F486016

General Info

Members Datasets Scaffolds Average Seq Length
930 375 914 337

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10063501|Ga0070717_100635013
Length 359
Sequence MTTDKPMQLGMIGLGRMGANLSRRLMRDGHRVVVYDHTPDHVKQLAGEGATGALTLEEFVAKLEKPRAAWLMLPAAVTGPVLERLAVLLEPGDIVIDGGNTYYRDDIDRAKELMPRQLHYVDVGTSGGIFGLERGFCLMIGGEDGPVEHLDPIFKSIAPGAGTAEPTPGRSRSDTGTAQDGYLHCGPSGSGHFVKMVHNGIEYGMMAAIAEGLSIIKHANVGQDEVQSDDAETTPLRDPQYYQYDIDVAEVAEVWRRGSVISSWLIDLTADALARSPQLDNFGGHVSDSGEGRWTVIAAVDEGVPAPVITAALIERFESRGLGEFGDKVLSALRSEFGGHAEKESDNSGRILPADPTGT

Samples

Sample ID Description Type Environment
1 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
2 2671180195 Frankia sp. CcI49 Isolate Nodule
3 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
4 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
5 2773857922 Frankia sp. CcI49 Isolate Nodule
6 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
7 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
8 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
9 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
10 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
11 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
97 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
132 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
133 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
134 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
199 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
200 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
201 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
202 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
203 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
206 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
207 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
208 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
209 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
210 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
211 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
212 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
214 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
215 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
216 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
217 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
218 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
219 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
220 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
221 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
222 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
223 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
224 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
225 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
226 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
228 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
229 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
230 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
231 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
232 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
233 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
235 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
236 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
237 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
238 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
239 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
240 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
241 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
242 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
243 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
244 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
245 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
246 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
247 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
248 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
249 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
250 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
251 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
252 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
253 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
254 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
255 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
256 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
257 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
258 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
259 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
260 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
261 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
262 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
263 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
264 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
265 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
266 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
267 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
268 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
269 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
270 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
271 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
272 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
273 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
274 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
275 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
276 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
277 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
278 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
279 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
280 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
281 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
282 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
283 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
284 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
285 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
286 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
287 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
288 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
289 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
290 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
291 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
292 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
293 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
294 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
295 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
296 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
297 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
298 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
299 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
300 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
301 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
302 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
303 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
304 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
305 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
306 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
307 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
308 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
309 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
310 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
311 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
312 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
313 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
314 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
315 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
316 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
317 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
318 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
319 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
320 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
321 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
322 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
323 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
324 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
325 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
326 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
327 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
339 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
340 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
341 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
342 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
343 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
344 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
345 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
346 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
347 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
350 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
351 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
352 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
353 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
354 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
355 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
356 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
357 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
358 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
359 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
360 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
361 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
362 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
363 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
364 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
365 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
366 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
367 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
368 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
369 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
370 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
371 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
372 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
373 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
374 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
375 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.63
Metatranscriptomes 0.65
Isolates 1.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.61
Nodule 0.22
Rhizoplane 5.7
Rhizosphere 90.32
Stem 0
Stem Tuber 0
Unclassified 2.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24742J22300_10012159 3300002244 Bacteria 1432
2 JGI25407J50210_10041359 3300003373 Bacteria 1180
3 Ga0055536_1024561 3300003781 Bacteria 1742
4 Ga0070658_10046996 3300005327 Bacteria 3493
5 Ga0070683_100000226 3300005329 Bacteria 38469
6 Ga0070683_100029490 3300005329 Bacteria 4968
7 Ga0070683_100179933 3300005329 Bacteria 2007
8 Ga0070690_100003251 3300005330 Bacteria 8869
9 Ga0070690_100074855 3300005330 Bacteria 2206
10 Ga0070690_100278915 3300005330 Bacteria 1191
11 Ga0070670_100166035 3300005331 Bacteria 1914
12 Ga0070666_10028275 3300005335 Bacteria 3678
13 Ga0070666_10035693 3300005335 Bacteria 3298
14 Ga0070680_100137959 3300005336 Bacteria 2044
15 Ga0070682_100000072 3300005337 Bacteria 93808
16 Ga0070682_100053977 3300005337 Bacteria 2520
17 Ga0068868_100012247 3300005338 Bacteria 6265
18 Ga0068868_100015708 3300005338 Bacteria 5608
19 Ga0068868_100345383 3300005338 Bacteria 1273
20 Ga0070660_100418869 3300005339 Bacteria 1109
21 Ga0070689_100001617 3300005340 Bacteria 14384
22 Ga0070689_100009128 3300005340 Bacteria 7021
23 Ga0070691_10009274 3300005341 Bacteria 4497
24 Ga0070692_10156612 3300005345 Bacteria 1302
25 Ga0070668_100002229 3300005347 Bacteria 14246
26 Ga0070668_100024108 3300005347 Bacteria 4608
27 Ga0070675_100000008 3300005354 Bacteria 250004
28 Ga0070675_100037489 3300005354 Bacteria 3949
29 Ga0070671_100091773 3300005355 Bacteria 2544
30 Ga0070674_100008015 3300005356 Bacteria 6261
31 Ga0070688_100000018 3300005365 Bacteria 72357
32 Ga0070688_100000364 3300005365 Bacteria 22986
33 Ga0070688_100038405 3300005365 Bacteria 2924
34 Ga0070659_100048610 3300005366 Bacteria 3333
35 Ga0070659_100052543 3300005366 Bacteria 3206
36 Ga0070667_100001736 3300005367 Bacteria 19468
37 Ga0070667_100002459 3300005367 Bacteria 16172
38 Ga0070709_10005538 3300005434 Bacteria 6836
39 Ga0070709_10096587 3300005434 Bacteria 1960
40 Ga0070709_10255817 3300005434 Bacteria 1263
41 Ga0070714_100074268 3300005435 Bacteria 2947
42 Ga0070713_100000061 3300005436 Bacteria 68662
43 Ga0070713_100000246 3300005436 Bacteria 35790
44 Ga0070713_100070690 3300005436 Bacteria 2947
45 Ga0070713_100098808 3300005436 Bacteria 2525
46 Ga0070713_100124655 3300005436 Bacteria 2264
47 Ga0070713_100230126 3300005436 Bacteria 1685
48 Ga0070710_10003126 3300005437 Bacteria 7843
49 Ga0070710_10003839 3300005437 Bacteria 7109
50 Ga0070710_10024104 3300005437 Bacteria 3206
51 Ga0070710_10114119 3300005437 Bacteria 1627
52 Ga0070701_10004227 3300005438 Bacteria 5785
53 Ga0070701_10004840 3300005438 Bacteria 5505
54 Ga0070701_10057040 3300005438 Bacteria 2046
55 Ga0070711_100001099 3300005439 Bacteria 14425
56 Ga0070711_100009291 3300005439 Bacteria 6048
57 Ga0070711_100052841 3300005439 Bacteria 2797
58 Ga0070711_100056556 3300005439 Bacteria 2713
59 Ga0070711_100092238 3300005439 Bacteria 2185
60 Ga0070705_100017856 3300005440 Bacteria 3710
61 Ga0070705_100018185 3300005440 Bacteria 3680
62 Ga0070705_100020873 3300005440 Bacteria 3476
63 Ga0070705_100040100 3300005440 Bacteria 2661
64 Ga0070700_100008540 3300005441 Bacteria 5576
65 Ga0070694_100003172 3300005444 Bacteria 9807
66 Ga0070694_100196659 3300005444 Bacteria 1500
67 Ga0070708_100005178 3300005445 Bacteria 10323
68 Ga0070708_100039880 3300005445 Bacteria 4111
69 Ga0070708_100088458 3300005445 Bacteria 2816
70 Ga0070708_100157043 3300005445 Bacteria 2118
71 Ga0070708_100396995 3300005445 Bacteria 1300
72 Ga0070663_100008138 3300005455 Bacteria 6431
73 Ga0070663_100437850 3300005455 Bacteria 1075
74 Ga0070678_100002322 3300005456 Bacteria 10386
75 Ga0070678_100033632 3300005456 Bacteria 3562
76 Ga0070662_100001811 3300005457 Bacteria 13140
77 Ga0070681_10019014 3300005458 Bacteria 6875
78 Ga0070681_10062806 3300005458 Bacteria 3687
79 Ga0070681_10086096 3300005458 Bacteria 3095
80 Ga0068867_100003850 3300005459 Bacteria 10550
81 Ga0070685_10000114 3300005466 Bacteria 51524
82 Ga0070685_10000437 3300005466 Bacteria 24303
83 Ga0070685_10032457 3300005466 Bacteria 2924
84 Ga0070685_10110372 3300005466 Bacteria 1693
85 Ga0070706_100002130 3300005467 Bacteria 20170
86 Ga0070706_100024697 3300005467 Bacteria 5533
87 Ga0070706_100051856 3300005467 Bacteria 3787
88 Ga0070706_100339049 3300005467 Bacteria 1401
89 Ga0070707_100005579 3300005468 Bacteria 11755
90 Ga0070707_100008372 3300005468 Bacteria 9603
91 Ga0070707_100009418 3300005468 Bacteria 9066
92 Ga0070707_100038877 3300005468 Bacteria 4546
93 Ga0070707_100154595 3300005468 Bacteria 2234
94 Ga0070698_100000231 3300005471 Bacteria 55183
95 Ga0070698_100002524 3300005471 Bacteria 20162
96 Ga0070698_100003478 3300005471 Bacteria 17336
97 Ga0070698_100036108 3300005471 Bacteria 5108
98 Ga0070699_100004142 3300005518 Bacteria 12813
99 Ga0070679_100321696 3300005530 Bacteria 1496
100 Ga0070684_100068355 3300005535 Bacteria 3122
101 Ga0070697_100087337 3300005536 Bacteria 2575
102 Ga0068853_100003312 3300005539 Bacteria 12323
103 Ga0068853_100068965 3300005539 Bacteria 3075
104 Ga0070672_100000018 3300005543 Bacteria 70205
105 Ga0070672_100151192 3300005543 Bacteria 1920
106 Ga0070686_100022148 3300005544 Bacteria 3782
107 Ga0070695_100022929 3300005545 Bacteria 3832
108 Ga0070695_100066903 3300005545 Bacteria 2342
109 Ga0070696_100001452 3300005546 Bacteria 15503
110 Ga0070696_100045297 3300005546 Bacteria 3048
111 Ga0070696_100139539 3300005546 Bacteria 1770
112 Ga0070693_100068640 3300005547 Bacteria 2081
113 Ga0070665_100019446 3300005548 Bacteria 6816
114 Ga0070704_100002458 3300005549 Bacteria 10400
115 Ga0070704_100036830 3300005549 Bacteria 3336
116 Ga0070704_100042140 3300005549 Bacteria 3156
117 Ga0070704_100176645 3300005549 Bacteria 1704
118 Ga0068855_100274719 3300005563 Bacteria 1873
119 Ga0070664_100003303 3300005564 Bacteria 13030
120 Ga0068854_100000044 3300005578 Bacteria 91882
121 Ga0068854_100001161 3300005578 Bacteria 15811
122 Ga0068854_100035498 3300005578 Bacteria 3489
123 Ga0068856_100000654 3300005614 Bacteria 37552
124 Ga0068856_100031615 3300005614 Bacteria 5180
125 Ga0068856_100130920 3300005614 Bacteria 2513
126 Ga0068856_100205034 3300005614 Bacteria 1986
127 Ga0070702_100002284 3300005615 Bacteria 8208
128 Ga0070702_100006065 3300005615 Bacteria 5693
129 Ga0070702_100031834 3300005615 Bacteria 2889
130 Ga0068852_100169033 3300005616 Bacteria 2048
131 Ga0068859_100004277 3300005617 Bacteria 14580
132 Ga0068859_100015441 3300005617 Bacteria 7670
133 Ga0068864_100039384 3300005618 Bacteria 4040
134 Ga0068864_100307216 3300005618 Bacteria 1486
135 Ga0068866_10003324 3300005718 Bacteria 6605
136 Ga0068861_100001255 3300005719 Bacteria 15831
137 Ga0068861_100011299 3300005719 Bacteria 6201
138 Ga0068851_10000922 3300005834 Bacteria 12681
139 Ga0068863_100082898 3300005841 Bacteria 3038
140 Ga0068863_100302269 3300005841 Bacteria 1552
141 Ga0068858_100003628 3300005842 Bacteria 15274
142 Ga0068858_100079405 3300005842 Bacteria 3049
143 Ga0068860_100003964 3300005843 Bacteria 15199
144 Ga0068860_100005857 3300005843 Bacteria 12371
145 Ga0068862_100006916 3300005844 Bacteria 9407
146 Ga0068862_100030058 3300005844 Bacteria 4578
147 Ga0068862_100069209 3300005844 Bacteria 3046
148 Ga0081455_10007980 3300005937 Bacteria 11069
149 Ga0081455_10053873 3300005937 Bacteria 3434
150 Ga0081538_10000068 3300005981 Bacteria 97659
151 Ga0081540_1000009 3300005983 Bacteria 193562
152 Ga0081540_1000740 3300005983 Bacteria 30077
153 Ga0070717_10002827 3300006028 Bacteria 12292
154 Ga0070717_10009210 3300006028 Bacteria 7421
155 Ga0070717_10049502 3300006028 Bacteria 3450
156 Ga0070717_10063501 3300006028 Bacteria 3065
157 Ga0070717_10378809 3300006028 Bacteria 1268
158 Ga0070715_10001613 3300006163 Bacteria 6655
159 Ga0070715_10041293 3300006163 Bacteria 1932
160 Ga0070716_100002864 3300006173 Bacteria 8037
161 Ga0070716_100021946 3300006173 Bacteria 3369
162 Ga0070716_100074708 3300006173 Bacteria 2004
163 Ga0070712_100004723 3300006175 Bacteria 8426
164 Ga0070712_100016409 3300006175 Bacteria 4784
165 Ga0070712_100018523 3300006175 Bacteria 4526
166 Ga0070712_100074536 3300006175 Bacteria 2438
167 Ga0070712_100294081 3300006175 Bacteria 1312
168 Ga0070712_100315471 3300006175 Bacteria 1270
169 Ga0070712_100330133 3300006175 Bacteria 1242
170 Ga0075369_10008808 3300006186 Bacteria 3897
171 Ga0097621_100111923 3300006237 Bacteria 2307
172 Ga0097621_100253752 3300006237 Bacteria 1541
173 Ga0075370_10150568 3300006353 Bacteria 1363
174 Ga0068871_100023983 3300006358 Bacteria 4727
175 Ga0068871_100052446 3300006358 Bacteria 3303
176 Ga0075433_10046997 3300006852 Bacteria 3754
177 Ga0075433_10130847 3300006852 Bacteria 2229
178 Ga0075433_10142060 3300006852 Bacteria 2134
179 Ga0068865_100000019 3300006881 Bacteria 105996
180 Ga0068865_100005261 3300006881 Bacteria 7825
181 Ga0075436_100057382 3300006914 Bacteria 2689
182 Ga0097620_100004277 3300006931 Bacteria 14580
183 Ga0097620_100015441 3300006931 Bacteria 7670
184 Ga0075435_100085874 3300007076 Bacteria 2590
185 Ga0099794_10037772 3300007265 Bacteria 2287
186 Ga0105251_10017754 3300009011 Bacteria 3804
187 Ga0105240_10034655 3300009093 Bacteria 6509
188 Ga0105240_10086989 3300009093 Bacteria 3828
189 Ga0111539_10070745 3300009094 Bacteria 4118
190 Ga0111539_10090382 3300009094 Bacteria 3598
191 Ga0105245_10000012 3300009098 Bacteria 267151
192 Ga0105245_10001816 3300009098 Bacteria 19416
193 Ga0105245_10021334 3300009098 Bacteria 5680
194 Ga0105245_10031998 3300009098 Bacteria 4656
195 Ga0105245_10089225 3300009098 Bacteria 2834
196 Ga0105245_10385799 3300009098 Bacteria 1396
197 Ga0105247_10009690 3300009101 Bacteria 5841
198 Ga0105247_10119690 3300009101 Bacteria 1705
199 Ga0114129_10004005 3300009147 Bacteria 20806
200 Ga0105243_10003858 3300009148 Bacteria 11974
201 Ga0105243_10087941 3300009148 Bacteria 2552
202 Ga0105243_10088705 3300009148 Bacteria 2541
203 Ga0105241_10124392 3300009174 Bacteria 2081
204 Ga0105242_10000325 3300009176 Bacteria 38289
205 Ga0105242_10144137 3300009176 Bacteria 2070
206 Ga0105248_10000267 3300009177 Bacteria 61244
207 Ga0105248_10054995 3300009177 Bacteria 4464
208 Ga0105248_10073625 3300009177 Bacteria 3839
209 Ga0105248_10156346 3300009177 Bacteria 2573
210 Ga0105248_10420112 3300009177 Bacteria 1506
211 Ga0105237_10024788 3300009545 Bacteria 6137
212 Ga0105238_10258866 3300009551 Bacteria 1719
213 Ga0105249_10014730 3300009553 Bacteria 6912
214 Ga0105249_10025516 3300009553 Bacteria 5321
215 Ga0105249_10157755 3300009553 Bacteria 2190
216 Ga0105249_10387431 3300009553 Bacteria 1425
217 Ga0105033_101725 3300009986 Bacteria 1801
218 Ga0105239_10016972 3300010375 Bacteria 8048
219 Ga0105239_10318484 3300010375 Bacteria 1753
220 Ga0105239_10482209 3300010375 Bacteria 1409
221 Ga0105239_10764756 3300010375 Bacteria 1106
222 Ga0105246_10012840 3300011119 Bacteria 5238
223 Ga0157342_1000392 3300012507 Bacteria 2582
224 Ga0157373_10145362 3300013100 Bacteria 1668
225 Ga0157370_10208486 3300013104 Bacteria 1812
226 Ga0157370_10334495 3300013104 Bacteria 1396
227 Ga0157369_10001010 3300013105 Bacteria 35439
228 Ga0157369_10222225 3300013105 Bacteria 1977
229 Ga0157374_10077156 3300013296 Bacteria 3152
230 Ga0157374_10435182 3300013296 Bacteria 1312
231 Ga0157378_10009698 3300013297 Bacteria 8386
232 Ga0157378_10128911 3300013297 Bacteria 2339
233 Ga0163162_10007124 3300013306 Bacteria 10851
234 Ga0163162_10019114 3300013306 Bacteria 6720
235 Ga0163162_10233978 3300013306 Bacteria 1968
236 Ga0157372_10000128 3300013307 Bacteria 82571
237 Ga0157372_10002534 3300013307 Bacteria 19823
238 Ga0157372_10070133 3300013307 Bacteria 3943
239 Ga0157375_10001489 3300013308 Bacteria 20109
240 Ga0157375_10018476 3300013308 Bacteria 6324
241 Ga0157375_10264421 3300013308 Bacteria 1882
242 Ga0157375_10420004 3300013308 Bacteria 1503
243 Ga0163163_10065823 3300014325 Bacteria 3598
244 Ga0163163_10108039 3300014325 Bacteria 2809
245 Ga0157380_10000009 3300014326 Bacteria 142155
246 Ga0157380_10002763 3300014326 Bacteria 11919
247 Ga0157377_10009168 3300014745 Bacteria 4846
248 Ga0157377_10062846 3300014745 Bacteria 2125
249 Ga0157379_10006987 3300014968 Bacteria 9759
250 Ga0157379_10009692 3300014968 Bacteria 8386
251 Ga0157379_10015635 3300014968 Bacteria 6666
252 Ga0157376_10034901 3300014969 Bacteria 4064
253 Ga0157376_10321902 3300014969 Bacteria 1470
254 Ga0163161_10002437 3300017792 Bacteria 13291
255 Ga0163161_10025836 3300017792 Bacteria 4158
256 Ga0197907_10255742 3300020069 Bacteria 2595
257 Ga0197907_11021319 3300020069 Bacteria 2087
258 Ga0206356_11118101 3300020070 Bacteria 2875
259 Ga0206350_11332138 3300020080 Bacteria 1677
260 Ga0213873_10000742 3300021358 Bacteria 5287
261 Ga0213876_10006294 3300021384 Bacteria 6466
262 Ga0213875_10007908 3300021388 Bacteria 5465
263 Ga0213875_10093865 3300021388 Bacteria 1399
264 Ga0224712_10004896 3300022467 Bacteria 3668
265 Ga0224712_10068449 3300022467 Bacteria 1435
266 Ga0209563_100088 3300025230 Bacteria 175375
267 Ga0209051_1044455 3300025303 Bacteria 1546
268 Ga0207656_10000153 3300025321 Bacteria 25555
269 Ga0207713_1048880 3300025735 Bacteria 1700
270 Ga0207653_10038162 3300025885 Bacteria 1569
271 Ga0207692_10000297 3300025898 Bacteria 17196
272 Ga0207692_10002263 3300025898 Bacteria 7378
273 Ga0207692_10046926 3300025898 Bacteria 2167
274 Ga0207710_10004469 3300025900 Bacteria 6101
275 Ga0207688_10026396 3300025901 Bacteria 3193
276 Ga0207647_10124002 3300025904 Bacteria 1522
277 Ga0207685_10001088 3300025905 Bacteria 5367
278 Ga0207685_10001777 3300025905 Bacteria 4691
279 Ga0207685_10029613 3300025905 Bacteria 1940
280 Ga0207685_10052613 3300025905 Bacteria 1578
281 Ga0207699_10054483 3300025906 Bacteria 2376
282 Ga0207684_10002157 3300025910 Bacteria 20173
283 Ga0207684_10013578 3300025910 Bacteria 7040
284 Ga0207684_10013721 3300025910 Bacteria 6998
285 Ga0207684_10020758 3300025910 Bacteria 5613
286 Ga0207707_10031073 3300025912 Bacteria 4672
287 Ga0207707_10089707 3300025912 Bacteria 2687
288 Ga0207695_10211133 3300025913 Bacteria 1852
289 Ga0207671_10052185 3300025914 Bacteria 3030
290 Ga0207693_10000882 3300025915 Bacteria 26867
291 Ga0207693_10000976 3300025915 Bacteria 25733
292 Ga0207693_10019671 3300025915 Bacteria 5369
293 Ga0207693_10041129 3300025915 Bacteria 3640
294 Ga0207693_10085318 3300025915 Bacteria 2474
295 Ga0207693_10110512 3300025915 Bacteria 2155
296 Ga0207693_10244588 3300025915 Bacteria 1408
297 Ga0207693_10466257 3300025915 Bacteria 987
298 Ga0207663_10001113 3300025916 Bacteria 12352
299 Ga0207663_10014740 3300025916 Bacteria 4292
300 Ga0207663_10016450 3300025916 Bacteria 4102
301 Ga0207660_10217684 3300025917 Bacteria 1497
302 Ga0207662_10177120 3300025918 Bacteria 1371
303 Ga0207657_10031018 3300025919 Bacteria 4846
304 Ga0207649_10000005 3300025920 Bacteria 356179
305 Ga0207652_10103749 3300025921 Bacteria 2514
306 Ga0207646_10024119 3300025922 Bacteria 5576
307 Ga0207646_10045626 3300025922 Bacteria 3934
308 Ga0207646_10055718 3300025922 Bacteria 3534
309 Ga0207681_10009903 3300025923 Bacteria 5832
310 Ga0207681_10118247 3300025923 Bacteria 1940
311 Ga0207650_10091591 3300025925 Bacteria 2324
312 Ga0207659_10000014 3300025926 Bacteria 168481
313 Ga0207659_10235998 3300025926 Bacteria 1477
314 Ga0207687_10000011 3300025927 Bacteria 388349
315 Ga0207687_10007446 3300025927 Bacteria 7206
316 Ga0207687_10038675 3300025927 Bacteria 3262
317 Ga0207687_10140722 3300025927 Bacteria 1830
318 Ga0207700_10000016 3300025928 Bacteria 202434
319 Ga0207700_10042632 3300025928 Bacteria 3328
320 Ga0207700_10053164 3300025928 Bacteria 3033
321 Ga0207700_10070458 3300025928 Bacteria 2688
322 Ga0207700_10092321 3300025928 Bacteria 2393
323 Ga0207700_10137796 3300025928 Bacteria 2001
324 Ga0207700_10386735 3300025928 Bacteria 1224
325 Ga0207664_10000495 3300025929 Bacteria 28038
326 Ga0207664_10033143 3300025929 Bacteria 3966
327 Ga0207664_10060418 3300025929 Bacteria 3020
328 Ga0207664_10121767 3300025929 Bacteria 2184
329 Ga0207664_10190867 3300025929 Bacteria 1763
330 Ga0207664_10363640 3300025929 Bacteria 1282
331 Ga0207664_10477170 3300025929 Bacteria 1115
332 Ga0207690_10015803 3300025932 Bacteria 4581
333 Ga0207690_10021359 3300025932 Bacteria 4014
334 Ga0207706_10000974 3300025933 Bacteria 29198
335 Ga0207686_10002796 3300025934 Bacteria 9449
336 Ga0207686_10031498 3300025934 Bacteria 3150
337 Ga0207709_10005737 3300025935 Bacteria 7012
338 Ga0207709_10057841 3300025935 Bacteria 2406
339 Ga0207670_10009403 3300025936 Bacteria 5579
340 Ga0207670_10034219 3300025936 Bacteria 3281
341 Ga0207704_10000009 3300025938 Bacteria 198266
342 Ga0207704_10226513 3300025938 Bacteria 1387
343 Ga0207665_10003803 3300025939 Bacteria 10083
344 Ga0207665_10008645 3300025939 Bacteria 6701
345 Ga0207665_10011749 3300025939 Bacteria 5755
346 Ga0207665_10271713 3300025939 Bacteria 1259
347 Ga0207691_10000121 3300025940 Bacteria 70558
348 Ga0207691_10068747 3300025940 Bacteria 3200
349 Ga0207711_10000024 3300025941 Bacteria 293596
350 Ga0207711_10071956 3300025941 Bacteria 3002
351 Ga0207711_10270200 3300025941 Bacteria 1564
352 Ga0207689_10030488 3300025942 Bacteria 4495
353 Ga0207689_10033846 3300025942 Bacteria 4245
354 Ga0207661_10000068 3300025944 Bacteria 70953
355 Ga0207661_10016099 3300025944 Bacteria 5512
356 Ga0207661_10205821 3300025944 Bacteria 1732
357 Ga0207679_10327555 3300025945 Bacteria 1328
358 Ga0207667_10234262 3300025949 Bacteria 1880
359 Ga0207667_10266684 3300025949 Bacteria 1751
360 Ga0207651_10262424 3300025960 Bacteria 1419
361 Ga0207712_10011404 3300025961 Bacteria 5663
362 Ga0207712_10043824 3300025961 Bacteria 3089
363 Ga0207668_10004668 3300025972 Bacteria 8061
364 Ga0207668_10013201 3300025972 Bacteria 5078
365 Ga0207668_10047103 3300025972 Bacteria 2951
366 Ga0207640_10000517 3300025981 Bacteria 23263
367 Ga0207640_10007221 3300025981 Bacteria 6126
368 Ga0207658_10000708 3300025986 Bacteria 28881
369 Ga0207658_10025320 3300025986 Bacteria 4154
370 Ga0207677_10000671 3300026023 Bacteria 20346
371 Ga0207677_10007576 3300026023 Bacteria 6022
372 Ga0207677_10154556 3300026023 Bacteria 1775
373 Ga0207703_10055569 3300026035 Bacteria 3221
374 Ga0207703_10094172 3300026035 Bacteria 2524
375 Ga0207703_10164249 3300026035 Bacteria 1947
376 Ga0207639_10017085 3300026041 Bacteria 5141
377 Ga0207678_10013696 3300026067 Bacteria 7123
378 Ga0207678_10027433 3300026067 Bacteria 4967
379 Ga0207708_10011118 3300026075 Bacteria 6694
380 Ga0207708_10022419 3300026075 Bacteria 4769
381 Ga0207708_10146618 3300026075 Bacteria 1855
382 Ga0207702_10000099 3300026078 Bacteria 100461
383 Ga0207702_10014292 3300026078 Bacteria 6591
384 Ga0207702_10122188 3300026078 Bacteria 2332
385 Ga0207702_10210684 3300026078 Bacteria 1807
386 Ga0207641_10068180 3300026088 Bacteria 3049
387 Ga0207641_10124906 3300026088 Bacteria 2302
388 Ga0207648_10002209 3300026089 Bacteria 21102
389 Ga0207676_10079234 3300026095 Bacteria 2663
390 Ga0207674_10059781 3300026116 Bacteria 3856
391 Ga0207674_10181029 3300026116 Bacteria 2059
392 Ga0207674_10492047 3300026116 Bacteria 1185
393 Ga0207675_100002728 3300026118 Bacteria 17389
394 Ga0207675_100003484 3300026118 Bacteria 15374
395 Ga0207675_100009266 3300026118 Bacteria 9232
396 Ga0207675_100129318 3300026118 Bacteria 2394
397 Ga0207683_10000557 3300026121 Bacteria 34447
398 Ga0207683_10000832 3300026121 Bacteria 28220
399 Ga0207683_10076606 3300026121 Bacteria 2961
400 Ga0207698_10035785 3300026142 Bacteria 3636
401 Ga0268266_10011831 3300028379 Bacteria 7561
402 Ga0268266_10128859 3300028379 Bacteria 2261
403 Ga0268266_10240837 3300028379 Bacteria 1669
404 Ga0268265_10002429 3300028380 Bacteria 14065
405 Ga0268265_10014382 3300028380 Bacteria 5392
406 Ga0268265_10036094 3300028380 Bacteria 3618
407 Ga0268264_10020629 3300028381 Bacteria 5383
408 Ga0265336_10017714 3300028666 Bacteria 2317
409 Ga0265338_10000743 3300028800 Bacteria 55581
410 Ga0307513_10014472 3300031456 Bacteria 9625
411 Ga0316575_10004917 3300031665 Bacteria 4724
412 Ga0316576_10009488 3300031727 Bacteria 6283
413 Ga0316576_10257501 3300031727 Bacteria 1309
414 Ga0316577_10011037 3300031733 Bacteria 4887
415 Ga0307416_100265125 3300032002 Bacteria 1682
416 Ga0373950_0001014 3300034818 Bacteria 3574
417 Ga0373926_0001758 3300035083 Bacteria 6724
418 Ga0373926_0004436 3300035083 Bacteria 4603
419 Ga0373926_0017855 3300035083 Bacteria 2437
420 Ga0373926_0020345 3300035083 Bacteria 2292
421 Ga0373926_0071266 3300035083 Bacteria 1277
422 Ga0373928_0004493 3300035084 Bacteria 2659
423 Ga0373929_0004745 3300035085 Bacteria 2437
424 Ga0373934_0000629 3300035086 Bacteria 12432
425 Ga0373934_0008756 3300035086 Bacteria 3778
426 Ga0373934_0018600 3300035086 Bacteria 2660
427 Ga0373934_0019023 3300035086 Bacteria 2633
428 Ga0373934_0033071 3300035086 Bacteria 2030
429 Ga0373944_0004052 3300035089 Bacteria 3797
430 Ga0373951_0005145 3300035091 Bacteria 3056
431 Ga0373923_0000272 3300035111 Bacteria 11329
432 Ga0373923_0035198 3300035111 Bacteria 2037
433 Ga0373923_0040755 3300035111 Bacteria 1912
434 Ga0373923_0212831 3300035111 Bacteria 896
435 Ga0373936_0000716 3300035113 Bacteria 11592
436 Ga0373936_0000918 3300035113 Bacteria 10522
437 Ga0373936_0015301 3300035113 Bacteria 2939
438 Ga0373936_0046082 3300035113 Bacteria 1757
439 Ga0373936_0111202 3300035113 Bacteria 1163
440 Ga0373945_0000124 3300035116 Bacteria 19016
441 Ga0373945_0000169 3300035116 Bacteria 17244
442 Ga0373945_0002456 3300035116 Bacteria 5817
443 Ga0373945_0026685 3300035116 Bacteria 2013
444 Ga0373953_0021007 3300035117 Bacteria 2445
445 Ga0373953_0025487 3300035117 Bacteria 2259
446 Ga0373954_0008891 3300035118 Bacteria 4420
447 Ga0373954_0027038 3300035118 Bacteria 2631
448 Ga0373954_0041769 3300035118 Bacteria 2139
449 Ga0373956_0000191 3300035119 Bacteria 23567
450 Ga0373956_0003979 3300035119 Bacteria 5938
451 Ga0373956_0035650 3300035119 Bacteria 2194
452 Ga0373957_0000550 3300035120 Bacteria 9517
453 Ga0373957_0002209 3300035120 Bacteria 5505
454 Ga0373957_0026216 3300035120 Bacteria 2106
455 Ga0373960_0009139 3300035121 Bacteria 2394
456 Ga0373943_0000064 3300035170 Bacteria 37284
457 Ga0373943_0008483 3300035170 Bacteria 4609
458 Ga0373943_0011403 3300035170 Bacteria 3999
459 Ga0373943_0043669 3300035170 Bacteria 2178
460 Ga0373946_0000149 3300035171 Bacteria 21381
461 Ga0373946_0000326 3300035171 Bacteria 15418
462 Ga0373946_0016738 3300035171 Bacteria 2796
463 Ga0373955_0000050 3300035172 Bacteria 45664
464 Ga0373955_0003540 3300035172 Bacteria 6873
465 Ga0373955_0004609 3300035172 Bacteria 6111
466 Ga0373955_0112163 3300035172 Bacteria 1577
467 Ga0316574_0004911 3300035398 Bacteria 7082
468 Ga0373924_0000037 3300035410 Bacteria 33504
469 Ga0373924_0014248 3300035410 Bacteria 3002
470 Ga0373924_0030687 3300035410 Bacteria 2156
471 Ga0373924_0069347 3300035410 Bacteria 1485
472 Ga0373931_0013437 3300035691 Bacteria 3986
473 Ga0373931_0235595 3300035691 Bacteria 1107
474 Ga0373935_0001258 3300035692 Bacteria 13997
475 Ga0373935_0021464 3300035692 Bacteria 3954
476 Ga0373935_0067950 3300035692 Bacteria 2292
477 Ga0373935_0075236 3300035692 Bacteria 2184
478 Ga0373935_0075656 3300035692 Bacteria 2178
479 Ga0373927_0001700 3300035695 Bacteria 16442
480 Ga0373927_0016572 3300035695 Bacteria 4860
481 Ga0373927_0034117 3300035695 Bacteria 3311
482 Ga0373927_0044293 3300035695 Bacteria 2879
483 Ga0373927_0124920 3300035695 Bacteria 1680
484 Ga0373933_0000149 3300035724 Bacteria 45676
485 Ga0373933_0003274 3300035724 Bacteria 9057
486 Ga0373933_0020277 3300035724 Bacteria 3767
487 Ga0373933_0020491 3300035724 Bacteria 3748
488 Ga0373933_0026835 3300035724 Bacteria 3311
489 Ga0373933_0072162 3300035724 Bacteria 2102
490 Ga0373933_0173855 3300035724 Bacteria 1371
491 Ga0373947_0000906 3300035725 Bacteria 17951
492 Ga0373947_0016202 3300035725 Bacteria 4285
493 Ga0373947_0066354 3300035725 Bacteria 2202
494 Ga0373947_0074142 3300035725 Bacteria 2093
495 Ga0373947_0187856 3300035725 Bacteria 1347
496 Ga0373937_0000319 3300036401 Bacteria 45685
497 Ga0373937_0000686 3300036401 Bacteria 29455
498 Ga0316582_0122288 3300036647 Bacteria 1742
499 Ga0316584_0004267 3300036712 Bacteria 9442
500 Ga0316584_0012190 3300036712 Bacteria 6059
501 Ga0373925_0018370 3300037068 Bacteria 5082
502 Ga0373925_0022837 3300037068 Bacteria 4564
503 Ga0373925_0175520 3300037068 Bacteria 1693
504 Ga0373925_0289620 3300037068 Bacteria 1320
505 Ga0373925_0323317 3300037068 Bacteria 1248
506 Ga0395898_0011622 3300037466 Bacteria 9138
507 Ga0436364_1080858 3300037853 Bacteria 3051
508 Ga0436364_1264688 3300037853 Bacteria 1592
509 Ga0395901_0225559 3300038443 Bacteria 1957
510 Ga0436365_1406444 3300039437 Bacteria 25793
511 Ga0436365_1629153 3300039437 Bacteria 1390
512 Ga0436365_1749326 3300039437 Bacteria 4296
513 Ga0436362_0578357 3300039453 Bacteria 15297
514 Ga0451802_0384859 3300041460 Bacteria 1747
515 Ga0439452_038862 3300042010 Bacteria 1128
516 Ga0466964_0045575 3300044706 Bacteria 1785
517 Ga0466970_0029327 3300044765 Bacteria 2896
518 Ga0466957_0112712 3300044842 Bacteria 1726
519 Ga0466960_0039009 3300044901 Bacteria 2238
520 Ga0466959_0045081 3300045049 Bacteria 3248
521 Ga0466958_0025987 3300045836 Bacteria 3457
522 Ga0466958_0142355 3300045836 Bacteria 1510
523 Ga0466967_0000123 3300045976 Bacteria 29223
524 Ga0466967_0026324 3300045976 Bacteria 4816
525 Ga0466967_0032936 3300045976 Bacteria 4382
526 Ga0466967_0042603 3300045976 Bacteria 3924
527 Ga0466967_0307967 3300045976 Bacteria 1525
528 Ga0495592_0000255 3300046454 Bacteria 45685
529 Ga0495592_0030140 3300046454 Bacteria 4103
530 Ga0495592_0039236 3300046454 Bacteria 3558
531 Ga0495592_0041517 3300046454 Bacteria 3447
532 Ga0495592_0045175 3300046454 Bacteria 3287
533 Ga0495603_0003038 3300046455 Bacteria 9945
534 Ga0495603_0022542 3300046455 Bacteria 3812
535 Ga0495629_0000377 3300046459 Bacteria 37247
536 Ga0495629_0002409 3300046459 Bacteria 14397
537 Ga0495629_0003497 3300046459 Bacteria 11884
538 Ga0495629_0034223 3300046459 Bacteria 3591
539 Ga0495629_0042946 3300046459 Bacteria 3175
540 Ga0495638_0003039 3300046460 Bacteria 13363
541 Ga0495638_0009577 3300046460 Bacteria 6784
542 Ga0495638_0021853 3300046460 Bacteria 4206
543 Ga0495641_0006016 3300046461 Bacteria 7987
544 Ga0495641_0006400 3300046461 Bacteria 7638
545 Ga0495641_0016629 3300046461 Bacteria 3866
546 Ga0495641_0021908 3300046461 Bacteria 3207
547 Ga0495641_0030310 3300046461 Bacteria 2596
548 Ga0495641_0044539 3300046461 Bacteria 2046
549 Ga0495651_0000199 3300046462 Bacteria 45685
550 Ga0495651_0001591 3300046462 Bacteria 17556
551 Ga0495651_0017370 3300046462 Bacteria 5572
552 Ga0495651_0046737 3300046462 Bacteria 3349
553 Ga0495651_0070134 3300046462 Bacteria 2667
554 Ga0495653_0003175 3300046463 Bacteria 13165
555 Ga0495653_0014635 3300046463 Bacteria 6400
556 Ga0495653_0016440 3300046463 Bacteria 6025
557 Ga0495653_0022138 3300046463 Bacteria 5143
558 Ga0495653_0031203 3300046463 Bacteria 4237
559 Ga0495653_0148026 3300046463 Bacteria 1643
560 Ga0495580_0002596 3300046472 Bacteria 15708
561 Ga0495580_0015371 3300046472 Bacteria 5774
562 Ga0495580_0053162 3300046472 Bacteria 2859
563 Ga0495580_0188230 3300046472 Bacteria 1424
564 Ga0495582_0000730 3300046473 Bacteria 18129
565 Ga0495582_0012628 3300046473 Bacteria 4657
566 Ga0495582_0051155 3300046473 Bacteria 2277
567 Ga0495639_0000935 3300046475 Bacteria 13201
568 Ga0495639_0007453 3300046475 Bacteria 4696
569 Ga0495639_0019139 3300046475 Bacteria 2987
570 Ga0495639_0022336 3300046475 Bacteria 2775
571 Ga0495662_0007677 3300046476 Bacteria 5316
572 Ga0495662_0010492 3300046476 Bacteria 4534
573 Ga0495662_0026802 3300046476 Bacteria 2783
574 Ga0495662_0027018 3300046476 Bacteria 2772
575 Ga0495664_0001131 3300046477 Bacteria 13835
576 Ga0495664_0102303 3300046477 Bacteria 1726
577 Ga0495664_0129065 3300046477 Bacteria 1530
578 Ga0495594_0046808 3300046499 Bacteria 2375
579 Ga0495594_0178601 3300046499 Bacteria 1208
580 Ga0495606_0000294 3300046507 Bacteria 85998
581 Ga0495606_0004323 3300046507 Bacteria 14291
582 Ga0495608_0000010 3300046511 Bacteria 258660
583 Ga0495608_0000499 3300046511 Bacteria 27122
584 Ga0495608_0004767 3300046511 Bacteria 9702
585 Ga0495608_0035640 3300046511 Bacteria 3354
586 Ga0495608_0065349 3300046511 Bacteria 2382
587 Ga0495618_0008665 3300046514 Bacteria 6147
588 Ga0495618_0011052 3300046514 Bacteria 5472
589 Ga0495618_0042134 3300046514 Bacteria 2877
590 Ga0495618_0123121 3300046514 Bacteria 1660
591 Ga0495618_0193745 3300046514 Bacteria 1288
592 Ga0495628_0000282 3300046516 Bacteria 45645
593 Ga0495628_0107238 3300046516 Bacteria 2151
594 Ga0495628_0120706 3300046516 Bacteria 2011
595 Ga0495630_0000011 3300046517 Bacteria 232063
596 Ga0495630_0018874 3300046517 Bacteria 5068
597 Ga0495630_0029722 3300046517 Bacteria 4062
598 Ga0495630_0041672 3300046517 Bacteria 3429
599 Ga0495630_0054071 3300046517 Bacteria 3007
600 Ga0495632_0060129 3300046519 Bacteria 1847
601 Ga0495643_0003383 3300046522 Bacteria 11733
602 Ga0495644_0044766 3300046523 Bacteria 1665
603 Ga0495648_0027978 3300046524 Bacteria 3764
604 Ga0495666_0004831 3300046526 Bacteria 6810
605 Ga0495666_0016851 3300046526 Bacteria 3638
606 Ga0495652_0001352 3300046529 Bacteria 27313
607 Ga0495652_0023245 3300046529 Bacteria 5496
608 Ga0495652_0087975 3300046529 Bacteria 2546
609 Ga0495652_0097219 3300046529 Bacteria 2395
610 Ga0495652_0200777 3300046529 Bacteria 1513
611 Ga0495652_0212244 3300046529 Bacteria 1460
612 Ga0495665_0003232 3300046531 Bacteria 8815
613 Ga0495665_0013243 3300046531 Bacteria 4460
614 Ga0495665_0019544 3300046531 Bacteria 3643
615 Ga0495665_0024755 3300046531 Bacteria 3224
616 Ga0495665_0049028 3300046531 Bacteria 2239
617 Ga0495665_0109981 3300046531 Bacteria 1445
618 Ga0495640_0012108 3300046533 Bacteria 6607
619 Ga0495640_0013029 3300046533 Bacteria 6333
620 Ga0495640_0036069 3300046533 Bacteria 3495
621 Ga0495640_0055712 3300046533 Bacteria 2704
622 Ga0495640_0058215 3300046533 Bacteria 2636
623 Ga0495586_0002011 3300046535 Bacteria 11035
624 Ga0495586_0012080 3300046535 Bacteria 4586
625 Ga0495586_0050941 3300046535 Bacteria 2240
626 Ga0495586_0121606 3300046535 Bacteria 1459
627 Ga0495587_0000189 3300046536 Bacteria 45681
628 Ga0495587_0010133 3300046536 Bacteria 6012
629 Ga0495587_0022593 3300046536 Bacteria 3872
630 Ga0495587_0050750 3300046536 Bacteria 2454
631 Ga0495645_0018972 3300046543 Bacteria 4948
632 Ga0495645_0026413 3300046543 Bacteria 4215
633 Ga0495645_0056664 3300046543 Bacteria 2845
634 Ga0495645_0080182 3300046543 Bacteria 2343
635 Ga0495645_0115768 3300046543 Bacteria 1893
636 Ga0495645_0167300 3300046543 Bacteria 1515
637 Ga0495667_0000136 3300046559 Bacteria 50731
638 Ga0495667_0009068 3300046559 Bacteria 6757
639 Ga0495667_0026481 3300046559 Bacteria 3908
640 Ga0495667_0036661 3300046559 Bacteria 3271
641 Ga0495667_0065583 3300046559 Bacteria 2375
642 Ga0495667_0130427 3300046559 Bacteria 1621
643 Ga0495667_0150710 3300046559 Bacteria 1497
644 Ga0495634_0009897 3300046642 Bacteria 7007
645 Ga0495634_0027996 3300046642 Bacteria 3915
646 Ga0495634_0035770 3300046642 Bacteria 3399
647 Ga0495634_0039571 3300046642 Bacteria 3210
648 Ga0495634_0047766 3300046642 Bacteria 2883
649 Ga0495634_0067261 3300046642 Bacteria 2370
650 Ga0495634_0121004 3300046642 Bacteria 1676
651 Ga0495634_0183868 3300046642 Bacteria 1307
652 Ga0495625_0008112 3300046660 Bacteria 9000
653 Ga0495625_0256172 3300046660 Bacteria 1134
654 Ga0495635_0000124 3300046663 Bacteria 46888
655 Ga0495635_0003210 3300046663 Bacteria 11269
656 Ga0495635_0006536 3300046663 Bacteria 8135
657 Ga0495635_0010617 3300046663 Bacteria 6446
658 Ga0495635_0017321 3300046663 Bacteria 5033
659 Ga0495635_0136350 3300046663 Bacteria 1672
660 Ga0495588_0000218 3300046674 Bacteria 54328
661 Ga0495588_0001492 3300046674 Bacteria 10033
662 Ga0495657_0000005 3300046675 Bacteria 254860
663 Ga0495657_0000290 3300046675 Bacteria 45685
664 Ga0495657_0016245 3300046675 Bacteria 5426
665 Ga0495657_0038600 3300046675 Bacteria 3285
666 Ga0495657_0053587 3300046675 Bacteria 2698
667 Ga0495657_0073927 3300046675 Bacteria 2218
668 Ga0495599_0000282 3300046678 Bacteria 31243
669 Ga0495599_0027822 3300046678 Bacteria 3542
670 Ga0495599_0053165 3300046678 Bacteria 2537
671 Ga0495599_0070865 3300046678 Bacteria 2175
672 Ga0495623_0000368 3300046679 Bacteria 29559
673 Ga0495623_0036513 3300046679 Bacteria 3147
674 Ga0495623_0058226 3300046679 Bacteria 2429
675 Ga0495646_0014864 3300046680 Bacteria 4944
676 Ga0495646_0018156 3300046680 Bacteria 4455
677 Ga0495646_0024999 3300046680 Bacteria 3758
678 Ga0495646_0047465 3300046680 Bacteria 2613
679 Ga0495646_0184086 3300046680 Bacteria 1145
680 Ga0495647_0000111 3300046681 Bacteria 20557
681 Ga0495647_0012514 3300046681 Bacteria 2923
682 Ga0495647_0023204 3300046681 Bacteria 2248
683 Ga0495658_0000965 3300046683 Bacteria 15281
684 Ga0495658_0002269 3300046683 Bacteria 9714
685 Ga0495658_0034678 3300046683 Bacteria 2770
686 Ga0495658_0126095 3300046683 Bacteria 1553
687 Ga0495613_0000131 3300046689 Bacteria 74262
688 Ga0495613_0019246 3300046689 Bacteria 5090
689 Ga0495613_0019940 3300046689 Bacteria 4998
690 Ga0495613_0028981 3300046689 Bacteria 4116
691 Ga0495624_0000455 3300046690 Bacteria 32215
692 Ga0495624_0007084 3300046690 Bacteria 7895
693 Ga0495624_0014987 3300046690 Bacteria 5250
694 Ga0495624_0025562 3300046690 Bacteria 3875
695 Ga0495624_0042139 3300046690 Bacteria 2917
696 Ga0495624_0123243 3300046690 Bacteria 1591
697 Ga0495670_0011360 3300046691 Bacteria 4378
698 Ga0495649_0022100 3300046694 Bacteria 3561
699 Ga0495600_0002942 3300046809 Bacteria 9928
700 Ga0495600_0008634 3300046809 Bacteria 6266
701 Ga0495600_0020345 3300046809 Bacteria 4245
702 Ga0495600_0033112 3300046809 Bacteria 3354
703 Ga0495600_0036276 3300046809 Bacteria 3204
704 Ga0495600_0050961 3300046809 Bacteria 2701
705 Ga0495581_0005558 3300047315 Bacteria 7304
706 Ga0495581_0024613 3300047315 Bacteria 3489
707 Ga0495581_0038893 3300047315 Bacteria 2754
708 Ga0495581_0039162 3300047315 Bacteria 2743
709 Ga0495581_0041225 3300047315 Bacteria 2671
710 Ga0495604_0000078 3300047317 Bacteria 83632
711 Ga0495604_0000280 3300047317 Bacteria 45685
712 Ga0495604_0024326 3300047317 Bacteria 4830
713 Ga0495604_0035697 3300047317 Bacteria 3924
714 Ga0495604_0036151 3300047317 Bacteria 3895
715 Ga0495604_0065678 3300047317 Bacteria 2761
716 Ga0495674_0000063 3300047319 Bacteria 71737
717 Ga0495674_0000405 3300047319 Bacteria 38766
718 Ga0495674_0015523 3300047319 Bacteria 7116
719 Ga0495674_0029627 3300047319 Bacteria 4982
720 Ga0495674_0052205 3300047319 Bacteria 3599
721 Ga0495674_0055126 3300047319 Bacteria 3487
722 Ga0495674_0106405 3300047319 Bacteria 2382
723 Ga0495674_0169564 3300047319 Bacteria 1822
724 Ga0495672_0023757 3300047320 Bacteria 3961
725 Ga0495676_0015559 3300047321 Bacteria 6769
726 Ga0495676_0028446 3300047321 Bacteria 4772
727 Ga0495676_0045718 3300047321 Bacteria 3560
728 Ga0495676_0073273 3300047321 Bacteria 2626
729 Ga0495676_0088268 3300047321 Bacteria 2326
730 Ga0495676_0119364 3300047321 Bacteria 1921
731 Ga0495676_0248131 3300047321 Bacteria 1215
732 Ga0495680_0000430 3300047322 Bacteria 47076
733 Ga0495680_0004034 3300047322 Bacteria 14169
734 Ga0495680_0005228 3300047322 Bacteria 12252
735 Ga0495680_0008764 3300047322 Bacteria 9163
736 Ga0495680_0013885 3300047322 Bacteria 7007
737 Ga0495680_0098296 3300047322 Bacteria 2184
738 Ga0495680_0171514 3300047322 Bacteria 1570
739 Ga0495675_0000004 3300047444 Bacteria 211049
740 Ga0495675_0002808 3300047444 Bacteria 10433
741 Ga0495675_0014801 3300047444 Bacteria 4933
742 Ga0495675_0015192 3300047444 Bacteria 4868
743 Ga0495675_0020477 3300047444 Bacteria 4207
744 Ga0495684_0004452 3300047471 Bacteria 10950
745 Ga0495684_0018973 3300047471 Bacteria 5295
746 Ga0495684_0020434 3300047471 Bacteria 5103
747 Ga0495684_0049220 3300047471 Bacteria 3220
748 Ga0495684_0062945 3300047471 Bacteria 2821
749 Ga0495684_0076194 3300047471 Bacteria 2547
750 Ga0495686_0001014 3300047472 Bacteria 33997
751 Ga0495686_0055601 3300047472 Bacteria 2474
752 Ga0495593_0011015 3300047673 Bacteria 5205
753 Ga0495593_0016581 3300047673 Bacteria 4153
754 Ga0495593_0024417 3300047673 Bacteria 3350
755 Ga0495593_0050660 3300047673 Bacteria 2199
756 Ga0495593_0062139 3300047673 Bacteria 1952
757 Ga0495593_0079250 3300047673 Bacteria 1700
758 Ga0495602_0000009 3300048088 Bacteria 258991
759 Ga0495602_0000297 3300048088 Bacteria 45689
760 Ga0495602_0042892 3300048088 Bacteria 4117
761 Ga0495602_0139758 3300048088 Bacteria 1918
762 Ga0495602_0195445 3300048088 Bacteria 1547
763 Ga0495614_0020759 3300048089 Bacteria 2838
764 Ga0495614_0023298 3300048089 Bacteria 2671
765 Ga0495614_0035644 3300048089 Bacteria 2137
766 Ga0496100_0040807 3300048903 Bacteria 2955
767 Ga0496100_0077534 3300048903 Bacteria 2234
768 Ga0496101_0005422 3300048904 Bacteria 8125
769 Ga0496102_0005112 3300048905 Bacteria 11115
770 Ga0496102_0046003 3300048905 Bacteria 3963
771 Ga0496102_0067777 3300048905 Bacteria 3274
772 Ga0496103_0001480 3300048906 Bacteria 15703
773 Ga0496103_0024665 3300048906 Bacteria 3629
774 Ga0496104_0076412 3300048907 Bacteria 3190
775 Ga0496104_0077895 3300048907 Bacteria 3158
776 Ga0496104_0102693 3300048907 Bacteria 2738
777 Ga0496105_0010084 3300048908 Bacteria 7416
778 Ga0496105_0091586 3300048908 Bacteria 2510
779 Ga0496106_0002660 3300048909 Bacteria 13295
780 Ga0496106_0076366 3300048909 Bacteria 2568
781 Ga0496106_0090074 3300048909 Bacteria 2367
782 Ga0496106_0125955 3300048909 Bacteria 2005
783 Ga0496107_0001604 3300048910 Bacteria 14080
784 Ga0496107_0037662 3300048910 Bacteria 3471
785 Ga0496107_0194935 3300048910 Bacteria 1505
786 Ga0496108_0000012 3300048911 Bacteria 258433
787 Ga0496108_0002885 3300048911 Bacteria 13794
788 Ga0496108_0060977 3300048911 Bacteria 3174
789 Ga0496109_0000076 3300048912 Bacteria 104273
790 Ga0496109_0020426 3300048912 Bacteria 5850
791 Ga0496109_0032385 3300048912 Bacteria 4699
792 Ga0496109_0045125 3300048912 Bacteria 3999
793 Ga0496109_0416206 3300048912 Bacteria 1270
794 Ga0496110_0000015 3300048913 Bacteria 85373
795 Ga0496110_0016082 3300048913 Bacteria 6239
796 Ga0496110_0024029 3300048913 Bacteria 5192
797 Ga0496110_0033575 3300048913 Bacteria 4440
798 Ga0496110_0055285 3300048913 Bacteria 3492
799 Ga0496111_0000001 3300048914 Bacteria 194837
800 Ga0496111_0004168 3300048914 Bacteria 9098
801 Ga0496111_0029999 3300048914 Bacteria 3865
802 Ga0496111_0055218 3300048914 Bacteria 2872
803 Ga0496111_0325613 3300048914 Bacteria 1138
804 Ga0496111_0347667 3300048914 Bacteria 1098
805 Ga0496112_0000250 3300048915 Bacteria 34271
806 Ga0496112_0012300 3300048915 Bacteria 7859
807 Ga0496112_0027878 3300048915 Bacteria 5448
808 Ga0496112_0157464 3300048915 Bacteria 2238
809 Ga0496113_0000039 3300048916 Bacteria 55926
810 Ga0496113_0035974 3300048916 Bacteria 3626
811 Ga0496113_0139704 3300048916 Bacteria 1905
812 Ga0496114_0002063 3300048917 Bacteria 15300
813 Ga0496114_0022716 3300048917 Bacteria 5113
814 Ga0496114_0054616 3300048917 Bacteria 3331
815 Ga0496115_0007251 3300048918 Bacteria 8148
816 Ga0496115_0046554 3300048918 Bacteria 3467
817 Ga0496119_0000011 3300048922 Bacteria 438315
818 Ga0496120_0000206 3300048923 Bacteria 101409
819 Ga0496121_0019494 3300048924 Bacteria 6777
820 Ga0496121_0184873 3300048924 Bacteria 1500
821 Ga0496125_0140916 3300048928 Bacteria 1677
822 Ga0496126_0196052 3300048929 Bacteria 1708
823 Ga0495682_0000276 3300049460 Bacteria 40134
824 Ga0501032_0200611 3300049569 Bacteria 1302
825 Ga0501033_0002379 3300049570 Bacteria 16017
826 Ga0501033_0057489 3300049570 Bacteria 2875
827 Ga0501034_0009939 3300049571 Bacteria 9944
828 Ga0501034_0098775 3300049571 Bacteria 2914
829 Ga0501036_0000429 3300049572 Bacteria 29860
830 Ga0501036_0011601 3300049572 Bacteria 7300
831 Ga0501036_0054089 3300049572 Bacteria 3399
832 Ga0501036_0163426 3300049572 Bacteria 1877
833 Ga0501038_0023598 3300049574 Bacteria 5497
834 Ga0501038_0059052 3300049574 Bacteria 3286
835 Ga0501038_0117145 3300049574 Bacteria 2200
836 Ga0501039_0045543 3300049575 Bacteria 3389
837 Ga0501042_0002245 3300049578 Bacteria 11787
838 Ga0501042_0033126 3300049578 Bacteria 3662
839 Ga0501043_0130156 3300049579 Bacteria 1972
840 Ga0501043_0270622 3300049579 Bacteria 1304
841 Ga0501046_0098084 3300049580 Bacteria 2250
842 Ga0501046_0139159 3300049580 Bacteria 1838
843 Ga0501046_0239454 3300049580 Bacteria 1338
844 Ga0501047_0003786 3300049581 Bacteria 14243
845 Ga0501048_0000726 3300049582 Bacteria 24134
846 Ga0501048_0036936 3300049582 Bacteria 3509
847 Ga0501048_0214231 3300049582 Bacteria 1366
848 Ga0501067_0001837 3300049583 Bacteria 11675
849 Ga0501067_0005707 3300049583 Bacteria 6908
850 Ga0501068_0007750 3300049584 Bacteria 5946
851 Ga0501069_0002284 3300049585 Bacteria 9682
852 Ga0501069_0004484 3300049585 Bacteria 7213
853 Ga0501069_0009014 3300049585 Bacteria 5264
854 Ga0501070_0012978 3300049586 Bacteria 7022
855 Ga0501070_0073483 3300049586 Bacteria 2829
856 Ga0501070_0086972 3300049586 Bacteria 2587
857 Ga0501070_0180811 3300049586 Bacteria 1735
858 Ga0501071_0041093 3300049587 Bacteria 3311
859 Ga0501072_0068519 3300049588 Bacteria 2801
860 Ga0501072_0535164 3300049588 Bacteria 926
861 Ga0501073_0007634 3300049589 Bacteria 8029
862 Ga0501073_0055955 3300049589 Bacteria 2760
863 Ga0501074_0050626 3300049590 Bacteria 2998
864 Ga0501074_0095274 3300049590 Bacteria 2131
865 Ga0501083_0031749 3300049744 Bacteria 3625
866 Ga0501035_0008036 3300049822 Bacteria 9832
867 Ga0501035_0009228 3300049822 Bacteria 9172
868 Ga0501035_0092029 3300049822 Bacteria 2668
869 Ga0501044_0013019 3300049823 Bacteria 9002
870 Ga0501044_0057572 3300049823 Bacteria 3988
871 Ga0501044_0155601 3300049823 Bacteria 2265
872 Ga0501045_0005678 3300049824 Bacteria 8635
873 Ga0501045_0127329 3300049824 Bacteria 1892
874 nmdc:mga06z11_126144_c1 3300050494 Bacteria 1432
875 nmdc:mga07m45_16415_c1 3300050496 Bacteria 3964
876 nmdc:mga05p37_5558_c1 3300050507 Bacteria 14820
877 nmdc:mga08y16_51567_c2 3300050511 Bacteria 3629
878 nmdc:mga0n895_111424_c1 3300050512 Bacteria 2753
879 nmdc:mga0n895_43025_c1 3300050512 Bacteria 4399
880 nmdc:mga0rr50_137511_c1 3300050513 Bacteria 1963
881 nmdc:mga08x19_166694_c1 3300050514 Bacteria 1498
882 nmdc:mga0a205_157901_c1 3300050515 Bacteria 2166
883 Ga0495601_0000042 3300053077 Bacteria 77373
884 Ga0495601_0011568 3300053077 Bacteria 5286
885 Ga0495601_0039241 3300053077 Bacteria 2965
886 Ga0495601_0042188 3300053077 Bacteria 2861
887 Ga0495601_0053560 3300053077 Bacteria 2550
888 Ga0495601_0098668 3300053077 Bacteria 1885
889 Ga0495612_0003776 3300053078 Bacteria 6301
890 Ga0495612_0013108 3300053078 Bacteria 3338
891 Ga0495612_0013937 3300053078 Bacteria 3239
892 Ga0495595_0000005 3300053084 Bacteria 258660
893 Ga0495595_0002052 3300053084 Bacteria 7836
894 Ga0495595_0021151 3300053084 Bacteria 2839
895 Ga0495595_0053821 3300053084 Bacteria 1870
896 Ga0495595_0092079 3300053084 Bacteria 1455
897 Ga0495595_0102050 3300053084 Bacteria 1386
898 Ga0495619_0000040 3300053085 Bacteria 118238
899 Ga0495619_0000126 3300053085 Bacteria 56169
900 Ga0495619_0007828 3300053085 Bacteria 6762
901 Ga0495619_0008414 3300053085 Bacteria 6525
902 Ga0495619_0040351 3300053085 Bacteria 3052
903 Ga0495619_0046481 3300053085 Bacteria 2854
904 Ga0500641_0002279 3300053096 Bacteria 6808
905 Ga0500650_0056890 3300053098 Bacteria 1823
906 Ga0500593_000783 3300053117 Bacteria 11865
907 Ga0500608_047987 3300053122 Bacteria 2052
908 Ga0500608_108312 3300053122 Bacteria 1277
909 Ga0500568_0000002 3300053139 Bacteria 880601
910 Ga0500588_0053691 3300053146 Bacteria 1267
911 Ga0500645_000054 3300053730 Bacteria 93914
912 Ga0501084_0030294 3300054114 Bacteria 4526
913 Ga0501084_0049833 3300054114 Bacteria 3505
914 Ga0501082_0028798 3300060353 Bacteria 4784

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053122 Ga0500608_108312 Ga0500608_108312_407_1243 256
2 3300049588 Ga0501072_0535164 Ga0501072_0535164_15_830 268
3 3300005436 Ga0070713_100000246 Ga0070713_1000002462 278
4 3300006028 Ga0070717_10002827 Ga0070717_100028272 278
5 3300006175 Ga0070712_100018523 Ga0070712_1000185235 278
6 3300025915 Ga0207693_10110512 Ga0207693_101105121 278
7 3300025928 Ga0207700_10042632 Ga0207700_100426323 278
8 3300025929 Ga0207664_10060418 Ga0207664_100604184 278
9 3300010375 Ga0105239_10764756 Ga0105239_107647561 287
10 3300013100 Ga0157373_10145362 Ga0157373_101453622 287
11 3300035111 Ga0373923_0212831 Ga0373923_0212831_16_885 287
12 3300025906 Ga0207699_10054483 Ga0207699_100544832 294
13 3300025915 Ga0207693_10466257 Ga0207693_104662571 294
14 3300014969 Ga0157376_10321902 Ga0157376_103219022 296
15 3300031665 Ga0316575_10004917 Ga0316575_100049172 297
16 3300046499 Ga0495594_0178601 Ga0495594_0178601_253_1155 297
17 3300021358 Ga0213873_10000742 Ga0213873_100007425 307
18 3300039437 Ga0436365_1749326 Ga0436365_1749326_212_1306 307
19 3300039453 Ga0436362_0578357 Ga0436362_0578357_4744_5838 307
20 3300044842 Ga0466957_0112712 Ga0466957_0112712_617_1630 308
21 3300045836 Ga0466958_0142355 Ga0466958_0142355_36_1049 308
22 3300046516 Ga0495628_0120706 Ga0495628_0120706_16_948 309
23 3300009093 Ga0105240_10034655 Ga0105240_100346555 314
24 3300005455 Ga0070663_100437850 Ga0070663_1004378501 316
25 3300005530 Ga0070679_100321696 Ga0070679_1003216962 316
26 3300031727 Ga0316576_10009488 Ga0316576_100094885 316
27 3300035083 Ga0373926_0071266 Ga0373926_0071266_18_971 316
28 3300046461 Ga0495641_0021908 Ga0495641_0021908_19_972 316
29 3300046507 Ga0495606_0004323 Ga0495606_0004323_1397_2425 316
30 3300047472 Ga0495686_0001014 Ga0495686_0001014_12193_13221 316
31 3300047472 Ga0495686_0055601 Ga0495686_0055601_1019_2044 316
32 3300048924 Ga0496121_0019494 Ga0496121_0019494_2174_3202 316
33 3300048928 Ga0496125_0140916 Ga0496125_0140916_63_1091 316
34 3300049569 Ga0501032_0200611 Ga0501032_0200611_56_1030 316
35 3300049579 Ga0501043_0130156 Ga0501043_0130156_571_1545 316
36 3300049580 Ga0501046_0139159 Ga0501046_0139159_299_1273 316
37 3300049581 Ga0501047_0003786 Ga0501047_0003786_9530_10504 316
38 3300049586 Ga0501070_0012978 Ga0501070_0012978_3719_4693 316
39 3300049589 Ga0501073_0055955 Ga0501073_0055955_1717_2691 316
40 3300049822 Ga0501035_0008036 Ga0501035_0008036_6386_7360 316
41 3300049823 Ga0501044_0013019 Ga0501044_0013019_6789_7763 316
42 3300003781 Ga0055536_1024561 Ga0055536_10245611 318
43 3300013307 Ga0157372_10070133 Ga0157372_100701333 318
44 3300048922 Ga0496119_0000011 Ga0496119_0000011_330040_331023 318
45 3300048923 Ga0496120_0000206 Ga0496120_0000206_73698_74681 318
46 3300049460 Ga0495682_0000276 Ga0495682_0000276_30914_31891 318
47 3300053117 Ga0500593_000783 Ga0500593_000783_6695_7693 318
48 3300053139 Ga0500568_0000002 Ga0500568_0000002_284514_285512 318
49 iso_pu_bacteria 2919155634 2919157199 318
50 iso_pu_bacteria 3007872151 3007875097 318
51 iso_pu_bacteria 8056137416 8056139468 318
52 3300035695 Ga0373927_0124920 Ga0373927_0124920_606_1640 319
53 3300035725 Ga0373947_0074142 Ga0373947_0074142_1008_2042 319
54 3300047321 Ga0495676_0073273 Ga0495676_0073273_1184_2188 319
55 3300005436 Ga0070713_100000061 Ga0070713_10000006141 320
56 3300005578 Ga0068854_100000044 Ga0068854_10000004437 320
57 3300025928 Ga0207700_10000016 Ga0207700_10000016117 320
58 3300025981 Ga0207640_10000517 Ga0207640_100005173 320
59 3300005434 Ga0070709_10096587 Ga0070709_100965872 321
60 3300005437 Ga0070710_10114119 Ga0070710_101141192 321
61 3300005439 Ga0070711_100052841 Ga0070711_1000528412 321
62 3300005445 Ga0070708_100039880 Ga0070708_1000398802 321
63 3300006175 Ga0070712_100074536 Ga0070712_1000745362 321
64 3300025915 Ga0207693_10085318 Ga0207693_100853182 321
65 3300025916 Ga0207663_10014740 Ga0207663_100147403 321
66 3300026075 Ga0207708_10146618 Ga0207708_101466182 321
67 3300035724 Ga0373933_0026835 Ga0373933_0026835_2261_3289 321
68 3300046462 Ga0495651_0070134 Ga0495651_0070134_1453_2481 321
69 3300046514 Ga0495618_0193745 Ga0495618_0193745_77_1105 321
70 3300046642 Ga0495634_0047766 Ga0495634_0047766_1786_2814 321
71 3300046809 Ga0495600_0036276 Ga0495600_0036276_2098_3126 321
72 3300048913 Ga0496110_0016082 Ga0496110_0016082_776_1750 321
73 3300053084 Ga0495595_0102050 Ga0495595_0102050_213_1241 321
74 3300053085 Ga0495619_0040351 Ga0495619_0040351_1304_2332 321
75 3300049582 Ga0501048_0214231 Ga0501048_0214231_333_1328 323
76 3300049824 Ga0501045_0005678 Ga0501045_0005678_1561_2544 324
77 3300005981 Ga0081538_10000068 Ga0081538_1000006824 325
78 3300009148 Ga0105243_10088705 Ga0105243_100887052 325
79 3300009986 Ga0105033_101725 Ga0105033_1017252 325
80 3300013308 Ga0157375_10420004 Ga0157375_104200041 325
81 3300036712 Ga0316584_0004267 Ga0316584_0004267_5351_6364 325
82 3300041460 Ga0451802_0384859 Ga0451802_0384859_507_1502 325
83 3300046459 Ga0495629_0000377 Ga0495629_0000377_12637_13623 325
84 3300046461 Ga0495641_0006400 Ga0495641_0006400_1520_2506 325
85 3300046507 Ga0495606_0000294 Ga0495606_0000294_24190_25176 325
86 3300046517 Ga0495630_0000011 Ga0495630_0000011_23743_24729 325
87 3300046690 Ga0495624_0000455 Ga0495624_0000455_31153_32139 325
88 3300047673 Ga0495593_0079250 Ga0495593_0079250_531_1517 325
89 3300049578 Ga0501042_0033126 Ga0501042_0033126_26_1033 325
90 3300053078 Ga0495612_0003776 Ga0495612_0003776_185_1171 325
91 3300005347 Ga0070668_100002229 Ga0070668_1000022298 326
92 3300005356 Ga0070674_100008015 Ga0070674_1000080155 326
93 3300005367 Ga0070667_100002459 Ga0070667_1000024594 326
94 3300005437 Ga0070710_10003126 Ga0070710_100031261 326
95 3300005438 Ga0070701_10004227 Ga0070701_100042273 326
96 3300005439 Ga0070711_100001099 Ga0070711_10000109913 326
97 3300005444 Ga0070694_100003172 Ga0070694_1000031724 326
98 3300005455 Ga0070663_100008138 Ga0070663_1000081385 326
99 3300005456 Ga0070678_100002322 Ga0070678_1000023226 326
100 3300005457 Ga0070662_100001811 Ga0070662_10000181114 326
101 3300005459 Ga0068867_100003850 Ga0068867_1000038506 326
102 3300005466 Ga0070685_10032457 Ga0070685_100324573 326
103 3300005539 Ga0068853_100003312 Ga0068853_1000033128 326
104 3300005544 Ga0070686_100022148 Ga0070686_1000221481 326
105 3300005546 Ga0070696_100001452 Ga0070696_10000145214 326
106 3300005548 Ga0070665_100019446 Ga0070665_1000194465 326
107 3300005549 Ga0070704_100002458 Ga0070704_1000024587 326
108 3300005578 Ga0068854_100001161 Ga0068854_1000011613 326
109 3300005616 Ga0068852_100169033 Ga0068852_1001690332 326
110 3300005617 Ga0068859_100004277 Ga0068859_10000427711 326
111 3300005718 Ga0068866_10003324 Ga0068866_100033244 326
112 3300005719 Ga0068861_100001255 Ga0068861_1000012556 326
113 3300005842 Ga0068858_100003628 Ga0068858_1000036288 326
114 3300005843 Ga0068860_100003964 Ga0068860_1000039645 326
115 3300005937 Ga0081455_10007980 Ga0081455_100079806 326
116 3300006173 Ga0070716_100002864 Ga0070716_1000028644 326
117 3300006175 Ga0070712_100004723 Ga0070712_1000047235 326
118 3300006881 Ga0068865_100005261 Ga0068865_1000052614 326
119 3300006931 Ga0097620_100004277 Ga0097620_1000042775 326
120 3300013105 Ga0157369_10001010 Ga0157369_100010103 326
121 3300017792 Ga0163161_10002437 Ga0163161_100024376 326
122 3300025898 Ga0207692_10002263 Ga0207692_100022633 326
123 3300025900 Ga0207710_10004469 Ga0207710_100044693 326
124 3300025905 Ga0207685_10001088 Ga0207685_100010885 326
125 3300025915 Ga0207693_10000882 Ga0207693_1000088212 326
126 3300025916 Ga0207663_10001113 Ga0207663_100011138 326
127 3300025917 Ga0207660_10217684 Ga0207660_102176842 326
128 3300025923 Ga0207681_10009903 Ga0207681_100099033 326
129 3300025932 Ga0207690_10015803 Ga0207690_100158032 326
130 3300025933 Ga0207706_10000974 Ga0207706_100009747 326
131 3300025934 Ga0207686_10002796 Ga0207686_100027965 326
132 3300025935 Ga0207709_10005737 Ga0207709_100057375 326
133 3300025936 Ga0207670_10009403 Ga0207670_100094034 326
134 3300025939 Ga0207665_10003803 Ga0207665_100038037 326
135 3300025942 Ga0207689_10030488 Ga0207689_100304882 326
136 3300025960 Ga0207651_10262424 Ga0207651_102624242 326
137 3300025972 Ga0207668_10013201 Ga0207668_100132013 326
138 3300025981 Ga0207640_10007221 Ga0207640_100072214 326
139 3300026023 Ga0207677_10007576 Ga0207677_100075764 326
140 3300026041 Ga0207639_10017085 Ga0207639_100170854 326
141 3300026067 Ga0207678_10027433 Ga0207678_100274332 326
142 3300026075 Ga0207708_10011118 Ga0207708_100111183 326
143 3300026089 Ga0207648_10002209 Ga0207648_1000220918 326
144 3300026118 Ga0207675_100003484 Ga0207675_1000034849 326
145 3300026121 Ga0207683_10000832 Ga0207683_1000083219 326
146 3300028381 Ga0268264_10020629 Ga0268264_100206293 326
147 3300032002 Ga0307416_100265125 Ga0307416_1002651252 326
148 3300044901 Ga0466960_0039009 Ga0466960_0039009_878_1861 326
149 3300046519 Ga0495632_0060129 Ga0495632_0060129_278_1291 326
150 3300026075 Ga0207708_10022419 Ga0207708_100224194 328
151 3300026118 Ga0207675_100009266 Ga0207675_1000092664 328
152 3300046460 Ga0495638_0003039 Ga0495638_0003039_3349_4368 328
153 3300005330 Ga0070690_100003251 Ga0070690_1000032517 329
154 3300005340 Ga0070689_100001617 Ga0070689_10000161710 329
155 3300005438 Ga0070701_10004840 Ga0070701_100048404 329
156 3300005440 Ga0070705_100018185 Ga0070705_1000181853 329
157 3300005445 Ga0070708_100088458 Ga0070708_1000884582 329
158 3300005467 Ga0070706_100339049 Ga0070706_1003390491 329
159 3300005468 Ga0070707_100005579 Ga0070707_1000055793 329
160 3300005468 Ga0070707_100154595 Ga0070707_1001545952 329
161 3300005546 Ga0070696_100045297 Ga0070696_1000452973 329
162 3300005549 Ga0070704_100176645 Ga0070704_1001766452 329
163 3300005615 Ga0070702_100006065 Ga0070702_1000060655 329
164 3300005617 Ga0068859_100015441 Ga0068859_1000154415 329
165 3300005618 Ga0068864_100307216 Ga0068864_1003072162 329
166 3300005719 Ga0068861_100011299 Ga0068861_1000112993 329
167 3300005843 Ga0068860_100005857 Ga0068860_1000058574 329
168 3300005844 Ga0068862_100069209 Ga0068862_1000692092 329
169 3300006028 Ga0070717_10049502 Ga0070717_100495022 329
170 3300006931 Ga0097620_100015441 Ga0097620_1000154414 329
171 3300007265 Ga0099794_10037772 Ga0099794_100377722 329
172 3300009098 Ga0105245_10031998 Ga0105245_100319982 329
173 3300013308 Ga0157375_10264421 Ga0157375_102644211 329
174 3300025230 Ga0209563_100088 Ga0209563_10008844 329
175 3300025922 Ga0207646_10055718 Ga0207646_100557183 329
176 3300025936 Ga0207670_10034219 Ga0207670_100342194 329
177 3300026118 Ga0207675_100002728 Ga0207675_10000272813 329
178 3300028380 Ga0268265_10014382 Ga0268265_100143823 329
179 3300031456 Ga0307513_10014472 Ga0307513_100144729 329
180 3300046660 Ga0495625_0008112 Ga0495625_0008112_6944_7966 329
181 3300046660 Ga0495625_0256172 Ga0495625_0256172_102_1124 329
182 3300046694 Ga0495649_0022100 Ga0495649_0022100_375_1388 329
183 3300049571 Ga0501034_0098775 Ga0501034_0098775_1010_2020 329
184 3300049572 Ga0501036_0011601 Ga0501036_0011601_1147_2157 329
185 3300049574 Ga0501038_0117145 Ga0501038_0117145_148_1158 329
186 3300049575 Ga0501039_0045543 Ga0501039_0045543_1285_2295 329
187 3300049580 Ga0501046_0239454 Ga0501046_0239454_13_1023 329
188 3300049582 Ga0501048_0036936 Ga0501048_0036936_2432_3442 329
189 3300049583 Ga0501067_0005707 Ga0501067_0005707_3061_4071 329
190 3300049584 Ga0501068_0007750 Ga0501068_0007750_1834_2844 329
191 3300049585 Ga0501069_0009014 Ga0501069_0009014_1677_2687 329
192 3300049586 Ga0501070_0180811 Ga0501070_0180811_595_1605 329
193 3300049590 Ga0501074_0095274 Ga0501074_0095274_181_1191 329
194 3300049744 Ga0501083_0031749 Ga0501083_0031749_924_1934 329
195 3300049822 Ga0501035_0092029 Ga0501035_0092029_149_1159 329
196 3300049823 Ga0501044_0155601 Ga0501044_0155601_309_1319 329
197 3300049824 Ga0501045_0127329 Ga0501045_0127329_647_1657 329
198 3300005471 Ga0070698_100036108 Ga0070698_1000361082 330
199 3300005518 Ga0070699_100004142 Ga0070699_1000041423 330
200 3300006852 Ga0075433_10142060 Ga0075433_101420602 330
201 3300020069 Ga0197907_11021319 Ga0197907_110213192 330
202 3300022467 Ga0224712_10004896 Ga0224712_100048964 330
203 3300025910 Ga0207684_10013721 Ga0207684_100137212 330
204 3300025929 Ga0207664_10190867 Ga0207664_101908672 330
205 3300025939 Ga0207665_10271713 Ga0207665_102717132 330
206 3300049570 Ga0501033_0002379 Ga0501033_0002379_12347_13360 330
207 3300049570 Ga0501033_0057489 Ga0501033_0057489_201_1211 330
208 3300049572 Ga0501036_0000429 Ga0501036_0000429_6614_7627 330
209 3300049572 Ga0501036_0054089 Ga0501036_0054089_2018_3031 330
210 3300049574 Ga0501038_0023598 Ga0501038_0023598_1642_2655 330
211 3300049574 Ga0501038_0059052 Ga0501038_0059052_499_1512 330
212 3300049578 Ga0501042_0002245 Ga0501042_0002245_257_1294 330
213 3300049579 Ga0501043_0270622 Ga0501043_0270622_246_1259 330
214 3300049580 Ga0501046_0098084 Ga0501046_0098084_1209_2222 330
215 3300049582 Ga0501048_0000726 Ga0501048_0000726_5569_6582 330
216 3300049585 Ga0501069_0004484 Ga0501069_0004484_4860_5873 330
217 3300049586 Ga0501070_0073483 Ga0501070_0073483_84_1097 330
218 3300049586 Ga0501070_0086972 Ga0501070_0086972_889_1902 330
219 3300049587 Ga0501071_0041093 Ga0501071_0041093_2124_3137 330
220 3300049589 Ga0501073_0007634 Ga0501073_0007634_181_1194 330
221 3300049590 Ga0501074_0050626 Ga0501074_0050626_1565_2578 330
222 3300049822 Ga0501035_0009228 Ga0501035_0009228_4119_5132 330
223 3300049823 Ga0501044_0057572 Ga0501044_0057572_865_1878 330
224 3300050514 nmdc:mga08x19_166694_c1 nmdc:mga08x19_166694_c1_314_1354 330
225 3300050515 nmdc:mga0a205_157901_c1 nmdc:mga0a205_157901_c1_1025_2032 330
226 3300054114 Ga0501084_0049833 Ga0501084_0049833_1629_2642 330
227 3300060353 Ga0501082_0028798 Ga0501082_0028798_1771_2784 330
228 3300003373 JGI25407J50210_10041359 JGI25407J50210_100413591 331
229 3300005327 Ga0070658_10046996 Ga0070658_100469962 331
230 3300005329 Ga0070683_100000226 Ga0070683_10000022618 331
231 3300005329 Ga0070683_100029490 Ga0070683_1000294903 331
232 3300005330 Ga0070690_100278915 Ga0070690_1002789151 331
233 3300005331 Ga0070670_100166035 Ga0070670_1001660352 331
234 3300005335 Ga0070666_10035693 Ga0070666_100356932 331
235 3300005337 Ga0070682_100000072 Ga0070682_10000007256 331
236 3300005337 Ga0070682_100053977 Ga0070682_1000539772 331
237 3300005338 Ga0068868_100015708 Ga0068868_1000157082 331
238 3300005338 Ga0068868_100345383 Ga0068868_1003453832 331
239 3300005339 Ga0070660_100418869 Ga0070660_1004188691 331
240 3300005345 Ga0070692_10156612 Ga0070692_101566121 331
241 3300005347 Ga0070668_100024108 Ga0070668_1000241081 331
242 3300005354 Ga0070675_100000008 Ga0070675_100000008148 331
243 3300005354 Ga0070675_100037489 Ga0070675_1000374893 331
244 3300005355 Ga0070671_100091773 Ga0070671_1000917732 331
245 3300005365 Ga0070688_100000018 Ga0070688_10000001868 331
246 3300005365 Ga0070688_100000364 Ga0070688_1000003649 331
247 3300005365 Ga0070688_100038405 Ga0070688_1000384052 331
248 3300005366 Ga0070659_100048610 Ga0070659_1000486102 331
249 3300005367 Ga0070667_100001736 Ga0070667_1000017368 331
250 3300005434 Ga0070709_10005538 Ga0070709_100055385 331
251 3300005434 Ga0070709_10255817 Ga0070709_102558171 331
252 3300005435 Ga0070714_100074268 Ga0070714_1000742682 331
253 3300005436 Ga0070713_100070690 Ga0070713_1000706902 331
254 3300005436 Ga0070713_100098808 Ga0070713_1000988083 331
255 3300005436 Ga0070713_100124655 Ga0070713_1001246553 331
256 3300005436 Ga0070713_100230126 Ga0070713_1002301262 331
257 3300005437 Ga0070710_10003839 Ga0070710_100038398 331
258 3300005438 Ga0070701_10057040 Ga0070701_100570401 331
259 3300005439 Ga0070711_100009291 Ga0070711_1000092918 331
260 3300005439 Ga0070711_100056556 Ga0070711_1000565562 331
261 3300005440 Ga0070705_100020873 Ga0070705_1000208732 331
262 3300005440 Ga0070705_100040100 Ga0070705_1000401001 331
263 3300005444 Ga0070694_100196659 Ga0070694_1001966591 331
264 3300005445 Ga0070708_100005178 Ga0070708_1000051786 331
265 3300005445 Ga0070708_100157043 Ga0070708_1001570432 331
266 3300005445 Ga0070708_100396995 Ga0070708_1003969951 331
267 3300005456 Ga0070678_100033632 Ga0070678_1000336324 331
268 3300005458 Ga0070681_10019014 Ga0070681_100190142 331
269 3300005458 Ga0070681_10062806 Ga0070681_100628062 331
270 3300005458 Ga0070681_10086096 Ga0070681_100860962 331
271 3300005466 Ga0070685_10000114 Ga0070685_1000011449 331
272 3300005466 Ga0070685_10000437 Ga0070685_1000043711 331
273 3300005466 Ga0070685_10110372 Ga0070685_101103722 331
274 3300005467 Ga0070706_100051856 Ga0070706_1000518564 331
275 3300005468 Ga0070707_100008372 Ga0070707_1000083725 331
276 3300005471 Ga0070698_100003478 Ga0070698_1000034786 331
277 3300005535 Ga0070684_100068355 Ga0070684_1000683551 331
278 3300005536 Ga0070697_100087337 Ga0070697_1000873372 331
279 3300005539 Ga0068853_100068965 Ga0068853_1000689652 331
280 3300005543 Ga0070672_100000018 Ga0070672_10000001827 331
281 3300005543 Ga0070672_100151192 Ga0070672_1001511922 331
282 3300005545 Ga0070695_100066903 Ga0070695_1000669032 331
283 3300005546 Ga0070696_100139539 Ga0070696_1001395392 331
284 3300005547 Ga0070693_100068640 Ga0070693_1000686402 331
285 3300005549 Ga0070704_100036830 Ga0070704_1000368302 331
286 3300005549 Ga0070704_100042140 Ga0070704_1000421403 331
287 3300005564 Ga0070664_100003303 Ga0070664_10000330311 331
288 3300005578 Ga0068854_100035498 Ga0068854_1000354982 331
289 3300005614 Ga0068856_100000654 Ga0068856_1000006542 331
290 3300005614 Ga0068856_100031615 Ga0068856_1000316154 331
291 3300005614 Ga0068856_100205034 Ga0068856_1002050342 331
292 3300005615 Ga0070702_100031834 Ga0070702_1000318342 331
293 3300005618 Ga0068864_100039384 Ga0068864_1000393842 331
294 3300005834 Ga0068851_10000922 Ga0068851_100009227 331
295 3300005841 Ga0068863_100302269 Ga0068863_1003022692 331
296 3300005844 Ga0068862_100006916 Ga0068862_10000691611 331
297 3300005983 Ga0081540_1000009 Ga0081540_1000009157 331
298 3300005983 Ga0081540_1000740 Ga0081540_10007408 331
299 3300006028 Ga0070717_10378809 Ga0070717_103788092 331
300 3300006163 Ga0070715_10001613 Ga0070715_100016133 331
301 3300006173 Ga0070716_100021946 Ga0070716_1000219462 331
302 3300006175 Ga0070712_100016409 Ga0070712_1000164096 331
303 3300006175 Ga0070712_100315471 Ga0070712_1003154712 331
304 3300006175 Ga0070712_100330133 Ga0070712_1003301331 331
305 3300006237 Ga0097621_100111923 Ga0097621_1001119233 331
306 3300006852 Ga0075433_10046997 Ga0075433_100469976 331
307 3300006852 Ga0075433_10130847 Ga0075433_101308472 331
308 3300006881 Ga0068865_100000019 Ga0068865_1000000194 331
309 3300006914 Ga0075436_100057382 Ga0075436_1000573822 331
310 3300007076 Ga0075435_100085874 Ga0075435_1000858743 331
311 3300009011 Ga0105251_10017754 Ga0105251_100177542 331
312 3300009093 Ga0105240_10086989 Ga0105240_100869892 331
313 3300009094 Ga0111539_10090382 Ga0111539_100903822 331
314 3300009098 Ga0105245_10000012 Ga0105245_10000012110 331
315 3300009098 Ga0105245_10021334 Ga0105245_100213346 331
316 3300009098 Ga0105245_10089225 Ga0105245_100892253 331
317 3300009098 Ga0105245_10385799 Ga0105245_103857992 331
318 3300009101 Ga0105247_10119690 Ga0105247_101196902 331
319 3300009147 Ga0114129_10004005 Ga0114129_1000400522 331
320 3300009148 Ga0105243_10087941 Ga0105243_100879413 331
321 3300009176 Ga0105242_10144137 Ga0105242_101441372 331
322 3300009177 Ga0105248_10000267 Ga0105248_100002677 331
323 3300009177 Ga0105248_10054995 Ga0105248_100549952 331
324 3300009177 Ga0105248_10156346 Ga0105248_101563462 331
325 3300009551 Ga0105238_10258866 Ga0105238_102588662 331
326 3300009553 Ga0105249_10014730 Ga0105249_100147308 331
327 3300009553 Ga0105249_10157755 Ga0105249_101577552 331
328 3300009553 Ga0105249_10387431 Ga0105249_103874312 331
329 3300010375 Ga0105239_10318484 Ga0105239_103184842 331
330 3300010375 Ga0105239_10482209 Ga0105239_104822092 331
331 3300011119 Ga0105246_10012840 Ga0105246_100128402 331
332 3300012507 Ga0157342_1000392 Ga0157342_10003923 331
333 3300013104 Ga0157370_10208486 Ga0157370_102084862 331
334 3300013296 Ga0157374_10435182 Ga0157374_104351821 331
335 3300013297 Ga0157378_10128911 Ga0157378_101289112 331
336 3300013306 Ga0163162_10233978 Ga0163162_102339782 331
337 3300013307 Ga0157372_10000128 Ga0157372_1000012810 331
338 3300013308 Ga0157375_10018476 Ga0157375_100184768 331
339 3300014325 Ga0163163_10065823 Ga0163163_100658232 331
340 3300014326 Ga0157380_10000009 Ga0157380_1000000996 331
341 3300014745 Ga0157377_10009168 Ga0157377_100091682 331
342 3300014745 Ga0157377_10062846 Ga0157377_100628462 331
343 3300014968 Ga0157379_10009692 Ga0157379_100096926 331
344 3300014969 Ga0157376_10034901 Ga0157376_100349015 331
345 3300017792 Ga0163161_10025836 Ga0163161_100258362 331
346 3300020069 Ga0197907_10255742 Ga0197907_102557422 331
347 3300020070 Ga0206356_11118101 Ga0206356_111181013 331
348 3300020080 Ga0206350_11332138 Ga0206350_113321382 331
349 3300021384 Ga0213876_10006294 Ga0213876_100062943 331
350 3300021388 Ga0213875_10007908 Ga0213875_100079084 331
351 3300021388 Ga0213875_10093865 Ga0213875_100938652 331
352 3300022467 Ga0224712_10068449 Ga0224712_100684492 331
353 3300025321 Ga0207656_10000153 Ga0207656_100001538 331
354 3300025735 Ga0207713_1048880 Ga0207713_10488801 331
355 3300025885 Ga0207653_10038162 Ga0207653_100381622 331
356 3300025898 Ga0207692_10000297 Ga0207692_100002972 331
357 3300025901 Ga0207688_10026396 Ga0207688_100263962 331
358 3300025905 Ga0207685_10001777 Ga0207685_100017772 331
359 3300025905 Ga0207685_10029613 Ga0207685_100296132 331
360 3300025905 Ga0207685_10052613 Ga0207685_100526132 331
361 3300025910 Ga0207684_10013578 Ga0207684_100135783 331
362 3300025912 Ga0207707_10031073 Ga0207707_100310735 331
363 3300025912 Ga0207707_10089707 Ga0207707_100897072 331
364 3300025913 Ga0207695_10211133 Ga0207695_102111332 331
365 3300025915 Ga0207693_10000976 Ga0207693_100009768 331
366 3300025915 Ga0207693_10019671 Ga0207693_100196714 331
367 3300025915 Ga0207693_10041129 Ga0207693_100411293 331
368 3300025916 Ga0207663_10016450 Ga0207663_100164502 331
369 3300025918 Ga0207662_10177120 Ga0207662_101771202 331
370 3300025919 Ga0207657_10031018 Ga0207657_100310182 331
371 3300025920 Ga0207649_10000005 Ga0207649_1000000562 331
372 3300025921 Ga0207652_10103749 Ga0207652_101037492 331
373 3300025923 Ga0207681_10118247 Ga0207681_101182472 331
374 3300025925 Ga0207650_10091591 Ga0207650_100915912 331
375 3300025926 Ga0207659_10000014 Ga0207659_10000014167 331
376 3300025926 Ga0207659_10235998 Ga0207659_102359981 331
377 3300025927 Ga0207687_10000011 Ga0207687_10000011163 331
378 3300025927 Ga0207687_10007446 Ga0207687_100074462 331
379 3300025927 Ga0207687_10038675 Ga0207687_100386753 331
380 3300025927 Ga0207687_10140722 Ga0207687_101407222 331
381 3300025928 Ga0207700_10053164 Ga0207700_100531642 331
382 3300025928 Ga0207700_10070458 Ga0207700_100704582 331
383 3300025928 Ga0207700_10137796 Ga0207700_101377962 331
384 3300025928 Ga0207700_10386735 Ga0207700_103867351 331
385 3300025929 Ga0207664_10000495 Ga0207664_1000049521 331
386 3300025929 Ga0207664_10033143 Ga0207664_100331431 331
387 3300025929 Ga0207664_10363640 Ga0207664_103636402 331
388 3300025929 Ga0207664_10477170 Ga0207664_104771701 331
389 3300025932 Ga0207690_10021359 Ga0207690_100213592 331
390 3300025934 Ga0207686_10031498 Ga0207686_100314982 331
391 3300025935 Ga0207709_10057841 Ga0207709_100578412 331
392 3300025938 Ga0207704_10000009 Ga0207704_1000000985 331
393 3300025938 Ga0207704_10226513 Ga0207704_102265131 331
394 3300025939 Ga0207665_10008645 Ga0207665_100086454 331
395 3300025939 Ga0207665_10011749 Ga0207665_100117492 331
396 3300025940 Ga0207691_10000121 Ga0207691_1000012149 331
397 3300025940 Ga0207691_10068747 Ga0207691_100687472 331
398 3300025941 Ga0207711_10000024 Ga0207711_10000024108 331
399 3300025941 Ga0207711_10270200 Ga0207711_102702002 331
400 3300025942 Ga0207689_10033846 Ga0207689_100338463 331
401 3300025944 Ga0207661_10000068 Ga0207661_1000006857 331
402 3300025944 Ga0207661_10016099 Ga0207661_100160994 331
403 3300025944 Ga0207661_10205821 Ga0207661_102058211 331
404 3300025945 Ga0207679_10327555 Ga0207679_103275551 331
405 3300025949 Ga0207667_10234262 Ga0207667_102342624 331
406 3300025949 Ga0207667_10266684 Ga0207667_102666842 331
407 3300025961 Ga0207712_10011404 Ga0207712_100114042 331
408 3300025972 Ga0207668_10004668 Ga0207668_1000466810 331
409 3300025972 Ga0207668_10047103 Ga0207668_100471032 331
410 3300025986 Ga0207658_10000708 Ga0207658_100007085 331
411 3300026023 Ga0207677_10000671 Ga0207677_100006716 331
412 3300026035 Ga0207703_10164249 Ga0207703_101642491 331
413 3300026067 Ga0207678_10013696 Ga0207678_100136965 331
414 3300026078 Ga0207702_10000099 Ga0207702_1000009972 331
415 3300026078 Ga0207702_10014292 Ga0207702_100142923 331
416 3300026078 Ga0207702_10122188 Ga0207702_101221884 331
417 3300026078 Ga0207702_10210684 Ga0207702_102106842 331
418 3300026088 Ga0207641_10068180 Ga0207641_100681802 331
419 3300026095 Ga0207676_10079234 Ga0207676_100792342 331
420 3300026116 Ga0207674_10059781 Ga0207674_100597812 331
421 3300026116 Ga0207674_10492047 Ga0207674_104920472 331
422 3300026118 Ga0207675_100129318 Ga0207675_1001293182 331
423 3300026121 Ga0207683_10000557 Ga0207683_1000055727 331
424 3300026121 Ga0207683_10076606 Ga0207683_100766062 331
425 3300028379 Ga0268266_10011831 Ga0268266_100118317 331
426 3300028379 Ga0268266_10240837 Ga0268266_102408371 331
427 3300028380 Ga0268265_10002429 Ga0268265_1000242918 331
428 3300031727 Ga0316576_10257501 Ga0316576_102575011 331
429 3300031733 Ga0316577_10011037 Ga0316577_100110373 331
430 3300034818 Ga0373950_0001014 Ga0373950_0001014_1433_2443 331
431 3300035083 Ga0373926_0001758 Ga0373926_0001758_948_1958 331
432 3300035083 Ga0373926_0004436 Ga0373926_0004436_3010_4038 331
433 3300035083 Ga0373926_0017855 Ga0373926_0017855_592_1602 331
434 3300035083 Ga0373926_0020345 Ga0373926_0020345_1194_2228 331
435 3300035084 Ga0373928_0004493 Ga0373928_0004493_1336_2346 331
436 3300035085 Ga0373929_0004745 Ga0373929_0004745_1358_2368 331
437 3300035086 Ga0373934_0000629 Ga0373934_0000629_244_1272 331
438 3300035086 Ga0373934_0008756 Ga0373934_0008756_387_1397 331
439 3300035086 Ga0373934_0018600 Ga0373934_0018600_769_1797 331
440 3300035086 Ga0373934_0019023 Ga0373934_0019023_306_1334 331
441 3300035089 Ga0373944_0004052 Ga0373944_0004052_1126_2154 331
442 3300035091 Ga0373951_0005145 Ga0373951_0005145_907_1917 331
443 3300035111 Ga0373923_0000272 Ga0373923_0000272_343_1353 331
444 3300035111 Ga0373923_0035198 Ga0373923_0035198_874_1902 331
445 3300035111 Ga0373923_0040755 Ga0373923_0040755_246_1274 331
446 3300035113 Ga0373936_0000716 Ga0373936_0000716_8191_9225 331
447 3300035113 Ga0373936_0000918 Ga0373936_0000918_8622_9632 331
448 3300035113 Ga0373936_0015301 Ga0373936_0015301_1240_2268 331
449 3300035113 Ga0373936_0046082 Ga0373936_0046082_513_1541 331
450 3300035116 Ga0373945_0000124 Ga0373945_0000124_15327_16361 331
451 3300035116 Ga0373945_0000169 Ga0373945_0000169_14368_15396 331
452 3300035116 Ga0373945_0002456 Ga0373945_0002456_128_1138 331
453 3300035116 Ga0373945_0026685 Ga0373945_0026685_480_1490 331
454 3300035117 Ga0373953_0025487 Ga0373953_0025487_132_1142 331
455 3300035118 Ga0373954_0008891 Ga0373954_0008891_3024_4034 331
456 3300035118 Ga0373954_0027038 Ga0373954_0027038_303_1331 331
457 3300035118 Ga0373954_0041769 Ga0373954_0041769_164_1192 331
458 3300035119 Ga0373956_0000191 Ga0373956_0000191_7190_8218 331
459 3300035119 Ga0373956_0003979 Ga0373956_0003979_4694_5722 331
460 3300035119 Ga0373956_0035650 Ga0373956_0035650_520_1530 331
461 3300035120 Ga0373957_0000550 Ga0373957_0000550_7904_8932 331
462 3300035120 Ga0373957_0002209 Ga0373957_0002209_1596_2606 331
463 3300035120 Ga0373957_0026216 Ga0373957_0026216_664_1692 331
464 3300035121 Ga0373960_0009139 Ga0373960_0009139_438_1448 331
465 3300035170 Ga0373943_0000064 Ga0373943_0000064_9541_10569 331
466 3300035170 Ga0373943_0008483 Ga0373943_0008483_253_1263 331
467 3300035170 Ga0373943_0011403 Ga0373943_0011403_65_1099 331
468 3300035170 Ga0373943_0043669 Ga0373943_0043669_868_1893 331
469 3300035171 Ga0373946_0000149 Ga0373946_0000149_9313_10323 331
470 3300035171 Ga0373946_0000326 Ga0373946_0000326_4860_5888 331
471 3300035171 Ga0373946_0016738 Ga0373946_0016738_217_1245 331
472 3300035172 Ga0373955_0000050 Ga0373955_0000050_11161_12189 331
473 3300035172 Ga0373955_0003540 Ga0373955_0003540_860_1870 331
474 3300035172 Ga0373955_0004609 Ga0373955_0004609_5041_6069 331
475 3300035410 Ga0373924_0000037 Ga0373924_0000037_24840_25868 331
476 3300035410 Ga0373924_0014248 Ga0373924_0014248_1219_2247 331
477 3300035410 Ga0373924_0030687 Ga0373924_0030687_1015_2049 331
478 3300035410 Ga0373924_0069347 Ga0373924_0069347_343_1353 331
479 3300035691 Ga0373931_0013437 Ga0373931_0013437_2788_3798 331
480 3300035691 Ga0373931_0235595 Ga0373931_0235595_33_1043 331
481 3300035692 Ga0373935_0001258 Ga0373935_0001258_5617_6645 331
482 3300035692 Ga0373935_0021464 Ga0373935_0021464_2505_3515 331
483 3300035692 Ga0373935_0067950 Ga0373935_0067950_253_1263 331
484 3300035692 Ga0373935_0075236 Ga0373935_0075236_653_1681 331
485 3300035692 Ga0373935_0075656 Ga0373935_0075656_871_1905 331
486 3300035695 Ga0373927_0001700 Ga0373927_0001700_14225_15253 331
487 3300035695 Ga0373927_0016572 Ga0373927_0016572_2737_3771 331
488 3300035695 Ga0373927_0034117 Ga0373927_0034117_1959_2969 331
489 3300035695 Ga0373927_0044293 Ga0373927_0044293_1335_2345 331
490 3300035724 Ga0373933_0000149 Ga0373933_0000149_33497_34525 331
491 3300035724 Ga0373933_0003274 Ga0373933_0003274_3374_4402 331
492 3300035724 Ga0373933_0020277 Ga0373933_0020277_343_1353 331
493 3300035724 Ga0373933_0020491 Ga0373933_0020491_397_1425 331
494 3300035724 Ga0373933_0072162 Ga0373933_0072162_572_1570 331
495 3300035725 Ga0373947_0000906 Ga0373947_0000906_12807_13835 331
496 3300035725 Ga0373947_0016202 Ga0373947_0016202_833_1858 331
497 3300035725 Ga0373947_0066354 Ga0373947_0066354_1019_2053 331
498 3300035725 Ga0373947_0187856 Ga0373947_0187856_231_1259 331
499 3300036401 Ga0373937_0000319 Ga0373937_0000319_11161_12189 331
500 3300036401 Ga0373937_0000686 Ga0373937_0000686_16516_17544 331
501 3300036647 Ga0316582_0122288 Ga0316582_0122288_316_1359 331
502 3300036712 Ga0316584_0012190 Ga0316584_0012190_3200_4246 331
503 3300037068 Ga0373925_0018370 Ga0373925_0018370_2464_3492 331
504 3300037068 Ga0373925_0022837 Ga0373925_0022837_1695_2750 331
505 3300037068 Ga0373925_0175520 Ga0373925_0175520_454_1482 331
506 3300037068 Ga0373925_0289620 Ga0373925_0289620_79_1104 331
507 3300037068 Ga0373925_0323317 Ga0373925_0323317_150_1184 331
508 3300037466 Ga0395898_0011622 Ga0395898_0011622_2308_3333 331
509 3300037853 Ga0436364_1080858 Ga0436364_1080858_848_1858 331
510 3300037853 Ga0436364_1264688 Ga0436364_1264688_15_1043 331
511 3300038443 Ga0395901_0225559 Ga0395901_0225559_70_1095 331
512 3300039437 Ga0436365_1406444 Ga0436365_1406444_13478_14497 331
513 3300039437 Ga0436365_1629153 Ga0436365_1629153_125_1153 331
514 3300042010 Ga0439452_038862 Ga0439452_038862_33_1061 331
515 3300044706 Ga0466964_0045575 Ga0466964_0045575_79_1095 331
516 3300044765 Ga0466970_0029327 Ga0466970_0029327_1174_2193 331
517 3300045049 Ga0466959_0045081 Ga0466959_0045081_732_1742 331
518 3300045836 Ga0466958_0025987 Ga0466958_0025987_1750_2760 331
519 3300045976 Ga0466967_0000123 Ga0466967_0000123_1627_2643 331
520 3300045976 Ga0466967_0026324 Ga0466967_0026324_212_1222 331
521 3300045976 Ga0466967_0032936 Ga0466967_0032936_1273_2289 331
522 3300045976 Ga0466967_0042603 Ga0466967_0042603_1883_2905 331
523 3300045976 Ga0466967_0307967 Ga0466967_0307967_426_1436 331
524 3300046454 Ga0495592_0000255 Ga0495592_0000255_11161_12189 331
525 3300046454 Ga0495592_0030140 Ga0495592_0030140_1572_2600 331
526 3300046454 Ga0495592_0041517 Ga0495592_0041517_1030_2040 331
527 3300046454 Ga0495592_0045175 Ga0495592_0045175_2155_3183 331
528 3300046455 Ga0495603_0003038 Ga0495603_0003038_8593_9603 331
529 3300046455 Ga0495603_0022542 Ga0495603_0022542_998_2032 331
530 3300046459 Ga0495629_0002409 Ga0495629_0002409_541_1569 331
531 3300046459 Ga0495629_0003497 Ga0495629_0003497_1280_2290 331
532 3300046459 Ga0495629_0034223 Ga0495629_0034223_2165_3175 331
533 3300046459 Ga0495629_0042946 Ga0495629_0042946_681_1709 331
534 3300046460 Ga0495638_0021853 Ga0495638_0021853_2050_3066 331
535 3300046461 Ga0495641_0006016 Ga0495641_0006016_343_1353 331
536 3300046461 Ga0495641_0016629 Ga0495641_0016629_718_1752 331
537 3300046461 Ga0495641_0030310 Ga0495641_0030310_570_1598 331
538 3300046462 Ga0495651_0000199 Ga0495651_0000199_33497_34525 331
539 3300046462 Ga0495651_0017370 Ga0495651_0017370_2361_3371 331
540 3300046462 Ga0495651_0046737 Ga0495651_0046737_1890_2918 331
541 3300046463 Ga0495653_0003175 Ga0495653_0003175_11433_12461 331
542 3300046463 Ga0495653_0014635 Ga0495653_0014635_4667_5677 331
543 3300046463 Ga0495653_0016440 Ga0495653_0016440_3589_4617 331
544 3300046463 Ga0495653_0022138 Ga0495653_0022138_2517_3527 331
545 3300046463 Ga0495653_0031203 Ga0495653_0031203_46_1056 331
546 3300046463 Ga0495653_0148026 Ga0495653_0148026_403_1431 331
547 3300046472 Ga0495580_0002596 Ga0495580_0002596_8712_9722 331
548 3300046472 Ga0495580_0015371 Ga0495580_0015371_3206_4216 331
549 3300046472 Ga0495580_0053162 Ga0495580_0053162_319_1353 331
550 3300046472 Ga0495580_0188230 Ga0495580_0188230_22_1050 331
551 3300046473 Ga0495582_0000730 Ga0495582_0000730_8938_9948 331
552 3300046473 Ga0495582_0012628 Ga0495582_0012628_2171_3199 331
553 3300046473 Ga0495582_0051155 Ga0495582_0051155_718_1752 331
554 3300046475 Ga0495639_0000935 Ga0495639_0000935_988_2022 331
555 3300046475 Ga0495639_0007453 Ga0495639_0007453_1245_2255 331
556 3300046475 Ga0495639_0019139 Ga0495639_0019139_1949_2959 331
557 3300046476 Ga0495662_0007677 Ga0495662_0007677_3149_4159 331
558 3300046476 Ga0495662_0010492 Ga0495662_0010492_3162_4172 331
559 3300046476 Ga0495662_0027018 Ga0495662_0027018_1403_2431 331
560 3300046477 Ga0495664_0001131 Ga0495664_0001131_10440_11468 331
561 3300046477 Ga0495664_0102303 Ga0495664_0102303_704_1714 331
562 3300046499 Ga0495594_0046808 Ga0495594_0046808_416_1426 331
563 3300046511 Ga0495608_0000010 Ga0495608_0000010_27930_28946 331
564 3300046511 Ga0495608_0000499 Ga0495608_0000499_11153_12181 331
565 3300046511 Ga0495608_0035640 Ga0495608_0035640_1895_2923 331
566 3300046511 Ga0495608_0065349 Ga0495608_0065349_343_1353 331
567 3300046514 Ga0495618_0008665 Ga0495618_0008665_1410_2438 331
568 3300046514 Ga0495618_0011052 Ga0495618_0011052_2102_3112 331
569 3300046514 Ga0495618_0042134 Ga0495618_0042134_1416_2444 331
570 3300046516 Ga0495628_0000282 Ga0495628_0000282_33457_34485 331
571 3300046516 Ga0495628_0107238 Ga0495628_0107238_156_1169 331
572 3300046517 Ga0495630_0018874 Ga0495630_0018874_2190_3200 331
573 3300046517 Ga0495630_0029722 Ga0495630_0029722_2171_3199 331
574 3300046517 Ga0495630_0054071 Ga0495630_0054071_1393_2421 331
575 3300046523 Ga0495644_0044766 Ga0495644_0044766_633_1637 331
576 3300046524 Ga0495648_0027978 Ga0495648_0027978_2103_3125 331
577 3300046526 Ga0495666_0004831 Ga0495666_0004831_5586_6596 331
578 3300046526 Ga0495666_0016851 Ga0495666_0016851_558_1568 331
579 3300046529 Ga0495652_0001352 Ga0495652_0001352_11165_12193 331
580 3300046529 Ga0495652_0023245 Ga0495652_0023245_3172_4200 331
581 3300046529 Ga0495652_0087975 Ga0495652_0087975_507_1517 331
582 3300046529 Ga0495652_0200777 Ga0495652_0200777_329_1339 331
583 3300046529 Ga0495652_0212244 Ga0495652_0212244_192_1214 331
584 3300046531 Ga0495665_0003232 Ga0495665_0003232_3081_4091 331
585 3300046531 Ga0495665_0013243 Ga0495665_0013243_417_1427 331
586 3300046531 Ga0495665_0019544 Ga0495665_0019544_882_1910 331
587 3300046531 Ga0495665_0024755 Ga0495665_0024755_1230_2264 331
588 3300046531 Ga0495665_0109981 Ga0495665_0109981_206_1234 331
589 3300046533 Ga0495640_0036069 Ga0495640_0036069_297_1307 331
590 3300046533 Ga0495640_0055712 Ga0495640_0055712_369_1385 331
591 3300046535 Ga0495586_0002011 Ga0495586_0002011_7766_8800 331
592 3300046535 Ga0495586_0012080 Ga0495586_0012080_2332_3342 331
593 3300046535 Ga0495586_0050941 Ga0495586_0050941_1099_2127 331
594 3300046535 Ga0495586_0121606 Ga0495586_0121606_212_1285 331
595 3300046536 Ga0495587_0000189 Ga0495587_0000189_33497_34525 331
596 3300046536 Ga0495587_0022593 Ga0495587_0022593_2080_3090 331
597 3300046536 Ga0495587_0050750 Ga0495587_0050750_736_1734 331
598 3300046543 Ga0495645_0018972 Ga0495645_0018972_343_1353 331
599 3300046543 Ga0495645_0026413 Ga0495645_0026413_2171_3181 331
600 3300046543 Ga0495645_0056664 Ga0495645_0056664_307_1335 331
601 3300046543 Ga0495645_0115768 Ga0495645_0115768_107_1105 331
602 3300046559 Ga0495667_0000136 Ga0495667_0000136_38543_39571 331
603 3300046559 Ga0495667_0009068 Ga0495667_0009068_4340_5350 331
604 3300046559 Ga0495667_0026481 Ga0495667_0026481_1460_2488 331
605 3300046559 Ga0495667_0036661 Ga0495667_0036661_858_1886 331
606 3300046559 Ga0495667_0065583 Ga0495667_0065583_1023_2057 331
607 3300046559 Ga0495667_0130427 Ga0495667_0130427_85_1113 331
608 3300046559 Ga0495667_0150710 Ga0495667_0150710_418_1446 331
609 3300046642 Ga0495634_0009897 Ga0495634_0009897_5332_6366 331
610 3300046642 Ga0495634_0035770 Ga0495634_0035770_1686_2696 331
611 3300046642 Ga0495634_0039571 Ga0495634_0039571_301_1311 331
612 3300046642 Ga0495634_0067261 Ga0495634_0067261_528_1556 331
613 3300046642 Ga0495634_0183868 Ga0495634_0183868_72_1082 331
614 3300046663 Ga0495635_0000124 Ga0495635_0000124_45295_46329 331
615 3300046663 Ga0495635_0003210 Ga0495635_0003210_7966_8994 331
616 3300046663 Ga0495635_0010617 Ga0495635_0010617_1158_2168 331
617 3300046663 Ga0495635_0017321 Ga0495635_0017321_2609_3637 331
618 3300046663 Ga0495635_0136350 Ga0495635_0136350_213_1241 331
619 3300046674 Ga0495588_0000218 Ga0495588_0000218_32072_33088 331
620 3300046674 Ga0495588_0001492 Ga0495588_0001492_8040_9044 331
621 3300046675 Ga0495657_0000005 Ga0495657_0000005_225915_226931 331
622 3300046675 Ga0495657_0000290 Ga0495657_0000290_33497_34525 331
623 3300046675 Ga0495657_0038600 Ga0495657_0038600_565_1593 331
624 3300046675 Ga0495657_0073927 Ga0495657_0073927_271_1299 331
625 3300046678 Ga0495599_0000282 Ga0495599_0000282_19051_20079 331
626 3300046678 Ga0495599_0053165 Ga0495599_0053165_883_1893 331
627 3300046678 Ga0495599_0070865 Ga0495599_0070865_895_1923 331
628 3300046679 Ga0495623_0000368 Ga0495623_0000368_7137_8165 331
629 3300046679 Ga0495623_0036513 Ga0495623_0036513_1850_2878 331
630 3300046680 Ga0495646_0018156 Ga0495646_0018156_2170_3198 331
631 3300046680 Ga0495646_0024999 Ga0495646_0024999_1554_2612 331
632 3300046680 Ga0495646_0047465 Ga0495646_0047465_1261_2271 331
633 3300046680 Ga0495646_0184086 Ga0495646_0184086_61_1089 331
634 3300046681 Ga0495647_0000111 Ga0495647_0000111_8799_9815 331
635 3300046681 Ga0495647_0012514 Ga0495647_0012514_946_1956 331
636 3300046681 Ga0495647_0023204 Ga0495647_0023204_451_1461 331
637 3300046683 Ga0495658_0000965 Ga0495658_0000965_4195_5211 331
638 3300046683 Ga0495658_0002269 Ga0495658_0002269_1744_2754 331
639 3300046683 Ga0495658_0034678 Ga0495658_0034678_1153_2181 331
640 3300046683 Ga0495658_0126095 Ga0495658_0126095_488_1498 331
641 3300046689 Ga0495613_0000131 Ga0495613_0000131_28659_29675 331
642 3300046689 Ga0495613_0019246 Ga0495613_0019246_781_1791 331
643 3300046689 Ga0495613_0019940 Ga0495613_0019940_3139_4149 331
644 3300046690 Ga0495624_0007084 Ga0495624_0007084_1657_2691 331
645 3300046690 Ga0495624_0014987 Ga0495624_0014987_1246_2256 331
646 3300046690 Ga0495624_0025562 Ga0495624_0025562_2055_3083 331
647 3300046690 Ga0495624_0123243 Ga0495624_0123243_321_1349 331
648 3300046691 Ga0495670_0011360 Ga0495670_0011360_1965_2969 331
649 3300046809 Ga0495600_0002942 Ga0495600_0002942_2393_3421 331
650 3300046809 Ga0495600_0008634 Ga0495600_0008634_3659_4687 331
651 3300046809 Ga0495600_0020345 Ga0495600_0020345_1074_2090 331
652 3300046809 Ga0495600_0033112 Ga0495600_0033112_1741_2769 331
653 3300047315 Ga0495581_0005558 Ga0495581_0005558_4612_5640 331
654 3300047315 Ga0495581_0024613 Ga0495581_0024613_2178_3188 331
655 3300047315 Ga0495581_0039162 Ga0495581_0039162_704_1714 331
656 3300047315 Ga0495581_0041225 Ga0495581_0041225_1399_2433 331
657 3300047317 Ga0495604_0000078 Ga0495604_0000078_54766_55782 331
658 3300047317 Ga0495604_0000280 Ga0495604_0000280_33497_34525 331
659 3300047317 Ga0495604_0024326 Ga0495604_0024326_343_1353 331
660 3300047317 Ga0495604_0035697 Ga0495604_0035697_11_1027 331
661 3300047317 Ga0495604_0065678 Ga0495604_0065678_1629_2657 331
662 3300047319 Ga0495674_0000063 Ga0495674_0000063_35575_36591 331
663 3300047319 Ga0495674_0000405 Ga0495674_0000405_37664_38692 331
664 3300047319 Ga0495674_0029627 Ga0495674_0029627_2074_3084 331
665 3300047319 Ga0495674_0052205 Ga0495674_0052205_1631_2665 331
666 3300047319 Ga0495674_0106405 Ga0495674_0106405_343_1353 331
667 3300047319 Ga0495674_0169564 Ga0495674_0169564_642_1670 331
668 3300047321 Ga0495676_0015559 Ga0495676_0015559_3410_4438 331
669 3300047321 Ga0495676_0028446 Ga0495676_0028446_181_1197 331
670 3300047321 Ga0495676_0045718 Ga0495676_0045718_508_1518 331
671 3300047321 Ga0495676_0088268 Ga0495676_0088268_287_1297 331
672 3300047321 Ga0495676_0119364 Ga0495676_0119364_503_1531 331
673 3300047321 Ga0495676_0248131 Ga0495676_0248131_117_1151 331
674 3300047322 Ga0495680_0000430 Ga0495680_0000430_34884_35912 331
675 3300047322 Ga0495680_0005228 Ga0495680_0005228_486_1520 331
676 3300047322 Ga0495680_0008764 Ga0495680_0008764_7812_8840 331
677 3300047322 Ga0495680_0013885 Ga0495680_0013885_4261_5289 331
678 3300047322 Ga0495680_0098296 Ga0495680_0098296_417_1427 331
679 3300047322 Ga0495680_0171514 Ga0495680_0171514_458_1486 331
680 3300047444 Ga0495675_0000004 Ga0495675_0000004_19070_20086 331
681 3300047444 Ga0495675_0002808 Ga0495675_0002808_3520_4548 331
682 3300047444 Ga0495675_0014801 Ga0495675_0014801_1365_2381 331
683 3300047444 Ga0495675_0015192 Ga0495675_0015192_3009_4019 331
684 3300047471 Ga0495684_0004452 Ga0495684_0004452_7435_8463 331
685 3300047471 Ga0495684_0018973 Ga0495684_0018973_1658_2716 331
686 3300047471 Ga0495684_0020434 Ga0495684_0020434_2018_3028 331
687 3300047471 Ga0495684_0049220 Ga0495684_0049220_1762_2790 331
688 3300047471 Ga0495684_0062945 Ga0495684_0062945_1303_2313 331
689 3300047471 Ga0495684_0076194 Ga0495684_0076194_1030_2040 331
690 3300047673 Ga0495593_0011015 Ga0495593_0011015_66_1100 331
691 3300047673 Ga0495593_0024417 Ga0495593_0024417_1552_2562 331
692 3300047673 Ga0495593_0062139 Ga0495593_0062139_243_1271 331
693 3300048088 Ga0495602_0000009 Ga0495602_0000009_190988_192004 331
694 3300048088 Ga0495602_0000297 Ga0495602_0000297_33497_34525 331
695 3300048088 Ga0495602_0139758 Ga0495602_0139758_655_1653 331
696 3300048088 Ga0495602_0195445 Ga0495602_0195445_307_1335 331
697 3300048089 Ga0495614_0020759 Ga0495614_0020759_13_1023 331
698 3300048089 Ga0495614_0035644 Ga0495614_0035644_702_1736 331
699 3300048903 Ga0496100_0077534 Ga0496100_0077534_773_1783 331
700 3300048906 Ga0496103_0024665 Ga0496103_0024665_1343_2353 331
701 3300048907 Ga0496104_0076412 Ga0496104_0076412_2014_3030 331
702 3300048907 Ga0496104_0077895 Ga0496104_0077895_1842_2852 331
703 3300048908 Ga0496105_0091586 Ga0496105_0091586_856_1866 331
704 3300048909 Ga0496106_0076366 Ga0496106_0076366_663_1697 331
705 3300048909 Ga0496106_0125955 Ga0496106_0125955_14_1024 331
706 3300048910 Ga0496107_0037662 Ga0496107_0037662_1235_2245 331
707 3300048910 Ga0496107_0194935 Ga0496107_0194935_276_1286 331
708 3300048911 Ga0496108_0000012 Ga0496108_0000012_22084_23100 331
709 3300048911 Ga0496108_0002885 Ga0496108_0002885_3017_4051 331
710 3300048911 Ga0496108_0060977 Ga0496108_0060977_1800_2810 331
711 3300048912 Ga0496109_0000076 Ga0496109_0000076_42502_43518 331
712 3300048912 Ga0496109_0032385 Ga0496109_0032385_2160_3182 331
713 3300048912 Ga0496109_0045125 Ga0496109_0045125_207_1241 331
714 3300048912 Ga0496109_0416206 Ga0496109_0416206_27_1052 331
715 3300048913 Ga0496110_0000015 Ga0496110_0000015_15252_16268 331
716 3300048913 Ga0496110_0033575 Ga0496110_0033575_846_1868 331
717 3300048913 Ga0496110_0055285 Ga0496110_0055285_1521_2531 331
718 3300048914 Ga0496111_0000001 Ga0496111_0000001_158560_159576 331
719 3300048914 Ga0496111_0029999 Ga0496111_0029999_2169_3179 331
720 3300048914 Ga0496111_0055218 Ga0496111_0055218_668_1684 331
721 3300048914 Ga0496111_0325613 Ga0496111_0325613_48_1070 331
722 3300048914 Ga0496111_0347667 Ga0496111_0347667_27_1055 331
723 3300048915 Ga0496112_0000250 Ga0496112_0000250_6204_7220 331
724 3300048915 Ga0496112_0012300 Ga0496112_0012300_2746_3780 331
725 3300048915 Ga0496112_0027878 Ga0496112_0027878_2233_3255 331
726 3300048916 Ga0496113_0000039 Ga0496113_0000039_2374_3390 331
727 3300048916 Ga0496113_0139704 Ga0496113_0139704_216_1238 331
728 3300048917 Ga0496114_0054616 Ga0496114_0054616_531_1541 331
729 3300048918 Ga0496115_0007251 Ga0496115_0007251_3219_4253 331
730 3300048929 Ga0496126_0196052 Ga0496126_0196052_330_1340 331
731 3300049571 Ga0501034_0009939 Ga0501034_0009939_8653_9684 331
732 3300049583 Ga0501067_0001837 Ga0501067_0001837_8708_9724 331
733 3300049585 Ga0501069_0002284 Ga0501069_0002284_2349_3365 331
734 3300050507 nmdc:mga05p37_5558_c1 nmdc:mga05p37_5558_c1_10455_11465 331
735 3300050511 nmdc:mga08y16_51567_c2 nmdc:mga08y16_51567_c2_1425_2447 331
736 3300050512 nmdc:mga0n895_111424_c1 nmdc:mga0n895_111424_c1_1158_2168 331
737 3300050512 nmdc:mga0n895_43025_c1 nmdc:mga0n895_43025_c1_1073_2083 331
738 3300050513 nmdc:mga0rr50_137511_c1 nmdc:mga0rr50_137511_c1_19_1029 331
739 3300053077 Ga0495601_0000042 Ga0495601_0000042_30522_31538 331
740 3300053077 Ga0495601_0011568 Ga0495601_0011568_3934_4944 331
741 3300053077 Ga0495601_0039241 Ga0495601_0039241_1273_2289 331
742 3300053077 Ga0495601_0053560 Ga0495601_0053560_90_1118 331
743 3300053077 Ga0495601_0098668 Ga0495601_0098668_789_1799 331
744 3300053078 Ga0495612_0013108 Ga0495612_0013108_1802_2830 331
745 3300053078 Ga0495612_0013937 Ga0495612_0013937_535_1548 331
746 3300053084 Ga0495595_0000005 Ga0495595_0000005_229715_230731 331
747 3300053084 Ga0495595_0002052 Ga0495595_0002052_532_1560 331
748 3300053084 Ga0495595_0053821 Ga0495595_0053821_412_1440 331
749 3300053084 Ga0495595_0092079 Ga0495595_0092079_419_1417 331
750 3300053085 Ga0495619_0000040 Ga0495619_0000040_34598_35614 331
751 3300053085 Ga0495619_0000126 Ga0495619_0000126_27235_28251 331
752 3300053085 Ga0495619_0007828 Ga0495619_0007828_1158_2192 331
753 3300053085 Ga0495619_0008414 Ga0495619_0008414_343_1353 331
754 3300053096 Ga0500641_0002279 Ga0500641_0002279_3363_4379 331
755 3300054114 Ga0501084_0030294 Ga0501084_0030294_2629_3657 331
756 iso_pu_bacteria 2671180195 2671837835 331
757 iso_pu_bacteria 2773857922 2774855991 331
758 iso_pu_bacteria 2775506925 2776375977 331
759 iso_pu_bacteria 2863067949 2863075036 331
760 iso_pu_bacteria 2884693830 2884699581 331
761 iso_pu_bacteria 2895442618 2895443216 331
762 iso_pu_bacteria 8047893842 8047895127 331
763 iso_pu_bacteria 8048356638 8048363923 331
764 iso_pu_bacteria 8048369669 8048372153 331
765 iso_pu_bacteria 8048379754 8048381087 331
766 3300002244 JGI24742J22300_10012159 JGI24742J22300_100121592 332
767 3300005329 Ga0070683_100179933 Ga0070683_1001799332 332
768 3300005330 Ga0070690_100074855 Ga0070690_1000748552 332
769 3300005335 Ga0070666_10028275 Ga0070666_100282751 332
770 3300005336 Ga0070680_100137959 Ga0070680_1001379592 332
771 3300005338 Ga0068868_100012247 Ga0068868_1000122474 332
772 3300005340 Ga0070689_100009128 Ga0070689_1000091285 332
773 3300005341 Ga0070691_10009274 Ga0070691_100092742 332
774 3300005366 Ga0070659_100052543 Ga0070659_1000525432 332
775 3300005437 Ga0070710_10024104 Ga0070710_100241042 332
776 3300005439 Ga0070711_100092238 Ga0070711_1000922382 332
777 3300005440 Ga0070705_100017856 Ga0070705_1000178564 332
778 3300005441 Ga0070700_100008540 Ga0070700_1000085404 332
779 3300005467 Ga0070706_100002130 Ga0070706_1000021308 332
780 3300005467 Ga0070706_100024697 Ga0070706_1000246972 332
781 3300005468 Ga0070707_100009418 Ga0070707_1000094184 332
782 3300005468 Ga0070707_100038877 Ga0070707_1000388772 332
783 3300005471 Ga0070698_100000231 Ga0070698_10000023122 332
784 3300005471 Ga0070698_100002524 Ga0070698_1000025248 332
785 3300005545 Ga0070695_100022929 Ga0070695_1000229293 332
786 3300005563 Ga0068855_100274719 Ga0068855_1002747192 332
787 3300005614 Ga0068856_100130920 Ga0068856_1001309202 332
788 3300005615 Ga0070702_100002284 Ga0070702_1000022849 332
789 3300005841 Ga0068863_100082898 Ga0068863_1000828982 332
790 3300005842 Ga0068858_100079405 Ga0068858_1000794052 332
791 3300005844 Ga0068862_100030058 Ga0068862_1000300582 332
792 3300005937 Ga0081455_10053873 Ga0081455_100538732 332
793 3300006028 Ga0070717_10009210 Ga0070717_100092102 332
794 3300006028 Ga0070717_10063501 Ga0070717_100635013 332
795 3300006163 Ga0070715_10041293 Ga0070715_100412932 332
796 3300006173 Ga0070716_100074708 Ga0070716_1000747082 332
797 3300006175 Ga0070712_100294081 Ga0070712_1002940811 332
798 3300006186 Ga0075369_10008808 Ga0075369_100088083 332
799 3300006237 Ga0097621_100253752 Ga0097621_1002537522 332
800 3300006353 Ga0075370_10150568 Ga0075370_101505681 332
801 3300006358 Ga0068871_100023983 Ga0068871_1000239833 332
802 3300006358 Ga0068871_100052446 Ga0068871_1000524462 332
803 3300009094 Ga0111539_10070745 Ga0111539_100707452 332
804 3300009098 Ga0105245_10001816 Ga0105245_1000181618 332
805 3300009101 Ga0105247_10009690 Ga0105247_100096905 332
806 3300009148 Ga0105243_10003858 Ga0105243_100038588 332
807 3300009174 Ga0105241_10124392 Ga0105241_101243922 332
808 3300009176 Ga0105242_10000325 Ga0105242_1000032514 332
809 3300009177 Ga0105248_10073625 Ga0105248_100736252 332
810 3300009177 Ga0105248_10420112 Ga0105248_104201122 332
811 3300009545 Ga0105237_10024788 Ga0105237_100247882 332
812 3300009553 Ga0105249_10025516 Ga0105249_100255163 332
813 3300010375 Ga0105239_10016972 Ga0105239_100169723 332
814 3300013104 Ga0157370_10334495 Ga0157370_103344952 332
815 3300013105 Ga0157369_10222225 Ga0157369_102222252 332
816 3300013296 Ga0157374_10077156 Ga0157374_100771562 332
817 3300013297 Ga0157378_10009698 Ga0157378_100096985 332
818 3300013306 Ga0163162_10007124 Ga0163162_100071247 332
819 3300013306 Ga0163162_10019114 Ga0163162_100191146 332
820 3300013307 Ga0157372_10002534 Ga0157372_1000253417 332
821 3300013308 Ga0157375_10001489 Ga0157375_100014897 332
822 3300014325 Ga0163163_10108039 Ga0163163_101080392 332
823 3300014326 Ga0157380_10002763 Ga0157380_1000276311 332
824 3300014968 Ga0157379_10006987 Ga0157379_100069872 332
825 3300014968 Ga0157379_10015635 Ga0157379_100156355 332
826 3300025303 Ga0209051_1044455 Ga0209051_10444551 332
827 3300025898 Ga0207692_10046926 Ga0207692_100469262 332
828 3300025904 Ga0207647_10124002 Ga0207647_101240022 332
829 3300025910 Ga0207684_10002157 Ga0207684_100021578 332
830 3300025910 Ga0207684_10020758 Ga0207684_100207586 332
831 3300025914 Ga0207671_10052185 Ga0207671_100521852 332
832 3300025915 Ga0207693_10244588 Ga0207693_102445881 332
833 3300025922 Ga0207646_10024119 Ga0207646_100241194 332
834 3300025922 Ga0207646_10045626 Ga0207646_100456262 332
835 3300025928 Ga0207700_10092321 Ga0207700_100923212 332
836 3300025929 Ga0207664_10121767 Ga0207664_101217672 332
837 3300025941 Ga0207711_10071956 Ga0207711_100719562 332
838 3300025961 Ga0207712_10043824 Ga0207712_100438243 332
839 3300025986 Ga0207658_10025320 Ga0207658_100253203 332
840 3300026023 Ga0207677_10154556 Ga0207677_101545562 332
841 3300026035 Ga0207703_10055569 Ga0207703_100555692 332
842 3300026035 Ga0207703_10094172 Ga0207703_100941722 332
843 3300026088 Ga0207641_10124906 Ga0207641_101249061 332
844 3300026116 Ga0207674_10181029 Ga0207674_101810292 332
845 3300026142 Ga0207698_10035785 Ga0207698_100357852 332
846 3300028379 Ga0268266_10128859 Ga0268266_101288592 332
847 3300028380 Ga0268265_10036094 Ga0268265_100360943 332
848 3300028666 Ga0265336_10017714 Ga0265336_100177141 332
849 3300028800 Ga0265338_10000743 Ga0265338_1000074336 332
850 3300035086 Ga0373934_0033071 Ga0373934_0033071_425_1459 332
851 3300035113 Ga0373936_0111202 Ga0373936_0111202_29_1063 332
852 3300035117 Ga0373953_0021007 Ga0373953_0021007_332_1366 332
853 3300035172 Ga0373955_0112163 Ga0373955_0112163_334_1368 332
854 3300035398 Ga0316574_0004911 Ga0316574_0004911_5866_6897 332
855 3300035724 Ga0373933_0173855 Ga0373933_0173855_324_1358 332
856 3300046454 Ga0495592_0039236 Ga0495592_0039236_98_1132 332
857 3300046460 Ga0495638_0009577 Ga0495638_0009577_321_1334 332
858 3300046461 Ga0495641_0044539 Ga0495641_0044539_335_1369 332
859 3300046462 Ga0495651_0001591 Ga0495651_0001591_11709_12743 332
860 3300046475 Ga0495639_0022336 Ga0495639_0022336_727_1761 332
861 3300046476 Ga0495662_0026802 Ga0495662_0026802_819_1853 332
862 3300046477 Ga0495664_0129065 Ga0495664_0129065_355_1389 332
863 3300046511 Ga0495608_0004767 Ga0495608_0004767_997_2031 332
864 3300046514 Ga0495618_0123121 Ga0495618_0123121_590_1624 332
865 3300046517 Ga0495630_0041672 Ga0495630_0041672_149_1228 332
866 3300046522 Ga0495643_0003383 Ga0495643_0003383_6952_7983 332
867 3300046529 Ga0495652_0097219 Ga0495652_0097219_318_1352 332
868 3300046531 Ga0495665_0049028 Ga0495665_0049028_1155_2189 332
869 3300046533 Ga0495640_0012108 Ga0495640_0012108_1776_2810 332
870 3300046533 Ga0495640_0013029 Ga0495640_0013029_4311_5342 332
871 3300046533 Ga0495640_0058215 Ga0495640_0058215_255_1334 332
872 3300046536 Ga0495587_0010133 Ga0495587_0010133_4792_5826 332
873 3300046543 Ga0495645_0080182 Ga0495645_0080182_52_1086 332
874 3300046543 Ga0495645_0167300 Ga0495645_0167300_56_1090 332
875 3300046642 Ga0495634_0027996 Ga0495634_0027996_1901_2935 332
876 3300046642 Ga0495634_0121004 Ga0495634_0121004_405_1436 332
877 3300046663 Ga0495635_0006536 Ga0495635_0006536_4807_5841 332
878 3300046675 Ga0495657_0016245 Ga0495657_0016245_605_1636 332
879 3300046675 Ga0495657_0053587 Ga0495657_0053587_1441_2475 332
880 3300046678 Ga0495599_0027822 Ga0495599_0027822_120_1154 332
881 3300046679 Ga0495623_0058226 Ga0495623_0058226_360_1394 332
882 3300046680 Ga0495646_0014864 Ga0495646_0014864_3065_4099 332
883 3300046689 Ga0495613_0028981 Ga0495613_0028981_2845_3858 332
884 3300046690 Ga0495624_0042139 Ga0495624_0042139_378_1409 332
885 3300046809 Ga0495600_0050961 Ga0495600_0050961_1173_2213 332
886 3300047315 Ga0495581_0038893 Ga0495581_0038893_1348_2379 332
887 3300047317 Ga0495604_0036151 Ga0495604_0036151_2511_3542 332
888 3300047319 Ga0495674_0015523 Ga0495674_0015523_2948_4027 332
889 3300047319 Ga0495674_0055126 Ga0495674_0055126_1258_2292 332
890 3300047320 Ga0495672_0023757 Ga0495672_0023757_2913_3926 332
891 3300047322 Ga0495680_0004034 Ga0495680_0004034_8330_9364 332
892 3300047444 Ga0495675_0020477 Ga0495675_0020477_1915_2949 332
893 3300047673 Ga0495593_0016581 Ga0495593_0016581_2268_3299 332
894 3300047673 Ga0495593_0050660 Ga0495593_0050660_809_1840 332
895 3300048088 Ga0495602_0042892 Ga0495602_0042892_1826_2860 332
896 3300048089 Ga0495614_0023298 Ga0495614_0023298_1045_2076 332
897 3300048903 Ga0496100_0040807 Ga0496100_0040807_1305_2315 332
898 3300048904 Ga0496101_0005422 Ga0496101_0005422_5942_6952 332
899 3300048905 Ga0496102_0005112 Ga0496102_0005112_2267_3277 332
900 3300048905 Ga0496102_0046003 Ga0496102_0046003_1040_2074 332
901 3300048905 Ga0496102_0067777 Ga0496102_0067777_1606_2637 332
902 3300048906 Ga0496103_0001480 Ga0496103_0001480_12383_13393 332
903 3300048907 Ga0496104_0102693 Ga0496104_0102693_1223_2257 332
904 3300048908 Ga0496105_0010084 Ga0496105_0010084_2614_3648 332
905 3300048909 Ga0496106_0002660 Ga0496106_0002660_1335_2345 332
906 3300048909 Ga0496106_0090074 Ga0496106_0090074_726_1760 332
907 3300048910 Ga0496107_0001604 Ga0496107_0001604_2295_3305 332
908 3300048912 Ga0496109_0020426 Ga0496109_0020426_1195_2229 332
909 3300048913 Ga0496110_0024029 Ga0496110_0024029_367_1401 332
910 3300048914 Ga0496111_0004168 Ga0496111_0004168_3336_4370 332
911 3300048915 Ga0496112_0157464 Ga0496112_0157464_740_1774 332
912 3300048916 Ga0496113_0035974 Ga0496113_0035974_1341_2375 332
913 3300048917 Ga0496114_0002063 Ga0496114_0002063_5279_6289 332
914 3300048917 Ga0496114_0022716 Ga0496114_0022716_3918_4967 332
915 3300048918 Ga0496115_0046554 Ga0496115_0046554_1582_2592 332
916 3300048924 Ga0496121_0184873 Ga0496121_0184873_249_1250 332
917 3300049572 Ga0501036_0163426 Ga0501036_0163426_55_1104 332
918 3300049588 Ga0501072_0068519 Ga0501072_0068519_1088_2149 332
919 3300050494 nmdc:mga06z11_126144_c1 nmdc:mga06z11_126144_c1_261_1262 332
920 3300050496 nmdc:mga07m45_16415_c1 nmdc:mga07m45_16415_c1_2466_3497 332
921 3300053077 Ga0495601_0042188 Ga0495601_0042188_331_1365 332
922 3300053084 Ga0495595_0021151 Ga0495595_0021151_1173_2207 332
923 3300053085 Ga0495619_0046481 Ga0495619_0046481_25_1059 332
924 3300053098 Ga0500650_0056890 Ga0500650_0056890_609_1622 332
925 3300053122 Ga0500608_047987 Ga0500608_047987_60_1073 332
926 3300053146 Ga0500588_0053691 Ga0500588_0053691_162_1163 332
927 3300053730 Ga0500645_000054 Ga0500645_000054_45592_46605 332
928 iso_pu_bacteria 2616644814 2616693556 332
929 iso_pu_bacteria 2738541274 2738704002 332
930 iso_pu_bacteria 2738543028 2739334376 332

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

8

164

0.97

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

191

229

0.87

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

8

101

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4e21-assembly1.cif.gz_B-2 the crystal structure of 6-phosphogluconate dehydrogenase from geobacter metallireducens 0.968 1 324
4e21-assembly1.cif.gz_A-2 the crystal structure of 6-phosphogluconate dehydrogenase from geobacter metallireducens 0.9615 1 322
4e21-assembly1.cif.gz_B-2 the crystal structure of 6-phosphogluconate dehydrogenase from geobacter metallireducens 0.9472 1 324
4e21-assembly1.cif.gz_A-2 the crystal structure of 6-phosphogluconate dehydrogenase from geobacter metallireducens 0.9436 1 322
6vpb-assembly1.cif.gz_A-2 a novel membrane-bound 6-phosphogluconate dehydrogenase from the acetic acid bacteria gluconacetobacter diazotrophicus (gd6pgd) 0.9201 2 327
ID Description Score Start End Superfamily
4e21A02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9806 176 320 1.10.1040.10
4e21B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9672 2 175 3.40.50.720
4e21A02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9656 176 320 1.10.1040.10
4e21B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9397 2 175 3.40.50.720
af_Q4DU92_1_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.938 2 132 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4U3ASQ3-F1-model_v4 deleted 0.9983 2 101
AF-A0A535SKF7-F1-model_v4 6-phosphogluconate dehydrogenase NADP-binding domain-containing protein 0.9974 1 109 GO:0004616
GO:0050661
AF-A0A5E8XFU2-F1-model_v4 deleted 0.996 1 101
AF-A0A2W5XZ41-F1-model_v4 6-phosphogluconate dehydrogenase (Decarboxylating) 0.9952 1 148 GO:0004616
GO:0042558
GO:0050661
AF-A0A2M7WZ84-F1-model_v4 6-phosphogluconate dehydrogenase (Decarboxylating) 0.9951 1 148 GO:0004616
GO:0050661

Feature Viewer

pLDDT pTM Quality
90.72 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map