F485874

General Info

Members Datasets Scaffolds Average Seq Length
924 464 1848 236

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2547132111|2547412972
Length 271
Sequence TPHPAPAHPASAHATSAQPGPSTTRPLTASRTTATAARVLRQLAHDPRTIALLLVIPCLMLFLLRYVFDGSPRTFDTIGASLLGIFPLITMFLVTSIATLRERTSGTLERLLAMPLGKGDLIAGYALAFGTLAIVQSALATGLAVWFLGLDVTGSPWLLLLVALLDALLGTALGLFVSAFAASEFQAVQFMPAVIFPQLLLCGLFTPRDDMHPALEAISDVLPMSYAVDGMNEVLRHTDMTAAFVRDALIVAGCALLVLALGAATLKRRTA

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
86 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
127 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
128 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
132 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
133 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
134 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
135 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
136 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
137 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
140 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
141 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
142 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
143 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
144 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
154 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
155 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
156 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
157 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
159 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
160 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
165 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
179 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
180 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
181 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
182 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
183 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
184 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
185 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
186 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
187 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
188 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
189 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
190 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
191 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
192 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
193 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
194 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
195 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
196 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
197 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
198 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
199 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
200 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
201 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
202 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
203 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
204 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
205 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
206 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
207 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
208 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
215 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
220 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
221 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
222 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
225 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
226 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
227 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
228 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
229 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
230 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
231 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
232 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
233 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
234 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
235 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
236 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
237 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
238 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
239 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
240 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
241 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
242 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
243 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
244 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
245 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
246 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
247 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
248 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
249 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
250 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
251 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
252 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
253 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
254 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
255 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
256 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
257 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
258 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
259 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
260 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
261 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
262 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
263 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
264 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
265 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
266 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
267 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
268 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
269 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
270 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
271 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
272 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
273 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
274 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
275 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
276 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
277 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
278 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
279 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
280 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
281 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
282 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
283 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
284 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
285 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
286 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
287 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
288 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
289 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
290 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
291 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
292 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
293 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
294 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
295 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
296 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
297 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
298 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
299 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
300 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
301 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
302 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
303 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
304 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
305 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
306 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
307 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
308 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
309 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
323 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
324 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
325 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
326 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
327 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
328 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
329 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
330 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
331 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
332 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
333 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
334 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
335 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
336 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
339 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
340 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
341 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
342 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
343 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
344 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
345 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
346 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
347 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
348 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
349 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
350 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
351 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
352 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
353 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
354 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
355 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
356 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
357 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
358 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
359 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
360 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
361 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
362 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
363 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
364 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
365 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
366 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
367 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
368 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
369 2547132424 Nocardia nova SH22a Isolate Unclassified
370 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
371 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
372 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
373 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
374 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
375 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
376 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
377 2643221548 Streptomyces sp. Root55 Isolate Unclassified
378 2643221578 Streptomyces sp. Root63 Isolate Unclassified
379 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
380 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
381 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
382 2643221647 Streptomyces sp. Root369 Isolate Unclassified
383 2643221670 Streptomyces sp. Root431 Isolate Unclassified
384 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
385 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
386 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
387 2643221679 Angustibacter sp. Root456 Isolate Unclassified
388 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
389 2643221692 Nocardia sp. Root136 Isolate Unclassified
390 2643221714 Streptomyces sp. Root264 Isolate Unclassified
391 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
392 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
393 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
394 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
395 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
396 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
397 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
398 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
399 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
400 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
401 2808606448 Streptomyces sp. 193411 Isolate Unclassified
402 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
403 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
404 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
405 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
406 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
407 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
408 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
409 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
410 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
411 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
412 2862574272 Streptomyces sp. AcE210 Isolate Nodule
413 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
414 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
415 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
416 2867369537 Streptomyces sp. Z26 Isolate Unclassified
417 2867428634 Streptomyces sp. RP5T Isolate Unclassified
418 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
419 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
420 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
421 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
422 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
423 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
424 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
425 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
426 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
427 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
428 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
429 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
430 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
431 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
432 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
433 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
434 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
435 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
436 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
437 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
438 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
439 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
440 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
441 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
442 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
443 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
444 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
445 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
446 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
447 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
448 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
449 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
450 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
451 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
452 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
453 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
454 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
455 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
456 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
457 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
458 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
459 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
460 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
461 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
462 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
463 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
464 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.07
Metatranscriptomes 0.43
Isolates 10.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.25
Nodule 0.32
Rhizoplane 8.44
Rhizosphere 79.22
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10095448 3300001989 Bacteria 901
2 JGI24737J22298_10091489 3300001990 Bacteria 902
3 JGI24735J21928_10038438 3300002067 Bacteria 1401
4 JGI25406J46586_10065161 3300003203 Bacteria 1162
5 rootH1_10009519 3300003323 Bacteria 1078
6 JGI25407J50210_10002838 3300003373 Bacteria 4122
7 JGI25407J50210_10009296 3300003373 Bacteria 2488
8 Ga0006562J51391_1016685 3300003578 Bacteria 3230
9 Ga0006562J51391_1016687 3300003578 Bacteria 5610
10 Ga0006562J51391_1120034 3300003578 Bacteria 3517
11 Ga0070683_100111204 3300005329 Bacteria 2584
12 Ga0068869_100154845 3300005334 Bacteria 1780
13 Ga0070680_100085086 3300005336 Bacteria 2612
14 Ga0070680_100514626 3300005336 Bacteria 1024
15 Ga0070682_100028616 3300005337 Bacteria 3352
16 Ga0068868_100022277 3300005338 Bacteria 4778
17 Ga0068868_100210160 3300005338 Bacteria 1626
18 Ga0070660_100473790 3300005339 Bacteria 1040
19 Ga0070691_10009540 3300005341 Bacteria 4432
20 Ga0070691_10212243 3300005341 Bacteria 1022
21 Ga0070687_100313886 3300005343 Bacteria 999
22 Ga0070692_10008927 3300005345 Bacteria 4494
23 Ga0070692_10068630 3300005345 Bacteria 1884
24 Ga0070692_10117604 3300005345 Bacteria 1478
25 Ga0070668_100147120 3300005347 Bacteria 1902
26 Ga0070675_100386750 3300005354 Bacteria 1246
27 Ga0070659_100015188 3300005366 Bacteria 5762
28 Ga0070659_100294401 3300005366 Bacteria 1352
29 Ga0070714_100030707 3300005435 Bacteria 4475
30 Ga0070714_100045145 3300005435 Bacteria 3733
31 Ga0070714_100048535 3300005435 Bacteria 3611
32 Ga0070714_100065941 3300005435 Bacteria 3119
33 Ga0070713_100119269 3300005436 Bacteria 2311
34 Ga0070710_10267143 3300005437 Bacteria 1105
35 Ga0070701_10147881 3300005438 Bacteria 1350
36 Ga0070711_100140150 3300005439 Bacteria 1812
37 Ga0070711_100335095 3300005439 Bacteria 1212
38 Ga0070705_100098396 3300005440 Bacteria 1841
39 Ga0070708_100237995 3300005445 Bacteria 1709
40 Ga0070663_100192525 3300005455 Bacteria 1588
41 Ga0070663_100328378 3300005455 Bacteria 1232
42 Ga0070663_100364470 3300005455 Bacteria 1173
43 Ga0070681_10123135 3300005458 Bacteria 2526
44 Ga0068867_100220308 3300005459 Bacteria 1529
45 Ga0070698_100000205 3300005471 Bacteria 56962
46 Ga0070699_100036144 3300005518 Bacteria 4272
47 Ga0070679_100005026 3300005530 Bacteria 12206
48 Ga0070679_100052534 3300005530 Bacteria 4058
49 Ga0070679_100328146 3300005530 Bacteria 1479
50 Ga0070684_100011688 3300005535 Bacteria 7001
51 Ga0070684_100046743 3300005535 Bacteria 3751
52 Ga0070684_100064838 3300005535 Bacteria 3205
53 Ga0070684_100199149 3300005535 Bacteria 1824
54 Ga0068853_100289236 3300005539 Bacteria 1512
55 Ga0070672_100153162 3300005543 Bacteria 1908
56 Ga0070672_100472670 3300005543 Bacteria 1082
57 Ga0070672_100817296 3300005543 Bacteria 821
58 Ga0070696_100207248 3300005546 Bacteria 1466
59 Ga0070665_100449331 3300005548 Bacteria 1298
60 Ga0068855_100059913 3300005563 Bacteria 4453
61 Ga0068855_100290738 3300005563 Bacteria 1812
62 Ga0068855_100462769 3300005563 Bacteria 1383
63 Ga0070664_100005522 3300005564 Bacteria 10150
64 Ga0070664_100046190 3300005564 Bacteria 3679
65 Ga0070664_100095346 3300005564 Bacteria 2581
66 Ga0070664_100137236 3300005564 Bacteria 2151
67 Ga0070664_100617928 3300005564 Bacteria 1006
68 Ga0068857_100053192 3300005577 Bacteria 3593
69 Ga0068857_100195209 3300005577 Bacteria 1844
70 Ga0068857_100434341 3300005577 Bacteria 1226
71 Ga0068857_100754074 3300005577 Bacteria 927
72 Ga0068854_100108151 3300005578 Bacteria 2094
73 Ga0068856_100010453 3300005614 Bacteria 9009
74 Ga0070702_100323459 3300005615 Bacteria 1076
75 Ga0070702_100508235 3300005615 Bacteria 886
76 Ga0068852_100198436 3300005616 Bacteria 1898
77 Ga0068852_100293781 3300005616 Bacteria 1571
78 Ga0068852_100672717 3300005616 Bacteria 1044
79 Ga0068851_10058238 3300005834 Bacteria 1974
80 Ga0068860_100000742 3300005843 Bacteria 37185
81 Ga0068860_100009354 3300005843 Bacteria 9737
82 Ga0081455_10023374 3300005937 Bacteria 5752
83 Ga0081455_10126402 3300005937 Bacteria 2006
84 Ga0081455_10136246 3300005937 Bacteria 1913
85 Ga0081455_10190643 3300005937 Bacteria 1544
86 Ga0081538_10000290 3300005981 Bacteria 57591
87 Ga0081538_10000706 3300005981 Bacteria 36619
88 Ga0081538_10005735 3300005981 Bacteria 11096
89 Ga0081539_10006522 3300005985 Bacteria 11144
90 Ga0081539_10025573 3300005985 Bacteria 3796
91 Ga0081539_10148639 3300005985 Bacteria 1130
92 Ga0070717_10018838 3300006028 Bacteria 5399
93 Ga0070717_10124757 3300006028 Bacteria 2210
94 Ga0075365_10068736 3300006038 Bacteria 2380
95 Ga0075365_10267272 3300006038 Bacteria 1203
96 Ga0075365_10424678 3300006038 Bacteria 938
97 Ga0075363_100076040 3300006048 Bacteria 1830
98 Ga0075363_100101656 3300006048 Bacteria 1591
99 Ga0075363_100181904 3300006048 Bacteria 1196
100 Ga0070716_100006557 3300006173 Bacteria 5689
101 Ga0070712_100257498 3300006175 Bacteria 1397
102 Ga0070712_100261565 3300006175 Bacteria 1387
103 Ga0075370_10056496 3300006353 Bacteria 2231
104 Ga0075370_10087701 3300006353 Bacteria 1793
105 Ga0068871_100235177 3300006358 Bacteria 1591
106 Ga0075428_100057946 3300006844 Bacteria 4241
107 Ga0075428_100509097 3300006844 Bacteria 1288
108 Ga0075428_100581333 3300006844 Bacteria 1197
109 Ga0075428_100804655 3300006844 Bacteria 999
110 Ga0075430_100036563 3300006846 Bacteria 4164
111 Ga0075430_100153103 3300006846 Bacteria 1920
112 Ga0075431_100231966 3300006847 Bacteria 1880
113 Ga0075431_100555278 3300006847 Bacteria 1135
114 Ga0075434_100277896 3300006871 Bacteria 1694
115 Ga0075429_100068196 3300006880 Bacteria 3096
116 Ga0105244_10057637 3300009036 Bacteria 1962
117 Ga0111539_10020276 3300009094 Bacteria 8191
118 Ga0111539_10451127 3300009094 Bacteria 1497
119 Ga0105245_10016564 3300009098 Bacteria 6431
120 Ga0105245_10269432 3300009098 Bacteria 1660
121 Ga0105245_10310197 3300009098 Bacteria 1551
122 Ga0105245_10818042 3300009098 Bacteria 970
123 Ga0114129_10046964 3300009147 Bacteria 6068
124 Ga0114129_10080443 3300009147 Bacteria 4529
125 Ga0114129_10406302 3300009147 Bacteria 1794
126 Ga0114129_10442049 3300009147 Bacteria 1707
127 Ga0114129_10774185 3300009147 Bacteria 1226
128 Ga0105243_10131523 3300009148 Bacteria 2123
129 Ga0105243_10139026 3300009148 Bacteria 2070
130 Ga0105243_10419843 3300009148 Bacteria 1247
131 Ga0105242_10529289 3300009176 Bacteria 1126
132 Ga0105248_10518479 3300009177 Bacteria 1344
133 Ga0105237_10086971 3300009545 Bacteria 3115
134 Ga0105237_10241683 3300009545 Bacteria 1807
135 Ga0105237_10436683 3300009545 Bacteria 1315
136 Ga0105238_10079697 3300009551 Bacteria 3265
137 Ga0105238_10389841 3300009551 Bacteria 1385
138 Ga0105249_10228456 3300009553 Bacteria 1834
139 Ga0105239_10175022 3300010375 Bacteria 2400
140 Ga0105239_10184263 3300010375 Bacteria 2336
141 Ga0105239_10700416 3300010375 Bacteria 1158
142 Ga0105246_10018547 3300011119 Bacteria 4436
143 Ga0157369_10274856 3300013105 Bacteria 1755
144 Ga0157369_10684887 3300013105 Bacteria 1056
145 Ga0157369_10851449 3300013105 Bacteria 936
146 Ga0157374_10200004 3300013296 Bacteria 1956
147 Ga0157378_10704994 3300013297 Bacteria 1029
148 Ga0163162_10035725 3300013306 Bacteria 4951
149 Ga0163162_10048311 3300013306 Bacteria 4263
150 Ga0157372_10021291 3300013307 Bacteria 7004
151 Ga0157372_10231700 3300013307 Bacteria 2141
152 Ga0157372_10384271 3300013307 Bacteria 1636
153 Ga0157372_10935116 3300013307 Bacteria 1005
154 Ga0157372_10967032 3300013307 Bacteria 987
155 Ga0157375_10030082 3300013308 Bacteria 5115
156 Ga0157375_10480366 3300013308 Bacteria 1408
157 Ga0157375_11109478 3300013308 Bacteria 926
158 Ga0163163_10030934 3300014325 Bacteria 5161
159 Ga0163163_10337988 3300014325 Bacteria 1561
160 Ga0163163_11039905 3300014325 Bacteria 882
161 Ga0157380_10258559 3300014326 Bacteria 1580
162 Ga0182008_10006311 3300014497 Bacteria 6644
163 Ga0157377_10280012 3300014745 Bacteria 1093
164 Ga0157376_10336520 3300014969 Bacteria 1440
165 Ga0182007_10006346 3300015262 Bacteria 5083
166 Ga0183367_1015 3300015688 Bacteria 298435
167 Ga0206353_11058284 3300020082 Bacteria 1025
168 Ga0209758_1003745 3300025297 Bacteria 13467
169 Ga0207426_1002560 3300025302 Bacteria 11375
170 Ga0207426_1029729 3300025302 Bacteria 1798
171 Ga0207688_10018280 3300025901 Bacteria 3816
172 Ga0207688_10176137 3300025901 Bacteria 1274
173 Ga0207647_10016173 3300025904 Bacteria 5093
174 Ga0207647_10232887 3300025904 Bacteria 1059
175 Ga0207699_10054874 3300025906 Bacteria 2369
176 Ga0207707_10616410 3300025912 Bacteria 917
177 Ga0207693_10207873 3300025915 Bacteria 1539
178 Ga0207663_10083270 3300025916 Bacteria 2101
179 Ga0207663_10380970 3300025916 Bacteria 1074
180 Ga0207660_10031917 3300025917 Bacteria 3633
181 Ga0207660_10148189 3300025917 Bacteria 1801
182 Ga0207660_10225569 3300025917 Bacteria 1472
183 Ga0207662_10032757 3300025918 Bacteria 3026
184 Ga0207662_10233946 3300025918 Bacteria 1201
185 Ga0207657_10241803 3300025919 Bacteria 1441
186 Ga0207652_10169240 3300025921 Bacteria 1960
187 Ga0207659_10434544 3300025926 Bacteria 1103
188 Ga0207687_10085146 3300025927 Bacteria 2293
189 Ga0207687_10112647 3300025927 Bacteria 2022
190 Ga0207700_10000001 3300025928 Bacteria 1122509
191 Ga0207664_10005315 3300025929 Bacteria 8797
192 Ga0207664_10019791 3300025929 Bacteria 4981
193 Ga0207664_10063049 3300025929 Bacteria 2962
194 Ga0207664_10193442 3300025929 Bacteria 1752
195 Ga0207690_10004152 3300025932 Bacteria 8564
196 Ga0207690_10117549 3300025932 Bacteria 1925
197 Ga0207709_10084910 3300025935 Bacteria 2051
198 Ga0207709_10710115 3300025935 Bacteria 805
199 Ga0207669_10599671 3300025937 Bacteria 895
200 Ga0207665_10002267 3300025939 Bacteria 12982
201 Ga0207689_10045569 3300025942 Bacteria 3625
202 Ga0207661_10068071 3300025944 Bacteria 2898
203 Ga0207661_10099321 3300025944 Bacteria 2441
204 Ga0207661_10160672 3300025944 Bacteria 1949
205 Ga0207679_10068035 3300025945 Bacteria 2674
206 Ga0207679_10154393 3300025945 Bacteria 1872
207 Ga0207679_10204592 3300025945 Bacteria 1651
208 Ga0207679_10278450 3300025945 Bacteria 1434
209 Ga0207667_10187389 3300025949 Bacteria 2123
210 Ga0207667_10257284 3300025949 Bacteria 1785
211 Ga0207712_10471437 3300025961 Bacteria 1068
212 Ga0207668_10105394 3300025972 Bacteria 2104
213 Ga0207640_10289183 3300025981 Bacteria 1291
214 Ga0207639_10151683 3300026041 Bacteria 1942
215 Ga0207639_11079339 3300026041 Bacteria 753
216 Ga0207678_10190458 3300026067 Bacteria 1752
217 Ga0207678_10311782 3300026067 Bacteria 1353
218 Ga0207702_10210965 3300026078 Bacteria 1805
219 Ga0207702_10362823 3300026078 Bacteria 1389
220 Ga0207702_10552483 3300026078 Bacteria 1126
221 Ga0207648_10047000 3300026089 Bacteria 3784
222 Ga0207674_10213382 3300026116 Bacteria 1879
223 Ga0207674_10316910 3300026116 Bacteria 1509
224 Ga0207683_10185233 3300026121 Bacteria 1889
225 Ga0207683_10320000 3300026121 Bacteria 1421
226 Ga0207683_10587482 3300026121 Bacteria 1030
227 Ga0207698_10295349 3300026142 Bacteria 1506
228 Ga0209371_1027823 3300027312 Bacteria 1268
229 Ga0268266_10036141 3300028379 Bacteria 4203
230 Ga0268266_10125012 3300028379 Bacteria 2294
231 Ga0268265_10370700 3300028380 Bacteria 1314
232 Ga0268264_10000238 3300028381 Bacteria 105229
233 Ga0265319_1038466 3300028563 Bacteria 1626
234 Ga0265318_10027106 3300028577 Bacteria 2253
235 Ga0307517_10004143 3300028786 Bacteria 22365
236 Ga0307517_10033990 3300028786 Bacteria 5826
237 Ga0307517_10092322 3300028786 Bacteria 2464
238 Ga0307515_10007000 3300028794 Bacteria 22397
239 Ga0307515_10226172 3300028794 Bacteria 1675
240 Ga0265338_10000625 3300028800 Bacteria 61650
241 Ga0265338_10093439 3300028800 Bacteria 2478
242 Ga0265324_10067306 3300029957 Bacteria 1222
243 Ga0268256_1031578 3300030500 Bacteria 1270
244 Ga0307511_10019620 3300030521 Bacteria 6421
245 Ga0307512_10004971 3300030522 Bacteria 14176
246 Ga0265320_10040625 3300031240 Bacteria 2318
247 Ga0265340_10032297 3300031247 Bacteria 2614
248 Ga0265331_10125670 3300031250 Bacteria 1172
249 Ga0265316_10064106 3300031344 Bacteria 2847
250 Ga0307513_10003894 3300031456 Bacteria 20080
251 Ga0307513_10136363 3300031456 Bacteria 2389
252 Ga0307513_10142269 3300031456 Bacteria 2323
253 Ga0307509_10033033 3300031507 Bacteria 5697
254 Ga0307509_10034766 3300031507 Bacteria 5536
255 Ga0265313_10010904 3300031595 Bacteria 5700
256 Ga0307508_10017100 3300031616 Bacteria 6595
257 Ga0307508_10079511 3300031616 Bacteria 2859
258 Ga0307508_10237097 3300031616 Bacteria 1422
259 Ga0307514_10008187 3300031649 Bacteria 8931
260 Ga0316579_10093380 3300031691 Bacteria 1438
261 Ga0265314_10102708 3300031711 Bacteria 1834
262 Ga0307516_10025490 3300031730 Bacteria 6021
263 Ga0307516_10333243 3300031730 Bacteria 1186
264 Ga0307413_10001674 3300031824 Bacteria 8620
265 Ga0307518_10233205 3300031838 Bacteria 1189
266 Ga0307410_10008804 3300031852 Bacteria 5623
267 Ga0307410_10184648 3300031852 Bacteria 1582
268 Ga0307407_10142859 3300031903 Bacteria 1546
269 Ga0307409_100212600 3300031995 Bacteria 1739
270 Ga0307409_100351871 3300031995 Bacteria 1390
271 Ga0307409_100367536 3300031995 Bacteria 1363
272 Ga0307416_100174823 3300032002 Bacteria 2004
273 Ga0307507_10000005 3300033179 Bacteria 281494
274 Ga0307507_10025944 3300033179 Bacteria 6333
275 Ga0307507_10215066 3300033179 Bacteria 1303
276 Ga0307510_10026883 3300033180 Bacteria 6605
277 Ga0307510_10063541 3300033180 Bacteria 3759
278 Ga0307510_10084620 3300033180 Bacteria 3053
279 Ga0307510_10175902 3300033180 Bacteria 1711
280 Ga0307510_10203168 3300033180 Bacteria 1513
281 Ga0373934_0193078 3300035086 Bacteria 838
282 Ga0373944_0009573 3300035089 Bacteria 2630
283 Ga0373936_0018705 3300035113 Bacteria 2678
284 Ga0373945_0006731 3300035116 Bacteria 3713
285 Ga0373953_0060045 3300035117 Bacteria 1553
286 Ga0373956_0245138 3300035119 Bacteria 852
287 Ga0373943_0001754 3300035170 Bacteria 9822
288 Ga0373946_0059247 3300035171 Bacteria 1624
289 Ga0373955_0038200 3300035172 Bacteria 2557
290 Ga0316574_0066613 3300035398 Bacteria 2269
291 Ga0316574_0196893 3300035398 Bacteria 1295
292 Ga0373924_0004634 3300035410 Bacteria 4820
293 Ga0373935_0001379 3300035692 Bacteria 13421
294 Ga0373927_0147860 3300035695 Bacteria 1538
295 Ga0373933_0145794 3300035724 Bacteria 1497
296 Ga0373947_0000226 3300035725 Bacteria 31559
297 Ga0373937_0022211 3300036401 Bacteria 5702
298 Ga0373937_0139961 3300036401 Bacteria 2264
299 Ga0373937_0344400 3300036401 Bacteria 1411
300 Ga0316582_0131663 3300036647 Bacteria 1680
301 Ga0373925_0001646 3300037068 Bacteria 18823
302 Ga0373925_0226686 3300037068 Bacteria 1493
303 Ga0395899_0001716 3300037312 Bacteria 18224
304 Ga0395900_0088333 3300037418 Bacteria 3187
305 Ga0395900_0106748 3300037418 Bacteria 2877
306 Ga0395900_0265621 3300037418 Bacteria 1712
307 Ga0395900_0340967 3300037418 Bacteria 1474
308 Ga0395898_0002109 3300037466 Bacteria 24644
309 Ga0395898_0003292 3300037466 Bacteria 18144
310 Ga0395898_0163335 3300037466 Bacteria 2130
311 Ga0395898_0454358 3300037466 Bacteria 1220
312 Ga0395905_0147818 3300037471 Bacteria 2211
313 Ga0395905_0235169 3300037471 Bacteria 1713
314 Ga0395905_0266366 3300037471 Bacteria 1599
315 Ga0395901_0017382 3300038443 Bacteria 7342
316 Ga0395901_0250568 3300038443 Bacteria 1845
317 Ga0395901_0299344 3300038443 Bacteria 1668
318 Ga0395901_0319280 3300038443 Bacteria 1607
319 Ga0395901_0719709 3300038443 Bacteria 994
320 Ga0439436_0000544 3300041404 Bacteria 9915
321 Ga0439436_0066954 3300041404 Bacteria 1002
322 Ga0451800_0617174 3300041459 Bacteria 1109
323 Ga0451837_1298709 3300041494 Bacteria 3142
324 Ga0451845_0745478 3300041501 Bacteria 1586
325 Ga0451849_1194329 3300041505 Bacteria 950
326 Ga0451853_0760780 3300041512 Bacteria 1432
327 Ga0451853_1262046 3300041512 Bacteria 6496
328 Ga0451853_1799241 3300041512 Bacteria 4970
329 Ga0439433_0001673 3300041999 Bacteria 4623
330 Ga0439433_0007983 3300041999 Bacteria 2289
331 Ga0439448_0012885 3300042005 Bacteria 2508
332 Ga0439432_016449 3300042006 Bacteria 2489
333 Ga0439449_0010032 3300042007 Bacteria 3583
334 Ga0439449_0014176 3300042007 Bacteria 2996
335 Ga0439455_0017576 3300042012 Bacteria 1668
336 Ga0439457_000818 3300042014 Bacteria 9305
337 Ga0439457_001534 3300042014 Bacteria 6930
338 Ga0439462_0025343 3300042015 Bacteria 1561
339 Ga0439462_0049922 3300042015 Bacteria 1123
340 Ga0450894_001082 3300042131 Bacteria 4118
341 Ga0450896_001747 3300042133 Bacteria 2729
342 Ga0450898_000748 3300042134 Bacteria 3979
343 Ga0450899_000527 3300042135 Bacteria 4358
344 Ga0450900_008237 3300042136 Bacteria 1299
345 Ga0450902_025881 3300042137 Bacteria 980
346 Ga0450902_027212 3300042137 Bacteria 958
347 Ga0450903_000006 3300042138 Bacteria 38832
348 Ga0450906_001712 3300042145 Bacteria 4798
349 Ga0466969_0045528 3300044656 Bacteria 2178
350 Ga0466972_0017633 3300044658 Bacteria 3573
351 Ga0466965_0042008 3300044683 Bacteria 2254
352 Ga0466966_0016597 3300044684 Bacteria 4863
353 Ga0466966_0039956 3300044684 Bacteria 3020
354 Ga0466961_0004189 3300044693 Bacteria 9013
355 Ga0466961_0143770 3300044693 Bacteria 1492
356 Ga0466963_0027993 3300044694 Bacteria 3614
357 Ga0466963_0126466 3300044694 Bacteria 1762
358 Ga0466964_0004350 3300044706 Bacteria 5221
359 Ga0466971_0067012 3300044719 Bacteria 1627
360 Ga0466968_0044777 3300044735 Bacteria 1876
361 Ga0466970_0012979 3300044765 Bacteria 4267
362 Ga0466957_0036960 3300044842 Bacteria 2938
363 Ga0466960_0056544 3300044901 Bacteria 1910
364 Ga0466960_0090858 3300044901 Bacteria 1556
365 Ga0466960_0093228 3300044901 Bacteria 1539
366 Ga0466960_0100081 3300044901 Bacteria 1491
367 Ga0466959_0010913 3300045049 Bacteria 6514
368 Ga0466958_0030897 3300045836 Bacteria 3184
369 Ga0466958_0184677 3300045836 Bacteria 1324
370 Ga0466967_0052140 3300045976 Bacteria 3589
371 Ga0466967_0140893 3300045976 Bacteria 2246
372 Ga0466967_0200478 3300045976 Bacteria 1890
373 Ga0466967_0460632 3300045976 Bacteria 1243
374 Ga0495627_024896 3300046453 Bacteria 1946
375 Ga0495592_0005321 3300046454 Bacteria 9490
376 Ga0495592_0020757 3300046454 Bacteria 4997
377 Ga0495592_0052180 3300046454 Bacteria 3037
378 Ga0495592_0277306 3300046454 Bacteria 1097
379 Ga0495603_0000466 3300046455 Bacteria 22223
380 Ga0495603_0004813 3300046455 Bacteria 8067
381 Ga0495603_0023312 3300046455 Bacteria 3748
382 Ga0495603_0036402 3300046455 Bacteria 2954
383 Ga0495603_0063903 3300046455 Bacteria 2171
384 Ga0495603_0108054 3300046455 Bacteria 1623
385 Ga0495603_0179817 3300046455 Bacteria 1224
386 Ga0495590_0009950 3300046457 Bacteria 3595
387 Ga0495590_0032256 3300046457 Bacteria 1832
388 Ga0495629_0007630 3300046459 Bacteria 7965
389 Ga0495629_0016172 3300046459 Bacteria 5355
390 Ga0495629_0021880 3300046459 Bacteria 4562
391 Ga0495629_0031983 3300046459 Bacteria 3725
392 Ga0495629_0083233 3300046459 Bacteria 2233
393 Ga0495629_0100122 3300046459 Bacteria 2022
394 Ga0495629_0121143 3300046459 Bacteria 1822
395 Ga0495629_0215159 3300046459 Bacteria 1326
396 Ga0495638_0000551 3300046460 Bacteria 42775
397 Ga0495638_0027561 3300046460 Bacteria 3676
398 Ga0495638_0039468 3300046460 Bacteria 2997
399 Ga0495641_0025788 3300046461 Bacteria 2880
400 Ga0495641_0042768 3300046461 Bacteria 2098
401 Ga0495651_0009262 3300046462 Bacteria 7553
402 Ga0495651_0056261 3300046462 Bacteria 3022
403 Ga0495651_0057633 3300046462 Bacteria 2982
404 Ga0495651_0079290 3300046462 Bacteria 2482
405 Ga0495653_0008637 3300046463 Bacteria 8352
406 Ga0495653_0009702 3300046463 Bacteria 7871
407 Ga0495653_0094103 3300046463 Bacteria 2184
408 Ga0495653_0121448 3300046463 Bacteria 1861
409 Ga0495653_0125606 3300046463 Bacteria 1822
410 Ga0495580_0060729 3300046472 Bacteria 2655
411 Ga0495582_0000726 3300046473 Bacteria 18153
412 Ga0495582_0003467 3300046473 Bacteria 8892
413 Ga0495582_0041385 3300046473 Bacteria 2539
414 Ga0495582_0077603 3300046473 Bacteria 1842
415 Ga0495582_0216418 3300046473 Bacteria 1096
416 Ga0495582_0297204 3300046473 Bacteria 928
417 Ga0495639_0030797 3300046475 Bacteria 2385
418 Ga0495662_0000499 3300046476 Bacteria 17842
419 Ga0495662_0003417 3300046476 Bacteria 8045
420 Ga0495662_0031367 3300046476 Bacteria 2567
421 Ga0495662_0085651 3300046476 Bacteria 1534
422 Ga0495664_0003367 3300046477 Bacteria 8690
423 Ga0495664_0106425 3300046477 Bacteria 1691
424 Ga0495664_0125704 3300046477 Bacteria 1551
425 Ga0495664_0223522 3300046477 Bacteria 1139
426 Ga0495585_0038948 3300046492 Bacteria 2674
427 Ga0495594_0006887 3300046499 Bacteria 5845
428 Ga0495594_0008252 3300046499 Bacteria 5360
429 Ga0495594_0011484 3300046499 Bacteria 4604
430 Ga0495594_0032590 3300046499 Bacteria 2829
431 Ga0495594_0068248 3300046499 Bacteria 1974
432 Ga0495594_0178376 3300046499 Bacteria 1209
433 Ga0495596_0066335 3300046500 Bacteria 1403
434 Ga0495596_0146265 3300046500 Bacteria 918
435 Ga0495607_0022183 3300046501 Bacteria 3992
436 Ga0495607_0096033 3300046501 Bacteria 1596
437 Ga0495606_0012495 3300046507 Bacteria 6801
438 Ga0495608_0003425 3300046511 Bacteria 11358
439 Ga0495608_0112299 3300046511 Bacteria 1752
440 Ga0495608_0160149 3300046511 Bacteria 1431
441 Ga0495608_0198408 3300046511 Bacteria 1265
442 Ga0495608_0464960 3300046511 Bacteria 768
443 Ga0495610_0111514 3300046512 Bacteria 1211
444 Ga0495616_0016333 3300046513 Bacteria 4112
445 Ga0495618_0002894 3300046514 Bacteria 10872
446 Ga0495618_0047479 3300046514 Bacteria 2710
447 Ga0495618_0206174 3300046514 Bacteria 1243
448 Ga0495618_0370999 3300046514 Bacteria 879
449 Ga0495620_0048447 3300046515 Bacteria 1823
450 Ga0495628_0027289 3300046516 Bacteria 4647
451 Ga0495628_0173679 3300046516 Bacteria 1633
452 Ga0495630_0000269 3300046517 Bacteria 42207
453 Ga0495630_0051164 3300046517 Bacteria 3092
454 Ga0495630_0127885 3300046517 Bacteria 1928
455 Ga0495631_0002894 3300046518 Bacteria 9511
456 Ga0495632_0175486 3300046519 Bacteria 983
457 Ga0495643_0003085 3300046522 Bacteria 12509
458 Ga0495643_0013633 3300046522 Bacteria 4858
459 Ga0495666_0003338 3300046526 Bacteria 8105
460 Ga0495652_0016816 3300046529 Bacteria 6537
461 Ga0495652_0032236 3300046529 Bacteria 4584
462 Ga0495652_0033573 3300046529 Bacteria 4479
463 Ga0495652_0041578 3300046529 Bacteria 3967
464 Ga0495652_0294842 3300046529 Bacteria 1182
465 Ga0495654_0045751 3300046530 Bacteria 2158
466 Ga0495665_0003059 3300046531 Bacteria 9043
467 Ga0495665_0259202 3300046531 Bacteria 894
468 Ga0495640_0002044 3300046533 Bacteria 16093
469 Ga0495640_0014745 3300046533 Bacteria 5904
470 Ga0495640_0049806 3300046533 Bacteria 2886
471 Ga0495640_0112645 3300046533 Bacteria 1776
472 Ga0495640_0219117 3300046533 Bacteria 1201
473 Ga0495640_0251922 3300046533 Bacteria 1105
474 Ga0495586_0033311 3300046535 Bacteria 2765
475 Ga0495586_0075111 3300046535 Bacteria 1850
476 Ga0495586_0086861 3300046535 Bacteria 1724
477 Ga0495586_0141136 3300046535 Bacteria 1352
478 Ga0495587_0002915 3300046536 Bacteria 11445
479 Ga0495587_0035939 3300046536 Bacteria 2982
480 Ga0495587_0196883 3300046536 Bacteria 1140
481 Ga0495609_0009250 3300046538 Bacteria 4774
482 Ga0495597_0017266 3300046542 Bacteria 3399
483 Ga0495597_0105220 3300046542 Bacteria 1187
484 Ga0495645_0008828 3300046543 Bacteria 7039
485 Ga0495645_0063648 3300046543 Bacteria 2670
486 Ga0495622_0016908 3300046557 Bacteria 3395
487 Ga0495622_0099519 3300046557 Bacteria 1333
488 Ga0495622_0124677 3300046557 Bacteria 1175
489 Ga0495633_0135822 3300046558 Bacteria 1137
490 Ga0495667_0020067 3300046559 Bacteria 4508
491 Ga0495667_0056740 3300046559 Bacteria 2575
492 Ga0495634_0006056 3300046642 Bacteria 9222
493 Ga0495634_0033925 3300046642 Bacteria 3504
494 Ga0495634_0053892 3300046642 Bacteria 2692
495 Ga0495634_0079640 3300046642 Bacteria 2145
496 Ga0495634_0157099 3300046642 Bacteria 1435
497 Ga0495611_0031467 3300046648 Bacteria 2336
498 Ga0495625_0151553 3300046660 Bacteria 1558
499 Ga0495635_0019076 3300046663 Bacteria 4787
500 Ga0495635_0028080 3300046663 Bacteria 3911
501 Ga0495635_0043546 3300046663 Bacteria 3098
502 Ga0495661_0025442 3300046665 Bacteria 3822
503 Ga0495588_0006416 3300046674 Bacteria 5295
504 Ga0495588_0008967 3300046674 Bacteria 4606
505 Ga0495588_0030137 3300046674 Bacteria 2725
506 Ga0495588_0109062 3300046674 Bacteria 1457
507 Ga0495657_0000202 3300046675 Bacteria 53160
508 Ga0495657_0003226 3300046675 Bacteria 13416
509 Ga0495657_0007038 3300046675 Bacteria 8724
510 Ga0495657_0040440 3300046675 Bacteria 3198
511 Ga0495599_0014182 3300046678 Bacteria 4934
512 Ga0495599_0195004 3300046678 Bacteria 1245
513 Ga0495623_0081145 3300046679 Bacteria 2006
514 Ga0495646_0019606 3300046680 Bacteria 4278
515 Ga0495646_0054507 3300046680 Bacteria 2405
516 Ga0495647_0003456 3300046681 Bacteria 5051
517 Ga0495647_0004990 3300046681 Bacteria 4346
518 Ga0495658_0000034 3300046683 Bacteria 69176
519 Ga0495658_0013726 3300046683 Bacteria 4129
520 Ga0495658_0055814 3300046683 Bacteria 2251
521 Ga0495658_0072980 3300046683 Bacteria 1997
522 Ga0495658_0096040 3300046683 Bacteria 1762
523 Ga0495613_0001481 3300046689 Bacteria 17896
524 Ga0495613_0003658 3300046689 Bacteria 11522
525 Ga0495613_0027986 3300046689 Bacteria 4195
526 Ga0495613_0032698 3300046689 Bacteria 3864
527 Ga0495613_0056727 3300046689 Bacteria 2876
528 Ga0495613_0084491 3300046689 Bacteria 2304
529 Ga0495613_0173160 3300046689 Bacteria 1531
530 Ga0495613_0214147 3300046689 Bacteria 1354
531 Ga0495613_0270308 3300046689 Bacteria 1182
532 Ga0495624_0003791 3300046690 Bacteria 11171
533 Ga0495624_0182998 3300046690 Bacteria 1276
534 Ga0495670_0005831 3300046691 Bacteria 6033
535 Ga0495671_0013195 3300046692 Bacteria 4485
536 Ga0495671_0120254 3300046692 Bacteria 1282
537 Ga0495649_0096354 3300046694 Bacteria 1574
538 Ga0495589_0014304 3300046794 Bacteria 4088
539 Ga0495589_0018865 3300046794 Bacteria 3537
540 Ga0495589_0025472 3300046794 Bacteria 3001
541 Ga0495589_0045563 3300046794 Bacteria 2178
542 Ga0495600_0002863 3300046809 Bacteria 10045
543 Ga0495600_0067872 3300046809 Bacteria 2330
544 Ga0495600_0323526 3300046809 Bacteria 969
545 Ga0495660_0014026 3300046810 Bacteria 4646
546 Ga0495581_0001476 3300047315 Bacteria 13089
547 Ga0495581_0008225 3300047315 Bacteria 6047
548 Ga0495581_0018379 3300047315 Bacteria 4060
549 Ga0495581_0065656 3300047315 Bacteria 2098
550 Ga0495581_0237183 3300047315 Bacteria 1067
551 Ga0495604_0001168 3300047317 Bacteria 21698
552 Ga0495604_0059596 3300047317 Bacteria 2925
553 Ga0495604_0073512 3300047317 Bacteria 2580
554 Ga0495604_0102323 3300047317 Bacteria 2103
555 Ga0495636_0005117 3300047318 Bacteria 5148
556 Ga0495636_0006463 3300047318 Bacteria 4604
557 Ga0495636_0006877 3300047318 Bacteria 4473
558 Ga0495636_0057768 3300047318 Bacteria 1635
559 Ga0495674_0001859 3300047319 Bacteria 20807
560 Ga0495674_0031487 3300047319 Bacteria 4819
561 Ga0495674_0278301 3300047319 Bacteria 1371
562 Ga0495674_0469727 3300047319 Bacteria 1009
563 Ga0495674_0505337 3300047319 Bacteria 966
564 Ga0495676_0016188 3300047321 Bacteria 6624
565 Ga0495676_0025216 3300047321 Bacteria 5136
566 Ga0495676_0039976 3300047321 Bacteria 3877
567 Ga0495676_0042632 3300047321 Bacteria 3722
568 Ga0495676_0055732 3300047321 Bacteria 3131
569 Ga0495676_0057646 3300047321 Bacteria 3061
570 Ga0495676_0123724 3300047321 Bacteria 1877
571 Ga0495676_0190728 3300047321 Bacteria 1429
572 Ga0495680_0008542 3300047322 Bacteria 9301
573 Ga0495680_0031860 3300047322 Bacteria 4285
574 Ga0495680_0052068 3300047322 Bacteria 3193
575 Ga0495680_0052755 3300047322 Bacteria 3169
576 Ga0495680_0087601 3300047322 Bacteria 2341
577 Ga0495680_0176557 3300047322 Bacteria 1544
578 Ga0495680_0188227 3300047322 Bacteria 1486
579 Ga0495683_0006385 3300047323 Bacteria 6444
580 Ga0495683_0063711 3300047323 Bacteria 1821
581 Ga0495687_008351 3300047443 Bacteria 5938
582 Ga0495687_058475 3300047443 Bacteria 1599
583 Ga0495675_0047959 3300047444 Bacteria 2717
584 Ga0495675_0047970 3300047444 Bacteria 2717
585 Ga0495679_022541 3300047446 Bacteria 2153
586 Ga0495685_007214 3300047447 Bacteria 3661
587 Ga0495685_007855 3300047447 Bacteria 3531
588 Ga0495685_013221 3300047447 Bacteria 2800
589 Ga0495685_037286 3300047447 Bacteria 1667
590 Ga0495685_051987 3300047447 Bacteria 1388
591 Ga0495685_081790 3300047447 Bacteria 1075
592 Ga0495685_096140 3300047447 Bacteria 979
593 Ga0495681_0005684 3300047470 Bacteria 8303
594 Ga0495681_0009279 3300047470 Bacteria 6078
595 Ga0495684_0001185 3300047471 Bacteria 21022
596 Ga0495684_0017654 3300047471 Bacteria 5496
597 Ga0495686_0059088 3300047472 Bacteria 2388
598 Ga0495686_0116411 3300047472 Bacteria 1597
599 Ga0495593_0000562 3300047673 Bacteria 21077
600 Ga0495593_0014592 3300047673 Bacteria 4464
601 Ga0495602_0047287 3300048088 Bacteria 3878
602 Ga0495602_0053192 3300048088 Bacteria 3588
603 Ga0495614_0000779 3300048089 Bacteria 13490
604 Ga0495614_0012459 3300048089 Bacteria 3731
605 Ga0495614_0015109 3300048089 Bacteria 3369
606 Ga0495614_0073039 3300048089 Bacteria 1480
607 Ga0496100_0022674 3300048903 Bacteria 3802
608 Ga0496100_0031846 3300048903 Bacteria 3282
609 Ga0496100_0053090 3300048903 Bacteria 2638
610 Ga0496100_0095195 3300048903 Bacteria 2041
611 Ga0496100_0224275 3300048903 Bacteria 1380
612 Ga0496101_0004050 3300048904 Bacteria 9161
613 Ga0496101_0133583 3300048904 Bacteria 1886
614 Ga0496101_0146612 3300048904 Bacteria 1803
615 Ga0496101_0222092 3300048904 Bacteria 1466
616 Ga0496101_0305572 3300048904 Bacteria 1246
617 Ga0496101_0369141 3300048904 Bacteria 1128
618 Ga0496102_0773588 3300048905 Bacteria 883
619 Ga0496103_0023248 3300048906 Bacteria 3737
620 Ga0496103_0052951 3300048906 Bacteria 2515
621 Ga0496104_0032026 3300048907 Bacteria 4893
622 Ga0496104_0034190 3300048907 Bacteria 4738
623 Ga0496104_0035255 3300048907 Bacteria 4672
624 Ga0496104_0067364 3300048907 Bacteria 3401
625 Ga0496104_0096667 3300048907 Bacteria 2826
626 Ga0496105_0053951 3300048908 Bacteria 3320
627 Ga0496106_0007391 3300048909 Bacteria 8119
628 Ga0496106_0012915 3300048909 Bacteria 6163
629 Ga0496106_0037127 3300048909 Bacteria 3645
630 Ga0496107_0005661 3300048910 Bacteria 8551
631 Ga0496107_0026798 3300048910 Bacteria 4089
632 Ga0496107_0081066 3300048910 Bacteria 2367
633 Ga0496107_0124594 3300048910 Bacteria 1900
634 Ga0496107_0167150 3300048910 Bacteria 1631
635 Ga0496107_0192602 3300048910 Bacteria 1515
636 Ga0496107_0517814 3300048910 Bacteria 884
637 Ga0496108_0003061 3300048911 Bacteria 13439
638 Ga0496108_0100173 3300048911 Bacteria 2471
639 Ga0496108_0111919 3300048911 Bacteria 2335
640 Ga0496108_0137624 3300048911 Bacteria 2102
641 Ga0496108_0212604 3300048911 Bacteria 1679
642 Ga0496108_0301272 3300048911 Bacteria 1396
643 Ga0496108_0581256 3300048911 Bacteria 976
644 Ga0496109_0022625 3300048912 Bacteria 5568
645 Ga0496109_0080465 3300048912 Bacteria 3001
646 Ga0496109_0094310 3300048912 Bacteria 2770
647 Ga0496109_0117432 3300048912 Bacteria 2476
648 Ga0496109_0153858 3300048912 Bacteria 2154
649 Ga0496109_0163486 3300048912 Bacteria 2086
650 Ga0496109_0199622 3300048912 Bacteria 1880
651 Ga0496109_0210043 3300048912 Bacteria 1831
652 Ga0496109_0241512 3300048912 Bacteria 1700
653 Ga0496109_0258064 3300048912 Bacteria 1642
654 Ga0496109_0264323 3300048912 Bacteria 1621
655 Ga0496109_0416111 3300048912 Bacteria 1270
656 Ga0496109_0566128 3300048912 Bacteria 1071
657 Ga0496110_0016706 3300048913 Bacteria 6129
658 Ga0496110_0053442 3300048913 Bacteria 3551
659 Ga0496110_0072203 3300048913 Bacteria 3062
660 Ga0496110_0196526 3300048913 Bacteria 1832
661 Ga0496110_0269276 3300048913 Bacteria 1551
662 Ga0496110_0287405 3300048913 Bacteria 1497
663 Ga0496110_0429836 3300048913 Bacteria 1204
664 Ga0496111_0003852 3300048914 Bacteria 9376
665 Ga0496111_0023769 3300048914 Bacteria 4305
666 Ga0496111_0036833 3300048914 Bacteria 3499
667 Ga0496111_0264458 3300048914 Bacteria 1276
668 Ga0496112_0013703 3300048915 Bacteria 7494
669 Ga0496112_0021054 3300048915 Bacteria 6194
670 Ga0496112_0336995 3300048915 Bacteria 1452
671 Ga0496113_0029238 3300048916 Bacteria 3976
672 Ga0496113_0105989 3300048916 Bacteria 2183
673 Ga0496113_0130268 3300048916 Bacteria 1973
674 Ga0496113_0166898 3300048916 Bacteria 1742
675 Ga0496114_0003711 3300048917 Bacteria 11754
676 Ga0496114_0007773 3300048917 Bacteria 8485
677 Ga0496114_0023386 3300048917 Bacteria 5043
678 Ga0496114_0028974 3300048917 Bacteria 4549
679 Ga0496114_0040272 3300048917 Bacteria 3867
680 Ga0496114_0167546 3300048917 Bacteria 1913
681 Ga0496114_0176240 3300048917 Bacteria 1866
682 Ga0496115_0001021 3300048918 Bacteria 20300
683 Ga0496115_0683319 3300048918 Bacteria 808
684 Ga0501031_0082991 3300049568 Bacteria 2089
685 Ga0501031_0187188 3300049568 Bacteria 1352
686 Ga0501031_0221531 3300049568 Bacteria 1232
687 Ga0501031_0224662 3300049568 Bacteria 1222
688 Ga0501032_0187115 3300049569 Bacteria 1354
689 Ga0501032_0216590 3300049569 Bacteria 1247
690 Ga0501033_0018487 3300049570 Bacteria 5266
691 Ga0501036_0048515 3300049572 Bacteria 3595
692 Ga0501038_0007874 3300049574 Bacteria 9819
693 Ga0501038_0574193 3300049574 Bacteria 856
694 Ga0501039_0170342 3300049575 Bacteria 1712
695 Ga0501039_0313386 3300049575 Bacteria 1233
696 Ga0501040_0069124 3300049576 Bacteria 2436
697 Ga0501040_0152774 3300049576 Bacteria 1629
698 Ga0501040_0283595 3300049576 Bacteria 1183
699 Ga0501041_0075084 3300049577 Bacteria 2078
700 Ga0501041_0108215 3300049577 Bacteria 1724
701 Ga0501041_0260606 3300049577 Bacteria 1090
702 Ga0501041_0262748 3300049577 Bacteria 1085
703 Ga0501041_0277111 3300049577 Bacteria 1055
704 Ga0501042_0016520 3300049578 Bacteria 5068
705 Ga0501042_0051947 3300049578 Bacteria 2924
706 Ga0501042_0187562 3300049578 Bacteria 1492
707 Ga0501042_0264570 3300049578 Bacteria 1241
708 Ga0501043_0049577 3300049579 Bacteria 3301
709 Ga0501043_0602050 3300049579 Bacteria 812
710 Ga0501046_0000583 3300049580 Bacteria 35953
711 Ga0501046_0206987 3300049580 Bacteria 1458
712 Ga0501046_0266557 3300049580 Bacteria 1257
713 Ga0501047_0173218 3300049581 Bacteria 2027
714 Ga0501048_0060940 3300049582 Bacteria 2673
715 Ga0501048_0132197 3300049582 Bacteria 1764
716 Ga0501067_0013389 3300049583 Bacteria 4542
717 Ga0501067_0142959 3300049583 Bacteria 1333
718 Ga0501067_0188282 3300049583 Bacteria 1149
719 Ga0501068_0070188 3300049584 Bacteria 2137
720 Ga0501068_0113148 3300049584 Bacteria 1689
721 Ga0501068_0165022 3300049584 Bacteria 1397
722 Ga0501069_0003548 3300049585 Bacteria 8032
723 Ga0501069_0057707 3300049585 Bacteria 2165
724 Ga0501069_0098176 3300049585 Bacteria 1661
725 Ga0501069_0278165 3300049585 Bacteria 979
726 Ga0501070_0002920 3300049586 Bacteria 14867
727 Ga0501070_0156868 3300049586 Bacteria 1877
728 Ga0501070_0160569 3300049586 Bacteria 1853
729 Ga0501070_0199482 3300049586 Bacteria 1643
730 Ga0501070_0569172 3300049586 Bacteria 906
731 Ga0501071_0045486 3300049587 Bacteria 3151
732 Ga0501071_0199262 3300049587 Bacteria 1503
733 Ga0501071_0276642 3300049587 Bacteria 1270
734 Ga0501071_0388725 3300049587 Bacteria 1064
735 Ga0501071_0473468 3300049587 Bacteria 960
736 Ga0501072_0062196 3300049588 Bacteria 2945
737 Ga0501072_0085101 3300049588 Bacteria 2508
738 Ga0501073_0061178 3300049589 Bacteria 2628
739 Ga0501074_0040946 3300049590 Bacteria 3354
740 Ga0501074_0075181 3300049590 Bacteria 2425
741 Ga0501074_0237117 3300049590 Bacteria 1298
742 Ga0501074_0278001 3300049590 Bacteria 1190
743 Ga0501075_0021362 3300049591 Bacteria 4717
744 Ga0501075_0158837 3300049591 Bacteria 1724
745 Ga0501075_0179415 3300049591 Bacteria 1616
746 Ga0501076_0028798 3300049592 Bacteria 4316
747 Ga0501076_0097645 3300049592 Bacteria 2366
748 Ga0501076_0209665 3300049592 Bacteria 1592
749 Ga0501076_0235562 3300049592 Bacteria 1497
750 Ga0501076_0262329 3300049592 Bacteria 1414
751 Ga0501077_0025803 3300049593 Bacteria 3729
752 Ga0501077_0188760 3300049593 Bacteria 1309
753 Ga0501079_0133009 3300049741 Bacteria 1936
754 Ga0501079_0153902 3300049741 Bacteria 1792
755 Ga0501080_0114340 3300049742 Bacteria 2502
756 Ga0501080_0121411 3300049742 Bacteria 2421
757 Ga0501080_0180611 3300049742 Bacteria 1942
758 Ga0501083_0240831 3300049744 Bacteria 1178
759 Ga0501035_0125187 3300049822 Bacteria 2244
760 Ga0501035_0186743 3300049822 Bacteria 1784
761 Ga0501035_0321369 3300049822 Bacteria 1300
762 Ga0501044_0032944 3300049823 Bacteria 5446
763 Ga0501044_0038476 3300049823 Bacteria 4994
764 Ga0501044_0108167 3300049823 Bacteria 2791
765 Ga0501044_0630714 3300049823 Bacteria 962
766 Ga0501045_0063813 3300049824 Bacteria 2703
767 Ga0501045_0086489 3300049824 Bacteria 2314
768 Ga0501045_0088124 3300049824 Bacteria 2292
769 Ga0501045_0234312 3300049824 Bacteria 1367
770 Ga0501045_0377680 3300049824 Bacteria 1055
771 Ga0501045_0669523 3300049824 Bacteria 766
772 nmdc:mga0yw44_24363_c1 3300050492 Bacteria 3424
773 nmdc:mga06z11_241081_c1 3300050494 Bacteria 1062
774 nmdc:mga05p37_125957_c2 3300050507 Bacteria 2293
775 nmdc:mga05p37_130267_c1 3300050507 Bacteria 3086
776 nmdc:mga09592_121715_c1 3300050508 Bacteria 2242
777 nmdc:mga09592_128037_c1 3300050508 Bacteria 2183
778 nmdc:mga0qj67_113701_c1 3300050509 Bacteria 2186
779 nmdc:mga0qj67_212059_c1 3300050509 Bacteria 1573
780 nmdc:mga0qj67_75936_c1 3300050509 Bacteria 2687
781 nmdc:mga06r32_216651_c1 3300050510 Bacteria 1902
782 nmdc:mga06r32_367259_c1 3300050510 Bacteria 1423
783 nmdc:mga06r32_72195_c1 3300050510 Bacteria 3342
784 nmdc:mga08y16_306882_c1 3300050511 Bacteria 1635
785 nmdc:mga08y16_455294_c1 3300050511 Bacteria 1304
786 nmdc:mga08y16_91341_c1 3300050511 Bacteria 3173
787 Ga0495601_0019616 3300053077 Bacteria 4125
788 Ga0495601_0196516 3300053077 Bacteria 1318
789 Ga0495601_0311882 3300053077 Bacteria 1024
790 Ga0495601_0561579 3300053077 Bacteria 734
791 Ga0495612_0078182 3300053078 Bacteria 1387
792 Ga0495612_0200880 3300053078 Bacteria 879
793 Ga0495595_0001710 3300053084 Bacteria 8588
794 Ga0495595_0024015 3300053084 Bacteria 2689
795 Ga0495595_0045474 3300053084 Bacteria 2020
796 Ga0495619_0000438 3300053085 Bacteria 28186
797 Ga0495619_0018837 3300053085 Bacteria 4383
798 Ga0495619_0030614 3300053085 Bacteria 3483
799 Ga0500644_0081069 3300053088 Bacteria 1193
800 Ga0500640_009186 3300053095 Bacteria 3939
801 Ga0500654_036679 3300053099 Bacteria 2853
802 Ga0500553_065185 3300053101 Bacteria 1692
803 Ga0500553_083779 3300053101 Bacteria 1425
804 Ga0500560_016293 3300053107 Bacteria 2024
805 Ga0500569_000018 3300053109 Bacteria 42775
806 Ga0500569_000792 3300053109 Bacteria 5545
807 Ga0500614_005334 3300053123 Bacteria 2698
808 Ga0500628_001533 3300053129 Bacteria 3935
809 Ga0500628_029720 3300053129 Bacteria 1176
810 Ga0500573_0062393 3300053140 Bacteria 2134
811 Ga0500577_0000928 3300053142 Bacteria 7599
812 Ga0500588_0001320 3300053146 Bacteria 4665
813 Ga0500600_0015152 3300053149 Bacteria 4681
814 Ga0500633_0001262 3300053160 Bacteria 4666
815 Ga0500634_0009937 3300053161 Bacteria 4841
816 Ga0501084_0056954 3300054114 Bacteria 3271
817 Ga0501084_0066392 3300054114 Bacteria 3018
818 Ga0501084_0142029 3300054114 Bacteria 2022
819 Ga0501084_0202307 3300054114 Bacteria 1676
820 Ga0501084_0450640 3300054114 Bacteria 1088
821 Ga0501082_0166971 3300060353 Bacteria 1913
822 Ga0501082_0205058 3300060353 Bacteria 1715
823 Ga0501082_0228205 3300060353 Bacteria 1621
824 Ga0501082_0283002 3300060353 Bacteria 1443
825 Ga0466962_0037469 3300061719 Bacteria 2322
826 Ga0530510_0174619 3300061734 Bacteria 1592
827 Ga0530510_0378476 3300061734 Bacteria 1065
828 2547412972 2547132111 Bacteria 8013147
829 2548694832 2547132424 Bacteria 8348532
830 2552107522 2551306166 Bacteria 9731570
831 2554256988 2554235005 Bacteria 6457341
832 2585298122 2582581312 Bacteria 7308206
833 2585305088 2582581313 Bacteria 10042643
834 2585318260 2582581314 Bacteria 11452267
835 2616701428 2616644814 Bacteria 11555299
836 2616903569 2616644941 Bacteria 8510691
837 2643763538 2643221548 Bacteria 8053412
838 2643899656 2643221578 Bacteria 9213798
839 2643947693 2643221587 Bacteria 7586415
840 2644014307 2643221601 Bacteria 7493239
841 2644175744 2643221631 Bacteria 8168043
842 2644266224 2643221647 Bacteria 10741251
843 2644390126 2643221670 Bacteria 6497041
844 2644403624 2643221673 Bacteria 9196637
845 2644435385 2643221677 Bacteria 7584031
846 2644437641 2643221678 Bacteria 9540101
847 2644445746 2643221679 Bacteria 3839507
848 2644463594 2643221682 Bacteria 6743283
849 2644518118 2643221692 Bacteria 7282860
850 2644627900 2643221714 Bacteria 9015452
851 2753070286 2751185734 Bacteria 8863695
852 2768641994 2767802112 Bacteria 6465194
853 2784589467 2784132148 Bacteria 8627943
854 2785342119 2784746763 Bacteria 9783172
855 2785370540 2784746768 Bacteria 10036182
856 2786671698 2786546132 Bacteria 10419719
857 2791913493 2791354901 Bacteria 8322202
858 2804845791 2802429296 Bacteria 7227771
859 2808843096 2808606359 Bacteria 9866990
860 2808921443 2808606375 Bacteria 9466072
861 2809233131 2808606448 Bacteria 8656184
862 2811845303 2808606982 Bacteria 7791042
863 2812357022 2811994879 Bacteria 9313447
864 2812479686 2811994917 Bacteria 7761064
865 2819698319 2818991463 Bacteria 7948711
866 2852640113 2852635781 Bacteria 8251373
867 2862183625 2862178590 Bacteria 8583590
868 2862286726 2862281513 Bacteria 9621493
869 2862295210 2862290372 Bacteria 7471434
870 2862384510 2862382967 Bacteria 10317375
871 2862510311 2862507626 Bacteria 9425308
872 2862578383 2862574272 Bacteria 10567477
873 2862707837 2862705112 Bacteria 6563286
874 2863411802 2863404153 Bacteria 9672205
875 2867348482 2867346516 Bacteria 7608576
876 2867373037 2867369537 Bacteria 6501581
877 2867436293 2867428634 Bacteria 9590268
878 2870729909 2870721527 Bacteria 9689237
879 2875394624 2875391855 Bacteria 7600475
880 2877680082 2877676314 Bacteria 9512378
881 2902803813 2902799365 Bacteria 5419524
882 2912718674 2912715099 Bacteria 9460473
883 2912761920 2912757875 Bacteria 7940295
884 2918504560 2918501144 Bacteria 8668083
885 2919471512 2919468124 Bacteria 9133025
886 2919718940 2919713450 Bacteria 7431245
887 2935396917 2935390628 Bacteria 7043367
888 2946050009 2946045630 Bacteria 8527308
889 2946068858 2946064051 Bacteria 8957905
890 2946076896 2946072368 Bacteria 8999607
891 2947228054 2947224130 Bacteria 9938529
892 2954005885 2954002825 Bacteria 9173742
893 2954385015 2954380949 Bacteria 10050426
894 2954677983 2954673503 Bacteria 9685905
895 2954686174 2954682443 Bacteria 9862841
896 2954695832 2954691527 Bacteria 10720516
897 2954711023 2954701450 Bacteria 10834262
898 2954715239 2954711539 Bacteria 10867210
899 2954725180 2954721474 Bacteria 10456478
900 2954736637 2954731030 Bacteria 10243860
901 2954744112 2954740390 Bacteria 10229294
902 2954755485 2954749733 Bacteria 10366972
903 2954763054 2954759201 Bacteria 9358192
904 2966602533 2966598605 Bacteria 7676064
905 2990045631 2990044586 Bacteria 6603797
906 2990061678 2990059506 Bacteria 9321252
907 2990089991 2990088156 Bacteria 6657676
908 2995464858 2995463766 Bacteria 8577691
909 2995728918 2995726249 Bacteria 3470435
910 2997454216 2997451912 Bacteria 8492419
911 3006326429 3006321560 Bacteria 8247479
912 3006398555 3006393351 Bacteria 6615579
913 3006428419 3006425503 Bacteria 6491253
914 3006491422 3006486233 Bacteria 8157040
915 3006498283 3006493962 Bacteria 8825450
916 8008485927 8008485437 Bacteria 7198341
917 8008566286 8008558824 Bacteria 10610750
918 8008578012 8008574985 Bacteria 7815457
919 8023630121 8023623736 Bacteria 8593882
920 8025418469 8025413630 Bacteria 7014048
921 8025525011 8025524527 Bacteria 7197316
922 8025538090 8025530807 Bacteria 8495698
923 8048409520 8048406513 Bacteria 8936924
924 8056833278 8056829672 Bacteria 9045328
925 JGI24739J22299_10095448
926 JGI24737J22298_10091489
927 JGI24735J21928_10038438
928 JGI25406J46586_10065161
929 rootH1_10009519
930 JGI25407J50210_10002838
931 JGI25407J50210_10009296
932 Ga0006562J51391_1016685
933 Ga0006562J51391_1016687
934 Ga0006562J51391_1120034
935 Ga0070683_100111204
936 Ga0068869_100154845
937 Ga0070680_100085086
938 Ga0070680_100514626
939 Ga0070682_100028616
940 Ga0068868_100022277
941 Ga0068868_100210160
942 Ga0070660_100473790
943 Ga0070691_10009540
944 Ga0070691_10212243
945 Ga0070687_100313886
946 Ga0070692_10008927
947 Ga0070692_10068630
948 Ga0070692_10117604
949 Ga0070668_100147120
950 Ga0070675_100386750
951 Ga0070659_100015188
952 Ga0070659_100294401
953 Ga0070714_100030707
954 Ga0070714_100045145
955 Ga0070714_100048535
956 Ga0070714_100065941
957 Ga0070713_100119269
958 Ga0070710_10267143
959 Ga0070701_10147881
960 Ga0070711_100140150
961 Ga0070711_100335095
962 Ga0070705_100098396
963 Ga0070708_100237995
964 Ga0070663_100192525
965 Ga0070663_100328378
966 Ga0070663_100364470
967 Ga0070681_10123135
968 Ga0068867_100220308
969 Ga0070698_100000205
970 Ga0070699_100036144
971 Ga0070679_100005026
972 Ga0070679_100052534
973 Ga0070679_100328146
974 Ga0070684_100011688
975 Ga0070684_100046743
976 Ga0070684_100064838
977 Ga0070684_100199149
978 Ga0068853_100289236
979 Ga0070672_100153162
980 Ga0070672_100472670
981 Ga0070672_100817296
982 Ga0070696_100207248
983 Ga0070665_100449331
984 Ga0068855_100059913
985 Ga0068855_100290738
986 Ga0068855_100462769
987 Ga0070664_100005522
988 Ga0070664_100046190
989 Ga0070664_100095346
990 Ga0070664_100137236
991 Ga0070664_100617928
992 Ga0068857_100053192
993 Ga0068857_100195209
994 Ga0068857_100434341
995 Ga0068857_100754074
996 Ga0068854_100108151
997 Ga0068856_100010453
998 Ga0070702_100323459
999 Ga0070702_100508235
1000 Ga0068852_100198436
1001 Ga0068852_100293781
1002 Ga0068852_100672717
1003 Ga0068851_10058238
1004 Ga0068860_100000742
1005 Ga0068860_100009354
1006 Ga0081455_10023374
1007 Ga0081455_10126402
1008 Ga0081455_10136246
1009 Ga0081455_10190643
1010 Ga0081538_10000290
1011 Ga0081538_10000706
1012 Ga0081538_10005735
1013 Ga0081539_10006522
1014 Ga0081539_10025573
1015 Ga0081539_10148639
1016 Ga0070717_10018838
1017 Ga0070717_10124757
1018 Ga0075365_10068736
1019 Ga0075365_10267272
1020 Ga0075365_10424678
1021 Ga0075363_100076040
1022 Ga0075363_100101656
1023 Ga0075363_100181904
1024 Ga0070716_100006557
1025 Ga0070712_100257498
1026 Ga0070712_100261565
1027 Ga0075370_10056496
1028 Ga0075370_10087701
1029 Ga0068871_100235177
1030 Ga0075428_100057946
1031 Ga0075428_100509097
1032 Ga0075428_100581333
1033 Ga0075428_100804655
1034 Ga0075430_100036563
1035 Ga0075430_100153103
1036 Ga0075431_100231966
1037 Ga0075431_100555278
1038 Ga0075434_100277896
1039 Ga0075429_100068196
1040 Ga0105244_10057637
1041 Ga0111539_10020276
1042 Ga0111539_10451127
1043 Ga0105245_10016564
1044 Ga0105245_10269432
1045 Ga0105245_10310197
1046 Ga0105245_10818042
1047 Ga0114129_10046964
1048 Ga0114129_10080443
1049 Ga0114129_10406302
1050 Ga0114129_10442049
1051 Ga0114129_10774185
1052 Ga0105243_10131523
1053 Ga0105243_10139026
1054 Ga0105243_10419843
1055 Ga0105242_10529289
1056 Ga0105248_10518479
1057 Ga0105237_10086971
1058 Ga0105237_10241683
1059 Ga0105237_10436683
1060 Ga0105238_10079697
1061 Ga0105238_10389841
1062 Ga0105249_10228456
1063 Ga0105239_10175022
1064 Ga0105239_10184263
1065 Ga0105239_10700416
1066 Ga0105246_10018547
1067 Ga0157369_10274856
1068 Ga0157369_10684887
1069 Ga0157369_10851449
1070 Ga0157374_10200004
1071 Ga0157378_10704994
1072 Ga0163162_10035725
1073 Ga0163162_10048311
1074 Ga0157372_10021291
1075 Ga0157372_10231700
1076 Ga0157372_10384271
1077 Ga0157372_10935116
1078 Ga0157372_10967032
1079 Ga0157375_10030082
1080 Ga0157375_10480366
1081 Ga0157375_11109478
1082 Ga0163163_10030934
1083 Ga0163163_10337988
1084 Ga0163163_11039905
1085 Ga0157380_10258559
1086 Ga0182008_10006311
1087 Ga0157377_10280012
1088 Ga0157376_10336520
1089 Ga0182007_10006346
1090 Ga0183367_1015
1091 Ga0206353_11058284
1092 Ga0209758_1003745
1093 Ga0207426_1002560
1094 Ga0207426_1029729
1095 Ga0207688_10018280
1096 Ga0207688_10176137
1097 Ga0207647_10016173
1098 Ga0207647_10232887
1099 Ga0207699_10054874
1100 Ga0207707_10616410
1101 Ga0207693_10207873
1102 Ga0207663_10083270
1103 Ga0207663_10380970
1104 Ga0207660_10031917
1105 Ga0207660_10148189
1106 Ga0207660_10225569
1107 Ga0207662_10032757
1108 Ga0207662_10233946
1109 Ga0207657_10241803
1110 Ga0207652_10169240
1111 Ga0207659_10434544
1112 Ga0207687_10085146
1113 Ga0207687_10112647
1114 Ga0207700_10000001
1115 Ga0207664_10005315
1116 Ga0207664_10019791
1117 Ga0207664_10063049
1118 Ga0207664_10193442
1119 Ga0207690_10004152
1120 Ga0207690_10117549
1121 Ga0207709_10084910
1122 Ga0207709_10710115
1123 Ga0207669_10599671
1124 Ga0207665_10002267
1125 Ga0207689_10045569
1126 Ga0207661_10068071
1127 Ga0207661_10099321
1128 Ga0207661_10160672
1129 Ga0207679_10068035
1130 Ga0207679_10154393
1131 Ga0207679_10204592
1132 Ga0207679_10278450
1133 Ga0207667_10187389
1134 Ga0207667_10257284
1135 Ga0207712_10471437
1136 Ga0207668_10105394
1137 Ga0207640_10289183
1138 Ga0207639_10151683
1139 Ga0207639_11079339
1140 Ga0207678_10190458
1141 Ga0207678_10311782
1142 Ga0207702_10210965
1143 Ga0207702_10362823
1144 Ga0207702_10552483
1145 Ga0207648_10047000
1146 Ga0207674_10213382
1147 Ga0207674_10316910
1148 Ga0207683_10185233
1149 Ga0207683_10320000
1150 Ga0207683_10587482
1151 Ga0207698_10295349
1152 Ga0209371_1027823
1153 Ga0268266_10036141
1154 Ga0268266_10125012
1155 Ga0268265_10370700
1156 Ga0268264_10000238
1157 Ga0265319_1038466
1158 Ga0265318_10027106
1159 Ga0307517_10004143
1160 Ga0307517_10033990
1161 Ga0307517_10092322
1162 Ga0307515_10007000
1163 Ga0307515_10226172
1164 Ga0265338_10000625
1165 Ga0265338_10093439
1166 Ga0265324_10067306
1167 Ga0268256_1031578
1168 Ga0307511_10019620
1169 Ga0307512_10004971
1170 Ga0265320_10040625
1171 Ga0265340_10032297
1172 Ga0265331_10125670
1173 Ga0265316_10064106
1174 Ga0307513_10003894
1175 Ga0307513_10136363
1176 Ga0307513_10142269
1177 Ga0307509_10033033
1178 Ga0307509_10034766
1179 Ga0265313_10010904
1180 Ga0307508_10017100
1181 Ga0307508_10079511
1182 Ga0307508_10237097
1183 Ga0307514_10008187
1184 Ga0316579_10093380
1185 Ga0265314_10102708
1186 Ga0307516_10025490
1187 Ga0307516_10333243
1188 Ga0307413_10001674
1189 Ga0307518_10233205
1190 Ga0307410_10008804
1191 Ga0307410_10184648
1192 Ga0307407_10142859
1193 Ga0307409_100212600
1194 Ga0307409_100351871
1195 Ga0307409_100367536
1196 Ga0307416_100174823
1197 Ga0307507_10000005
1198 Ga0307507_10025944
1199 Ga0307507_10215066
1200 Ga0307510_10026883
1201 Ga0307510_10063541
1202 Ga0307510_10084620
1203 Ga0307510_10175902
1204 Ga0307510_10203168
1205 Ga0373934_0193078
1206 Ga0373944_0009573
1207 Ga0373936_0018705
1208 Ga0373945_0006731
1209 Ga0373953_0060045
1210 Ga0373956_0245138
1211 Ga0373943_0001754
1212 Ga0373946_0059247
1213 Ga0373955_0038200
1214 Ga0316574_0066613
1215 Ga0316574_0196893
1216 Ga0373924_0004634
1217 Ga0373935_0001379
1218 Ga0373927_0147860
1219 Ga0373933_0145794
1220 Ga0373947_0000226
1221 Ga0373937_0022211
1222 Ga0373937_0139961
1223 Ga0373937_0344400
1224 Ga0316582_0131663
1225 Ga0373925_0001646
1226 Ga0373925_0226686
1227 Ga0395899_0001716
1228 Ga0395900_0088333
1229 Ga0395900_0106748
1230 Ga0395900_0265621
1231 Ga0395900_0340967
1232 Ga0395898_0002109
1233 Ga0395898_0003292
1234 Ga0395898_0163335
1235 Ga0395898_0454358
1236 Ga0395905_0147818
1237 Ga0395905_0235169
1238 Ga0395905_0266366
1239 Ga0395901_0017382
1240 Ga0395901_0250568
1241 Ga0395901_0299344
1242 Ga0395901_0319280
1243 Ga0395901_0719709
1244 Ga0439436_0000544
1245 Ga0439436_0066954
1246 Ga0451800_0617174
1247 Ga0451837_1298709
1248 Ga0451845_0745478
1249 Ga0451849_1194329
1250 Ga0451853_0760780
1251 Ga0451853_1262046
1252 Ga0451853_1799241
1253 Ga0439433_0001673
1254 Ga0439433_0007983
1255 Ga0439448_0012885
1256 Ga0439432_016449
1257 Ga0439449_0010032
1258 Ga0439449_0014176
1259 Ga0439455_0017576
1260 Ga0439457_000818
1261 Ga0439457_001534
1262 Ga0439462_0025343
1263 Ga0439462_0049922
1264 Ga0450894_001082
1265 Ga0450896_001747
1266 Ga0450898_000748
1267 Ga0450899_000527
1268 Ga0450900_008237
1269 Ga0450902_025881
1270 Ga0450902_027212
1271 Ga0450903_000006
1272 Ga0450906_001712
1273 Ga0466969_0045528
1274 Ga0466972_0017633
1275 Ga0466965_0042008
1276 Ga0466966_0016597
1277 Ga0466966_0039956
1278 Ga0466961_0004189
1279 Ga0466961_0143770
1280 Ga0466963_0027993
1281 Ga0466963_0126466
1282 Ga0466964_0004350
1283 Ga0466971_0067012
1284 Ga0466968_0044777
1285 Ga0466970_0012979
1286 Ga0466957_0036960
1287 Ga0466960_0056544
1288 Ga0466960_0090858
1289 Ga0466960_0093228
1290 Ga0466960_0100081
1291 Ga0466959_0010913
1292 Ga0466958_0030897
1293 Ga0466958_0184677
1294 Ga0466967_0052140
1295 Ga0466967_0140893
1296 Ga0466967_0200478
1297 Ga0466967_0460632
1298 Ga0495627_024896
1299 Ga0495592_0005321
1300 Ga0495592_0020757
1301 Ga0495592_0052180
1302 Ga0495592_0277306
1303 Ga0495603_0000466
1304 Ga0495603_0004813
1305 Ga0495603_0023312
1306 Ga0495603_0036402
1307 Ga0495603_0063903
1308 Ga0495603_0108054
1309 Ga0495603_0179817
1310 Ga0495590_0009950
1311 Ga0495590_0032256
1312 Ga0495629_0007630
1313 Ga0495629_0016172
1314 Ga0495629_0021880
1315 Ga0495629_0031983
1316 Ga0495629_0083233
1317 Ga0495629_0100122
1318 Ga0495629_0121143
1319 Ga0495629_0215159
1320 Ga0495638_0000551
1321 Ga0495638_0027561
1322 Ga0495638_0039468
1323 Ga0495641_0025788
1324 Ga0495641_0042768
1325 Ga0495651_0009262
1326 Ga0495651_0056261
1327 Ga0495651_0057633
1328 Ga0495651_0079290
1329 Ga0495653_0008637
1330 Ga0495653_0009702
1331 Ga0495653_0094103
1332 Ga0495653_0121448
1333 Ga0495653_0125606
1334 Ga0495580_0060729
1335 Ga0495582_0000726
1336 Ga0495582_0003467
1337 Ga0495582_0041385
1338 Ga0495582_0077603
1339 Ga0495582_0216418
1340 Ga0495582_0297204
1341 Ga0495639_0030797
1342 Ga0495662_0000499
1343 Ga0495662_0003417
1344 Ga0495662_0031367
1345 Ga0495662_0085651
1346 Ga0495664_0003367
1347 Ga0495664_0106425
1348 Ga0495664_0125704
1349 Ga0495664_0223522
1350 Ga0495585_0038948
1351 Ga0495594_0006887
1352 Ga0495594_0008252
1353 Ga0495594_0011484
1354 Ga0495594_0032590
1355 Ga0495594_0068248
1356 Ga0495594_0178376
1357 Ga0495596_0066335
1358 Ga0495596_0146265
1359 Ga0495607_0022183
1360 Ga0495607_0096033
1361 Ga0495606_0012495
1362 Ga0495608_0003425
1363 Ga0495608_0112299
1364 Ga0495608_0160149
1365 Ga0495608_0198408
1366 Ga0495608_0464960
1367 Ga0495610_0111514
1368 Ga0495616_0016333
1369 Ga0495618_0002894
1370 Ga0495618_0047479
1371 Ga0495618_0206174
1372 Ga0495618_0370999
1373 Ga0495620_0048447
1374 Ga0495628_0027289
1375 Ga0495628_0173679
1376 Ga0495630_0000269
1377 Ga0495630_0051164
1378 Ga0495630_0127885
1379 Ga0495631_0002894
1380 Ga0495632_0175486
1381 Ga0495643_0003085
1382 Ga0495643_0013633
1383 Ga0495666_0003338
1384 Ga0495652_0016816
1385 Ga0495652_0032236
1386 Ga0495652_0033573
1387 Ga0495652_0041578
1388 Ga0495652_0294842
1389 Ga0495654_0045751
1390 Ga0495665_0003059
1391 Ga0495665_0259202
1392 Ga0495640_0002044
1393 Ga0495640_0014745
1394 Ga0495640_0049806
1395 Ga0495640_0112645
1396 Ga0495640_0219117
1397 Ga0495640_0251922
1398 Ga0495586_0033311
1399 Ga0495586_0075111
1400 Ga0495586_0086861
1401 Ga0495586_0141136
1402 Ga0495587_0002915
1403 Ga0495587_0035939
1404 Ga0495587_0196883
1405 Ga0495609_0009250
1406 Ga0495597_0017266
1407 Ga0495597_0105220
1408 Ga0495645_0008828
1409 Ga0495645_0063648
1410 Ga0495622_0016908
1411 Ga0495622_0099519
1412 Ga0495622_0124677
1413 Ga0495633_0135822
1414 Ga0495667_0020067
1415 Ga0495667_0056740
1416 Ga0495634_0006056
1417 Ga0495634_0033925
1418 Ga0495634_0053892
1419 Ga0495634_0079640
1420 Ga0495634_0157099
1421 Ga0495611_0031467
1422 Ga0495625_0151553
1423 Ga0495635_0019076
1424 Ga0495635_0028080
1425 Ga0495635_0043546
1426 Ga0495661_0025442
1427 Ga0495588_0006416
1428 Ga0495588_0008967
1429 Ga0495588_0030137
1430 Ga0495588_0109062
1431 Ga0495657_0000202
1432 Ga0495657_0003226
1433 Ga0495657_0007038
1434 Ga0495657_0040440
1435 Ga0495599_0014182
1436 Ga0495599_0195004
1437 Ga0495623_0081145
1438 Ga0495646_0019606
1439 Ga0495646_0054507
1440 Ga0495647_0003456
1441 Ga0495647_0004990
1442 Ga0495658_0000034
1443 Ga0495658_0013726
1444 Ga0495658_0055814
1445 Ga0495658_0072980
1446 Ga0495658_0096040
1447 Ga0495613_0001481
1448 Ga0495613_0003658
1449 Ga0495613_0027986
1450 Ga0495613_0032698
1451 Ga0495613_0056727
1452 Ga0495613_0084491
1453 Ga0495613_0173160
1454 Ga0495613_0214147
1455 Ga0495613_0270308
1456 Ga0495624_0003791
1457 Ga0495624_0182998
1458 Ga0495670_0005831
1459 Ga0495671_0013195
1460 Ga0495671_0120254
1461 Ga0495649_0096354
1462 Ga0495589_0014304
1463 Ga0495589_0018865
1464 Ga0495589_0025472
1465 Ga0495589_0045563
1466 Ga0495600_0002863
1467 Ga0495600_0067872
1468 Ga0495600_0323526
1469 Ga0495660_0014026
1470 Ga0495581_0001476
1471 Ga0495581_0008225
1472 Ga0495581_0018379
1473 Ga0495581_0065656
1474 Ga0495581_0237183
1475 Ga0495604_0001168
1476 Ga0495604_0059596
1477 Ga0495604_0073512
1478 Ga0495604_0102323
1479 Ga0495636_0005117
1480 Ga0495636_0006463
1481 Ga0495636_0006877
1482 Ga0495636_0057768
1483 Ga0495674_0001859
1484 Ga0495674_0031487
1485 Ga0495674_0278301
1486 Ga0495674_0469727
1487 Ga0495674_0505337
1488 Ga0495676_0016188
1489 Ga0495676_0025216
1490 Ga0495676_0039976
1491 Ga0495676_0042632
1492 Ga0495676_0055732
1493 Ga0495676_0057646
1494 Ga0495676_0123724
1495 Ga0495676_0190728
1496 Ga0495680_0008542
1497 Ga0495680_0031860
1498 Ga0495680_0052068
1499 Ga0495680_0052755
1500 Ga0495680_0087601
1501 Ga0495680_0176557
1502 Ga0495680_0188227
1503 Ga0495683_0006385
1504 Ga0495683_0063711
1505 Ga0495687_008351
1506 Ga0495687_058475
1507 Ga0495675_0047959
1508 Ga0495675_0047970
1509 Ga0495679_022541
1510 Ga0495685_007214
1511 Ga0495685_007855
1512 Ga0495685_013221
1513 Ga0495685_037286
1514 Ga0495685_051987
1515 Ga0495685_081790
1516 Ga0495685_096140
1517 Ga0495681_0005684
1518 Ga0495681_0009279
1519 Ga0495684_0001185
1520 Ga0495684_0017654
1521 Ga0495686_0059088
1522 Ga0495686_0116411
1523 Ga0495593_0000562
1524 Ga0495593_0014592
1525 Ga0495602_0047287
1526 Ga0495602_0053192
1527 Ga0495614_0000779
1528 Ga0495614_0012459
1529 Ga0495614_0015109
1530 Ga0495614_0073039
1531 Ga0496100_0022674
1532 Ga0496100_0031846
1533 Ga0496100_0053090
1534 Ga0496100_0095195
1535 Ga0496100_0224275
1536 Ga0496101_0004050
1537 Ga0496101_0133583
1538 Ga0496101_0146612
1539 Ga0496101_0222092
1540 Ga0496101_0305572
1541 Ga0496101_0369141
1542 Ga0496102_0773588
1543 Ga0496103_0023248
1544 Ga0496103_0052951
1545 Ga0496104_0032026
1546 Ga0496104_0034190
1547 Ga0496104_0035255
1548 Ga0496104_0067364
1549 Ga0496104_0096667
1550 Ga0496105_0053951
1551 Ga0496106_0007391
1552 Ga0496106_0012915
1553 Ga0496106_0037127
1554 Ga0496107_0005661
1555 Ga0496107_0026798
1556 Ga0496107_0081066
1557 Ga0496107_0124594
1558 Ga0496107_0167150
1559 Ga0496107_0192602
1560 Ga0496107_0517814
1561 Ga0496108_0003061
1562 Ga0496108_0100173
1563 Ga0496108_0111919
1564 Ga0496108_0137624
1565 Ga0496108_0212604
1566 Ga0496108_0301272
1567 Ga0496108_0581256
1568 Ga0496109_0022625
1569 Ga0496109_0080465
1570 Ga0496109_0094310
1571 Ga0496109_0117432
1572 Ga0496109_0153858
1573 Ga0496109_0163486
1574 Ga0496109_0199622
1575 Ga0496109_0210043
1576 Ga0496109_0241512
1577 Ga0496109_0258064
1578 Ga0496109_0264323
1579 Ga0496109_0416111
1580 Ga0496109_0566128
1581 Ga0496110_0016706
1582 Ga0496110_0053442
1583 Ga0496110_0072203
1584 Ga0496110_0196526
1585 Ga0496110_0269276
1586 Ga0496110_0287405
1587 Ga0496110_0429836
1588 Ga0496111_0003852
1589 Ga0496111_0023769
1590 Ga0496111_0036833
1591 Ga0496111_0264458
1592 Ga0496112_0013703
1593 Ga0496112_0021054
1594 Ga0496112_0336995
1595 Ga0496113_0029238
1596 Ga0496113_0105989
1597 Ga0496113_0130268
1598 Ga0496113_0166898
1599 Ga0496114_0003711
1600 Ga0496114_0007773
1601 Ga0496114_0023386
1602 Ga0496114_0028974
1603 Ga0496114_0040272
1604 Ga0496114_0167546
1605 Ga0496114_0176240
1606 Ga0496115_0001021
1607 Ga0496115_0683319
1608 Ga0501031_0082991
1609 Ga0501031_0187188
1610 Ga0501031_0221531
1611 Ga0501031_0224662
1612 Ga0501032_0187115
1613 Ga0501032_0216590
1614 Ga0501033_0018487
1615 Ga0501036_0048515
1616 Ga0501038_0007874
1617 Ga0501038_0574193
1618 Ga0501039_0170342
1619 Ga0501039_0313386
1620 Ga0501040_0069124
1621 Ga0501040_0152774
1622 Ga0501040_0283595
1623 Ga0501041_0075084
1624 Ga0501041_0108215
1625 Ga0501041_0260606
1626 Ga0501041_0262748
1627 Ga0501041_0277111
1628 Ga0501042_0016520
1629 Ga0501042_0051947
1630 Ga0501042_0187562
1631 Ga0501042_0264570
1632 Ga0501043_0049577
1633 Ga0501043_0602050
1634 Ga0501046_0000583
1635 Ga0501046_0206987
1636 Ga0501046_0266557
1637 Ga0501047_0173218
1638 Ga0501048_0060940
1639 Ga0501048_0132197
1640 Ga0501067_0013389
1641 Ga0501067_0142959
1642 Ga0501067_0188282
1643 Ga0501068_0070188
1644 Ga0501068_0113148
1645 Ga0501068_0165022
1646 Ga0501069_0003548
1647 Ga0501069_0057707
1648 Ga0501069_0098176
1649 Ga0501069_0278165
1650 Ga0501070_0002920
1651 Ga0501070_0156868
1652 Ga0501070_0160569
1653 Ga0501070_0199482
1654 Ga0501070_0569172
1655 Ga0501071_0045486
1656 Ga0501071_0199262
1657 Ga0501071_0276642
1658 Ga0501071_0388725
1659 Ga0501071_0473468
1660 Ga0501072_0062196
1661 Ga0501072_0085101
1662 Ga0501073_0061178
1663 Ga0501074_0040946
1664 Ga0501074_0075181
1665 Ga0501074_0237117
1666 Ga0501074_0278001
1667 Ga0501075_0021362
1668 Ga0501075_0158837
1669 Ga0501075_0179415
1670 Ga0501076_0028798
1671 Ga0501076_0097645
1672 Ga0501076_0209665
1673 Ga0501076_0235562
1674 Ga0501076_0262329
1675 Ga0501077_0025803
1676 Ga0501077_0188760
1677 Ga0501079_0133009
1678 Ga0501079_0153902
1679 Ga0501080_0114340
1680 Ga0501080_0121411
1681 Ga0501080_0180611
1682 Ga0501083_0240831
1683 Ga0501035_0125187
1684 Ga0501035_0186743
1685 Ga0501035_0321369
1686 Ga0501044_0032944
1687 Ga0501044_0038476
1688 Ga0501044_0108167
1689 Ga0501044_0630714
1690 Ga0501045_0063813
1691 Ga0501045_0086489
1692 Ga0501045_0088124
1693 Ga0501045_0234312
1694 Ga0501045_0377680
1695 Ga0501045_0669523
1696 nmdc:mga0yw44_24363_c1
1697 nmdc:mga06z11_241081_c1
1698 nmdc:mga05p37_125957_c2
1699 nmdc:mga05p37_130267_c1
1700 nmdc:mga09592_121715_c1
1701 nmdc:mga09592_128037_c1
1702 nmdc:mga0qj67_113701_c1
1703 nmdc:mga0qj67_212059_c1
1704 nmdc:mga0qj67_75936_c1
1705 nmdc:mga06r32_216651_c1
1706 nmdc:mga06r32_367259_c1
1707 nmdc:mga06r32_72195_c1
1708 nmdc:mga08y16_306882_c1
1709 nmdc:mga08y16_455294_c1
1710 nmdc:mga08y16_91341_c1
1711 Ga0495601_0019616
1712 Ga0495601_0196516
1713 Ga0495601_0311882
1714 Ga0495601_0561579
1715 Ga0495612_0078182
1716 Ga0495612_0200880
1717 Ga0495595_0001710
1718 Ga0495595_0024015
1719 Ga0495595_0045474
1720 Ga0495619_0000438
1721 Ga0495619_0018837
1722 Ga0495619_0030614
1723 Ga0500644_0081069
1724 Ga0500640_009186
1725 Ga0500654_036679
1726 Ga0500553_065185
1727 Ga0500553_083779
1728 Ga0500560_016293
1729 Ga0500569_000018
1730 Ga0500569_000792
1731 Ga0500614_005334
1732 Ga0500628_001533
1733 Ga0500628_029720
1734 Ga0500573_0062393
1735 Ga0500577_0000928
1736 Ga0500588_0001320
1737 Ga0500600_0015152
1738 Ga0500633_0001262
1739 Ga0500634_0009937
1740 Ga0501084_0056954
1741 Ga0501084_0066392
1742 Ga0501084_0142029
1743 Ga0501084_0202307
1744 Ga0501084_0450640
1745 Ga0501082_0166971
1746 Ga0501082_0205058
1747 Ga0501082_0228205
1748 Ga0501082_0283002
1749 Ga0466962_0037469
1750 Ga0530510_0174619
1751 Ga0530510_0378476
1752 2547412972
1753 2548694832
1754 2552107522
1755 2554256988
1756 2585298122
1757 2585305088
1758 2585318260
1759 2616701428
1760 2616903569
1761 2643763538
1762 2643899656
1763 2643947693
1764 2644014307
1765 2644175744
1766 2644266224
1767 2644390126
1768 2644403624
1769 2644435385
1770 2644437641
1771 2644445746
1772 2644463594
1773 2644518118
1774 2644627900
1775 2753070286
1776 2768641994
1777 2784589467
1778 2785342119
1779 2785370540
1780 2786671698
1781 2791913493
1782 2804845791
1783 2808843096
1784 2808921443
1785 2809233131
1786 2811845303
1787 2812357022
1788 2812479686
1789 2819698319
1790 2852640113
1791 2862183625
1792 2862286726
1793 2862295210
1794 2862384510
1795 2862510311
1796 2862578383
1797 2862707837
1798 2863411802
1799 2867348482
1800 2867373037
1801 2867436293
1802 2870729909
1803 2875394624
1804 2877680082
1805 2902803813
1806 2912718674
1807 2912761920
1808 2918504560
1809 2919471512
1810 2919718940
1811 2935396917
1812 2946050009
1813 2946068858
1814 2946076896
1815 2947228054
1816 2954005885
1817 2954385015
1818 2954677983
1819 2954686174
1820 2954695832
1821 2954711023
1822 2954715239
1823 2954725180
1824 2954736637
1825 2954744112
1826 2954755485
1827 2954763054
1828 2966602533
1829 2990045631
1830 2990061678
1831 2990089991
1832 2995464858
1833 2995728918
1834 2997454216
1835 3006326429
1836 3006398555
1837 3006428419
1838 3006491422
1839 3006498283
1840 8008485927
1841 8008566286
1842 8008578012
1843 8023630121
1844 8025418469
1845 8025525011
1846 8025538090
1847 8048409520
1848 8056833278

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

31

235

0.91

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

64

264

0.89

PF12679

ABC2_membrane_2

ABC-2 family transporter protein

16

270

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bi0-assembly1.cif.gz_A abcg2 turnover-2 state with tariquidar bound 0.7458 5 216
8bi0-assembly1.cif.gz_A abcg2 turnover-2 state with tariquidar bound 0.7115 5 216
7nez-assembly1.cif.gz_B structure of topotecan-bound abcg2 0.7105 5 216
6hco-assembly1.cif.gz_A cryo-em structure of the abcg2 e211q mutant bound to estrone 3-sulfate and 5d3-fab 0.7038 5 215
8ce1-assembly1.cif.gz_B cytochrome c maturation complex ccmabcd 0.6907 5 219
ID Description Score Start End Superfamily
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8462 45 216 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7828 45 216 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7774 44 216 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6678 45 216 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6206 45 216 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A0A0M4D6-F1-model_v4 deleted 0.9065 43 137
AF-A0A1V3ZZN2-F1-model_v4 Transport permease protein 0.8889 5 223 GO:0043190
GO:0140359
AF-D1A4B5-F1-model_v4 Transport permease protein 0.8882 83 223 GO:0005886
GO:0140359
AF-A0A2A3IKG5-F1-model_v4 deleted 0.8879 5 223
AF-A0A388T1Q8-F1-model_v4 Transport permease protein 0.887 5 223 GO:0043190
GO:0140359

Map