F485874
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 924 | 464 | 1848 | 236 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2547132111|2547412972 |
| Length | 271 |
| Sequence | TPHPAPAHPASAHATSAQPGPSTTRPLTASRTTATAARVLRQLAHDPRTIALLLVIPCLMLFLLRYVFDGSPRTFDTIGASLLGIFPLITMFLVTSIATLRERTSGTLERLLAMPLGKGDLIAGYALAFGTLAIVQSALATGLAVWFLGLDVTGSPWLLLLVALLDALLGTALGLFVSAFAASEFQAVQFMPAVIFPQLLLCGLFTPRDDMHPALEAISDVLPMSYAVDGMNEVLRHTDMTAAFVRDALIVAGCALLVLALGAATLKRRTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 7 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 48 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 49 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 52 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 53 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 58 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 59 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 62 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 83 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 86 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 87 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 127 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 128 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 129 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 130 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 131 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 132 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 133 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 134 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 135 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 136 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 137 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 138 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 139 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 140 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 141 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 142 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 143 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 144 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 145 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 146 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 147 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 148 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 149 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 150 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 151 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 152 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 153 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 154 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 155 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 156 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 157 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 158 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 159 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 160 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 161 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 162 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 163 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 164 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 165 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 166 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 168 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 169 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 170 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 172 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 174 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 175 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 176 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 177 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 178 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 179 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 180 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 181 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 182 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 183 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 184 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 185 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 186 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 187 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 188 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 189 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 190 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 191 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 192 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 193 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 194 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 195 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 196 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 197 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 198 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 199 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 200 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 201 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 202 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 203 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 204 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 205 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 206 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 207 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 208 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 209 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 210 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 211 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 212 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 213 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 214 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 296 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 297 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 298 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 299 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 300 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 301 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 304 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 305 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 306 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 307 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 308 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 309 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 340 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 341 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 351 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 352 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 353 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 354 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 355 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 356 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 357 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 358 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 359 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 360 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 361 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 362 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 363 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 364 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 367 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 368 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 369 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 370 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 371 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 372 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 373 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 374 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 375 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 376 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 377 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 378 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 379 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 380 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 381 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 382 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 383 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 384 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 385 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 386 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 387 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 388 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 389 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 390 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 391 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 392 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 393 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 394 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 395 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 396 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 397 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 398 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 399 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 400 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 401 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 402 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 403 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 404 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 405 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 406 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 407 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 408 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 409 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 410 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 411 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 412 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 413 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 414 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 415 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 416 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 417 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 418 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 419 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 420 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 421 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 422 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 423 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 424 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 425 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 426 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 427 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 428 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 429 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 430 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 431 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 432 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 433 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 434 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 435 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 436 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 437 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 438 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 439 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 440 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 441 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 442 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 443 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 444 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 445 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 446 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 447 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 448 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 449 | 2995726249 | Leucobacter zeae CC-MF41 | Isolate | Rhizosphere |
| 450 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 451 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 452 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 453 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 454 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 455 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 456 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 457 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 458 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 459 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 460 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 461 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 462 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 463 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 464 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.07 |
| Metatranscriptomes | 0.43 |
| Isolates | 10.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.25 |
| Nodule | 0.32 |
| Rhizoplane | 8.44 |
| Rhizosphere | 79.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10095448 | 3300001989 | Bacteria | 901 |
| 2 | JGI24737J22298_10091489 | 3300001990 | Bacteria | 902 |
| 3 | JGI24735J21928_10038438 | 3300002067 | Bacteria | 1401 |
| 4 | JGI25406J46586_10065161 | 3300003203 | Bacteria | 1162 |
| 5 | rootH1_10009519 | 3300003323 | Bacteria | 1078 |
| 6 | JGI25407J50210_10002838 | 3300003373 | Bacteria | 4122 |
| 7 | JGI25407J50210_10009296 | 3300003373 | Bacteria | 2488 |
| 8 | Ga0006562J51391_1016685 | 3300003578 | Bacteria | 3230 |
| 9 | Ga0006562J51391_1016687 | 3300003578 | Bacteria | 5610 |
| 10 | Ga0006562J51391_1120034 | 3300003578 | Bacteria | 3517 |
| 11 | Ga0070683_100111204 | 3300005329 | Bacteria | 2584 |
| 12 | Ga0068869_100154845 | 3300005334 | Bacteria | 1780 |
| 13 | Ga0070680_100085086 | 3300005336 | Bacteria | 2612 |
| 14 | Ga0070680_100514626 | 3300005336 | Bacteria | 1024 |
| 15 | Ga0070682_100028616 | 3300005337 | Bacteria | 3352 |
| 16 | Ga0068868_100022277 | 3300005338 | Bacteria | 4778 |
| 17 | Ga0068868_100210160 | 3300005338 | Bacteria | 1626 |
| 18 | Ga0070660_100473790 | 3300005339 | Bacteria | 1040 |
| 19 | Ga0070691_10009540 | 3300005341 | Bacteria | 4432 |
| 20 | Ga0070691_10212243 | 3300005341 | Bacteria | 1022 |
| 21 | Ga0070687_100313886 | 3300005343 | Bacteria | 999 |
| 22 | Ga0070692_10008927 | 3300005345 | Bacteria | 4494 |
| 23 | Ga0070692_10068630 | 3300005345 | Bacteria | 1884 |
| 24 | Ga0070692_10117604 | 3300005345 | Bacteria | 1478 |
| 25 | Ga0070668_100147120 | 3300005347 | Bacteria | 1902 |
| 26 | Ga0070675_100386750 | 3300005354 | Bacteria | 1246 |
| 27 | Ga0070659_100015188 | 3300005366 | Bacteria | 5762 |
| 28 | Ga0070659_100294401 | 3300005366 | Bacteria | 1352 |
| 29 | Ga0070714_100030707 | 3300005435 | Bacteria | 4475 |
| 30 | Ga0070714_100045145 | 3300005435 | Bacteria | 3733 |
| 31 | Ga0070714_100048535 | 3300005435 | Bacteria | 3611 |
| 32 | Ga0070714_100065941 | 3300005435 | Bacteria | 3119 |
| 33 | Ga0070713_100119269 | 3300005436 | Bacteria | 2311 |
| 34 | Ga0070710_10267143 | 3300005437 | Bacteria | 1105 |
| 35 | Ga0070701_10147881 | 3300005438 | Bacteria | 1350 |
| 36 | Ga0070711_100140150 | 3300005439 | Bacteria | 1812 |
| 37 | Ga0070711_100335095 | 3300005439 | Bacteria | 1212 |
| 38 | Ga0070705_100098396 | 3300005440 | Bacteria | 1841 |
| 39 | Ga0070708_100237995 | 3300005445 | Bacteria | 1709 |
| 40 | Ga0070663_100192525 | 3300005455 | Bacteria | 1588 |
| 41 | Ga0070663_100328378 | 3300005455 | Bacteria | 1232 |
| 42 | Ga0070663_100364470 | 3300005455 | Bacteria | 1173 |
| 43 | Ga0070681_10123135 | 3300005458 | Bacteria | 2526 |
| 44 | Ga0068867_100220308 | 3300005459 | Bacteria | 1529 |
| 45 | Ga0070698_100000205 | 3300005471 | Bacteria | 56962 |
| 46 | Ga0070699_100036144 | 3300005518 | Bacteria | 4272 |
| 47 | Ga0070679_100005026 | 3300005530 | Bacteria | 12206 |
| 48 | Ga0070679_100052534 | 3300005530 | Bacteria | 4058 |
| 49 | Ga0070679_100328146 | 3300005530 | Bacteria | 1479 |
| 50 | Ga0070684_100011688 | 3300005535 | Bacteria | 7001 |
| 51 | Ga0070684_100046743 | 3300005535 | Bacteria | 3751 |
| 52 | Ga0070684_100064838 | 3300005535 | Bacteria | 3205 |
| 53 | Ga0070684_100199149 | 3300005535 | Bacteria | 1824 |
| 54 | Ga0068853_100289236 | 3300005539 | Bacteria | 1512 |
| 55 | Ga0070672_100153162 | 3300005543 | Bacteria | 1908 |
| 56 | Ga0070672_100472670 | 3300005543 | Bacteria | 1082 |
| 57 | Ga0070672_100817296 | 3300005543 | Bacteria | 821 |
| 58 | Ga0070696_100207248 | 3300005546 | Bacteria | 1466 |
| 59 | Ga0070665_100449331 | 3300005548 | Bacteria | 1298 |
| 60 | Ga0068855_100059913 | 3300005563 | Bacteria | 4453 |
| 61 | Ga0068855_100290738 | 3300005563 | Bacteria | 1812 |
| 62 | Ga0068855_100462769 | 3300005563 | Bacteria | 1383 |
| 63 | Ga0070664_100005522 | 3300005564 | Bacteria | 10150 |
| 64 | Ga0070664_100046190 | 3300005564 | Bacteria | 3679 |
| 65 | Ga0070664_100095346 | 3300005564 | Bacteria | 2581 |
| 66 | Ga0070664_100137236 | 3300005564 | Bacteria | 2151 |
| 67 | Ga0070664_100617928 | 3300005564 | Bacteria | 1006 |
| 68 | Ga0068857_100053192 | 3300005577 | Bacteria | 3593 |
| 69 | Ga0068857_100195209 | 3300005577 | Bacteria | 1844 |
| 70 | Ga0068857_100434341 | 3300005577 | Bacteria | 1226 |
| 71 | Ga0068857_100754074 | 3300005577 | Bacteria | 927 |
| 72 | Ga0068854_100108151 | 3300005578 | Bacteria | 2094 |
| 73 | Ga0068856_100010453 | 3300005614 | Bacteria | 9009 |
| 74 | Ga0070702_100323459 | 3300005615 | Bacteria | 1076 |
| 75 | Ga0070702_100508235 | 3300005615 | Bacteria | 886 |
| 76 | Ga0068852_100198436 | 3300005616 | Bacteria | 1898 |
| 77 | Ga0068852_100293781 | 3300005616 | Bacteria | 1571 |
| 78 | Ga0068852_100672717 | 3300005616 | Bacteria | 1044 |
| 79 | Ga0068851_10058238 | 3300005834 | Bacteria | 1974 |
| 80 | Ga0068860_100000742 | 3300005843 | Bacteria | 37185 |
| 81 | Ga0068860_100009354 | 3300005843 | Bacteria | 9737 |
| 82 | Ga0081455_10023374 | 3300005937 | Bacteria | 5752 |
| 83 | Ga0081455_10126402 | 3300005937 | Bacteria | 2006 |
| 84 | Ga0081455_10136246 | 3300005937 | Bacteria | 1913 |
| 85 | Ga0081455_10190643 | 3300005937 | Bacteria | 1544 |
| 86 | Ga0081538_10000290 | 3300005981 | Bacteria | 57591 |
| 87 | Ga0081538_10000706 | 3300005981 | Bacteria | 36619 |
| 88 | Ga0081538_10005735 | 3300005981 | Bacteria | 11096 |
| 89 | Ga0081539_10006522 | 3300005985 | Bacteria | 11144 |
| 90 | Ga0081539_10025573 | 3300005985 | Bacteria | 3796 |
| 91 | Ga0081539_10148639 | 3300005985 | Bacteria | 1130 |
| 92 | Ga0070717_10018838 | 3300006028 | Bacteria | 5399 |
| 93 | Ga0070717_10124757 | 3300006028 | Bacteria | 2210 |
| 94 | Ga0075365_10068736 | 3300006038 | Bacteria | 2380 |
| 95 | Ga0075365_10267272 | 3300006038 | Bacteria | 1203 |
| 96 | Ga0075365_10424678 | 3300006038 | Bacteria | 938 |
| 97 | Ga0075363_100076040 | 3300006048 | Bacteria | 1830 |
| 98 | Ga0075363_100101656 | 3300006048 | Bacteria | 1591 |
| 99 | Ga0075363_100181904 | 3300006048 | Bacteria | 1196 |
| 100 | Ga0070716_100006557 | 3300006173 | Bacteria | 5689 |
| 101 | Ga0070712_100257498 | 3300006175 | Bacteria | 1397 |
| 102 | Ga0070712_100261565 | 3300006175 | Bacteria | 1387 |
| 103 | Ga0075370_10056496 | 3300006353 | Bacteria | 2231 |
| 104 | Ga0075370_10087701 | 3300006353 | Bacteria | 1793 |
| 105 | Ga0068871_100235177 | 3300006358 | Bacteria | 1591 |
| 106 | Ga0075428_100057946 | 3300006844 | Bacteria | 4241 |
| 107 | Ga0075428_100509097 | 3300006844 | Bacteria | 1288 |
| 108 | Ga0075428_100581333 | 3300006844 | Bacteria | 1197 |
| 109 | Ga0075428_100804655 | 3300006844 | Bacteria | 999 |
| 110 | Ga0075430_100036563 | 3300006846 | Bacteria | 4164 |
| 111 | Ga0075430_100153103 | 3300006846 | Bacteria | 1920 |
| 112 | Ga0075431_100231966 | 3300006847 | Bacteria | 1880 |
| 113 | Ga0075431_100555278 | 3300006847 | Bacteria | 1135 |
| 114 | Ga0075434_100277896 | 3300006871 | Bacteria | 1694 |
| 115 | Ga0075429_100068196 | 3300006880 | Bacteria | 3096 |
| 116 | Ga0105244_10057637 | 3300009036 | Bacteria | 1962 |
| 117 | Ga0111539_10020276 | 3300009094 | Bacteria | 8191 |
| 118 | Ga0111539_10451127 | 3300009094 | Bacteria | 1497 |
| 119 | Ga0105245_10016564 | 3300009098 | Bacteria | 6431 |
| 120 | Ga0105245_10269432 | 3300009098 | Bacteria | 1660 |
| 121 | Ga0105245_10310197 | 3300009098 | Bacteria | 1551 |
| 122 | Ga0105245_10818042 | 3300009098 | Bacteria | 970 |
| 123 | Ga0114129_10046964 | 3300009147 | Bacteria | 6068 |
| 124 | Ga0114129_10080443 | 3300009147 | Bacteria | 4529 |
| 125 | Ga0114129_10406302 | 3300009147 | Bacteria | 1794 |
| 126 | Ga0114129_10442049 | 3300009147 | Bacteria | 1707 |
| 127 | Ga0114129_10774185 | 3300009147 | Bacteria | 1226 |
| 128 | Ga0105243_10131523 | 3300009148 | Bacteria | 2123 |
| 129 | Ga0105243_10139026 | 3300009148 | Bacteria | 2070 |
| 130 | Ga0105243_10419843 | 3300009148 | Bacteria | 1247 |
| 131 | Ga0105242_10529289 | 3300009176 | Bacteria | 1126 |
| 132 | Ga0105248_10518479 | 3300009177 | Bacteria | 1344 |
| 133 | Ga0105237_10086971 | 3300009545 | Bacteria | 3115 |
| 134 | Ga0105237_10241683 | 3300009545 | Bacteria | 1807 |
| 135 | Ga0105237_10436683 | 3300009545 | Bacteria | 1315 |
| 136 | Ga0105238_10079697 | 3300009551 | Bacteria | 3265 |
| 137 | Ga0105238_10389841 | 3300009551 | Bacteria | 1385 |
| 138 | Ga0105249_10228456 | 3300009553 | Bacteria | 1834 |
| 139 | Ga0105239_10175022 | 3300010375 | Bacteria | 2400 |
| 140 | Ga0105239_10184263 | 3300010375 | Bacteria | 2336 |
| 141 | Ga0105239_10700416 | 3300010375 | Bacteria | 1158 |
| 142 | Ga0105246_10018547 | 3300011119 | Bacteria | 4436 |
| 143 | Ga0157369_10274856 | 3300013105 | Bacteria | 1755 |
| 144 | Ga0157369_10684887 | 3300013105 | Bacteria | 1056 |
| 145 | Ga0157369_10851449 | 3300013105 | Bacteria | 936 |
| 146 | Ga0157374_10200004 | 3300013296 | Bacteria | 1956 |
| 147 | Ga0157378_10704994 | 3300013297 | Bacteria | 1029 |
| 148 | Ga0163162_10035725 | 3300013306 | Bacteria | 4951 |
| 149 | Ga0163162_10048311 | 3300013306 | Bacteria | 4263 |
| 150 | Ga0157372_10021291 | 3300013307 | Bacteria | 7004 |
| 151 | Ga0157372_10231700 | 3300013307 | Bacteria | 2141 |
| 152 | Ga0157372_10384271 | 3300013307 | Bacteria | 1636 |
| 153 | Ga0157372_10935116 | 3300013307 | Bacteria | 1005 |
| 154 | Ga0157372_10967032 | 3300013307 | Bacteria | 987 |
| 155 | Ga0157375_10030082 | 3300013308 | Bacteria | 5115 |
| 156 | Ga0157375_10480366 | 3300013308 | Bacteria | 1408 |
| 157 | Ga0157375_11109478 | 3300013308 | Bacteria | 926 |
| 158 | Ga0163163_10030934 | 3300014325 | Bacteria | 5161 |
| 159 | Ga0163163_10337988 | 3300014325 | Bacteria | 1561 |
| 160 | Ga0163163_11039905 | 3300014325 | Bacteria | 882 |
| 161 | Ga0157380_10258559 | 3300014326 | Bacteria | 1580 |
| 162 | Ga0182008_10006311 | 3300014497 | Bacteria | 6644 |
| 163 | Ga0157377_10280012 | 3300014745 | Bacteria | 1093 |
| 164 | Ga0157376_10336520 | 3300014969 | Bacteria | 1440 |
| 165 | Ga0182007_10006346 | 3300015262 | Bacteria | 5083 |
| 166 | Ga0183367_1015 | 3300015688 | Bacteria | 298435 |
| 167 | Ga0206353_11058284 | 3300020082 | Bacteria | 1025 |
| 168 | Ga0209758_1003745 | 3300025297 | Bacteria | 13467 |
| 169 | Ga0207426_1002560 | 3300025302 | Bacteria | 11375 |
| 170 | Ga0207426_1029729 | 3300025302 | Bacteria | 1798 |
| 171 | Ga0207688_10018280 | 3300025901 | Bacteria | 3816 |
| 172 | Ga0207688_10176137 | 3300025901 | Bacteria | 1274 |
| 173 | Ga0207647_10016173 | 3300025904 | Bacteria | 5093 |
| 174 | Ga0207647_10232887 | 3300025904 | Bacteria | 1059 |
| 175 | Ga0207699_10054874 | 3300025906 | Bacteria | 2369 |
| 176 | Ga0207707_10616410 | 3300025912 | Bacteria | 917 |
| 177 | Ga0207693_10207873 | 3300025915 | Bacteria | 1539 |
| 178 | Ga0207663_10083270 | 3300025916 | Bacteria | 2101 |
| 179 | Ga0207663_10380970 | 3300025916 | Bacteria | 1074 |
| 180 | Ga0207660_10031917 | 3300025917 | Bacteria | 3633 |
| 181 | Ga0207660_10148189 | 3300025917 | Bacteria | 1801 |
| 182 | Ga0207660_10225569 | 3300025917 | Bacteria | 1472 |
| 183 | Ga0207662_10032757 | 3300025918 | Bacteria | 3026 |
| 184 | Ga0207662_10233946 | 3300025918 | Bacteria | 1201 |
| 185 | Ga0207657_10241803 | 3300025919 | Bacteria | 1441 |
| 186 | Ga0207652_10169240 | 3300025921 | Bacteria | 1960 |
| 187 | Ga0207659_10434544 | 3300025926 | Bacteria | 1103 |
| 188 | Ga0207687_10085146 | 3300025927 | Bacteria | 2293 |
| 189 | Ga0207687_10112647 | 3300025927 | Bacteria | 2022 |
| 190 | Ga0207700_10000001 | 3300025928 | Bacteria | 1122509 |
| 191 | Ga0207664_10005315 | 3300025929 | Bacteria | 8797 |
| 192 | Ga0207664_10019791 | 3300025929 | Bacteria | 4981 |
| 193 | Ga0207664_10063049 | 3300025929 | Bacteria | 2962 |
| 194 | Ga0207664_10193442 | 3300025929 | Bacteria | 1752 |
| 195 | Ga0207690_10004152 | 3300025932 | Bacteria | 8564 |
| 196 | Ga0207690_10117549 | 3300025932 | Bacteria | 1925 |
| 197 | Ga0207709_10084910 | 3300025935 | Bacteria | 2051 |
| 198 | Ga0207709_10710115 | 3300025935 | Bacteria | 805 |
| 199 | Ga0207669_10599671 | 3300025937 | Bacteria | 895 |
| 200 | Ga0207665_10002267 | 3300025939 | Bacteria | 12982 |
| 201 | Ga0207689_10045569 | 3300025942 | Bacteria | 3625 |
| 202 | Ga0207661_10068071 | 3300025944 | Bacteria | 2898 |
| 203 | Ga0207661_10099321 | 3300025944 | Bacteria | 2441 |
| 204 | Ga0207661_10160672 | 3300025944 | Bacteria | 1949 |
| 205 | Ga0207679_10068035 | 3300025945 | Bacteria | 2674 |
| 206 | Ga0207679_10154393 | 3300025945 | Bacteria | 1872 |
| 207 | Ga0207679_10204592 | 3300025945 | Bacteria | 1651 |
| 208 | Ga0207679_10278450 | 3300025945 | Bacteria | 1434 |
| 209 | Ga0207667_10187389 | 3300025949 | Bacteria | 2123 |
| 210 | Ga0207667_10257284 | 3300025949 | Bacteria | 1785 |
| 211 | Ga0207712_10471437 | 3300025961 | Bacteria | 1068 |
| 212 | Ga0207668_10105394 | 3300025972 | Bacteria | 2104 |
| 213 | Ga0207640_10289183 | 3300025981 | Bacteria | 1291 |
| 214 | Ga0207639_10151683 | 3300026041 | Bacteria | 1942 |
| 215 | Ga0207639_11079339 | 3300026041 | Bacteria | 753 |
| 216 | Ga0207678_10190458 | 3300026067 | Bacteria | 1752 |
| 217 | Ga0207678_10311782 | 3300026067 | Bacteria | 1353 |
| 218 | Ga0207702_10210965 | 3300026078 | Bacteria | 1805 |
| 219 | Ga0207702_10362823 | 3300026078 | Bacteria | 1389 |
| 220 | Ga0207702_10552483 | 3300026078 | Bacteria | 1126 |
| 221 | Ga0207648_10047000 | 3300026089 | Bacteria | 3784 |
| 222 | Ga0207674_10213382 | 3300026116 | Bacteria | 1879 |
| 223 | Ga0207674_10316910 | 3300026116 | Bacteria | 1509 |
| 224 | Ga0207683_10185233 | 3300026121 | Bacteria | 1889 |
| 225 | Ga0207683_10320000 | 3300026121 | Bacteria | 1421 |
| 226 | Ga0207683_10587482 | 3300026121 | Bacteria | 1030 |
| 227 | Ga0207698_10295349 | 3300026142 | Bacteria | 1506 |
| 228 | Ga0209371_1027823 | 3300027312 | Bacteria | 1268 |
| 229 | Ga0268266_10036141 | 3300028379 | Bacteria | 4203 |
| 230 | Ga0268266_10125012 | 3300028379 | Bacteria | 2294 |
| 231 | Ga0268265_10370700 | 3300028380 | Bacteria | 1314 |
| 232 | Ga0268264_10000238 | 3300028381 | Bacteria | 105229 |
| 233 | Ga0265319_1038466 | 3300028563 | Bacteria | 1626 |
| 234 | Ga0265318_10027106 | 3300028577 | Bacteria | 2253 |
| 235 | Ga0307517_10004143 | 3300028786 | Bacteria | 22365 |
| 236 | Ga0307517_10033990 | 3300028786 | Bacteria | 5826 |
| 237 | Ga0307517_10092322 | 3300028786 | Bacteria | 2464 |
| 238 | Ga0307515_10007000 | 3300028794 | Bacteria | 22397 |
| 239 | Ga0307515_10226172 | 3300028794 | Bacteria | 1675 |
| 240 | Ga0265338_10000625 | 3300028800 | Bacteria | 61650 |
| 241 | Ga0265338_10093439 | 3300028800 | Bacteria | 2478 |
| 242 | Ga0265324_10067306 | 3300029957 | Bacteria | 1222 |
| 243 | Ga0268256_1031578 | 3300030500 | Bacteria | 1270 |
| 244 | Ga0307511_10019620 | 3300030521 | Bacteria | 6421 |
| 245 | Ga0307512_10004971 | 3300030522 | Bacteria | 14176 |
| 246 | Ga0265320_10040625 | 3300031240 | Bacteria | 2318 |
| 247 | Ga0265340_10032297 | 3300031247 | Bacteria | 2614 |
| 248 | Ga0265331_10125670 | 3300031250 | Bacteria | 1172 |
| 249 | Ga0265316_10064106 | 3300031344 | Bacteria | 2847 |
| 250 | Ga0307513_10003894 | 3300031456 | Bacteria | 20080 |
| 251 | Ga0307513_10136363 | 3300031456 | Bacteria | 2389 |
| 252 | Ga0307513_10142269 | 3300031456 | Bacteria | 2323 |
| 253 | Ga0307509_10033033 | 3300031507 | Bacteria | 5697 |
| 254 | Ga0307509_10034766 | 3300031507 | Bacteria | 5536 |
| 255 | Ga0265313_10010904 | 3300031595 | Bacteria | 5700 |
| 256 | Ga0307508_10017100 | 3300031616 | Bacteria | 6595 |
| 257 | Ga0307508_10079511 | 3300031616 | Bacteria | 2859 |
| 258 | Ga0307508_10237097 | 3300031616 | Bacteria | 1422 |
| 259 | Ga0307514_10008187 | 3300031649 | Bacteria | 8931 |
| 260 | Ga0316579_10093380 | 3300031691 | Bacteria | 1438 |
| 261 | Ga0265314_10102708 | 3300031711 | Bacteria | 1834 |
| 262 | Ga0307516_10025490 | 3300031730 | Bacteria | 6021 |
| 263 | Ga0307516_10333243 | 3300031730 | Bacteria | 1186 |
| 264 | Ga0307413_10001674 | 3300031824 | Bacteria | 8620 |
| 265 | Ga0307518_10233205 | 3300031838 | Bacteria | 1189 |
| 266 | Ga0307410_10008804 | 3300031852 | Bacteria | 5623 |
| 267 | Ga0307410_10184648 | 3300031852 | Bacteria | 1582 |
| 268 | Ga0307407_10142859 | 3300031903 | Bacteria | 1546 |
| 269 | Ga0307409_100212600 | 3300031995 | Bacteria | 1739 |
| 270 | Ga0307409_100351871 | 3300031995 | Bacteria | 1390 |
| 271 | Ga0307409_100367536 | 3300031995 | Bacteria | 1363 |
| 272 | Ga0307416_100174823 | 3300032002 | Bacteria | 2004 |
| 273 | Ga0307507_10000005 | 3300033179 | Bacteria | 281494 |
| 274 | Ga0307507_10025944 | 3300033179 | Bacteria | 6333 |
| 275 | Ga0307507_10215066 | 3300033179 | Bacteria | 1303 |
| 276 | Ga0307510_10026883 | 3300033180 | Bacteria | 6605 |
| 277 | Ga0307510_10063541 | 3300033180 | Bacteria | 3759 |
| 278 | Ga0307510_10084620 | 3300033180 | Bacteria | 3053 |
| 279 | Ga0307510_10175902 | 3300033180 | Bacteria | 1711 |
| 280 | Ga0307510_10203168 | 3300033180 | Bacteria | 1513 |
| 281 | Ga0373934_0193078 | 3300035086 | Bacteria | 838 |
| 282 | Ga0373944_0009573 | 3300035089 | Bacteria | 2630 |
| 283 | Ga0373936_0018705 | 3300035113 | Bacteria | 2678 |
| 284 | Ga0373945_0006731 | 3300035116 | Bacteria | 3713 |
| 285 | Ga0373953_0060045 | 3300035117 | Bacteria | 1553 |
| 286 | Ga0373956_0245138 | 3300035119 | Bacteria | 852 |
| 287 | Ga0373943_0001754 | 3300035170 | Bacteria | 9822 |
| 288 | Ga0373946_0059247 | 3300035171 | Bacteria | 1624 |
| 289 | Ga0373955_0038200 | 3300035172 | Bacteria | 2557 |
| 290 | Ga0316574_0066613 | 3300035398 | Bacteria | 2269 |
| 291 | Ga0316574_0196893 | 3300035398 | Bacteria | 1295 |
| 292 | Ga0373924_0004634 | 3300035410 | Bacteria | 4820 |
| 293 | Ga0373935_0001379 | 3300035692 | Bacteria | 13421 |
| 294 | Ga0373927_0147860 | 3300035695 | Bacteria | 1538 |
| 295 | Ga0373933_0145794 | 3300035724 | Bacteria | 1497 |
| 296 | Ga0373947_0000226 | 3300035725 | Bacteria | 31559 |
| 297 | Ga0373937_0022211 | 3300036401 | Bacteria | 5702 |
| 298 | Ga0373937_0139961 | 3300036401 | Bacteria | 2264 |
| 299 | Ga0373937_0344400 | 3300036401 | Bacteria | 1411 |
| 300 | Ga0316582_0131663 | 3300036647 | Bacteria | 1680 |
| 301 | Ga0373925_0001646 | 3300037068 | Bacteria | 18823 |
| 302 | Ga0373925_0226686 | 3300037068 | Bacteria | 1493 |
| 303 | Ga0395899_0001716 | 3300037312 | Bacteria | 18224 |
| 304 | Ga0395900_0088333 | 3300037418 | Bacteria | 3187 |
| 305 | Ga0395900_0106748 | 3300037418 | Bacteria | 2877 |
| 306 | Ga0395900_0265621 | 3300037418 | Bacteria | 1712 |
| 307 | Ga0395900_0340967 | 3300037418 | Bacteria | 1474 |
| 308 | Ga0395898_0002109 | 3300037466 | Bacteria | 24644 |
| 309 | Ga0395898_0003292 | 3300037466 | Bacteria | 18144 |
| 310 | Ga0395898_0163335 | 3300037466 | Bacteria | 2130 |
| 311 | Ga0395898_0454358 | 3300037466 | Bacteria | 1220 |
| 312 | Ga0395905_0147818 | 3300037471 | Bacteria | 2211 |
| 313 | Ga0395905_0235169 | 3300037471 | Bacteria | 1713 |
| 314 | Ga0395905_0266366 | 3300037471 | Bacteria | 1599 |
| 315 | Ga0395901_0017382 | 3300038443 | Bacteria | 7342 |
| 316 | Ga0395901_0250568 | 3300038443 | Bacteria | 1845 |
| 317 | Ga0395901_0299344 | 3300038443 | Bacteria | 1668 |
| 318 | Ga0395901_0319280 | 3300038443 | Bacteria | 1607 |
| 319 | Ga0395901_0719709 | 3300038443 | Bacteria | 994 |
| 320 | Ga0439436_0000544 | 3300041404 | Bacteria | 9915 |
| 321 | Ga0439436_0066954 | 3300041404 | Bacteria | 1002 |
| 322 | Ga0451800_0617174 | 3300041459 | Bacteria | 1109 |
| 323 | Ga0451837_1298709 | 3300041494 | Bacteria | 3142 |
| 324 | Ga0451845_0745478 | 3300041501 | Bacteria | 1586 |
| 325 | Ga0451849_1194329 | 3300041505 | Bacteria | 950 |
| 326 | Ga0451853_0760780 | 3300041512 | Bacteria | 1432 |
| 327 | Ga0451853_1262046 | 3300041512 | Bacteria | 6496 |
| 328 | Ga0451853_1799241 | 3300041512 | Bacteria | 4970 |
| 329 | Ga0439433_0001673 | 3300041999 | Bacteria | 4623 |
| 330 | Ga0439433_0007983 | 3300041999 | Bacteria | 2289 |
| 331 | Ga0439448_0012885 | 3300042005 | Bacteria | 2508 |
| 332 | Ga0439432_016449 | 3300042006 | Bacteria | 2489 |
| 333 | Ga0439449_0010032 | 3300042007 | Bacteria | 3583 |
| 334 | Ga0439449_0014176 | 3300042007 | Bacteria | 2996 |
| 335 | Ga0439455_0017576 | 3300042012 | Bacteria | 1668 |
| 336 | Ga0439457_000818 | 3300042014 | Bacteria | 9305 |
| 337 | Ga0439457_001534 | 3300042014 | Bacteria | 6930 |
| 338 | Ga0439462_0025343 | 3300042015 | Bacteria | 1561 |
| 339 | Ga0439462_0049922 | 3300042015 | Bacteria | 1123 |
| 340 | Ga0450894_001082 | 3300042131 | Bacteria | 4118 |
| 341 | Ga0450896_001747 | 3300042133 | Bacteria | 2729 |
| 342 | Ga0450898_000748 | 3300042134 | Bacteria | 3979 |
| 343 | Ga0450899_000527 | 3300042135 | Bacteria | 4358 |
| 344 | Ga0450900_008237 | 3300042136 | Bacteria | 1299 |
| 345 | Ga0450902_025881 | 3300042137 | Bacteria | 980 |
| 346 | Ga0450902_027212 | 3300042137 | Bacteria | 958 |
| 347 | Ga0450903_000006 | 3300042138 | Bacteria | 38832 |
| 348 | Ga0450906_001712 | 3300042145 | Bacteria | 4798 |
| 349 | Ga0466969_0045528 | 3300044656 | Bacteria | 2178 |
| 350 | Ga0466972_0017633 | 3300044658 | Bacteria | 3573 |
| 351 | Ga0466965_0042008 | 3300044683 | Bacteria | 2254 |
| 352 | Ga0466966_0016597 | 3300044684 | Bacteria | 4863 |
| 353 | Ga0466966_0039956 | 3300044684 | Bacteria | 3020 |
| 354 | Ga0466961_0004189 | 3300044693 | Bacteria | 9013 |
| 355 | Ga0466961_0143770 | 3300044693 | Bacteria | 1492 |
| 356 | Ga0466963_0027993 | 3300044694 | Bacteria | 3614 |
| 357 | Ga0466963_0126466 | 3300044694 | Bacteria | 1762 |
| 358 | Ga0466964_0004350 | 3300044706 | Bacteria | 5221 |
| 359 | Ga0466971_0067012 | 3300044719 | Bacteria | 1627 |
| 360 | Ga0466968_0044777 | 3300044735 | Bacteria | 1876 |
| 361 | Ga0466970_0012979 | 3300044765 | Bacteria | 4267 |
| 362 | Ga0466957_0036960 | 3300044842 | Bacteria | 2938 |
| 363 | Ga0466960_0056544 | 3300044901 | Bacteria | 1910 |
| 364 | Ga0466960_0090858 | 3300044901 | Bacteria | 1556 |
| 365 | Ga0466960_0093228 | 3300044901 | Bacteria | 1539 |
| 366 | Ga0466960_0100081 | 3300044901 | Bacteria | 1491 |
| 367 | Ga0466959_0010913 | 3300045049 | Bacteria | 6514 |
| 368 | Ga0466958_0030897 | 3300045836 | Bacteria | 3184 |
| 369 | Ga0466958_0184677 | 3300045836 | Bacteria | 1324 |
| 370 | Ga0466967_0052140 | 3300045976 | Bacteria | 3589 |
| 371 | Ga0466967_0140893 | 3300045976 | Bacteria | 2246 |
| 372 | Ga0466967_0200478 | 3300045976 | Bacteria | 1890 |
| 373 | Ga0466967_0460632 | 3300045976 | Bacteria | 1243 |
| 374 | Ga0495627_024896 | 3300046453 | Bacteria | 1946 |
| 375 | Ga0495592_0005321 | 3300046454 | Bacteria | 9490 |
| 376 | Ga0495592_0020757 | 3300046454 | Bacteria | 4997 |
| 377 | Ga0495592_0052180 | 3300046454 | Bacteria | 3037 |
| 378 | Ga0495592_0277306 | 3300046454 | Bacteria | 1097 |
| 379 | Ga0495603_0000466 | 3300046455 | Bacteria | 22223 |
| 380 | Ga0495603_0004813 | 3300046455 | Bacteria | 8067 |
| 381 | Ga0495603_0023312 | 3300046455 | Bacteria | 3748 |
| 382 | Ga0495603_0036402 | 3300046455 | Bacteria | 2954 |
| 383 | Ga0495603_0063903 | 3300046455 | Bacteria | 2171 |
| 384 | Ga0495603_0108054 | 3300046455 | Bacteria | 1623 |
| 385 | Ga0495603_0179817 | 3300046455 | Bacteria | 1224 |
| 386 | Ga0495590_0009950 | 3300046457 | Bacteria | 3595 |
| 387 | Ga0495590_0032256 | 3300046457 | Bacteria | 1832 |
| 388 | Ga0495629_0007630 | 3300046459 | Bacteria | 7965 |
| 389 | Ga0495629_0016172 | 3300046459 | Bacteria | 5355 |
| 390 | Ga0495629_0021880 | 3300046459 | Bacteria | 4562 |
| 391 | Ga0495629_0031983 | 3300046459 | Bacteria | 3725 |
| 392 | Ga0495629_0083233 | 3300046459 | Bacteria | 2233 |
| 393 | Ga0495629_0100122 | 3300046459 | Bacteria | 2022 |
| 394 | Ga0495629_0121143 | 3300046459 | Bacteria | 1822 |
| 395 | Ga0495629_0215159 | 3300046459 | Bacteria | 1326 |
| 396 | Ga0495638_0000551 | 3300046460 | Bacteria | 42775 |
| 397 | Ga0495638_0027561 | 3300046460 | Bacteria | 3676 |
| 398 | Ga0495638_0039468 | 3300046460 | Bacteria | 2997 |
| 399 | Ga0495641_0025788 | 3300046461 | Bacteria | 2880 |
| 400 | Ga0495641_0042768 | 3300046461 | Bacteria | 2098 |
| 401 | Ga0495651_0009262 | 3300046462 | Bacteria | 7553 |
| 402 | Ga0495651_0056261 | 3300046462 | Bacteria | 3022 |
| 403 | Ga0495651_0057633 | 3300046462 | Bacteria | 2982 |
| 404 | Ga0495651_0079290 | 3300046462 | Bacteria | 2482 |
| 405 | Ga0495653_0008637 | 3300046463 | Bacteria | 8352 |
| 406 | Ga0495653_0009702 | 3300046463 | Bacteria | 7871 |
| 407 | Ga0495653_0094103 | 3300046463 | Bacteria | 2184 |
| 408 | Ga0495653_0121448 | 3300046463 | Bacteria | 1861 |
| 409 | Ga0495653_0125606 | 3300046463 | Bacteria | 1822 |
| 410 | Ga0495580_0060729 | 3300046472 | Bacteria | 2655 |
| 411 | Ga0495582_0000726 | 3300046473 | Bacteria | 18153 |
| 412 | Ga0495582_0003467 | 3300046473 | Bacteria | 8892 |
| 413 | Ga0495582_0041385 | 3300046473 | Bacteria | 2539 |
| 414 | Ga0495582_0077603 | 3300046473 | Bacteria | 1842 |
| 415 | Ga0495582_0216418 | 3300046473 | Bacteria | 1096 |
| 416 | Ga0495582_0297204 | 3300046473 | Bacteria | 928 |
| 417 | Ga0495639_0030797 | 3300046475 | Bacteria | 2385 |
| 418 | Ga0495662_0000499 | 3300046476 | Bacteria | 17842 |
| 419 | Ga0495662_0003417 | 3300046476 | Bacteria | 8045 |
| 420 | Ga0495662_0031367 | 3300046476 | Bacteria | 2567 |
| 421 | Ga0495662_0085651 | 3300046476 | Bacteria | 1534 |
| 422 | Ga0495664_0003367 | 3300046477 | Bacteria | 8690 |
| 423 | Ga0495664_0106425 | 3300046477 | Bacteria | 1691 |
| 424 | Ga0495664_0125704 | 3300046477 | Bacteria | 1551 |
| 425 | Ga0495664_0223522 | 3300046477 | Bacteria | 1139 |
| 426 | Ga0495585_0038948 | 3300046492 | Bacteria | 2674 |
| 427 | Ga0495594_0006887 | 3300046499 | Bacteria | 5845 |
| 428 | Ga0495594_0008252 | 3300046499 | Bacteria | 5360 |
| 429 | Ga0495594_0011484 | 3300046499 | Bacteria | 4604 |
| 430 | Ga0495594_0032590 | 3300046499 | Bacteria | 2829 |
| 431 | Ga0495594_0068248 | 3300046499 | Bacteria | 1974 |
| 432 | Ga0495594_0178376 | 3300046499 | Bacteria | 1209 |
| 433 | Ga0495596_0066335 | 3300046500 | Bacteria | 1403 |
| 434 | Ga0495596_0146265 | 3300046500 | Bacteria | 918 |
| 435 | Ga0495607_0022183 | 3300046501 | Bacteria | 3992 |
| 436 | Ga0495607_0096033 | 3300046501 | Bacteria | 1596 |
| 437 | Ga0495606_0012495 | 3300046507 | Bacteria | 6801 |
| 438 | Ga0495608_0003425 | 3300046511 | Bacteria | 11358 |
| 439 | Ga0495608_0112299 | 3300046511 | Bacteria | 1752 |
| 440 | Ga0495608_0160149 | 3300046511 | Bacteria | 1431 |
| 441 | Ga0495608_0198408 | 3300046511 | Bacteria | 1265 |
| 442 | Ga0495608_0464960 | 3300046511 | Bacteria | 768 |
| 443 | Ga0495610_0111514 | 3300046512 | Bacteria | 1211 |
| 444 | Ga0495616_0016333 | 3300046513 | Bacteria | 4112 |
| 445 | Ga0495618_0002894 | 3300046514 | Bacteria | 10872 |
| 446 | Ga0495618_0047479 | 3300046514 | Bacteria | 2710 |
| 447 | Ga0495618_0206174 | 3300046514 | Bacteria | 1243 |
| 448 | Ga0495618_0370999 | 3300046514 | Bacteria | 879 |
| 449 | Ga0495620_0048447 | 3300046515 | Bacteria | 1823 |
| 450 | Ga0495628_0027289 | 3300046516 | Bacteria | 4647 |
| 451 | Ga0495628_0173679 | 3300046516 | Bacteria | 1633 |
| 452 | Ga0495630_0000269 | 3300046517 | Bacteria | 42207 |
| 453 | Ga0495630_0051164 | 3300046517 | Bacteria | 3092 |
| 454 | Ga0495630_0127885 | 3300046517 | Bacteria | 1928 |
| 455 | Ga0495631_0002894 | 3300046518 | Bacteria | 9511 |
| 456 | Ga0495632_0175486 | 3300046519 | Bacteria | 983 |
| 457 | Ga0495643_0003085 | 3300046522 | Bacteria | 12509 |
| 458 | Ga0495643_0013633 | 3300046522 | Bacteria | 4858 |
| 459 | Ga0495666_0003338 | 3300046526 | Bacteria | 8105 |
| 460 | Ga0495652_0016816 | 3300046529 | Bacteria | 6537 |
| 461 | Ga0495652_0032236 | 3300046529 | Bacteria | 4584 |
| 462 | Ga0495652_0033573 | 3300046529 | Bacteria | 4479 |
| 463 | Ga0495652_0041578 | 3300046529 | Bacteria | 3967 |
| 464 | Ga0495652_0294842 | 3300046529 | Bacteria | 1182 |
| 465 | Ga0495654_0045751 | 3300046530 | Bacteria | 2158 |
| 466 | Ga0495665_0003059 | 3300046531 | Bacteria | 9043 |
| 467 | Ga0495665_0259202 | 3300046531 | Bacteria | 894 |
| 468 | Ga0495640_0002044 | 3300046533 | Bacteria | 16093 |
| 469 | Ga0495640_0014745 | 3300046533 | Bacteria | 5904 |
| 470 | Ga0495640_0049806 | 3300046533 | Bacteria | 2886 |
| 471 | Ga0495640_0112645 | 3300046533 | Bacteria | 1776 |
| 472 | Ga0495640_0219117 | 3300046533 | Bacteria | 1201 |
| 473 | Ga0495640_0251922 | 3300046533 | Bacteria | 1105 |
| 474 | Ga0495586_0033311 | 3300046535 | Bacteria | 2765 |
| 475 | Ga0495586_0075111 | 3300046535 | Bacteria | 1850 |
| 476 | Ga0495586_0086861 | 3300046535 | Bacteria | 1724 |
| 477 | Ga0495586_0141136 | 3300046535 | Bacteria | 1352 |
| 478 | Ga0495587_0002915 | 3300046536 | Bacteria | 11445 |
| 479 | Ga0495587_0035939 | 3300046536 | Bacteria | 2982 |
| 480 | Ga0495587_0196883 | 3300046536 | Bacteria | 1140 |
| 481 | Ga0495609_0009250 | 3300046538 | Bacteria | 4774 |
| 482 | Ga0495597_0017266 | 3300046542 | Bacteria | 3399 |
| 483 | Ga0495597_0105220 | 3300046542 | Bacteria | 1187 |
| 484 | Ga0495645_0008828 | 3300046543 | Bacteria | 7039 |
| 485 | Ga0495645_0063648 | 3300046543 | Bacteria | 2670 |
| 486 | Ga0495622_0016908 | 3300046557 | Bacteria | 3395 |
| 487 | Ga0495622_0099519 | 3300046557 | Bacteria | 1333 |
| 488 | Ga0495622_0124677 | 3300046557 | Bacteria | 1175 |
| 489 | Ga0495633_0135822 | 3300046558 | Bacteria | 1137 |
| 490 | Ga0495667_0020067 | 3300046559 | Bacteria | 4508 |
| 491 | Ga0495667_0056740 | 3300046559 | Bacteria | 2575 |
| 492 | Ga0495634_0006056 | 3300046642 | Bacteria | 9222 |
| 493 | Ga0495634_0033925 | 3300046642 | Bacteria | 3504 |
| 494 | Ga0495634_0053892 | 3300046642 | Bacteria | 2692 |
| 495 | Ga0495634_0079640 | 3300046642 | Bacteria | 2145 |
| 496 | Ga0495634_0157099 | 3300046642 | Bacteria | 1435 |
| 497 | Ga0495611_0031467 | 3300046648 | Bacteria | 2336 |
| 498 | Ga0495625_0151553 | 3300046660 | Bacteria | 1558 |
| 499 | Ga0495635_0019076 | 3300046663 | Bacteria | 4787 |
| 500 | Ga0495635_0028080 | 3300046663 | Bacteria | 3911 |
| 501 | Ga0495635_0043546 | 3300046663 | Bacteria | 3098 |
| 502 | Ga0495661_0025442 | 3300046665 | Bacteria | 3822 |
| 503 | Ga0495588_0006416 | 3300046674 | Bacteria | 5295 |
| 504 | Ga0495588_0008967 | 3300046674 | Bacteria | 4606 |
| 505 | Ga0495588_0030137 | 3300046674 | Bacteria | 2725 |
| 506 | Ga0495588_0109062 | 3300046674 | Bacteria | 1457 |
| 507 | Ga0495657_0000202 | 3300046675 | Bacteria | 53160 |
| 508 | Ga0495657_0003226 | 3300046675 | Bacteria | 13416 |
| 509 | Ga0495657_0007038 | 3300046675 | Bacteria | 8724 |
| 510 | Ga0495657_0040440 | 3300046675 | Bacteria | 3198 |
| 511 | Ga0495599_0014182 | 3300046678 | Bacteria | 4934 |
| 512 | Ga0495599_0195004 | 3300046678 | Bacteria | 1245 |
| 513 | Ga0495623_0081145 | 3300046679 | Bacteria | 2006 |
| 514 | Ga0495646_0019606 | 3300046680 | Bacteria | 4278 |
| 515 | Ga0495646_0054507 | 3300046680 | Bacteria | 2405 |
| 516 | Ga0495647_0003456 | 3300046681 | Bacteria | 5051 |
| 517 | Ga0495647_0004990 | 3300046681 | Bacteria | 4346 |
| 518 | Ga0495658_0000034 | 3300046683 | Bacteria | 69176 |
| 519 | Ga0495658_0013726 | 3300046683 | Bacteria | 4129 |
| 520 | Ga0495658_0055814 | 3300046683 | Bacteria | 2251 |
| 521 | Ga0495658_0072980 | 3300046683 | Bacteria | 1997 |
| 522 | Ga0495658_0096040 | 3300046683 | Bacteria | 1762 |
| 523 | Ga0495613_0001481 | 3300046689 | Bacteria | 17896 |
| 524 | Ga0495613_0003658 | 3300046689 | Bacteria | 11522 |
| 525 | Ga0495613_0027986 | 3300046689 | Bacteria | 4195 |
| 526 | Ga0495613_0032698 | 3300046689 | Bacteria | 3864 |
| 527 | Ga0495613_0056727 | 3300046689 | Bacteria | 2876 |
| 528 | Ga0495613_0084491 | 3300046689 | Bacteria | 2304 |
| 529 | Ga0495613_0173160 | 3300046689 | Bacteria | 1531 |
| 530 | Ga0495613_0214147 | 3300046689 | Bacteria | 1354 |
| 531 | Ga0495613_0270308 | 3300046689 | Bacteria | 1182 |
| 532 | Ga0495624_0003791 | 3300046690 | Bacteria | 11171 |
| 533 | Ga0495624_0182998 | 3300046690 | Bacteria | 1276 |
| 534 | Ga0495670_0005831 | 3300046691 | Bacteria | 6033 |
| 535 | Ga0495671_0013195 | 3300046692 | Bacteria | 4485 |
| 536 | Ga0495671_0120254 | 3300046692 | Bacteria | 1282 |
| 537 | Ga0495649_0096354 | 3300046694 | Bacteria | 1574 |
| 538 | Ga0495589_0014304 | 3300046794 | Bacteria | 4088 |
| 539 | Ga0495589_0018865 | 3300046794 | Bacteria | 3537 |
| 540 | Ga0495589_0025472 | 3300046794 | Bacteria | 3001 |
| 541 | Ga0495589_0045563 | 3300046794 | Bacteria | 2178 |
| 542 | Ga0495600_0002863 | 3300046809 | Bacteria | 10045 |
| 543 | Ga0495600_0067872 | 3300046809 | Bacteria | 2330 |
| 544 | Ga0495600_0323526 | 3300046809 | Bacteria | 969 |
| 545 | Ga0495660_0014026 | 3300046810 | Bacteria | 4646 |
| 546 | Ga0495581_0001476 | 3300047315 | Bacteria | 13089 |
| 547 | Ga0495581_0008225 | 3300047315 | Bacteria | 6047 |
| 548 | Ga0495581_0018379 | 3300047315 | Bacteria | 4060 |
| 549 | Ga0495581_0065656 | 3300047315 | Bacteria | 2098 |
| 550 | Ga0495581_0237183 | 3300047315 | Bacteria | 1067 |
| 551 | Ga0495604_0001168 | 3300047317 | Bacteria | 21698 |
| 552 | Ga0495604_0059596 | 3300047317 | Bacteria | 2925 |
| 553 | Ga0495604_0073512 | 3300047317 | Bacteria | 2580 |
| 554 | Ga0495604_0102323 | 3300047317 | Bacteria | 2103 |
| 555 | Ga0495636_0005117 | 3300047318 | Bacteria | 5148 |
| 556 | Ga0495636_0006463 | 3300047318 | Bacteria | 4604 |
| 557 | Ga0495636_0006877 | 3300047318 | Bacteria | 4473 |
| 558 | Ga0495636_0057768 | 3300047318 | Bacteria | 1635 |
| 559 | Ga0495674_0001859 | 3300047319 | Bacteria | 20807 |
| 560 | Ga0495674_0031487 | 3300047319 | Bacteria | 4819 |
| 561 | Ga0495674_0278301 | 3300047319 | Bacteria | 1371 |
| 562 | Ga0495674_0469727 | 3300047319 | Bacteria | 1009 |
| 563 | Ga0495674_0505337 | 3300047319 | Bacteria | 966 |
| 564 | Ga0495676_0016188 | 3300047321 | Bacteria | 6624 |
| 565 | Ga0495676_0025216 | 3300047321 | Bacteria | 5136 |
| 566 | Ga0495676_0039976 | 3300047321 | Bacteria | 3877 |
| 567 | Ga0495676_0042632 | 3300047321 | Bacteria | 3722 |
| 568 | Ga0495676_0055732 | 3300047321 | Bacteria | 3131 |
| 569 | Ga0495676_0057646 | 3300047321 | Bacteria | 3061 |
| 570 | Ga0495676_0123724 | 3300047321 | Bacteria | 1877 |
| 571 | Ga0495676_0190728 | 3300047321 | Bacteria | 1429 |
| 572 | Ga0495680_0008542 | 3300047322 | Bacteria | 9301 |
| 573 | Ga0495680_0031860 | 3300047322 | Bacteria | 4285 |
| 574 | Ga0495680_0052068 | 3300047322 | Bacteria | 3193 |
| 575 | Ga0495680_0052755 | 3300047322 | Bacteria | 3169 |
| 576 | Ga0495680_0087601 | 3300047322 | Bacteria | 2341 |
| 577 | Ga0495680_0176557 | 3300047322 | Bacteria | 1544 |
| 578 | Ga0495680_0188227 | 3300047322 | Bacteria | 1486 |
| 579 | Ga0495683_0006385 | 3300047323 | Bacteria | 6444 |
| 580 | Ga0495683_0063711 | 3300047323 | Bacteria | 1821 |
| 581 | Ga0495687_008351 | 3300047443 | Bacteria | 5938 |
| 582 | Ga0495687_058475 | 3300047443 | Bacteria | 1599 |
| 583 | Ga0495675_0047959 | 3300047444 | Bacteria | 2717 |
| 584 | Ga0495675_0047970 | 3300047444 | Bacteria | 2717 |
| 585 | Ga0495679_022541 | 3300047446 | Bacteria | 2153 |
| 586 | Ga0495685_007214 | 3300047447 | Bacteria | 3661 |
| 587 | Ga0495685_007855 | 3300047447 | Bacteria | 3531 |
| 588 | Ga0495685_013221 | 3300047447 | Bacteria | 2800 |
| 589 | Ga0495685_037286 | 3300047447 | Bacteria | 1667 |
| 590 | Ga0495685_051987 | 3300047447 | Bacteria | 1388 |
| 591 | Ga0495685_081790 | 3300047447 | Bacteria | 1075 |
| 592 | Ga0495685_096140 | 3300047447 | Bacteria | 979 |
| 593 | Ga0495681_0005684 | 3300047470 | Bacteria | 8303 |
| 594 | Ga0495681_0009279 | 3300047470 | Bacteria | 6078 |
| 595 | Ga0495684_0001185 | 3300047471 | Bacteria | 21022 |
| 596 | Ga0495684_0017654 | 3300047471 | Bacteria | 5496 |
| 597 | Ga0495686_0059088 | 3300047472 | Bacteria | 2388 |
| 598 | Ga0495686_0116411 | 3300047472 | Bacteria | 1597 |
| 599 | Ga0495593_0000562 | 3300047673 | Bacteria | 21077 |
| 600 | Ga0495593_0014592 | 3300047673 | Bacteria | 4464 |
| 601 | Ga0495602_0047287 | 3300048088 | Bacteria | 3878 |
| 602 | Ga0495602_0053192 | 3300048088 | Bacteria | 3588 |
| 603 | Ga0495614_0000779 | 3300048089 | Bacteria | 13490 |
| 604 | Ga0495614_0012459 | 3300048089 | Bacteria | 3731 |
| 605 | Ga0495614_0015109 | 3300048089 | Bacteria | 3369 |
| 606 | Ga0495614_0073039 | 3300048089 | Bacteria | 1480 |
| 607 | Ga0496100_0022674 | 3300048903 | Bacteria | 3802 |
| 608 | Ga0496100_0031846 | 3300048903 | Bacteria | 3282 |
| 609 | Ga0496100_0053090 | 3300048903 | Bacteria | 2638 |
| 610 | Ga0496100_0095195 | 3300048903 | Bacteria | 2041 |
| 611 | Ga0496100_0224275 | 3300048903 | Bacteria | 1380 |
| 612 | Ga0496101_0004050 | 3300048904 | Bacteria | 9161 |
| 613 | Ga0496101_0133583 | 3300048904 | Bacteria | 1886 |
| 614 | Ga0496101_0146612 | 3300048904 | Bacteria | 1803 |
| 615 | Ga0496101_0222092 | 3300048904 | Bacteria | 1466 |
| 616 | Ga0496101_0305572 | 3300048904 | Bacteria | 1246 |
| 617 | Ga0496101_0369141 | 3300048904 | Bacteria | 1128 |
| 618 | Ga0496102_0773588 | 3300048905 | Bacteria | 883 |
| 619 | Ga0496103_0023248 | 3300048906 | Bacteria | 3737 |
| 620 | Ga0496103_0052951 | 3300048906 | Bacteria | 2515 |
| 621 | Ga0496104_0032026 | 3300048907 | Bacteria | 4893 |
| 622 | Ga0496104_0034190 | 3300048907 | Bacteria | 4738 |
| 623 | Ga0496104_0035255 | 3300048907 | Bacteria | 4672 |
| 624 | Ga0496104_0067364 | 3300048907 | Bacteria | 3401 |
| 625 | Ga0496104_0096667 | 3300048907 | Bacteria | 2826 |
| 626 | Ga0496105_0053951 | 3300048908 | Bacteria | 3320 |
| 627 | Ga0496106_0007391 | 3300048909 | Bacteria | 8119 |
| 628 | Ga0496106_0012915 | 3300048909 | Bacteria | 6163 |
| 629 | Ga0496106_0037127 | 3300048909 | Bacteria | 3645 |
| 630 | Ga0496107_0005661 | 3300048910 | Bacteria | 8551 |
| 631 | Ga0496107_0026798 | 3300048910 | Bacteria | 4089 |
| 632 | Ga0496107_0081066 | 3300048910 | Bacteria | 2367 |
| 633 | Ga0496107_0124594 | 3300048910 | Bacteria | 1900 |
| 634 | Ga0496107_0167150 | 3300048910 | Bacteria | 1631 |
| 635 | Ga0496107_0192602 | 3300048910 | Bacteria | 1515 |
| 636 | Ga0496107_0517814 | 3300048910 | Bacteria | 884 |
| 637 | Ga0496108_0003061 | 3300048911 | Bacteria | 13439 |
| 638 | Ga0496108_0100173 | 3300048911 | Bacteria | 2471 |
| 639 | Ga0496108_0111919 | 3300048911 | Bacteria | 2335 |
| 640 | Ga0496108_0137624 | 3300048911 | Bacteria | 2102 |
| 641 | Ga0496108_0212604 | 3300048911 | Bacteria | 1679 |
| 642 | Ga0496108_0301272 | 3300048911 | Bacteria | 1396 |
| 643 | Ga0496108_0581256 | 3300048911 | Bacteria | 976 |
| 644 | Ga0496109_0022625 | 3300048912 | Bacteria | 5568 |
| 645 | Ga0496109_0080465 | 3300048912 | Bacteria | 3001 |
| 646 | Ga0496109_0094310 | 3300048912 | Bacteria | 2770 |
| 647 | Ga0496109_0117432 | 3300048912 | Bacteria | 2476 |
| 648 | Ga0496109_0153858 | 3300048912 | Bacteria | 2154 |
| 649 | Ga0496109_0163486 | 3300048912 | Bacteria | 2086 |
| 650 | Ga0496109_0199622 | 3300048912 | Bacteria | 1880 |
| 651 | Ga0496109_0210043 | 3300048912 | Bacteria | 1831 |
| 652 | Ga0496109_0241512 | 3300048912 | Bacteria | 1700 |
| 653 | Ga0496109_0258064 | 3300048912 | Bacteria | 1642 |
| 654 | Ga0496109_0264323 | 3300048912 | Bacteria | 1621 |
| 655 | Ga0496109_0416111 | 3300048912 | Bacteria | 1270 |
| 656 | Ga0496109_0566128 | 3300048912 | Bacteria | 1071 |
| 657 | Ga0496110_0016706 | 3300048913 | Bacteria | 6129 |
| 658 | Ga0496110_0053442 | 3300048913 | Bacteria | 3551 |
| 659 | Ga0496110_0072203 | 3300048913 | Bacteria | 3062 |
| 660 | Ga0496110_0196526 | 3300048913 | Bacteria | 1832 |
| 661 | Ga0496110_0269276 | 3300048913 | Bacteria | 1551 |
| 662 | Ga0496110_0287405 | 3300048913 | Bacteria | 1497 |
| 663 | Ga0496110_0429836 | 3300048913 | Bacteria | 1204 |
| 664 | Ga0496111_0003852 | 3300048914 | Bacteria | 9376 |
| 665 | Ga0496111_0023769 | 3300048914 | Bacteria | 4305 |
| 666 | Ga0496111_0036833 | 3300048914 | Bacteria | 3499 |
| 667 | Ga0496111_0264458 | 3300048914 | Bacteria | 1276 |
| 668 | Ga0496112_0013703 | 3300048915 | Bacteria | 7494 |
| 669 | Ga0496112_0021054 | 3300048915 | Bacteria | 6194 |
| 670 | Ga0496112_0336995 | 3300048915 | Bacteria | 1452 |
| 671 | Ga0496113_0029238 | 3300048916 | Bacteria | 3976 |
| 672 | Ga0496113_0105989 | 3300048916 | Bacteria | 2183 |
| 673 | Ga0496113_0130268 | 3300048916 | Bacteria | 1973 |
| 674 | Ga0496113_0166898 | 3300048916 | Bacteria | 1742 |
| 675 | Ga0496114_0003711 | 3300048917 | Bacteria | 11754 |
| 676 | Ga0496114_0007773 | 3300048917 | Bacteria | 8485 |
| 677 | Ga0496114_0023386 | 3300048917 | Bacteria | 5043 |
| 678 | Ga0496114_0028974 | 3300048917 | Bacteria | 4549 |
| 679 | Ga0496114_0040272 | 3300048917 | Bacteria | 3867 |
| 680 | Ga0496114_0167546 | 3300048917 | Bacteria | 1913 |
| 681 | Ga0496114_0176240 | 3300048917 | Bacteria | 1866 |
| 682 | Ga0496115_0001021 | 3300048918 | Bacteria | 20300 |
| 683 | Ga0496115_0683319 | 3300048918 | Bacteria | 808 |
| 684 | Ga0501031_0082991 | 3300049568 | Bacteria | 2089 |
| 685 | Ga0501031_0187188 | 3300049568 | Bacteria | 1352 |
| 686 | Ga0501031_0221531 | 3300049568 | Bacteria | 1232 |
| 687 | Ga0501031_0224662 | 3300049568 | Bacteria | 1222 |
| 688 | Ga0501032_0187115 | 3300049569 | Bacteria | 1354 |
| 689 | Ga0501032_0216590 | 3300049569 | Bacteria | 1247 |
| 690 | Ga0501033_0018487 | 3300049570 | Bacteria | 5266 |
| 691 | Ga0501036_0048515 | 3300049572 | Bacteria | 3595 |
| 692 | Ga0501038_0007874 | 3300049574 | Bacteria | 9819 |
| 693 | Ga0501038_0574193 | 3300049574 | Bacteria | 856 |
| 694 | Ga0501039_0170342 | 3300049575 | Bacteria | 1712 |
| 695 | Ga0501039_0313386 | 3300049575 | Bacteria | 1233 |
| 696 | Ga0501040_0069124 | 3300049576 | Bacteria | 2436 |
| 697 | Ga0501040_0152774 | 3300049576 | Bacteria | 1629 |
| 698 | Ga0501040_0283595 | 3300049576 | Bacteria | 1183 |
| 699 | Ga0501041_0075084 | 3300049577 | Bacteria | 2078 |
| 700 | Ga0501041_0108215 | 3300049577 | Bacteria | 1724 |
| 701 | Ga0501041_0260606 | 3300049577 | Bacteria | 1090 |
| 702 | Ga0501041_0262748 | 3300049577 | Bacteria | 1085 |
| 703 | Ga0501041_0277111 | 3300049577 | Bacteria | 1055 |
| 704 | Ga0501042_0016520 | 3300049578 | Bacteria | 5068 |
| 705 | Ga0501042_0051947 | 3300049578 | Bacteria | 2924 |
| 706 | Ga0501042_0187562 | 3300049578 | Bacteria | 1492 |
| 707 | Ga0501042_0264570 | 3300049578 | Bacteria | 1241 |
| 708 | Ga0501043_0049577 | 3300049579 | Bacteria | 3301 |
| 709 | Ga0501043_0602050 | 3300049579 | Bacteria | 812 |
| 710 | Ga0501046_0000583 | 3300049580 | Bacteria | 35953 |
| 711 | Ga0501046_0206987 | 3300049580 | Bacteria | 1458 |
| 712 | Ga0501046_0266557 | 3300049580 | Bacteria | 1257 |
| 713 | Ga0501047_0173218 | 3300049581 | Bacteria | 2027 |
| 714 | Ga0501048_0060940 | 3300049582 | Bacteria | 2673 |
| 715 | Ga0501048_0132197 | 3300049582 | Bacteria | 1764 |
| 716 | Ga0501067_0013389 | 3300049583 | Bacteria | 4542 |
| 717 | Ga0501067_0142959 | 3300049583 | Bacteria | 1333 |
| 718 | Ga0501067_0188282 | 3300049583 | Bacteria | 1149 |
| 719 | Ga0501068_0070188 | 3300049584 | Bacteria | 2137 |
| 720 | Ga0501068_0113148 | 3300049584 | Bacteria | 1689 |
| 721 | Ga0501068_0165022 | 3300049584 | Bacteria | 1397 |
| 722 | Ga0501069_0003548 | 3300049585 | Bacteria | 8032 |
| 723 | Ga0501069_0057707 | 3300049585 | Bacteria | 2165 |
| 724 | Ga0501069_0098176 | 3300049585 | Bacteria | 1661 |
| 725 | Ga0501069_0278165 | 3300049585 | Bacteria | 979 |
| 726 | Ga0501070_0002920 | 3300049586 | Bacteria | 14867 |
| 727 | Ga0501070_0156868 | 3300049586 | Bacteria | 1877 |
| 728 | Ga0501070_0160569 | 3300049586 | Bacteria | 1853 |
| 729 | Ga0501070_0199482 | 3300049586 | Bacteria | 1643 |
| 730 | Ga0501070_0569172 | 3300049586 | Bacteria | 906 |
| 731 | Ga0501071_0045486 | 3300049587 | Bacteria | 3151 |
| 732 | Ga0501071_0199262 | 3300049587 | Bacteria | 1503 |
| 733 | Ga0501071_0276642 | 3300049587 | Bacteria | 1270 |
| 734 | Ga0501071_0388725 | 3300049587 | Bacteria | 1064 |
| 735 | Ga0501071_0473468 | 3300049587 | Bacteria | 960 |
| 736 | Ga0501072_0062196 | 3300049588 | Bacteria | 2945 |
| 737 | Ga0501072_0085101 | 3300049588 | Bacteria | 2508 |
| 738 | Ga0501073_0061178 | 3300049589 | Bacteria | 2628 |
| 739 | Ga0501074_0040946 | 3300049590 | Bacteria | 3354 |
| 740 | Ga0501074_0075181 | 3300049590 | Bacteria | 2425 |
| 741 | Ga0501074_0237117 | 3300049590 | Bacteria | 1298 |
| 742 | Ga0501074_0278001 | 3300049590 | Bacteria | 1190 |
| 743 | Ga0501075_0021362 | 3300049591 | Bacteria | 4717 |
| 744 | Ga0501075_0158837 | 3300049591 | Bacteria | 1724 |
| 745 | Ga0501075_0179415 | 3300049591 | Bacteria | 1616 |
| 746 | Ga0501076_0028798 | 3300049592 | Bacteria | 4316 |
| 747 | Ga0501076_0097645 | 3300049592 | Bacteria | 2366 |
| 748 | Ga0501076_0209665 | 3300049592 | Bacteria | 1592 |
| 749 | Ga0501076_0235562 | 3300049592 | Bacteria | 1497 |
| 750 | Ga0501076_0262329 | 3300049592 | Bacteria | 1414 |
| 751 | Ga0501077_0025803 | 3300049593 | Bacteria | 3729 |
| 752 | Ga0501077_0188760 | 3300049593 | Bacteria | 1309 |
| 753 | Ga0501079_0133009 | 3300049741 | Bacteria | 1936 |
| 754 | Ga0501079_0153902 | 3300049741 | Bacteria | 1792 |
| 755 | Ga0501080_0114340 | 3300049742 | Bacteria | 2502 |
| 756 | Ga0501080_0121411 | 3300049742 | Bacteria | 2421 |
| 757 | Ga0501080_0180611 | 3300049742 | Bacteria | 1942 |
| 758 | Ga0501083_0240831 | 3300049744 | Bacteria | 1178 |
| 759 | Ga0501035_0125187 | 3300049822 | Bacteria | 2244 |
| 760 | Ga0501035_0186743 | 3300049822 | Bacteria | 1784 |
| 761 | Ga0501035_0321369 | 3300049822 | Bacteria | 1300 |
| 762 | Ga0501044_0032944 | 3300049823 | Bacteria | 5446 |
| 763 | Ga0501044_0038476 | 3300049823 | Bacteria | 4994 |
| 764 | Ga0501044_0108167 | 3300049823 | Bacteria | 2791 |
| 765 | Ga0501044_0630714 | 3300049823 | Bacteria | 962 |
| 766 | Ga0501045_0063813 | 3300049824 | Bacteria | 2703 |
| 767 | Ga0501045_0086489 | 3300049824 | Bacteria | 2314 |
| 768 | Ga0501045_0088124 | 3300049824 | Bacteria | 2292 |
| 769 | Ga0501045_0234312 | 3300049824 | Bacteria | 1367 |
| 770 | Ga0501045_0377680 | 3300049824 | Bacteria | 1055 |
| 771 | Ga0501045_0669523 | 3300049824 | Bacteria | 766 |
| 772 | nmdc:mga0yw44_24363_c1 | 3300050492 | Bacteria | 3424 |
| 773 | nmdc:mga06z11_241081_c1 | 3300050494 | Bacteria | 1062 |
| 774 | nmdc:mga05p37_125957_c2 | 3300050507 | Bacteria | 2293 |
| 775 | nmdc:mga05p37_130267_c1 | 3300050507 | Bacteria | 3086 |
| 776 | nmdc:mga09592_121715_c1 | 3300050508 | Bacteria | 2242 |
| 777 | nmdc:mga09592_128037_c1 | 3300050508 | Bacteria | 2183 |
| 778 | nmdc:mga0qj67_113701_c1 | 3300050509 | Bacteria | 2186 |
| 779 | nmdc:mga0qj67_212059_c1 | 3300050509 | Bacteria | 1573 |
| 780 | nmdc:mga0qj67_75936_c1 | 3300050509 | Bacteria | 2687 |
| 781 | nmdc:mga06r32_216651_c1 | 3300050510 | Bacteria | 1902 |
| 782 | nmdc:mga06r32_367259_c1 | 3300050510 | Bacteria | 1423 |
| 783 | nmdc:mga06r32_72195_c1 | 3300050510 | Bacteria | 3342 |
| 784 | nmdc:mga08y16_306882_c1 | 3300050511 | Bacteria | 1635 |
| 785 | nmdc:mga08y16_455294_c1 | 3300050511 | Bacteria | 1304 |
| 786 | nmdc:mga08y16_91341_c1 | 3300050511 | Bacteria | 3173 |
| 787 | Ga0495601_0019616 | 3300053077 | Bacteria | 4125 |
| 788 | Ga0495601_0196516 | 3300053077 | Bacteria | 1318 |
| 789 | Ga0495601_0311882 | 3300053077 | Bacteria | 1024 |
| 790 | Ga0495601_0561579 | 3300053077 | Bacteria | 734 |
| 791 | Ga0495612_0078182 | 3300053078 | Bacteria | 1387 |
| 792 | Ga0495612_0200880 | 3300053078 | Bacteria | 879 |
| 793 | Ga0495595_0001710 | 3300053084 | Bacteria | 8588 |
| 794 | Ga0495595_0024015 | 3300053084 | Bacteria | 2689 |
| 795 | Ga0495595_0045474 | 3300053084 | Bacteria | 2020 |
| 796 | Ga0495619_0000438 | 3300053085 | Bacteria | 28186 |
| 797 | Ga0495619_0018837 | 3300053085 | Bacteria | 4383 |
| 798 | Ga0495619_0030614 | 3300053085 | Bacteria | 3483 |
| 799 | Ga0500644_0081069 | 3300053088 | Bacteria | 1193 |
| 800 | Ga0500640_009186 | 3300053095 | Bacteria | 3939 |
| 801 | Ga0500654_036679 | 3300053099 | Bacteria | 2853 |
| 802 | Ga0500553_065185 | 3300053101 | Bacteria | 1692 |
| 803 | Ga0500553_083779 | 3300053101 | Bacteria | 1425 |
| 804 | Ga0500560_016293 | 3300053107 | Bacteria | 2024 |
| 805 | Ga0500569_000018 | 3300053109 | Bacteria | 42775 |
| 806 | Ga0500569_000792 | 3300053109 | Bacteria | 5545 |
| 807 | Ga0500614_005334 | 3300053123 | Bacteria | 2698 |
| 808 | Ga0500628_001533 | 3300053129 | Bacteria | 3935 |
| 809 | Ga0500628_029720 | 3300053129 | Bacteria | 1176 |
| 810 | Ga0500573_0062393 | 3300053140 | Bacteria | 2134 |
| 811 | Ga0500577_0000928 | 3300053142 | Bacteria | 7599 |
| 812 | Ga0500588_0001320 | 3300053146 | Bacteria | 4665 |
| 813 | Ga0500600_0015152 | 3300053149 | Bacteria | 4681 |
| 814 | Ga0500633_0001262 | 3300053160 | Bacteria | 4666 |
| 815 | Ga0500634_0009937 | 3300053161 | Bacteria | 4841 |
| 816 | Ga0501084_0056954 | 3300054114 | Bacteria | 3271 |
| 817 | Ga0501084_0066392 | 3300054114 | Bacteria | 3018 |
| 818 | Ga0501084_0142029 | 3300054114 | Bacteria | 2022 |
| 819 | Ga0501084_0202307 | 3300054114 | Bacteria | 1676 |
| 820 | Ga0501084_0450640 | 3300054114 | Bacteria | 1088 |
| 821 | Ga0501082_0166971 | 3300060353 | Bacteria | 1913 |
| 822 | Ga0501082_0205058 | 3300060353 | Bacteria | 1715 |
| 823 | Ga0501082_0228205 | 3300060353 | Bacteria | 1621 |
| 824 | Ga0501082_0283002 | 3300060353 | Bacteria | 1443 |
| 825 | Ga0466962_0037469 | 3300061719 | Bacteria | 2322 |
| 826 | Ga0530510_0174619 | 3300061734 | Bacteria | 1592 |
| 827 | Ga0530510_0378476 | 3300061734 | Bacteria | 1065 |
| 828 | 2547412972 | 2547132111 | Bacteria | 8013147 |
| 829 | 2548694832 | 2547132424 | Bacteria | 8348532 |
| 830 | 2552107522 | 2551306166 | Bacteria | 9731570 |
| 831 | 2554256988 | 2554235005 | Bacteria | 6457341 |
| 832 | 2585298122 | 2582581312 | Bacteria | 7308206 |
| 833 | 2585305088 | 2582581313 | Bacteria | 10042643 |
| 834 | 2585318260 | 2582581314 | Bacteria | 11452267 |
| 835 | 2616701428 | 2616644814 | Bacteria | 11555299 |
| 836 | 2616903569 | 2616644941 | Bacteria | 8510691 |
| 837 | 2643763538 | 2643221548 | Bacteria | 8053412 |
| 838 | 2643899656 | 2643221578 | Bacteria | 9213798 |
| 839 | 2643947693 | 2643221587 | Bacteria | 7586415 |
| 840 | 2644014307 | 2643221601 | Bacteria | 7493239 |
| 841 | 2644175744 | 2643221631 | Bacteria | 8168043 |
| 842 | 2644266224 | 2643221647 | Bacteria | 10741251 |
| 843 | 2644390126 | 2643221670 | Bacteria | 6497041 |
| 844 | 2644403624 | 2643221673 | Bacteria | 9196637 |
| 845 | 2644435385 | 2643221677 | Bacteria | 7584031 |
| 846 | 2644437641 | 2643221678 | Bacteria | 9540101 |
| 847 | 2644445746 | 2643221679 | Bacteria | 3839507 |
| 848 | 2644463594 | 2643221682 | Bacteria | 6743283 |
| 849 | 2644518118 | 2643221692 | Bacteria | 7282860 |
| 850 | 2644627900 | 2643221714 | Bacteria | 9015452 |
| 851 | 2753070286 | 2751185734 | Bacteria | 8863695 |
| 852 | 2768641994 | 2767802112 | Bacteria | 6465194 |
| 853 | 2784589467 | 2784132148 | Bacteria | 8627943 |
| 854 | 2785342119 | 2784746763 | Bacteria | 9783172 |
| 855 | 2785370540 | 2784746768 | Bacteria | 10036182 |
| 856 | 2786671698 | 2786546132 | Bacteria | 10419719 |
| 857 | 2791913493 | 2791354901 | Bacteria | 8322202 |
| 858 | 2804845791 | 2802429296 | Bacteria | 7227771 |
| 859 | 2808843096 | 2808606359 | Bacteria | 9866990 |
| 860 | 2808921443 | 2808606375 | Bacteria | 9466072 |
| 861 | 2809233131 | 2808606448 | Bacteria | 8656184 |
| 862 | 2811845303 | 2808606982 | Bacteria | 7791042 |
| 863 | 2812357022 | 2811994879 | Bacteria | 9313447 |
| 864 | 2812479686 | 2811994917 | Bacteria | 7761064 |
| 865 | 2819698319 | 2818991463 | Bacteria | 7948711 |
| 866 | 2852640113 | 2852635781 | Bacteria | 8251373 |
| 867 | 2862183625 | 2862178590 | Bacteria | 8583590 |
| 868 | 2862286726 | 2862281513 | Bacteria | 9621493 |
| 869 | 2862295210 | 2862290372 | Bacteria | 7471434 |
| 870 | 2862384510 | 2862382967 | Bacteria | 10317375 |
| 871 | 2862510311 | 2862507626 | Bacteria | 9425308 |
| 872 | 2862578383 | 2862574272 | Bacteria | 10567477 |
| 873 | 2862707837 | 2862705112 | Bacteria | 6563286 |
| 874 | 2863411802 | 2863404153 | Bacteria | 9672205 |
| 875 | 2867348482 | 2867346516 | Bacteria | 7608576 |
| 876 | 2867373037 | 2867369537 | Bacteria | 6501581 |
| 877 | 2867436293 | 2867428634 | Bacteria | 9590268 |
| 878 | 2870729909 | 2870721527 | Bacteria | 9689237 |
| 879 | 2875394624 | 2875391855 | Bacteria | 7600475 |
| 880 | 2877680082 | 2877676314 | Bacteria | 9512378 |
| 881 | 2902803813 | 2902799365 | Bacteria | 5419524 |
| 882 | 2912718674 | 2912715099 | Bacteria | 9460473 |
| 883 | 2912761920 | 2912757875 | Bacteria | 7940295 |
| 884 | 2918504560 | 2918501144 | Bacteria | 8668083 |
| 885 | 2919471512 | 2919468124 | Bacteria | 9133025 |
| 886 | 2919718940 | 2919713450 | Bacteria | 7431245 |
| 887 | 2935396917 | 2935390628 | Bacteria | 7043367 |
| 888 | 2946050009 | 2946045630 | Bacteria | 8527308 |
| 889 | 2946068858 | 2946064051 | Bacteria | 8957905 |
| 890 | 2946076896 | 2946072368 | Bacteria | 8999607 |
| 891 | 2947228054 | 2947224130 | Bacteria | 9938529 |
| 892 | 2954005885 | 2954002825 | Bacteria | 9173742 |
| 893 | 2954385015 | 2954380949 | Bacteria | 10050426 |
| 894 | 2954677983 | 2954673503 | Bacteria | 9685905 |
| 895 | 2954686174 | 2954682443 | Bacteria | 9862841 |
| 896 | 2954695832 | 2954691527 | Bacteria | 10720516 |
| 897 | 2954711023 | 2954701450 | Bacteria | 10834262 |
| 898 | 2954715239 | 2954711539 | Bacteria | 10867210 |
| 899 | 2954725180 | 2954721474 | Bacteria | 10456478 |
| 900 | 2954736637 | 2954731030 | Bacteria | 10243860 |
| 901 | 2954744112 | 2954740390 | Bacteria | 10229294 |
| 902 | 2954755485 | 2954749733 | Bacteria | 10366972 |
| 903 | 2954763054 | 2954759201 | Bacteria | 9358192 |
| 904 | 2966602533 | 2966598605 | Bacteria | 7676064 |
| 905 | 2990045631 | 2990044586 | Bacteria | 6603797 |
| 906 | 2990061678 | 2990059506 | Bacteria | 9321252 |
| 907 | 2990089991 | 2990088156 | Bacteria | 6657676 |
| 908 | 2995464858 | 2995463766 | Bacteria | 8577691 |
| 909 | 2995728918 | 2995726249 | Bacteria | 3470435 |
| 910 | 2997454216 | 2997451912 | Bacteria | 8492419 |
| 911 | 3006326429 | 3006321560 | Bacteria | 8247479 |
| 912 | 3006398555 | 3006393351 | Bacteria | 6615579 |
| 913 | 3006428419 | 3006425503 | Bacteria | 6491253 |
| 914 | 3006491422 | 3006486233 | Bacteria | 8157040 |
| 915 | 3006498283 | 3006493962 | Bacteria | 8825450 |
| 916 | 8008485927 | 8008485437 | Bacteria | 7198341 |
| 917 | 8008566286 | 8008558824 | Bacteria | 10610750 |
| 918 | 8008578012 | 8008574985 | Bacteria | 7815457 |
| 919 | 8023630121 | 8023623736 | Bacteria | 8593882 |
| 920 | 8025418469 | 8025413630 | Bacteria | 7014048 |
| 921 | 8025525011 | 8025524527 | Bacteria | 7197316 |
| 922 | 8025538090 | 8025530807 | Bacteria | 8495698 |
| 923 | 8048409520 | 8048406513 | Bacteria | 8936924 |
| 924 | 8056833278 | 8056829672 | Bacteria | 9045328 |
| 925 | JGI24739J22299_10095448 | |||
| 926 | JGI24737J22298_10091489 | |||
| 927 | JGI24735J21928_10038438 | |||
| 928 | JGI25406J46586_10065161 | |||
| 929 | rootH1_10009519 | |||
| 930 | JGI25407J50210_10002838 | |||
| 931 | JGI25407J50210_10009296 | |||
| 932 | Ga0006562J51391_1016685 | |||
| 933 | Ga0006562J51391_1016687 | |||
| 934 | Ga0006562J51391_1120034 | |||
| 935 | Ga0070683_100111204 | |||
| 936 | Ga0068869_100154845 | |||
| 937 | Ga0070680_100085086 | |||
| 938 | Ga0070680_100514626 | |||
| 939 | Ga0070682_100028616 | |||
| 940 | Ga0068868_100022277 | |||
| 941 | Ga0068868_100210160 | |||
| 942 | Ga0070660_100473790 | |||
| 943 | Ga0070691_10009540 | |||
| 944 | Ga0070691_10212243 | |||
| 945 | Ga0070687_100313886 | |||
| 946 | Ga0070692_10008927 | |||
| 947 | Ga0070692_10068630 | |||
| 948 | Ga0070692_10117604 | |||
| 949 | Ga0070668_100147120 | |||
| 950 | Ga0070675_100386750 | |||
| 951 | Ga0070659_100015188 | |||
| 952 | Ga0070659_100294401 | |||
| 953 | Ga0070714_100030707 | |||
| 954 | Ga0070714_100045145 | |||
| 955 | Ga0070714_100048535 | |||
| 956 | Ga0070714_100065941 | |||
| 957 | Ga0070713_100119269 | |||
| 958 | Ga0070710_10267143 | |||
| 959 | Ga0070701_10147881 | |||
| 960 | Ga0070711_100140150 | |||
| 961 | Ga0070711_100335095 | |||
| 962 | Ga0070705_100098396 | |||
| 963 | Ga0070708_100237995 | |||
| 964 | Ga0070663_100192525 | |||
| 965 | Ga0070663_100328378 | |||
| 966 | Ga0070663_100364470 | |||
| 967 | Ga0070681_10123135 | |||
| 968 | Ga0068867_100220308 | |||
| 969 | Ga0070698_100000205 | |||
| 970 | Ga0070699_100036144 | |||
| 971 | Ga0070679_100005026 | |||
| 972 | Ga0070679_100052534 | |||
| 973 | Ga0070679_100328146 | |||
| 974 | Ga0070684_100011688 | |||
| 975 | Ga0070684_100046743 | |||
| 976 | Ga0070684_100064838 | |||
| 977 | Ga0070684_100199149 | |||
| 978 | Ga0068853_100289236 | |||
| 979 | Ga0070672_100153162 | |||
| 980 | Ga0070672_100472670 | |||
| 981 | Ga0070672_100817296 | |||
| 982 | Ga0070696_100207248 | |||
| 983 | Ga0070665_100449331 | |||
| 984 | Ga0068855_100059913 | |||
| 985 | Ga0068855_100290738 | |||
| 986 | Ga0068855_100462769 | |||
| 987 | Ga0070664_100005522 | |||
| 988 | Ga0070664_100046190 | |||
| 989 | Ga0070664_100095346 | |||
| 990 | Ga0070664_100137236 | |||
| 991 | Ga0070664_100617928 | |||
| 992 | Ga0068857_100053192 | |||
| 993 | Ga0068857_100195209 | |||
| 994 | Ga0068857_100434341 | |||
| 995 | Ga0068857_100754074 | |||
| 996 | Ga0068854_100108151 | |||
| 997 | Ga0068856_100010453 | |||
| 998 | Ga0070702_100323459 | |||
| 999 | Ga0070702_100508235 | |||
| 1000 | Ga0068852_100198436 | |||
| 1001 | Ga0068852_100293781 | |||
| 1002 | Ga0068852_100672717 | |||
| 1003 | Ga0068851_10058238 | |||
| 1004 | Ga0068860_100000742 | |||
| 1005 | Ga0068860_100009354 | |||
| 1006 | Ga0081455_10023374 | |||
| 1007 | Ga0081455_10126402 | |||
| 1008 | Ga0081455_10136246 | |||
| 1009 | Ga0081455_10190643 | |||
| 1010 | Ga0081538_10000290 | |||
| 1011 | Ga0081538_10000706 | |||
| 1012 | Ga0081538_10005735 | |||
| 1013 | Ga0081539_10006522 | |||
| 1014 | Ga0081539_10025573 | |||
| 1015 | Ga0081539_10148639 | |||
| 1016 | Ga0070717_10018838 | |||
| 1017 | Ga0070717_10124757 | |||
| 1018 | Ga0075365_10068736 | |||
| 1019 | Ga0075365_10267272 | |||
| 1020 | Ga0075365_10424678 | |||
| 1021 | Ga0075363_100076040 | |||
| 1022 | Ga0075363_100101656 | |||
| 1023 | Ga0075363_100181904 | |||
| 1024 | Ga0070716_100006557 | |||
| 1025 | Ga0070712_100257498 | |||
| 1026 | Ga0070712_100261565 | |||
| 1027 | Ga0075370_10056496 | |||
| 1028 | Ga0075370_10087701 | |||
| 1029 | Ga0068871_100235177 | |||
| 1030 | Ga0075428_100057946 | |||
| 1031 | Ga0075428_100509097 | |||
| 1032 | Ga0075428_100581333 | |||
| 1033 | Ga0075428_100804655 | |||
| 1034 | Ga0075430_100036563 | |||
| 1035 | Ga0075430_100153103 | |||
| 1036 | Ga0075431_100231966 | |||
| 1037 | Ga0075431_100555278 | |||
| 1038 | Ga0075434_100277896 | |||
| 1039 | Ga0075429_100068196 | |||
| 1040 | Ga0105244_10057637 | |||
| 1041 | Ga0111539_10020276 | |||
| 1042 | Ga0111539_10451127 | |||
| 1043 | Ga0105245_10016564 | |||
| 1044 | Ga0105245_10269432 | |||
| 1045 | Ga0105245_10310197 | |||
| 1046 | Ga0105245_10818042 | |||
| 1047 | Ga0114129_10046964 | |||
| 1048 | Ga0114129_10080443 | |||
| 1049 | Ga0114129_10406302 | |||
| 1050 | Ga0114129_10442049 | |||
| 1051 | Ga0114129_10774185 | |||
| 1052 | Ga0105243_10131523 | |||
| 1053 | Ga0105243_10139026 | |||
| 1054 | Ga0105243_10419843 | |||
| 1055 | Ga0105242_10529289 | |||
| 1056 | Ga0105248_10518479 | |||
| 1057 | Ga0105237_10086971 | |||
| 1058 | Ga0105237_10241683 | |||
| 1059 | Ga0105237_10436683 | |||
| 1060 | Ga0105238_10079697 | |||
| 1061 | Ga0105238_10389841 | |||
| 1062 | Ga0105249_10228456 | |||
| 1063 | Ga0105239_10175022 | |||
| 1064 | Ga0105239_10184263 | |||
| 1065 | Ga0105239_10700416 | |||
| 1066 | Ga0105246_10018547 | |||
| 1067 | Ga0157369_10274856 | |||
| 1068 | Ga0157369_10684887 | |||
| 1069 | Ga0157369_10851449 | |||
| 1070 | Ga0157374_10200004 | |||
| 1071 | Ga0157378_10704994 | |||
| 1072 | Ga0163162_10035725 | |||
| 1073 | Ga0163162_10048311 | |||
| 1074 | Ga0157372_10021291 | |||
| 1075 | Ga0157372_10231700 | |||
| 1076 | Ga0157372_10384271 | |||
| 1077 | Ga0157372_10935116 | |||
| 1078 | Ga0157372_10967032 | |||
| 1079 | Ga0157375_10030082 | |||
| 1080 | Ga0157375_10480366 | |||
| 1081 | Ga0157375_11109478 | |||
| 1082 | Ga0163163_10030934 | |||
| 1083 | Ga0163163_10337988 | |||
| 1084 | Ga0163163_11039905 | |||
| 1085 | Ga0157380_10258559 | |||
| 1086 | Ga0182008_10006311 | |||
| 1087 | Ga0157377_10280012 | |||
| 1088 | Ga0157376_10336520 | |||
| 1089 | Ga0182007_10006346 | |||
| 1090 | Ga0183367_1015 | |||
| 1091 | Ga0206353_11058284 | |||
| 1092 | Ga0209758_1003745 | |||
| 1093 | Ga0207426_1002560 | |||
| 1094 | Ga0207426_1029729 | |||
| 1095 | Ga0207688_10018280 | |||
| 1096 | Ga0207688_10176137 | |||
| 1097 | Ga0207647_10016173 | |||
| 1098 | Ga0207647_10232887 | |||
| 1099 | Ga0207699_10054874 | |||
| 1100 | Ga0207707_10616410 | |||
| 1101 | Ga0207693_10207873 | |||
| 1102 | Ga0207663_10083270 | |||
| 1103 | Ga0207663_10380970 | |||
| 1104 | Ga0207660_10031917 | |||
| 1105 | Ga0207660_10148189 | |||
| 1106 | Ga0207660_10225569 | |||
| 1107 | Ga0207662_10032757 | |||
| 1108 | Ga0207662_10233946 | |||
| 1109 | Ga0207657_10241803 | |||
| 1110 | Ga0207652_10169240 | |||
| 1111 | Ga0207659_10434544 | |||
| 1112 | Ga0207687_10085146 | |||
| 1113 | Ga0207687_10112647 | |||
| 1114 | Ga0207700_10000001 | |||
| 1115 | Ga0207664_10005315 | |||
| 1116 | Ga0207664_10019791 | |||
| 1117 | Ga0207664_10063049 | |||
| 1118 | Ga0207664_10193442 | |||
| 1119 | Ga0207690_10004152 | |||
| 1120 | Ga0207690_10117549 | |||
| 1121 | Ga0207709_10084910 | |||
| 1122 | Ga0207709_10710115 | |||
| 1123 | Ga0207669_10599671 | |||
| 1124 | Ga0207665_10002267 | |||
| 1125 | Ga0207689_10045569 | |||
| 1126 | Ga0207661_10068071 | |||
| 1127 | Ga0207661_10099321 | |||
| 1128 | Ga0207661_10160672 | |||
| 1129 | Ga0207679_10068035 | |||
| 1130 | Ga0207679_10154393 | |||
| 1131 | Ga0207679_10204592 | |||
| 1132 | Ga0207679_10278450 | |||
| 1133 | Ga0207667_10187389 | |||
| 1134 | Ga0207667_10257284 | |||
| 1135 | Ga0207712_10471437 | |||
| 1136 | Ga0207668_10105394 | |||
| 1137 | Ga0207640_10289183 | |||
| 1138 | Ga0207639_10151683 | |||
| 1139 | Ga0207639_11079339 | |||
| 1140 | Ga0207678_10190458 | |||
| 1141 | Ga0207678_10311782 | |||
| 1142 | Ga0207702_10210965 | |||
| 1143 | Ga0207702_10362823 | |||
| 1144 | Ga0207702_10552483 | |||
| 1145 | Ga0207648_10047000 | |||
| 1146 | Ga0207674_10213382 | |||
| 1147 | Ga0207674_10316910 | |||
| 1148 | Ga0207683_10185233 | |||
| 1149 | Ga0207683_10320000 | |||
| 1150 | Ga0207683_10587482 | |||
| 1151 | Ga0207698_10295349 | |||
| 1152 | Ga0209371_1027823 | |||
| 1153 | Ga0268266_10036141 | |||
| 1154 | Ga0268266_10125012 | |||
| 1155 | Ga0268265_10370700 | |||
| 1156 | Ga0268264_10000238 | |||
| 1157 | Ga0265319_1038466 | |||
| 1158 | Ga0265318_10027106 | |||
| 1159 | Ga0307517_10004143 | |||
| 1160 | Ga0307517_10033990 | |||
| 1161 | Ga0307517_10092322 | |||
| 1162 | Ga0307515_10007000 | |||
| 1163 | Ga0307515_10226172 | |||
| 1164 | Ga0265338_10000625 | |||
| 1165 | Ga0265338_10093439 | |||
| 1166 | Ga0265324_10067306 | |||
| 1167 | Ga0268256_1031578 | |||
| 1168 | Ga0307511_10019620 | |||
| 1169 | Ga0307512_10004971 | |||
| 1170 | Ga0265320_10040625 | |||
| 1171 | Ga0265340_10032297 | |||
| 1172 | Ga0265331_10125670 | |||
| 1173 | Ga0265316_10064106 | |||
| 1174 | Ga0307513_10003894 | |||
| 1175 | Ga0307513_10136363 | |||
| 1176 | Ga0307513_10142269 | |||
| 1177 | Ga0307509_10033033 | |||
| 1178 | Ga0307509_10034766 | |||
| 1179 | Ga0265313_10010904 | |||
| 1180 | Ga0307508_10017100 | |||
| 1181 | Ga0307508_10079511 | |||
| 1182 | Ga0307508_10237097 | |||
| 1183 | Ga0307514_10008187 | |||
| 1184 | Ga0316579_10093380 | |||
| 1185 | Ga0265314_10102708 | |||
| 1186 | Ga0307516_10025490 | |||
| 1187 | Ga0307516_10333243 | |||
| 1188 | Ga0307413_10001674 | |||
| 1189 | Ga0307518_10233205 | |||
| 1190 | Ga0307410_10008804 | |||
| 1191 | Ga0307410_10184648 | |||
| 1192 | Ga0307407_10142859 | |||
| 1193 | Ga0307409_100212600 | |||
| 1194 | Ga0307409_100351871 | |||
| 1195 | Ga0307409_100367536 | |||
| 1196 | Ga0307416_100174823 | |||
| 1197 | Ga0307507_10000005 | |||
| 1198 | Ga0307507_10025944 | |||
| 1199 | Ga0307507_10215066 | |||
| 1200 | Ga0307510_10026883 | |||
| 1201 | Ga0307510_10063541 | |||
| 1202 | Ga0307510_10084620 | |||
| 1203 | Ga0307510_10175902 | |||
| 1204 | Ga0307510_10203168 | |||
| 1205 | Ga0373934_0193078 | |||
| 1206 | Ga0373944_0009573 | |||
| 1207 | Ga0373936_0018705 | |||
| 1208 | Ga0373945_0006731 | |||
| 1209 | Ga0373953_0060045 | |||
| 1210 | Ga0373956_0245138 | |||
| 1211 | Ga0373943_0001754 | |||
| 1212 | Ga0373946_0059247 | |||
| 1213 | Ga0373955_0038200 | |||
| 1214 | Ga0316574_0066613 | |||
| 1215 | Ga0316574_0196893 | |||
| 1216 | Ga0373924_0004634 | |||
| 1217 | Ga0373935_0001379 | |||
| 1218 | Ga0373927_0147860 | |||
| 1219 | Ga0373933_0145794 | |||
| 1220 | Ga0373947_0000226 | |||
| 1221 | Ga0373937_0022211 | |||
| 1222 | Ga0373937_0139961 | |||
| 1223 | Ga0373937_0344400 | |||
| 1224 | Ga0316582_0131663 | |||
| 1225 | Ga0373925_0001646 | |||
| 1226 | Ga0373925_0226686 | |||
| 1227 | Ga0395899_0001716 | |||
| 1228 | Ga0395900_0088333 | |||
| 1229 | Ga0395900_0106748 | |||
| 1230 | Ga0395900_0265621 | |||
| 1231 | Ga0395900_0340967 | |||
| 1232 | Ga0395898_0002109 | |||
| 1233 | Ga0395898_0003292 | |||
| 1234 | Ga0395898_0163335 | |||
| 1235 | Ga0395898_0454358 | |||
| 1236 | Ga0395905_0147818 | |||
| 1237 | Ga0395905_0235169 | |||
| 1238 | Ga0395905_0266366 | |||
| 1239 | Ga0395901_0017382 | |||
| 1240 | Ga0395901_0250568 | |||
| 1241 | Ga0395901_0299344 | |||
| 1242 | Ga0395901_0319280 | |||
| 1243 | Ga0395901_0719709 | |||
| 1244 | Ga0439436_0000544 | |||
| 1245 | Ga0439436_0066954 | |||
| 1246 | Ga0451800_0617174 | |||
| 1247 | Ga0451837_1298709 | |||
| 1248 | Ga0451845_0745478 | |||
| 1249 | Ga0451849_1194329 | |||
| 1250 | Ga0451853_0760780 | |||
| 1251 | Ga0451853_1262046 | |||
| 1252 | Ga0451853_1799241 | |||
| 1253 | Ga0439433_0001673 | |||
| 1254 | Ga0439433_0007983 | |||
| 1255 | Ga0439448_0012885 | |||
| 1256 | Ga0439432_016449 | |||
| 1257 | Ga0439449_0010032 | |||
| 1258 | Ga0439449_0014176 | |||
| 1259 | Ga0439455_0017576 | |||
| 1260 | Ga0439457_000818 | |||
| 1261 | Ga0439457_001534 | |||
| 1262 | Ga0439462_0025343 | |||
| 1263 | Ga0439462_0049922 | |||
| 1264 | Ga0450894_001082 | |||
| 1265 | Ga0450896_001747 | |||
| 1266 | Ga0450898_000748 | |||
| 1267 | Ga0450899_000527 | |||
| 1268 | Ga0450900_008237 | |||
| 1269 | Ga0450902_025881 | |||
| 1270 | Ga0450902_027212 | |||
| 1271 | Ga0450903_000006 | |||
| 1272 | Ga0450906_001712 | |||
| 1273 | Ga0466969_0045528 | |||
| 1274 | Ga0466972_0017633 | |||
| 1275 | Ga0466965_0042008 | |||
| 1276 | Ga0466966_0016597 | |||
| 1277 | Ga0466966_0039956 | |||
| 1278 | Ga0466961_0004189 | |||
| 1279 | Ga0466961_0143770 | |||
| 1280 | Ga0466963_0027993 | |||
| 1281 | Ga0466963_0126466 | |||
| 1282 | Ga0466964_0004350 | |||
| 1283 | Ga0466971_0067012 | |||
| 1284 | Ga0466968_0044777 | |||
| 1285 | Ga0466970_0012979 | |||
| 1286 | Ga0466957_0036960 | |||
| 1287 | Ga0466960_0056544 | |||
| 1288 | Ga0466960_0090858 | |||
| 1289 | Ga0466960_0093228 | |||
| 1290 | Ga0466960_0100081 | |||
| 1291 | Ga0466959_0010913 | |||
| 1292 | Ga0466958_0030897 | |||
| 1293 | Ga0466958_0184677 | |||
| 1294 | Ga0466967_0052140 | |||
| 1295 | Ga0466967_0140893 | |||
| 1296 | Ga0466967_0200478 | |||
| 1297 | Ga0466967_0460632 | |||
| 1298 | Ga0495627_024896 | |||
| 1299 | Ga0495592_0005321 | |||
| 1300 | Ga0495592_0020757 | |||
| 1301 | Ga0495592_0052180 | |||
| 1302 | Ga0495592_0277306 | |||
| 1303 | Ga0495603_0000466 | |||
| 1304 | Ga0495603_0004813 | |||
| 1305 | Ga0495603_0023312 | |||
| 1306 | Ga0495603_0036402 | |||
| 1307 | Ga0495603_0063903 | |||
| 1308 | Ga0495603_0108054 | |||
| 1309 | Ga0495603_0179817 | |||
| 1310 | Ga0495590_0009950 | |||
| 1311 | Ga0495590_0032256 | |||
| 1312 | Ga0495629_0007630 | |||
| 1313 | Ga0495629_0016172 | |||
| 1314 | Ga0495629_0021880 | |||
| 1315 | Ga0495629_0031983 | |||
| 1316 | Ga0495629_0083233 | |||
| 1317 | Ga0495629_0100122 | |||
| 1318 | Ga0495629_0121143 | |||
| 1319 | Ga0495629_0215159 | |||
| 1320 | Ga0495638_0000551 | |||
| 1321 | Ga0495638_0027561 | |||
| 1322 | Ga0495638_0039468 | |||
| 1323 | Ga0495641_0025788 | |||
| 1324 | Ga0495641_0042768 | |||
| 1325 | Ga0495651_0009262 | |||
| 1326 | Ga0495651_0056261 | |||
| 1327 | Ga0495651_0057633 | |||
| 1328 | Ga0495651_0079290 | |||
| 1329 | Ga0495653_0008637 | |||
| 1330 | Ga0495653_0009702 | |||
| 1331 | Ga0495653_0094103 | |||
| 1332 | Ga0495653_0121448 | |||
| 1333 | Ga0495653_0125606 | |||
| 1334 | Ga0495580_0060729 | |||
| 1335 | Ga0495582_0000726 | |||
| 1336 | Ga0495582_0003467 | |||
| 1337 | Ga0495582_0041385 | |||
| 1338 | Ga0495582_0077603 | |||
| 1339 | Ga0495582_0216418 | |||
| 1340 | Ga0495582_0297204 | |||
| 1341 | Ga0495639_0030797 | |||
| 1342 | Ga0495662_0000499 | |||
| 1343 | Ga0495662_0003417 | |||
| 1344 | Ga0495662_0031367 | |||
| 1345 | Ga0495662_0085651 | |||
| 1346 | Ga0495664_0003367 | |||
| 1347 | Ga0495664_0106425 | |||
| 1348 | Ga0495664_0125704 | |||
| 1349 | Ga0495664_0223522 | |||
| 1350 | Ga0495585_0038948 | |||
| 1351 | Ga0495594_0006887 | |||
| 1352 | Ga0495594_0008252 | |||
| 1353 | Ga0495594_0011484 | |||
| 1354 | Ga0495594_0032590 | |||
| 1355 | Ga0495594_0068248 | |||
| 1356 | Ga0495594_0178376 | |||
| 1357 | Ga0495596_0066335 | |||
| 1358 | Ga0495596_0146265 | |||
| 1359 | Ga0495607_0022183 | |||
| 1360 | Ga0495607_0096033 | |||
| 1361 | Ga0495606_0012495 | |||
| 1362 | Ga0495608_0003425 | |||
| 1363 | Ga0495608_0112299 | |||
| 1364 | Ga0495608_0160149 | |||
| 1365 | Ga0495608_0198408 | |||
| 1366 | Ga0495608_0464960 | |||
| 1367 | Ga0495610_0111514 | |||
| 1368 | Ga0495616_0016333 | |||
| 1369 | Ga0495618_0002894 | |||
| 1370 | Ga0495618_0047479 | |||
| 1371 | Ga0495618_0206174 | |||
| 1372 | Ga0495618_0370999 | |||
| 1373 | Ga0495620_0048447 | |||
| 1374 | Ga0495628_0027289 | |||
| 1375 | Ga0495628_0173679 | |||
| 1376 | Ga0495630_0000269 | |||
| 1377 | Ga0495630_0051164 | |||
| 1378 | Ga0495630_0127885 | |||
| 1379 | Ga0495631_0002894 | |||
| 1380 | Ga0495632_0175486 | |||
| 1381 | Ga0495643_0003085 | |||
| 1382 | Ga0495643_0013633 | |||
| 1383 | Ga0495666_0003338 | |||
| 1384 | Ga0495652_0016816 | |||
| 1385 | Ga0495652_0032236 | |||
| 1386 | Ga0495652_0033573 | |||
| 1387 | Ga0495652_0041578 | |||
| 1388 | Ga0495652_0294842 | |||
| 1389 | Ga0495654_0045751 | |||
| 1390 | Ga0495665_0003059 | |||
| 1391 | Ga0495665_0259202 | |||
| 1392 | Ga0495640_0002044 | |||
| 1393 | Ga0495640_0014745 | |||
| 1394 | Ga0495640_0049806 | |||
| 1395 | Ga0495640_0112645 | |||
| 1396 | Ga0495640_0219117 | |||
| 1397 | Ga0495640_0251922 | |||
| 1398 | Ga0495586_0033311 | |||
| 1399 | Ga0495586_0075111 | |||
| 1400 | Ga0495586_0086861 | |||
| 1401 | Ga0495586_0141136 | |||
| 1402 | Ga0495587_0002915 | |||
| 1403 | Ga0495587_0035939 | |||
| 1404 | Ga0495587_0196883 | |||
| 1405 | Ga0495609_0009250 | |||
| 1406 | Ga0495597_0017266 | |||
| 1407 | Ga0495597_0105220 | |||
| 1408 | Ga0495645_0008828 | |||
| 1409 | Ga0495645_0063648 | |||
| 1410 | Ga0495622_0016908 | |||
| 1411 | Ga0495622_0099519 | |||
| 1412 | Ga0495622_0124677 | |||
| 1413 | Ga0495633_0135822 | |||
| 1414 | Ga0495667_0020067 | |||
| 1415 | Ga0495667_0056740 | |||
| 1416 | Ga0495634_0006056 | |||
| 1417 | Ga0495634_0033925 | |||
| 1418 | Ga0495634_0053892 | |||
| 1419 | Ga0495634_0079640 | |||
| 1420 | Ga0495634_0157099 | |||
| 1421 | Ga0495611_0031467 | |||
| 1422 | Ga0495625_0151553 | |||
| 1423 | Ga0495635_0019076 | |||
| 1424 | Ga0495635_0028080 | |||
| 1425 | Ga0495635_0043546 | |||
| 1426 | Ga0495661_0025442 | |||
| 1427 | Ga0495588_0006416 | |||
| 1428 | Ga0495588_0008967 | |||
| 1429 | Ga0495588_0030137 | |||
| 1430 | Ga0495588_0109062 | |||
| 1431 | Ga0495657_0000202 | |||
| 1432 | Ga0495657_0003226 | |||
| 1433 | Ga0495657_0007038 | |||
| 1434 | Ga0495657_0040440 | |||
| 1435 | Ga0495599_0014182 | |||
| 1436 | Ga0495599_0195004 | |||
| 1437 | Ga0495623_0081145 | |||
| 1438 | Ga0495646_0019606 | |||
| 1439 | Ga0495646_0054507 | |||
| 1440 | Ga0495647_0003456 | |||
| 1441 | Ga0495647_0004990 | |||
| 1442 | Ga0495658_0000034 | |||
| 1443 | Ga0495658_0013726 | |||
| 1444 | Ga0495658_0055814 | |||
| 1445 | Ga0495658_0072980 | |||
| 1446 | Ga0495658_0096040 | |||
| 1447 | Ga0495613_0001481 | |||
| 1448 | Ga0495613_0003658 | |||
| 1449 | Ga0495613_0027986 | |||
| 1450 | Ga0495613_0032698 | |||
| 1451 | Ga0495613_0056727 | |||
| 1452 | Ga0495613_0084491 | |||
| 1453 | Ga0495613_0173160 | |||
| 1454 | Ga0495613_0214147 | |||
| 1455 | Ga0495613_0270308 | |||
| 1456 | Ga0495624_0003791 | |||
| 1457 | Ga0495624_0182998 | |||
| 1458 | Ga0495670_0005831 | |||
| 1459 | Ga0495671_0013195 | |||
| 1460 | Ga0495671_0120254 | |||
| 1461 | Ga0495649_0096354 | |||
| 1462 | Ga0495589_0014304 | |||
| 1463 | Ga0495589_0018865 | |||
| 1464 | Ga0495589_0025472 | |||
| 1465 | Ga0495589_0045563 | |||
| 1466 | Ga0495600_0002863 | |||
| 1467 | Ga0495600_0067872 | |||
| 1468 | Ga0495600_0323526 | |||
| 1469 | Ga0495660_0014026 | |||
| 1470 | Ga0495581_0001476 | |||
| 1471 | Ga0495581_0008225 | |||
| 1472 | Ga0495581_0018379 | |||
| 1473 | Ga0495581_0065656 | |||
| 1474 | Ga0495581_0237183 | |||
| 1475 | Ga0495604_0001168 | |||
| 1476 | Ga0495604_0059596 | |||
| 1477 | Ga0495604_0073512 | |||
| 1478 | Ga0495604_0102323 | |||
| 1479 | Ga0495636_0005117 | |||
| 1480 | Ga0495636_0006463 | |||
| 1481 | Ga0495636_0006877 | |||
| 1482 | Ga0495636_0057768 | |||
| 1483 | Ga0495674_0001859 | |||
| 1484 | Ga0495674_0031487 | |||
| 1485 | Ga0495674_0278301 | |||
| 1486 | Ga0495674_0469727 | |||
| 1487 | Ga0495674_0505337 | |||
| 1488 | Ga0495676_0016188 | |||
| 1489 | Ga0495676_0025216 | |||
| 1490 | Ga0495676_0039976 | |||
| 1491 | Ga0495676_0042632 | |||
| 1492 | Ga0495676_0055732 | |||
| 1493 | Ga0495676_0057646 | |||
| 1494 | Ga0495676_0123724 | |||
| 1495 | Ga0495676_0190728 | |||
| 1496 | Ga0495680_0008542 | |||
| 1497 | Ga0495680_0031860 | |||
| 1498 | Ga0495680_0052068 | |||
| 1499 | Ga0495680_0052755 | |||
| 1500 | Ga0495680_0087601 | |||
| 1501 | Ga0495680_0176557 | |||
| 1502 | Ga0495680_0188227 | |||
| 1503 | Ga0495683_0006385 | |||
| 1504 | Ga0495683_0063711 | |||
| 1505 | Ga0495687_008351 | |||
| 1506 | Ga0495687_058475 | |||
| 1507 | Ga0495675_0047959 | |||
| 1508 | Ga0495675_0047970 | |||
| 1509 | Ga0495679_022541 | |||
| 1510 | Ga0495685_007214 | |||
| 1511 | Ga0495685_007855 | |||
| 1512 | Ga0495685_013221 | |||
| 1513 | Ga0495685_037286 | |||
| 1514 | Ga0495685_051987 | |||
| 1515 | Ga0495685_081790 | |||
| 1516 | Ga0495685_096140 | |||
| 1517 | Ga0495681_0005684 | |||
| 1518 | Ga0495681_0009279 | |||
| 1519 | Ga0495684_0001185 | |||
| 1520 | Ga0495684_0017654 | |||
| 1521 | Ga0495686_0059088 | |||
| 1522 | Ga0495686_0116411 | |||
| 1523 | Ga0495593_0000562 | |||
| 1524 | Ga0495593_0014592 | |||
| 1525 | Ga0495602_0047287 | |||
| 1526 | Ga0495602_0053192 | |||
| 1527 | Ga0495614_0000779 | |||
| 1528 | Ga0495614_0012459 | |||
| 1529 | Ga0495614_0015109 | |||
| 1530 | Ga0495614_0073039 | |||
| 1531 | Ga0496100_0022674 | |||
| 1532 | Ga0496100_0031846 | |||
| 1533 | Ga0496100_0053090 | |||
| 1534 | Ga0496100_0095195 | |||
| 1535 | Ga0496100_0224275 | |||
| 1536 | Ga0496101_0004050 | |||
| 1537 | Ga0496101_0133583 | |||
| 1538 | Ga0496101_0146612 | |||
| 1539 | Ga0496101_0222092 | |||
| 1540 | Ga0496101_0305572 | |||
| 1541 | Ga0496101_0369141 | |||
| 1542 | Ga0496102_0773588 | |||
| 1543 | Ga0496103_0023248 | |||
| 1544 | Ga0496103_0052951 | |||
| 1545 | Ga0496104_0032026 | |||
| 1546 | Ga0496104_0034190 | |||
| 1547 | Ga0496104_0035255 | |||
| 1548 | Ga0496104_0067364 | |||
| 1549 | Ga0496104_0096667 | |||
| 1550 | Ga0496105_0053951 | |||
| 1551 | Ga0496106_0007391 | |||
| 1552 | Ga0496106_0012915 | |||
| 1553 | Ga0496106_0037127 | |||
| 1554 | Ga0496107_0005661 | |||
| 1555 | Ga0496107_0026798 | |||
| 1556 | Ga0496107_0081066 | |||
| 1557 | Ga0496107_0124594 | |||
| 1558 | Ga0496107_0167150 | |||
| 1559 | Ga0496107_0192602 | |||
| 1560 | Ga0496107_0517814 | |||
| 1561 | Ga0496108_0003061 | |||
| 1562 | Ga0496108_0100173 | |||
| 1563 | Ga0496108_0111919 | |||
| 1564 | Ga0496108_0137624 | |||
| 1565 | Ga0496108_0212604 | |||
| 1566 | Ga0496108_0301272 | |||
| 1567 | Ga0496108_0581256 | |||
| 1568 | Ga0496109_0022625 | |||
| 1569 | Ga0496109_0080465 | |||
| 1570 | Ga0496109_0094310 | |||
| 1571 | Ga0496109_0117432 | |||
| 1572 | Ga0496109_0153858 | |||
| 1573 | Ga0496109_0163486 | |||
| 1574 | Ga0496109_0199622 | |||
| 1575 | Ga0496109_0210043 | |||
| 1576 | Ga0496109_0241512 | |||
| 1577 | Ga0496109_0258064 | |||
| 1578 | Ga0496109_0264323 | |||
| 1579 | Ga0496109_0416111 | |||
| 1580 | Ga0496109_0566128 | |||
| 1581 | Ga0496110_0016706 | |||
| 1582 | Ga0496110_0053442 | |||
| 1583 | Ga0496110_0072203 | |||
| 1584 | Ga0496110_0196526 | |||
| 1585 | Ga0496110_0269276 | |||
| 1586 | Ga0496110_0287405 | |||
| 1587 | Ga0496110_0429836 | |||
| 1588 | Ga0496111_0003852 | |||
| 1589 | Ga0496111_0023769 | |||
| 1590 | Ga0496111_0036833 | |||
| 1591 | Ga0496111_0264458 | |||
| 1592 | Ga0496112_0013703 | |||
| 1593 | Ga0496112_0021054 | |||
| 1594 | Ga0496112_0336995 | |||
| 1595 | Ga0496113_0029238 | |||
| 1596 | Ga0496113_0105989 | |||
| 1597 | Ga0496113_0130268 | |||
| 1598 | Ga0496113_0166898 | |||
| 1599 | Ga0496114_0003711 | |||
| 1600 | Ga0496114_0007773 | |||
| 1601 | Ga0496114_0023386 | |||
| 1602 | Ga0496114_0028974 | |||
| 1603 | Ga0496114_0040272 | |||
| 1604 | Ga0496114_0167546 | |||
| 1605 | Ga0496114_0176240 | |||
| 1606 | Ga0496115_0001021 | |||
| 1607 | Ga0496115_0683319 | |||
| 1608 | Ga0501031_0082991 | |||
| 1609 | Ga0501031_0187188 | |||
| 1610 | Ga0501031_0221531 | |||
| 1611 | Ga0501031_0224662 | |||
| 1612 | Ga0501032_0187115 | |||
| 1613 | Ga0501032_0216590 | |||
| 1614 | Ga0501033_0018487 | |||
| 1615 | Ga0501036_0048515 | |||
| 1616 | Ga0501038_0007874 | |||
| 1617 | Ga0501038_0574193 | |||
| 1618 | Ga0501039_0170342 | |||
| 1619 | Ga0501039_0313386 | |||
| 1620 | Ga0501040_0069124 | |||
| 1621 | Ga0501040_0152774 | |||
| 1622 | Ga0501040_0283595 | |||
| 1623 | Ga0501041_0075084 | |||
| 1624 | Ga0501041_0108215 | |||
| 1625 | Ga0501041_0260606 | |||
| 1626 | Ga0501041_0262748 | |||
| 1627 | Ga0501041_0277111 | |||
| 1628 | Ga0501042_0016520 | |||
| 1629 | Ga0501042_0051947 | |||
| 1630 | Ga0501042_0187562 | |||
| 1631 | Ga0501042_0264570 | |||
| 1632 | Ga0501043_0049577 | |||
| 1633 | Ga0501043_0602050 | |||
| 1634 | Ga0501046_0000583 | |||
| 1635 | Ga0501046_0206987 | |||
| 1636 | Ga0501046_0266557 | |||
| 1637 | Ga0501047_0173218 | |||
| 1638 | Ga0501048_0060940 | |||
| 1639 | Ga0501048_0132197 | |||
| 1640 | Ga0501067_0013389 | |||
| 1641 | Ga0501067_0142959 | |||
| 1642 | Ga0501067_0188282 | |||
| 1643 | Ga0501068_0070188 | |||
| 1644 | Ga0501068_0113148 | |||
| 1645 | Ga0501068_0165022 | |||
| 1646 | Ga0501069_0003548 | |||
| 1647 | Ga0501069_0057707 | |||
| 1648 | Ga0501069_0098176 | |||
| 1649 | Ga0501069_0278165 | |||
| 1650 | Ga0501070_0002920 | |||
| 1651 | Ga0501070_0156868 | |||
| 1652 | Ga0501070_0160569 | |||
| 1653 | Ga0501070_0199482 | |||
| 1654 | Ga0501070_0569172 | |||
| 1655 | Ga0501071_0045486 | |||
| 1656 | Ga0501071_0199262 | |||
| 1657 | Ga0501071_0276642 | |||
| 1658 | Ga0501071_0388725 | |||
| 1659 | Ga0501071_0473468 | |||
| 1660 | Ga0501072_0062196 | |||
| 1661 | Ga0501072_0085101 | |||
| 1662 | Ga0501073_0061178 | |||
| 1663 | Ga0501074_0040946 | |||
| 1664 | Ga0501074_0075181 | |||
| 1665 | Ga0501074_0237117 | |||
| 1666 | Ga0501074_0278001 | |||
| 1667 | Ga0501075_0021362 | |||
| 1668 | Ga0501075_0158837 | |||
| 1669 | Ga0501075_0179415 | |||
| 1670 | Ga0501076_0028798 | |||
| 1671 | Ga0501076_0097645 | |||
| 1672 | Ga0501076_0209665 | |||
| 1673 | Ga0501076_0235562 | |||
| 1674 | Ga0501076_0262329 | |||
| 1675 | Ga0501077_0025803 | |||
| 1676 | Ga0501077_0188760 | |||
| 1677 | Ga0501079_0133009 | |||
| 1678 | Ga0501079_0153902 | |||
| 1679 | Ga0501080_0114340 | |||
| 1680 | Ga0501080_0121411 | |||
| 1681 | Ga0501080_0180611 | |||
| 1682 | Ga0501083_0240831 | |||
| 1683 | Ga0501035_0125187 | |||
| 1684 | Ga0501035_0186743 | |||
| 1685 | Ga0501035_0321369 | |||
| 1686 | Ga0501044_0032944 | |||
| 1687 | Ga0501044_0038476 | |||
| 1688 | Ga0501044_0108167 | |||
| 1689 | Ga0501044_0630714 | |||
| 1690 | Ga0501045_0063813 | |||
| 1691 | Ga0501045_0086489 | |||
| 1692 | Ga0501045_0088124 | |||
| 1693 | Ga0501045_0234312 | |||
| 1694 | Ga0501045_0377680 | |||
| 1695 | Ga0501045_0669523 | |||
| 1696 | nmdc:mga0yw44_24363_c1 | |||
| 1697 | nmdc:mga06z11_241081_c1 | |||
| 1698 | nmdc:mga05p37_125957_c2 | |||
| 1699 | nmdc:mga05p37_130267_c1 | |||
| 1700 | nmdc:mga09592_121715_c1 | |||
| 1701 | nmdc:mga09592_128037_c1 | |||
| 1702 | nmdc:mga0qj67_113701_c1 | |||
| 1703 | nmdc:mga0qj67_212059_c1 | |||
| 1704 | nmdc:mga0qj67_75936_c1 | |||
| 1705 | nmdc:mga06r32_216651_c1 | |||
| 1706 | nmdc:mga06r32_367259_c1 | |||
| 1707 | nmdc:mga06r32_72195_c1 | |||
| 1708 | nmdc:mga08y16_306882_c1 | |||
| 1709 | nmdc:mga08y16_455294_c1 | |||
| 1710 | nmdc:mga08y16_91341_c1 | |||
| 1711 | Ga0495601_0019616 | |||
| 1712 | Ga0495601_0196516 | |||
| 1713 | Ga0495601_0311882 | |||
| 1714 | Ga0495601_0561579 | |||
| 1715 | Ga0495612_0078182 | |||
| 1716 | Ga0495612_0200880 | |||
| 1717 | Ga0495595_0001710 | |||
| 1718 | Ga0495595_0024015 | |||
| 1719 | Ga0495595_0045474 | |||
| 1720 | Ga0495619_0000438 | |||
| 1721 | Ga0495619_0018837 | |||
| 1722 | Ga0495619_0030614 | |||
| 1723 | Ga0500644_0081069 | |||
| 1724 | Ga0500640_009186 | |||
| 1725 | Ga0500654_036679 | |||
| 1726 | Ga0500553_065185 | |||
| 1727 | Ga0500553_083779 | |||
| 1728 | Ga0500560_016293 | |||
| 1729 | Ga0500569_000018 | |||
| 1730 | Ga0500569_000792 | |||
| 1731 | Ga0500614_005334 | |||
| 1732 | Ga0500628_001533 | |||
| 1733 | Ga0500628_029720 | |||
| 1734 | Ga0500573_0062393 | |||
| 1735 | Ga0500577_0000928 | |||
| 1736 | Ga0500588_0001320 | |||
| 1737 | Ga0500600_0015152 | |||
| 1738 | Ga0500633_0001262 | |||
| 1739 | Ga0500634_0009937 | |||
| 1740 | Ga0501084_0056954 | |||
| 1741 | Ga0501084_0066392 | |||
| 1742 | Ga0501084_0142029 | |||
| 1743 | Ga0501084_0202307 | |||
| 1744 | Ga0501084_0450640 | |||
| 1745 | Ga0501082_0166971 | |||
| 1746 | Ga0501082_0205058 | |||
| 1747 | Ga0501082_0228205 | |||
| 1748 | Ga0501082_0283002 | |||
| 1749 | Ga0466962_0037469 | |||
| 1750 | Ga0530510_0174619 | |||
| 1751 | Ga0530510_0378476 | |||
| 1752 | 2547412972 | |||
| 1753 | 2548694832 | |||
| 1754 | 2552107522 | |||
| 1755 | 2554256988 | |||
| 1756 | 2585298122 | |||
| 1757 | 2585305088 | |||
| 1758 | 2585318260 | |||
| 1759 | 2616701428 | |||
| 1760 | 2616903569 | |||
| 1761 | 2643763538 | |||
| 1762 | 2643899656 | |||
| 1763 | 2643947693 | |||
| 1764 | 2644014307 | |||
| 1765 | 2644175744 | |||
| 1766 | 2644266224 | |||
| 1767 | 2644390126 | |||
| 1768 | 2644403624 | |||
| 1769 | 2644435385 | |||
| 1770 | 2644437641 | |||
| 1771 | 2644445746 | |||
| 1772 | 2644463594 | |||
| 1773 | 2644518118 | |||
| 1774 | 2644627900 | |||
| 1775 | 2753070286 | |||
| 1776 | 2768641994 | |||
| 1777 | 2784589467 | |||
| 1778 | 2785342119 | |||
| 1779 | 2785370540 | |||
| 1780 | 2786671698 | |||
| 1781 | 2791913493 | |||
| 1782 | 2804845791 | |||
| 1783 | 2808843096 | |||
| 1784 | 2808921443 | |||
| 1785 | 2809233131 | |||
| 1786 | 2811845303 | |||
| 1787 | 2812357022 | |||
| 1788 | 2812479686 | |||
| 1789 | 2819698319 | |||
| 1790 | 2852640113 | |||
| 1791 | 2862183625 | |||
| 1792 | 2862286726 | |||
| 1793 | 2862295210 | |||
| 1794 | 2862384510 | |||
| 1795 | 2862510311 | |||
| 1796 | 2862578383 | |||
| 1797 | 2862707837 | |||
| 1798 | 2863411802 | |||
| 1799 | 2867348482 | |||
| 1800 | 2867373037 | |||
| 1801 | 2867436293 | |||
| 1802 | 2870729909 | |||
| 1803 | 2875394624 | |||
| 1804 | 2877680082 | |||
| 1805 | 2902803813 | |||
| 1806 | 2912718674 | |||
| 1807 | 2912761920 | |||
| 1808 | 2918504560 | |||
| 1809 | 2919471512 | |||
| 1810 | 2919718940 | |||
| 1811 | 2935396917 | |||
| 1812 | 2946050009 | |||
| 1813 | 2946068858 | |||
| 1814 | 2946076896 | |||
| 1815 | 2947228054 | |||
| 1816 | 2954005885 | |||
| 1817 | 2954385015 | |||
| 1818 | 2954677983 | |||
| 1819 | 2954686174 | |||
| 1820 | 2954695832 | |||
| 1821 | 2954711023 | |||
| 1822 | 2954715239 | |||
| 1823 | 2954725180 | |||
| 1824 | 2954736637 | |||
| 1825 | 2954744112 | |||
| 1826 | 2954755485 | |||
| 1827 | 2954763054 | |||
| 1828 | 2966602533 | |||
| 1829 | 2990045631 | |||
| 1830 | 2990061678 | |||
| 1831 | 2990089991 | |||
| 1832 | 2995464858 | |||
| 1833 | 2995728918 | |||
| 1834 | 2997454216 | |||
| 1835 | 3006326429 | |||
| 1836 | 3006398555 | |||
| 1837 | 3006428419 | |||
| 1838 | 3006491422 | |||
| 1839 | 3006498283 | |||
| 1840 | 8008485927 | |||
| 1841 | 8008566286 | |||
| 1842 | 8008578012 | |||
| 1843 | 8023630121 | |||
| 1844 | 8025418469 | |||
| 1845 | 8025525011 | |||
| 1846 | 8025538090 | |||
| 1847 | 8048409520 | |||
| 1848 | 8056833278 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8bi0-assembly1.cif.gz_A | abcg2 turnover-2 state with tariquidar bound | 0.7458 | 5 | 216 |
| 8bi0-assembly1.cif.gz_A | abcg2 turnover-2 state with tariquidar bound | 0.7115 | 5 | 216 |
| 7nez-assembly1.cif.gz_B | structure of topotecan-bound abcg2 | 0.7105 | 5 | 216 |
| 6hco-assembly1.cif.gz_A | cryo-em structure of the abcg2 e211q mutant bound to estrone 3-sulfate and 5d3-fab | 0.7038 | 5 | 215 |
| 8ce1-assembly1.cif.gz_B | cytochrome c maturation complex ccmabcd | 0.6907 | 5 | 219 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VMM9_322_706_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.8462 | 45 | 216 | 3.40.1710.10 |
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.7828 | 45 | 216 | 3.40.1710.10 |
| af_Q86P18_394_773_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.7774 | 44 | 216 | 3.40.1710.10 |
| af_Q9VMM9_322_706_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.6678 | 45 | 216 | 3.40.1710.10 |
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.6206 | 45 | 216 | 3.40.1710.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0A0M4D6-F1-model_v4 | deleted | 0.9065 | 43 | 137 |
|
| AF-A0A1V3ZZN2-F1-model_v4 | Transport permease protein | 0.8889 | 5 | 223 |
GO:0043190
GO:0140359 |
| AF-D1A4B5-F1-model_v4 | Transport permease protein | 0.8882 | 83 | 223 |
GO:0005886
GO:0140359 |
| AF-A0A2A3IKG5-F1-model_v4 | deleted | 0.8879 | 5 | 223 |
|
| AF-A0A388T1Q8-F1-model_v4 | Transport permease protein | 0.887 | 5 | 223 |
GO:0043190
GO:0140359 |