 Ga0496105_0394699 Ga0496105_0394699_309_521 66
339 3300048909 Ga0496106_0215487 Ga0496106_0215487_1111_1323 66
340 3300048912 Ga0496109_0753661 Ga0496109_0753661_215_427 66
341 3300048915 Ga0496112_0184937 Ga0496112_0184937_246_449 66
342 3300048917 Ga0496114_0332010 Ga0496114_0332010_28_240 66
343 3300048917 Ga0496114_1362103 Ga0496114_1362103_261_464 66
344 3300048918 Ga0496115_0036914 Ga0496115_0036914_200_412 66
345 3300048929 Ga0496126_0504148 Ga0496126_0504148_255_467 66
346 3300050514 nmdc:mga08x19_1025009_c1 nmdc:mga08x19_1025009_c1_105_305 66
347 3300053084 Ga0495595_0096836 Ga0495595_0096836_724_936 66
348 3300053085 Ga0495619_0624095 Ga0495619_0624095_112_324 66
349 3300005295 Ga0065707_11036024 Ga0065707_110360242 67
350 3300005328 Ga0070676_10004776 Ga0070676_100047765 67
351 3300005329 Ga0070683_100322780 Ga0070683_1003227803 67
352 3300005330 Ga0070690_100122080 Ga0070690_1001220802 67
353 3300005330 Ga0070690_100341478 Ga0070690_1003414782 67
354 3300005331 Ga0070670_100307148 Ga0070670_1003071483 67
355 3300005334 Ga0068869_100014372 Ga0068869_1000143722 67
356 3300005334 Ga0068869_100689580 Ga0068869_1006895802 67
357 3300005335 Ga0070666_10010107 Ga0070666_100101077 67
358 3300005336 Ga0070680_100061979 Ga0070680_1000619793 67
359 3300005336 Ga0070680_100830505 Ga0070680_1008305052 67
360 3300005337 Ga0070682_100141510 Ga0070682_1001415102 67
361 3300005337 Ga0070682_100590193 Ga0070682_1005901932 67
362 3300005339 Ga0070660_100139461 Ga0070660_1001394611 67
363 3300005340 Ga0070689_100172754 Ga0070689_1001727542 67
364 3300005340 Ga0070689_100446957 Ga0070689_1004469573 67
365 3300005343 Ga0070687_100497232 Ga0070687_1004972322 67
366 3300005343 Ga0070687_101109842 Ga0070687_1011098422 67
367 3300005344 Ga0070661_100018897 Ga0070661_1000188976 67
368 3300005344 Ga0070661_100913112 Ga0070661_1009131122 67
369 3300005345 Ga0070692_10910340 Ga0070692_109103402 67
370 3300005347 Ga0070668_100053030 Ga0070668_1000530302 67
371 3300005353 Ga0070669_100103748 Ga0070669_1001037483 67
372 3300005354 Ga0070675_100146387 Ga0070675_1001463872 67
373 3300005355 Ga0070671_100255078 Ga0070671_1002550783 67
374 3300005356 Ga0070674_100236991 Ga0070674_1002369912 67
375 3300005364 Ga0070673_100944465 Ga0070673_1009444652 67
376 3300005365 Ga0070688_100207210 Ga0070688_1002072102 67
377 3300005365 Ga0070688_100781848 Ga0070688_1007818482 67
378 3300005366 Ga0070659_100149849 Ga0070659_1001498492 67
379 3300005367 Ga0070667_100066877 Ga0070667_1000668772 67
380 3300005434 Ga0070709_10031545 Ga0070709_100315454 67
381 3300005434 Ga0070709_10232135 Ga0070709_102321353 67
382 3300005434 Ga0070709_10647352 Ga0070709_106473522 67
383 3300005434 Ga0070709_10722261 Ga0070709_107222612 67
384 3300005435 Ga0070714_100010335 Ga0070714_10001033512 67
385 3300005435 Ga0070714_102385542 Ga0070714_1023855421 67
386 3300005436 Ga0070713_100015219 Ga0070713_1000152193 67
387 3300005436 Ga0070713_100030142 Ga0070713_1000301423 67
388 3300005436 Ga0070713_100260906 Ga0070713_1002609063 67
389 3300005436 Ga0070713_100667440 Ga0070713_1006674402 67
390 3300005436 Ga0070713_101546400 Ga0070713_1015464002 67
391 3300005437 Ga0070710_10132132 Ga0070710_101321322 67
392 3300005437 Ga0070710_10377437 Ga0070710_103774373 67
393 3300005437 Ga0070710_11387037 Ga0070710_113870371 67
394 3300005438 Ga0070701_10964868 Ga0070701_109648682 67
395 3300005439 Ga0070711_100000191 Ga0070711_10000019123 67
396 3300005439 Ga0070711_100420861 Ga0070711_1004208611 67
397 3300005439 Ga0070711_100646646 Ga0070711_1006466461 67
398 3300005439 Ga0070711_101221628 Ga0070711_1012216282 67
399 3300005439 Ga0070711_101627094 Ga0070711_1016270942 67
400 3300005440 Ga0070705_100132317 Ga0070705_1001323173 67
401 3300005444 Ga0070694_100938564 Ga0070694_1009385642 67
402 3300005456 Ga0070678_100101422 Ga0070678_1001014223 67
403 3300005457 Ga0070662_100005784 Ga0070662_10000578415 67
404 3300005458 Ga0070681_10372053 Ga0070681_103720532 67
405 3300005458 Ga0070681_11340808 Ga0070681_113408082 67
406 3300005458 Ga0070681_11389979 Ga0070681_113899792 67
407 3300005459 Ga0068867_100090268 Ga0068867_1000902681 67
408 3300005466 Ga0070685_10044363 Ga0070685_100443632 67
409 3300005467 Ga0070706_102109245 Ga0070706_1021092451 67
410 3300005518 Ga0070699_102027579 Ga0070699_1020275791 67
411 3300005530 Ga0070679_100378503 Ga0070679_1003785032 67
412 3300005530 Ga0070679_100986095 Ga0070679_1009860952 67
413 3300005535 Ga0070684_100015104 Ga0070684_10001510412 67
414 3300005536 Ga0070697_100000975 Ga0070697_10000097520 67
415 3300005539 Ga0068853_100081315 Ga0068853_1000813154 67
416 3300005543 Ga0070672_100322681 Ga0070672_1003226813 67
417 3300005544 Ga0070686_100033425 Ga0070686_1000334255 67
418 3300005544 Ga0070686_101011357 Ga0070686_1010113572 67
419 3300005545 Ga0070695_100045508 Ga0070695_1000455082 67
420 3300005545 Ga0070695_100565960 Ga0070695_1005659602 67
421 3300005546 Ga0070696_100089544 Ga0070696_1000895442 67
422 3300005546 Ga0070696_100107978 Ga0070696_1001079783 67
423 3300005546 Ga0070696_100554755 Ga0070696_1005547552 67
424 3300005547 Ga0070693_100015931 Ga0070693_1000159314 67
425 3300005548 Ga0070665_100037358 Ga0070665_1000373585 67
426 3300005549 Ga0070704_100731609 Ga0070704_1007316091 67
427 3300005563 Ga0068855_100345257 Ga0068855_1003452574 67
428 3300005563 Ga0068855_101230413 Ga0068855_1012304132 67
429 3300005564 Ga0070664_100144991 Ga0070664_1001449913 67
430 3300005564 Ga0070664_100600895 Ga0070664_1006008952 67
431 3300005577 Ga0068857_100097440 Ga0068857_1000974404 67
432 3300005577 Ga0068857_100944824 Ga0068857_1009448242 67
433 3300005577 Ga0068857_102465828 Ga0068857_1024658282 67
434 3300005578 Ga0068854_100079731 Ga0068854_1000797315 67
435 3300005614 Ga0068856_100309821 Ga0068856_1003098212 67
436 3300005615 Ga0070702_100151255 Ga0070702_1001512552 67
437 3300005616 Ga0068852_100018750 Ga0068852_1000187507 67
438 3300005617 Ga0068859_100010649 Ga0068859_10001064916 67
439 3300005618 Ga0068864_100277958 Ga0068864_1002779583 67
440 3300005718 Ga0068866_10025064 Ga0068866_100250646 67
441 3300005719 Ga0068861_100454185 Ga0068861_1004541852 67
442 3300005834 Ga0068851_10015057 Ga0068851_100150572 67
443 3300005840 Ga0068870_10932203 Ga0068870_109322032 67
444 3300005842 Ga0068858_100059426 Ga0068858_1000594261 67
445 3300005842 Ga0068858_100135922 Ga0068858_1001359225 67
446 3300005843 Ga0068860_100073000 Ga0068860_1000730003 67
447 3300005843 Ga0068860_100564649 Ga0068860_1005646492 67
448 3300005844 Ga0068862_100031514 Ga0068862_1000315143 67
449 3300005844 Ga0068862_102047875 Ga0068862_1020478751 67
450 3300006028 Ga0070717_10006374 Ga0070717_100063744 67
451 3300006028 Ga0070717_10094307 Ga0070717_100943073 67
452 3300006028 Ga0070717_10120021 Ga0070717_101200213 67
453 3300006028 Ga0070717_10491944 Ga0070717_104919442 67
454 3300006028 Ga0070717_10982666 Ga0070717_109826662 67
455 3300006028 Ga0070717_11394051 Ga0070717_113940511 67
456 3300006163 Ga0070715_10019784 Ga0070715_100197844 67
457 3300006163 Ga0070715_10494896 Ga0070715_104948962 67
458 3300006163 Ga0070715_10815351 Ga0070715_108153512 67
459 3300006173 Ga0070716_100023941 Ga0070716_1000239413 67
460 3300006173 Ga0070716_100127708 Ga0070716_1001277083 67
461 3300006173 Ga0070716_100139392 Ga0070716_1001393922 67
462 3300006173 Ga0070716_100151070 Ga0070716_1001510703 67
463 3300006173 Ga0070716_100962603 Ga0070716_1009626032 67
464 3300006175 Ga0070712_100002103 Ga0070712_1000021033 67
465 3300006175 Ga0070712_100042575 Ga0070712_1000425754 67
466 3300006175 Ga0070712_100587298 Ga0070712_1005872982 67
467 3300006237 Ga0097621_100020695 Ga0097621_1000206954 67
468 3300006237 Ga0097621_101304847 Ga0097621_1013048472 67
469 3300006358 Ga0068871_100742892 Ga0068871_1007428922 67
470 3300006844 Ga0075428_101476913 Ga0075428_1014769132 67
471 3300006852 Ga0075433_10004383 Ga0075433_1000438315 67
472 3300006871 Ga0075434_100000230 Ga0075434_10000023020 67
473 3300006871 Ga0075434_100801380 Ga0075434_1008013802 67
474 3300006871 Ga0075434_101160788 Ga0075434_1011607882 67
475 3300006914 Ga0075436_100000510 Ga0075436_10000051018 67
476 3300006914 Ga0075436_100029891 Ga0075436_1000298912 67
477 3300006914 Ga0075436_100415732 Ga0075436_1004157322 67
478 3300006931 Ga0097620_100010649 Ga0097620_10001064916 67
479 3300007076 Ga0075435_100000389 Ga0075435_10000038920 67
480 3300007076 Ga0075435_100055600 Ga0075435_1000556005 67
481 3300007076 Ga0075435_100150842 Ga0075435_1001508423 67
482 3300009093 Ga0105240_10391623 Ga0105240_103916232 67
483 3300009093 Ga0105240_12267497 Ga0105240_122674971 67
484 3300009098 Ga0105245_10054232 Ga0105245_100542326 67
485 3300009098 Ga0105245_11080508 Ga0105245_110805082 67
486 3300009098 Ga0105245_12751900 Ga0105245_127519002 67
487 3300009098 Ga0105245_13255067 Ga0105245_132550672 67
488 3300009101 Ga0105247_10028333 Ga0105247_100283333 67
489 3300009101 Ga0105247_10037507 Ga0105247_100375076 67
490 3300009147 Ga0114129_11223317 Ga0114129_112233173 67
491 3300009174 Ga0105241_10104611 Ga0105241_101046114 67
492 3300009174 Ga0105241_10342448 Ga0105241_103424483 67
493 3300009174 Ga0105241_10503769 Ga0105241_105037693 67
494 3300009176 Ga0105242_10028689 Ga0105242_100286895 67
495 3300009176 Ga0105242_10110302 Ga0105242_101103025 67
496 3300009177 Ga0105248_10032147 Ga0105248_100321476 67
497 3300009177 Ga0105248_10569718 Ga0105248_105697183 67
498 3300009177 Ga0105248_10906466 Ga0105248_109064662 67
499 3300009545 Ga0105237_11286203 Ga0105237_112862032 67
500 3300009545 Ga0105237_11449041 Ga0105237_114490412 67
501 3300009551 Ga0105238_10019367 Ga0105238_1001936712 67
502 3300009553 Ga0105249_10017780 Ga0105249_100177805 67
503 3300009553 Ga0105249_13515939 Ga0105249_135159391 67
504 3300010159 Ga0099796_10076584 Ga0099796_100765843 67
505 3300010375 Ga0105239_10748483 Ga0105239_107484833 67
506 3300010375 Ga0105239_12396594 Ga0105239_123965942 67
507 3300010375 Ga0105239_13575427 Ga0105239_135754271 67
508 3300011119 Ga0105246_10302237 Ga0105246_103022372 67
509 3300012507 Ga0157342_1060785 Ga0157342_10607851 67
510 3300013100 Ga0157373_10952686 Ga0157373_109526862 67
511 3300013102 Ga0157371_10085091 Ga0157371_100850913 67
512 3300013104 Ga0157370_11712296 Ga0157370_117122962 67
513 3300013105 Ga0157369_10043759 Ga0157369_100437592 67
514 3300013105 Ga0157369_11861737 Ga0157369_118617372 67
515 3300013296 Ga0157374_10024267 Ga0157374_100242675 67
516 3300013296 Ga0157374_12080146 Ga0157374_120801462 67
517 3300013297 Ga0157378_10027505 Ga0157378_100275053 67
518 3300013297 Ga0157378_10281747 Ga0157378_102817474 67
519 3300013297 Ga0157378_10430415 Ga0157378_104304152 67
520 3300013297 Ga0157378_11200688 Ga0157378_112006882 67
521 3300013306 Ga0163162_10053758 Ga0163162_100537583 67
522 3300013307 Ga0157372_10040130 Ga0157372_100401305 67
523 3300013307 Ga0157372_10173185 Ga0157372_101731855 67
524 3300013308 Ga0157375_10150494 Ga0157375_101504942 67
525 3300014325 Ga0163163_10170068 Ga0163163_101700682 67
526 3300014745 Ga0157377_10184811 Ga0157377_101848113 67
527 3300014745 Ga0157377_10230324 Ga0157377_102303242 67
528 3300014968 Ga0157379_10004402 Ga0157379_100044028 67
529 3300014968 Ga0157379_10063957 Ga0157379_100639573 67
530 3300014969 Ga0157376_10089966 Ga0157376_100899664 67
531 3300014969 Ga0157376_10728258 Ga0157376_107282582 67
532 3300024227 Ga0228598_1105815 Ga0228598_11058151 67
533 3300025321 Ga0207656_10018423 Ga0207656_100184233 67
534 3300025711 Ga0207696_1098767 Ga0207696_10987671 67
535 3300025898 Ga0207692_10081189 Ga0207692_100811893 67
536 3300025898 Ga0207692_10087703 Ga0207692_100877031 67
537 3300025899 Ga0207642_10081086 Ga0207642_100810862 67
538 3300025900 Ga0207710_10025129 Ga0207710_100251293 67
539 3300025903 Ga0207680_10010187 Ga0207680_100101873 67
540 3300025905 Ga0207685_10239727 Ga0207685_102397272 67
541 3300025905 Ga0207685_10337338 Ga0207685_103373382 67
542 3300025906 Ga0207699_10073645 Ga0207699_100736453 67
543 3300025906 Ga0207699_10217781 Ga0207699_102177812 67
544 3300025906 Ga0207699_10986354 Ga0207699_109863541 67
545 3300025907 Ga0207645_10086495 Ga0207645_100864953 67
546 3300025908 Ga0207643_10165810 Ga0207643_101658102 67
547 3300025911 Ga0207654_10041777 Ga0207654_100417775 67
548 3300025912 Ga0207707_10015255 Ga0207707_1001525511 67
549 3300025912 Ga0207707_10353925 Ga0207707_103539253 67
550 3300025912 Ga0207707_11057736 Ga0207707_110577362 67
551 3300025913 Ga0207695_10007039 Ga0207695_1000703915 67
552 3300025914 Ga0207671_10144791 Ga0207671_101447911 67
553 3300025915 Ga0207693_10000922 Ga0207693_1000092225 67
554 3300025915 Ga0207693_10004232 Ga0207693_100042329 67
555 3300025915 Ga0207693_10026057 Ga0207693_100260573 67
556 3300025916 Ga0207663_10018817 Ga0207663_100188174 67
557 3300025916 Ga0207663_10531284 Ga0207663_105312842 67
558 3300025916 Ga0207663_10901261 Ga0207663_109012612 67
559 3300025916 Ga0207663_11257856 Ga0207663_112578561 67
560 3300025917 Ga0207660_10077165 Ga0207660_100771654 67
561 3300025919 Ga0207657_10006426 Ga0207657_100064266 67
562 3300025919 Ga0207657_10943231 Ga0207657_109432312 67
563 3300025920 Ga0207649_10495557 Ga0207649_104955573 67
564 3300025920 Ga0207649_11165604 Ga0207649_111656042 67
565 3300025921 Ga0207652_10037568 Ga0207652_100375683 67
566 3300025921 Ga0207652_10867502 Ga0207652_108675022 67
567 3300025922 Ga0207646_11363734 Ga0207646_113637342 67
568 3300025923 Ga0207681_10043862 Ga0207681_100438623 67
569 3300025924 Ga0207694_10118035 Ga0207694_101180354 67
570 3300025925 Ga0207650_11302802 Ga0207650_113028022 67
571 3300025926 Ga0207659_10141402 Ga0207659_101414023 67
572 3300025927 Ga0207687_10033504 Ga0207687_100335043 67
573 3300025927 Ga0207687_10921378 Ga0207687_109213782 67
574 3300025928 Ga0207700_10042550 Ga0207700_100425505 67
575 3300025928 Ga0207700_10137500 Ga0207700_101375003 67
576 3300025928 Ga0207700_10238412 Ga0207700_102384123 67
577 3300025928 Ga0207700_10592713 Ga0207700_105927132 67
578 3300025928 Ga0207700_11251637 Ga0207700_112516372 67
579 3300025928 Ga0207700_12023091 Ga0207700_120230912 67
580 3300025929 Ga0207664_10048949 Ga0207664_100489497 67
581 3300025929 Ga0207664_10432327 Ga0207664_104323272 67
582 3300025929 Ga0207664_10820419 Ga0207664_108204192 67
583 3300025929 Ga0207664_11221340 Ga0207664_112213402 67
584 3300025931 Ga0207644_10477872 Ga0207644_104778723 67
585 3300025931 Ga0207644_11008921 Ga0207644_110089212 67
586 3300025932 Ga0207690_10025533 Ga0207690_100255334 67
587 3300025933 Ga0207706_10005096 Ga0207706_1000509620 67
588 3300025934 Ga0207686_10088097 Ga0207686_100880972 67
589 3300025936 Ga0207670_10035791 Ga0207670_100357912 67
590 3300025936 Ga0207670_11370614 Ga0207670_113706142 67
591 3300025939 Ga0207665_10001798 Ga0207665_1000179817 67
592 3300025939 Ga0207665_10029689 Ga0207665_100296893 67
593 3300025939 Ga0207665_10061976 Ga0207665_100619762 67
594 3300025939 Ga0207665_10205212 Ga0207665_102052123 67
595 3300025939 Ga0207665_10371403 Ga0207665_103714033 67
596 3300025939 Ga0207665_10786959 Ga0207665_107869592 67
597 3300025940 Ga0207691_10273247 Ga0207691_102732473 67
598 3300025941 Ga0207711_10013154 Ga0207711_100131546 67
599 3300025942 Ga0207689_10063202 Ga0207689_100632022 67
600 3300025942 Ga0207689_10203187 Ga0207689_102031873 67
601 3300025944 Ga0207661_10398694 Ga0207661_103986943 67
602 3300025945 Ga0207679_10098174 Ga0207679_100981744 67
603 3300025945 Ga0207679_10588266 Ga0207679_105882662 67
604 3300025949 Ga0207667_10051651 Ga0207667_100516516 67
605 3300025960 Ga0207651_11009711 Ga0207651_110097112 67
606 3300025961 Ga0207712_10026658 Ga0207712_100266582 67
607 3300025972 Ga0207668_10022020 Ga0207668_100220206 67
608 3300025981 Ga0207640_10094115 Ga0207640_100941155 67
609 3300025986 Ga0207658_10806143 Ga0207658_108061432 67
610 3300026035 Ga0207703_10727815 Ga0207703_107278152 67
611 3300026067 Ga0207678_10001612 Ga0207678_100016127 67
612 3300026078 Ga0207702_10381932 Ga0207702_103819323 67
613 3300026088 Ga0207641_10243221 Ga0207641_102432212 67
614 3300026089 Ga0207648_10026519 Ga0207648_100265195 67
615 3300026116 Ga0207674_10018522 Ga0207674_100185226 67
616 3300026116 Ga0207674_11022583 Ga0207674_110225831 67
617 3300026118 Ga0207675_100029361 Ga0207675_1000293615 67
618 3300026121 Ga0207683_10091361 Ga0207683_100913613 67
619 3300026142 Ga0207698_10130599 Ga0207698_101305994 67
620 3300028016 Ga0265354_1009164 Ga0265354_10091643 67
621 3300028379 Ga0268266_10023242 Ga0268266_100232427 67
622 3300028380 Ga0268265_10048846 Ga0268265_100488465 67
623 3300028380 Ga0268265_11651110 Ga0268265_116511101 67
624 3300028381 Ga0268264_10099564 Ga0268264_100995644 67
625 3300028381 Ga0268264_10641535 Ga0268264_106415352 67
626 3300030760 Ga0265762_1049939 Ga0265762_10499392 67
627 3300030878 Ga0265770_1004221 Ga0265770_10042213 67
628 3300030878 Ga0265770_1065249 Ga0265770_10652491 67
629 3300031043 Ga0265779_103065 Ga0265779_1030652 67
630 3300031090 Ga0265760_10004716 Ga0265760_100047167 67
631 3300031090 Ga0265760_10008596 Ga0265760_100085966 67
632 3300031731 Ga0307405_10081873 Ga0307405_100818733 67
633 3300031852 Ga0307410_10009896 Ga0307410_1000989611 67
634 3300031852 Ga0307410_10056095 Ga0307410_100560953 67
635 3300031901 Ga0307406_10292192 Ga0307406_102921923 67
636 3300031901 Ga0307406_10565806 Ga0307406_105658062 67
637 3300031903 Ga0307407_10222083 Ga0307407_102220832 67
638 3300031903 Ga0307407_10460864 Ga0307407_104608642 67
639 3300031911 Ga0307412_10413758 Ga0307412_104137582 67
640 3300031995 Ga0307409_100065689 Ga0307409_1000656893 67
641 3300031995 Ga0307409_100395128 Ga0307409_1003951283 67
642 3300032002 Ga0307416_100117099 Ga0307416_1001170992 67
643 3300032002 Ga0307416_103632177 Ga0307416_1036321772 67
644 3300032004 Ga0307414_10305297 Ga0307414_103052972 67
645 3300032004 Ga0307414_11901792 Ga0307414_119017922 67
646 3300032005 Ga0307411_10133285 Ga0307411_101332853 67
647 3300032126 Ga0307415_100033737 Ga0307415_1000337374 67
648 3300034816 Ga0373930_0128935 Ga0373930_0128935_207_425 67
649 3300034818 Ga0373950_0051482 Ga0373950_0051482_333_551 67
650 3300034819 Ga0373958_0008489 Ga0373958_0008489_885_1103 67
651 3300034957 Ga0373938_0024859 Ga0373938_0024859_186_404 67
652 3300035083 Ga0373926_0006641 Ga0373926_0006641_2641_2844 67
653 3300035083 Ga0373926_0229018 Ga0373926_0229018_257_475 67
654 3300035086 Ga0373934_0483607 Ga0373934_0483607_45_248 67
655 3300035088 Ga0373940_0133982 Ga0373940_0133982_446_664 67
656 3300035088 Ga0373940_0340897 Ga0373940_0340897_227_445 67
657 3300035091 Ga0373951_0133050 Ga0373951_0133050_351_569 67
658 3300035111 Ga0373923_0310216 Ga0373923_0310216_293_496 67
659 3300035113 Ga0373936_0108171 Ga0373936_0108171_124_327 67
660 3300035113 Ga0373936_0447052 Ga0373936_0447052_379_582 67
661 3300035113 Ga0373936_0580978 Ga0373936_0580978_263_466 67
662 3300035114 Ga0373939_0025547 Ga0373939_0025547_1347_1565 67
663 3300035115 Ga0373941_0098284 Ga0373941_0098284_17_235 67
664 3300035116 Ga0373945_0026866 Ga0373945_0026866_761_964 67
665 3300035170 Ga0373943_0022407 Ga0373943_0022407_1555_1758 67
666 3300035171 Ga0373946_0044663 Ga0373946_0044663_222_425 67
667 3300035207 Ga0373942_0007478 Ga0373942_0007478_1924_2142 67
668 3300035241 Ga0373961_0007659 Ga0373961_0007659_1283_1501 67
669 3300035691 Ga0373931_0038758 Ga0373931_0038758_1554_1772 67
670 3300035692 Ga0373935_0015830 Ga0373935_0015830_2860_3063 67
671 3300035695 Ga0373927_0796417 Ga0373927_0796417_102_305 67
672 3300035724 Ga0373933_0398628 Ga0373933_0398628_328_531 67
673 3300035725 Ga0373947_0070018 Ga0373947_0070018_473_676 67
674 3300036401 Ga0373937_0535257 Ga0373937_0535257_595_798 67
675 3300037068 Ga0373925_0012340 Ga0373925_0012340_1795_1998 67
676 3300037466 Ga0395898_1067496 Ga0395898_1067496_15_257 67
677 3300038443 Ga0395901_0719389 Ga0395901_0719389_234_437 67
678 3300039437 Ga0436365_1246521 Ga0436365_1246521_361_564 67
679 3300039450 Ga0436363_0216863 Ga0436363_0216863_175_378 67
680 3300039450 Ga0436363_0929382 Ga0436363_0929382_257_460 67
681 3300039450 Ga0436363_1116219 Ga0436363_1116219_725_928 67
682 3300044694 Ga0466963_1138627 Ga0466963_1138627_278_484 67
683 3300044735 Ga0466968_0617027 Ga0466968_0617027_200_403 67
684 3300045976 Ga0466967_0047517 Ga0466967_0047517_2945_3151 67
685 3300045976 Ga0466967_1605092 Ga0466967_1605092_90_293 67
686 3300046472 Ga0495580_0001673 Ga0495580_0001673_18919_19122 67
687 3300046472 Ga0495580_0016664 Ga0495580_0016664_843_1058 67
688 3300046473 Ga0495582_0000596 Ga0495582_0000596_18072_18275 67
689 3300046517 Ga0495630_0528840 Ga0495630_0528840_176_379 67
690 3300046531 Ga0495665_0000974 Ga0495665_0000974_4542_4745 67
691 3300046535 Ga0495586_0201724 Ga0495586_0201724_67_270 67
692 3300046535 Ga0495586_0491546 Ga0495586_0491546_351_554 67
693 3300046683 Ga0495658_0040249 Ga0495658_0040249_1564_1767 67
694 3300046684 Ga0495669_0293526 Ga0495669_0293526_277_480 67
695 3300046684 Ga0495669_0303024 Ga0495669_0303024_204_407 67
696 3300046690 Ga0495624_0156645 Ga0495624_0156645_1156_1359 67
697 3300047315 Ga0495581_0580947 Ga0495581_0580947_213_416 67
698 3300047319 Ga0495674_0057042 Ga0495674_0057042_2518_2721 67
699 3300047319 Ga0495674_0614348 Ga0495674_0614348_274_477 67
700 3300048088 Ga0495602_0106256 Ga0495602_0106256_53_292 67
701 3300048903 Ga0496100_0034107 Ga0496100_0034107_2895_3113 67
702 3300048903 Ga0496100_0965606 Ga0496100_0965606_434_652 67
703 3300048904 Ga0496101_0011221 Ga0496101_0011221_2918_3136 67
704 3300048904 Ga0496101_0063740 Ga0496101_0063740_1433_1651 67
705 3300048905 Ga0496102_0003212 Ga0496102_0003212_3265_3483 67
706 3300048905 Ga0496102_0082208 Ga0496102_0082208_2573_2791 67
707 3300048905 Ga0496102_0733808 Ga0496102_0733808_195_413 67
708 3300048906 Ga0496103_0110851 Ga0496103_0110851_694_912 67
709 3300048907 Ga0496104_0076564 Ga0496104_0076564_2060_2278 67
710 3300048907 Ga0496104_0233662 Ga0496104_0233662_1287_1505 67
711 3300048907 Ga0496104_0637327 Ga0496104_0637327_143_346 67
712 3300048909 Ga0496106_0020191 Ga0496106_0020191_1659_1877 67
713 3300048909 Ga0496106_0132634 Ga0496106_0132634_1069_1287 67
714 3300048910 Ga0496107_0368605 Ga0496107_0368605_768_986 67
715 3300048912 Ga0496109_0034010 Ga0496109_0034010_1931_2149 67
716 3300048913 Ga0496110_0063397 Ga0496110_0063397_2133_2351 67
717 3300048914 Ga0496111_0341124 Ga0496111_0341124_551_769 67
718 3300048915 Ga0496112_0051891 Ga0496112_0051891_2235_2453 67
719 3300048916 Ga0496113_0009232 Ga0496113_0009232_4286_4504 67
720 3300049520 Ga0501297_020717 Ga0501297_020717_333_557 67
721 3300049652 Ga0501202_069189 Ga0501202_069189_461_685 67
722 3300049771 Ga0501274_036137 Ga0501274_036137_68_292 67
723 3300050512 nmdc:mga0n895_1101194_c1 nmdc:mga0n895_1101194_c1_290_508 67
724 3300050512 nmdc:mga0n895_133428_c1 nmdc:mga0n895_133428_c1_429_647 67
725 3300050512 nmdc:mga0n895_344_c1 nmdc:mga0n895_344_c1_7049_7252 67
726 3300050512 nmdc:mga0n895_883053_c1 nmdc:mga0n895_883053_c1_581_787 67
727 3300050513 nmdc:mga0rr50_40640_c1 nmdc:mga0rr50_40640_c1_1076_1279 67
728 3300050513 nmdc:mga0rr50_548981_c1 nmdc:mga0rr50_548981_c1_578_796 67
729 3300050513 nmdc:mga0rr50_775389_c1 nmdc:mga0rr50_775389_c1_48_254 67
730 3300050513 nmdc:mga0rr50_872_c1 nmdc:mga0rr50_872_c1_6449_6652 67
731 3300050514 nmdc:mga08x19_3391_c1 nmdc:mga08x19_3391_c1_3330_3533 67
732 3300050514 nmdc:mga08x19_51227_c1 nmdc:mga08x19_51227_c1_1077_1295 67
733 3300050514 nmdc:mga08x19_9637_c1 nmdc:mga08x19_9637_c1_3577_3780 67
734 3300050515 nmdc:mga0a205_7367_c1 nmdc:mga0a205_7367_c1_4230_4433 67
735 3300053078 Ga0495612_0444526 Ga0495612_0444526_114_317 67
736 3300001915 JGI24741J21665_1033502 JGI24741J21665_10335022 68
737 3300001976 JGI24752J21851_1000484 JGI24752J21851_10004841 68
738 3300001990 JGI24737J22298_10025233 JGI24737J22298_100252333 68
739 3300001991 JGI24743J22301_10003249 JGI24743J22301_100032494 68
740 3300002075 JGI24738J21930_10047296 JGI24738J21930_100472962 68
741 3300002155 JGI24033J26618_1039806 JGI24033J26618_10398062 68
742 3300002239 JGI24034J26672_10008468 JGI24034J26672_100084683 68
743 3300002459 JGI24751J29686_10001356 JGI24751J29686_1000135611 68
744 3300005289 Ga0065704_10534439 Ga0065704_105344392 68
745 3300005293 Ga0065715_10104722 Ga0065715_101047223 68
746 3300005327 Ga0070658_10036784 Ga0070658_100367844 68
747 3300005329 Ga0070683_100011087 Ga0070683_1000110873 68
748 3300005330 Ga0070690_100000550 Ga0070690_10000055021 68
749 3300005331 Ga0070670_100015559 Ga0070670_1000155593 68
750 3300005331 Ga0070670_100033183 Ga0070670_1000331839 68
751 3300005334 Ga0068869_100074090 Ga0068869_1000740903 68
752 3300005334 Ga0068869_100651889 Ga0068869_1006518891 68
753 3300005335 Ga0070666_10010510 Ga0070666_100105103 68
754 3300005337 Ga0070682_100196586 Ga0070682_1001965862 68
755 3300005338 Ga0068868_100011852 Ga0068868_10001185210 68
756 3300005339 Ga0070660_100002901 Ga0070660_10000290114 68
757 3300005340 Ga0070689_100068823 Ga0070689_1000688233 68
758 3300005343 Ga0070687_100000493 Ga0070687_1000004936 68
759 3300005344 Ga0070661_100012073 Ga0070661_1000120733 68
760 3300005347 Ga0070668_100014649 Ga0070668_1000146494 68
761 3300005353 Ga0070669_100007500 Ga0070669_1000075006 68
762 3300005354 Ga0070675_100004817 Ga0070675_1000048179 68
763 3300005355 Ga0070671_100451132 Ga0070671_1004511323 68
764 3300005356 Ga0070674_100010705 Ga0070674_1000107051 68
765 3300005364 Ga0070673_100073104 Ga0070673_1000731043 68
766 3300005365 Ga0070688_100031729 Ga0070688_1000317293 68
767 3300005366 Ga0070659_100023459 Ga0070659_1000234593 68
768 3300005367 Ga0070667_100289930 Ga0070667_1002899302 68
769 3300005441 Ga0070700_100068348 Ga0070700_1000683483 68
770 3300005444 Ga0070694_100577378 Ga0070694_1005773782 68
771 3300005455 Ga0070663_100012382 Ga0070663_1000123823 68
772 3300005455 Ga0070663_101360826 Ga0070663_1013608261 68
773 3300005456 Ga0070678_100132369 Ga0070678_1001323694 68
774 3300005457 Ga0070662_100018068 Ga0070662_1000180682 68
775 3300005459 Ga0068867_100009657 Ga0068867_1000096579 68
776 3300005466 Ga0070685_10001292 Ga0070685_100012924 68
777 3300005535 Ga0070684_100001423 Ga0070684_1000014239 68
778 3300005539 Ga0068853_100008308 Ga0068853_1000083089 68
779 3300005543 Ga0070672_100134491 Ga0070672_1001344913 68
780 3300005544 Ga0070686_100005280 Ga0070686_1000052807 68
781 3300005547 Ga0070693_100092826 Ga0070693_1000928263 68
782 3300005547 Ga0070693_100258541 Ga0070693_1002585412 68
783 3300005563 Ga0068855_100025048 Ga0068855_1000250487 68
784 3300005564 Ga0070664_100017663 Ga0070664_1000176634 68
785 3300005577 Ga0068857_100001133 Ga0068857_10000113313 68
786 3300005578 Ga0068854_101239939 Ga0068854_1012399392 68
787 3300005614 Ga0068856_100060929 Ga0068856_1000609293 68
788 3300005615 Ga0070702_100260522 Ga0070702_1002605222 68
789 3300005616 Ga0068852_100001223 Ga0068852_10000122311 68
790 3300005617 Ga0068859_100052886 Ga0068859_1000528863 68
791 3300005618 Ga0068864_100086394 Ga0068864_1000863943 68
792 3300005618 Ga0068864_100289329 Ga0068864_1002893292 68
793 3300005718 Ga0068866_10001380 Ga0068866_100013804 68
794 3300005719 Ga0068861_100006422 Ga0068861_1000064225 68
795 3300005834 Ga0068851_10001352 Ga0068851_1000135210 68
796 3300005840 Ga0068870_10007394 Ga0068870_100073945 68
797 3300005841 Ga0068863_100020550 Ga0068863_1000205505 68
798 3300005841 Ga0068863_101911187 Ga0068863_1019111872 68
799 3300005842 Ga0068858_100023794 Ga0068858_1000237944 68
800 3300005843 Ga0068860_100036537 Ga0068860_1000365372 68
801 3300005843 Ga0068860_100525026 Ga0068860_1005250263 68
802 3300005844 Ga0068862_100010568 Ga0068862_1000105689 68
803 3300005844 Ga0068862_100027948 Ga0068862_1000279486 68
804 3300006237 Ga0097621_100075555 Ga0097621_1000755553 68
805 3300006237 Ga0097621_101895105 Ga0097621_1018951052 68
806 3300006358 Ga0068871_100098154 Ga0068871_1000981543 68
807 3300006871 Ga0075434_101937085 Ga0075434_1019370852 68
808 3300006881 Ga0068865_100016197 Ga0068865_1000161975 68
809 3300006931 Ga0097620_100052889 Ga0097620_1000528893 68
810 3300009092 Ga0105250_10023011 Ga0105250_100230114 68
811 3300009093 Ga0105240_10399065 Ga0105240_103990653 68
812 3300009094 Ga0111539_12687721 Ga0111539_126877212 68
813 3300009098 Ga0105245_10005029 Ga0105245_1000502911 68
814 3300009101 Ga0105247_10052463 Ga0105247_100524633 68
815 3300009148 Ga0105243_11072228 Ga0105243_110722282 68
816 3300009174 Ga0105241_10014226 Ga0105241_100142268 68
817 3300009176 Ga0105242_10035557 Ga0105242_100355572 68
818 3300009177 Ga0105248_10038960 Ga0105248_100389602 68
819 3300009545 Ga0105237_10143015 Ga0105237_101430153 68
820 3300009545 Ga0105237_10191641 Ga0105237_101916412 68
821 3300009551 Ga0105238_10424409 Ga0105238_104244093 68
822 3300009553 Ga0105249_10111464 Ga0105249_101114642 68
823 3300010375 Ga0105239_10029298 Ga0105239_100292988 68
824 3300011119 Ga0105246_10002877 Ga0105246_1000287713 68
825 3300012483 Ga0157337_1025918 Ga0157337_10259181 68
826 3300013100 Ga0157373_10001758 Ga0157373_1000175821 68
827 3300013102 Ga0157371_10002134 Ga0157371_1000213412 68
828 3300013105 Ga0157369_10026263 Ga0157369_100262634 68
829 3300013296 Ga0157374_10014284 Ga0157374_100142842 68
830 3300013296 Ga0157374_10029721 Ga0157374_100297218 68
831 3300013297 Ga0157378_10029365 Ga0157378_100293654 68
832 3300013297 Ga0157378_10081386 Ga0157378_100813862 68
833 3300013306 Ga0163162_10015114 Ga0163162_1001511413 68
834 3300013306 Ga0163162_10296022 Ga0163162_102960224 68
835 3300013307 Ga0157372_10002154 Ga0157372_1000215413 68
836 3300013307 Ga0157372_10091572 Ga0157372_100915727 68
837 3300013308 Ga0157375_10067349 Ga0157375_100673494 68
838 3300014325 Ga0163163_10001073 Ga0163163_1000107321 68
839 3300014325 Ga0163163_12359656 Ga0163163_123596562 68
840 3300014326 Ga0157380_10030441 Ga0157380_100304415 68
841 3300014745 Ga0157377_10000768 Ga0157377_1000076817 68
842 3300014968 Ga0157379_10005366 Ga0157379_1000536612 68
843 3300014968 Ga0157379_12653172 Ga0157379_126531722 68
844 3300014969 Ga0157376_10013365 Ga0157376_100133652 68
845 3300015261 Ga0182006_1040198 Ga0182006_10401982 68
846 3300015262 Ga0182007_10081080 Ga0182007_100810802 68
847 3300017792 Ga0163161_10001969 Ga0163161_1000196920 68
848 3300025315 Ga0207697_10022130 Ga0207697_100221305 68
849 3300025321 Ga0207656_10007564 Ga0207656_100075645 68
850 3300025711 Ga0207696_1030544 Ga0207696_10305443 68
851 3300025893 Ga0207682_10254281 Ga0207682_102542812 68
852 3300025899 Ga0207642_10019526 Ga0207642_100195263 68
853 3300025900 Ga0207710_10011254 Ga0207710_100112543 68
854 3300025901 Ga0207688_10005204 Ga0207688_100052042 68
855 3300025903 Ga0207680_10001756 Ga0207680_1000175612 68
856 3300025904 Ga0207647_10001343 Ga0207647_100013434 68
857 3300025907 Ga0207645_10001180 Ga0207645_1000118014 68
858 3300025908 Ga0207643_10001067 Ga0207643_1000106711 68
859 3300025909 Ga0207705_10284805 Ga0207705_102848052 68
860 3300025911 Ga0207654_10028664 Ga0207654_100286643 68
861 3300025914 Ga0207671_10091668 Ga0207671_100916684 68
862 3300025916 Ga0207663_10160673 Ga0207663_101606731 68
863 3300025918 Ga0207662_10014118 Ga0207662_100141186 68
864 3300025919 Ga0207657_10004069 Ga0207657_1000406921 68
865 3300025920 Ga0207649_10001087 Ga0207649_1000108721 68
866 3300025923 Ga0207681_10009111 Ga0207681_100091119 68
867 3300025925 Ga0207650_10000152 Ga0207650_1000015260 68
868 3300025925 Ga0207650_11032043 Ga0207650_110320431 68
869 3300025926 Ga0207659_10003498 Ga0207659_1000349811 68
870 3300025927 Ga0207687_10010238 Ga0207687_100102383 68
871 3300025931 Ga0207644_10003335 Ga0207644_1000333512 68
872 3300025932 Ga0207690_10007754 Ga0207690_100077543 68
873 3300025933 Ga0207706_10000740 Ga0207706_1000074021 68
874 3300025934 Ga0207686_10234097 Ga0207686_102340973 68
875 3300025936 Ga0207670_10003610 Ga0207670_1000361014 68
876 3300025937 Ga0207669_11201146 Ga0207669_112011462 68
877 3300025938 Ga0207704_10009815 Ga0207704_100098154 68
878 3300025940 Ga0207691_10000308 Ga0207691_1000030835 68
879 3300025941 Ga0207711_10003068 Ga0207711_1000306811 68
880 3300025942 Ga0207689_10000618 Ga0207689_1000061821 68
881 3300025944 Ga0207661_10007082 Ga0207661_1000708211 68
882 3300025945 Ga0207679_10000298 Ga0207679_1000029821 68
883 3300025949 Ga0207667_10055132 Ga0207667_100551328 68
884 3300025960 Ga0207651_10003558 Ga0207651_1000355813 68
885 3300025961 Ga0207712_10063662 Ga0207712_100636622 68
886 3300025972 Ga0207668_10069658 Ga0207668_100696583 68
887 3300025981 Ga0207640_10063034 Ga0207640_100630343 68
888 3300025986 Ga0207658_10003391 Ga0207658_1000339110 68
889 3300026023 Ga0207677_10007921 Ga0207677_100079219 68
890 3300026035 Ga0207703_10007555 Ga0207703_100075555 68
891 3300026041 Ga0207639_10003445 Ga0207639_100034459 68
892 3300026067 Ga0207678_10003018 Ga0207678_100030189 68
893 3300026067 Ga0207678_11060377 Ga0207678_110603772 68
894 3300026075 Ga0207708_10073017 Ga0207708_100730174 68
895 3300026078 Ga0207702_10313960 Ga0207702_103139603 68
896 3300026088 Ga0207641_10000052 Ga0207641_1000005220 68
897 3300026089 Ga0207648_10003962 Ga0207648_1000396221 68
898 3300026095 Ga0207676_10000176 Ga0207676_1000017641 68
899 3300026095 Ga0207676_10564199 Ga0207676_105641992 68
900 3300026116 Ga0207674_10000561 Ga0207674_1000056135 68
901 3300026118 Ga0207675_100005443 Ga0207675_10000544311 68
902 3300026121 Ga0207683_10001978 Ga0207683_1000197812 68
903 3300026142 Ga0207698_10170772 Ga0207698_101707723 68
904 3300027907 Ga0207428_11136042 Ga0207428_111360422 68
905 3300028379 Ga0268266_10001266 Ga0268266_1000126626 68
906 3300028380 Ga0268265_10008088 Ga0268265_100080888 68
907 3300028380 Ga0268265_10044241 Ga0268265_100442413 68
908 3300028381 Ga0268264_10005269 Ga0268264_1000526912 68
909 3300035691 Ga0373931_0502874 Ga0373931_0502874_92_304 68
910 3300044712 Ga0453684_1249722 Ga0453684_1249722_288_494 68
911 3300046457 Ga0495590_0402543 Ga0495590_0402543_260_466 68
912 3300046472 Ga0495580_0039298 Ga0495580_0039298_72_278 68
913 3300046528 Ga0495642_0399567 Ga0495642_0399567_54_260 68
914 3300046684 Ga0495669_0033508 Ga0495669_0033508_1300_1506 68
915 3300048903 Ga0496100_0243051 Ga0496100_0243051_856_1062 68
916 3300048904 Ga0496101_1040896 Ga0496101_1040896_304_510 68
917 3300048905 Ga0496102_0021206 Ga0496102_0021206_5406_5612 68
918 3300048905 Ga0496102_0576757 Ga0496102_0576757_218_424 68
919 3300048906 Ga0496103_0254260 Ga0496103_0254260_444_650 68
920 3300048907 Ga0496104_0416050 Ga0496104_0416050_648_854 68
921 3300048909 Ga0496106_0159342 Ga0496106_0159342_1330_1536 68
922 3300048911 Ga0496108_0000242 Ga0496108_0000242_9977_10183 68
923 3300048912 Ga0496109_0000120 Ga0496109_0000120_8602_8808 68
924 3300048912 Ga0496109_0141665 Ga0496109_0141665_73_285 68
925 3300048913 Ga0496110_0000795 Ga0496110_0000795_9838_10044 68
926 3300048915 Ga0496112_0000198 Ga0496112_0000198_28363_28569 68
927 3300048915 Ga0496112_0478973 Ga0496112_0478973_964_1170 68
928 3300048916 Ga0496113_0000111 Ga0496113_0000111_25084_25290 68
929 3300048918 Ga0496115_0018551 Ga0496115_0018551_5055_5261 68
930 3300049744 Ga0501083_0089368 Ga0501083_0089368_455_661 68
931 3300049744 Ga0501083_0305202 Ga0501083_0305202_541_747 68
932 3300050512 nmdc:mga0n895_1691134_c1 nmdc:mga0n895_1691134_c1_251_457 68

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00327

Ribosomal_L30

Ribosomal protein L30p/L7e

24

74

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hl7-assembly1.cif.gz_W the crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with lefamulin 0.9073 12 68
4wf9-assembly1.cif.gz_W the crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with telithromycin 0.9049 12 68
8qpp-assembly1.cif.gz_x bacillus subtilis muts2-collided disome complex (stalled 70s) 0.9018 12 68
6fxc-assembly1.cif.gz_AX the cryo-em structure of hibernating 100s ribosome dimer from pathogenic staphylococcus aureus 0.8997 12 68
7s9u-assembly1.cif.gz_Z 44sr3c ribosomal particle 0.8975 12 68
ID Description Score Start End Superfamily
5hl7W00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9073 12 68 3.30.1390.20
4wfbW00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.9036 12 68 3.30.1390.20
5hl7W00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.8926 12 68 3.30.1390.20
1vw4U00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.8904 13 68 3.30.1390.20
af_P9WHA3_1_65_3.30.1390.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7 0.8902 13 67 3.30.1390.20
ID Description Score Start End GO Terms
AF-C7LKI6-F1-model_v4 Multifunctional fusion protein [Includes: Small ribosomal subunit protein uS5; Large ribosomal subunit protein uL30] 0.9417 13 68 GO:0003735
GO:0006412
GO:0015934
GO:0015935
GO:0019843
AF-A0A3D0FPQ4-F1-model_v4 Multifunctional fusion protein [Includes: Large ribosomal subunit protein uL15; Large ribosomal subunit protein uL30] 0.9386 13 66 GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-A0A5B9EEZ4-F1-model_v4 Large ribosomal subunit protein uL30 0.919 10 68 GO:0003735
GO:0006412
GO:0022625
AF-A0A7V4ZQE1-F1-model_v4 50S ribosomal protein L30 0.9175 12 67 GO:0003735
GO:0006412
GO:0022625
AF-A0A1V5FZK5-F1-model_v4 Large ribosomal subunit protein uL30 0.9164 12 68 GO:0003735
GO:0006412
GO:0022625

Feature Viewer

pLDDT pTM Quality
81.98 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map