F485872
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 924 | 362 | 871 | 213 |
Family's Representative Sequence
| Representative Sequence | 3300053125|Ga0500618_003076|Ga0500618_003076_2569_3399 |
| Length | 253 |
| Sequence | MARRTGMLPSASTASRQLCGNFETALRLLGTCFPHRNKEFDMTIFLGDTAPDFEQDSSIGPLHFHEWAGDAWVVLFSHPADFTPVCTTELGLTAKLKPEFDKRHVKAVALSVDDATSHTEWIKDIEATQKTVVGFPIIADHDRKVATLYGMIHPNQSATATVRSVFIIDPKKKVRLSLTYPMSTGRNFDEILRVIDALQLTDGYSVATPGNWKDGDDVIIPLTIKDEAELKQKFPKGYKAERPYLRLTPQPNK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 2 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 3 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 4 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 5 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 6 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 7 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 8 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 9 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 10 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 11 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 12 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 13 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 14 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 15 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 16 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 17 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 18 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 19 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 20 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 21 | 2831426010 | Nostoc sp. 106C | Isolate | Unclassified |
| 22 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 23 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 24 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 25 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 26 | 2848694841 | Nostoc sp. RF31YmG | Isolate | Unclassified |
| 27 | 2849660919 | Nostoc sp. T09 | Isolate | Unclassified |
| 28 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 29 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 30 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 31 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 32 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 33 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 34 | 2886627955 | Nostoc sp. PA-18-2419 JC1668 | Isolate | Unclassified |
| 35 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 36 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 37 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 38 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 39 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 40 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 41 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 42 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 43 | 2913844669 | Nostocales cyanobacterium LEGE 12452 | Isolate | Unclassified |
| 44 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 45 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 46 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 47 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 48 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 49 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 50 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 51 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 52 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 53 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 54 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 55 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 56 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 57 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 58 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 59 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 60 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 61 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 62 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 63 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 64 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 65 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 66 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 67 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 68 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 69 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 70 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 71 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 72 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 73 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 74 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 75 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 76 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 77 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 78 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 79 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 80 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 81 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 82 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 83 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 84 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 87 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 91 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 97 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 98 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 99 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 101 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 102 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 104 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 105 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 106 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 107 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 109 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 110 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 128 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 130 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 131 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 141 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 142 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 145 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 180 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 181 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 182 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 183 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 184 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 185 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 186 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 187 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 188 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 189 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 190 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 192 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 193 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 194 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 195 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 196 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 197 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 198 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 199 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 200 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 201 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 202 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 203 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 204 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 205 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 206 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 207 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 208 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 209 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 210 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 211 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 212 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 213 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 214 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 215 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 216 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 217 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 302 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 303 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 304 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 305 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 308 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 309 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 310 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 311 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 312 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 313 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 314 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 315 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 316 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 317 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 318 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 319 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 320 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 321 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 338 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 339 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 340 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 345 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 346 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 347 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 348 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 362 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.88 |
| Metatranscriptomes | 2.38 |
| Isolates | 5.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.93 |
| Nodule | 0.65 |
| Rhizoplane | 2.49 |
| Rhizosphere | 81.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000170 | 3300002704 | Bacteria | 28479 |
| 2 | JGI25155J39150_1000318 | 3300002704 | Bacteria | 16164 |
| 3 | JGI25156J39149_1000293 | 3300002705 | Bacteria | 33788 |
| 4 | JGI25156J39149_1001177 | 3300002705 | Bacteria | 11650 |
| 5 | JGI25162J39368_1004661 | 3300002737 | Bacteria | 3072 |
| 6 | JGI25154J39366_1000260 | 3300002738 | Bacteria | 33788 |
| 7 | JGI25154J39366_1000267 | 3300002738 | Bacteria | 32817 |
| 8 | JGI25154J39366_1000581 | 3300002738 | Bacteria | 17734 |
| 9 | JGI25157J39369_1000327 | 3300002741 | Bacteria | 33804 |
| 10 | JGI25150J39212_1005529 | 3300002774 | Bacteria | 2688 |
| 11 | JGI25150J39212_1012921 | 3300002774 | Bacteria | 1461 |
| 12 | JGI25159J45721_1003120 | 3300002987 | Bacteria | 5970 |
| 13 | JGI25151J46595_10035960 | 3300003187 | Bacteria | 1874 |
| 14 | JGI25153J46596_10009537 | 3300003215 | Bacteria | 4495 |
| 15 | Ga0007417J51691_1076888 | 3300003544 | Bacteria | 852 |
| 16 | Ga0007410J51695_1013512 | 3300003574 | Bacteria | 910 |
| 17 | Ga0007409J51694_1005946 | 3300003575 | Bacteria | 3452 |
| 18 | Ga0007409J51694_1006985 | 3300003575 | Bacteria | 1017 |
| 19 | Ga0007416J51690_1007671 | 3300003577 | Bacteria | 1268 |
| 20 | Ga0032354_1018852 | 3300003693 | Bacteria | 1041 |
| 21 | Ga0055538_1000138 | 3300003751 | Bacteria | 51369 |
| 22 | Ga0055539_1000187 | 3300003752 | Bacteria | 51369 |
| 23 | Ga0055533_1000189 | 3300003756 | Bacteria | 51369 |
| 24 | Ga0055532_1000184 | 3300003758 | Bacteria | 52595 |
| 25 | Ga0055525_1000133 | 3300003759 | Bacteria | 109627 |
| 26 | Ga0055525_1000254 | 3300003759 | Bacteria | 51369 |
| 27 | Ga0055535_1009076 | 3300003761 | Bacteria | 1740 |
| 28 | Ga0055529_1000154 | 3300003763 | Bacteria | 94292 |
| 29 | Ga0055526_1000237 | 3300003771 | Bacteria | 46547 |
| 30 | Ga0055526_1000525 | 3300003771 | Bacteria | 30396 |
| 31 | Ga0055537_1000111 | 3300003773 | Bacteria | 61884 |
| 32 | Ga0055537_1014742 | 3300003773 | Bacteria | 1404 |
| 33 | Ga0055524_1000015 | 3300003775 | Bacteria | 246493 |
| 34 | Ga0055524_1004885 | 3300003775 | Bacteria | 6089 |
| 35 | Ga0055524_1008329 | 3300003775 | Bacteria | 4314 |
| 36 | Ga0055534_1000509 | 3300003784 | Bacteria | 21144 |
| 37 | Ga0055534_1001874 | 3300003784 | Bacteria | 7802 |
| 38 | Ga0055528_1000178 | 3300003790 | Bacteria | 53709 |
| 39 | Ga0055541_1000122 | 3300003841 | Bacteria | 51369 |
| 40 | Ga0055543_1002600 | 3300004625 | Bacteria | 5838 |
| 41 | Ga0065165_1000286 | 3300005262 | Bacteria | 85993 |
| 42 | Ga0065165_1000465 | 3300005262 | Bacteria | 63558 |
| 43 | Ga0065165_1092670 | 3300005262 | Bacteria | 767 |
| 44 | Ga0065712_10165081 | 3300005290 | Bacteria | 1277 |
| 45 | Ga0065715_10228053 | 3300005293 | Bacteria | 1245 |
| 46 | Ga0070658_10825019 | 3300005327 | Bacteria | 806 |
| 47 | Ga0070670_100013536 | 3300005331 | Bacteria | 6991 |
| 48 | Ga0070670_100019310 | 3300005331 | Bacteria | 5847 |
| 49 | Ga0068869_100100111 | 3300005334 | Bacteria | 2191 |
| 50 | Ga0070682_100001863 | 3300005337 | Bacteria | 11766 |
| 51 | Ga0070682_100143786 | 3300005337 | Bacteria | 1629 |
| 52 | Ga0070660_100001978 | 3300005339 | Bacteria | 14153 |
| 53 | Ga0070660_100056850 | 3300005339 | Bacteria | 3028 |
| 54 | Ga0070660_100102515 | 3300005339 | Bacteria | 2268 |
| 55 | Ga0070661_100122751 | 3300005344 | Bacteria | 1946 |
| 56 | Ga0070661_100126061 | 3300005344 | Bacteria | 1921 |
| 57 | Ga0070688_100204107 | 3300005365 | Bacteria | 1384 |
| 58 | Ga0070659_100001966 | 3300005366 | Bacteria | 14673 |
| 59 | Ga0070659_100327545 | 3300005366 | Bacteria | 1281 |
| 60 | Ga0070713_100664514 | 3300005436 | Bacteria | 993 |
| 61 | Ga0070701_10204655 | 3300005438 | Bacteria | 1168 |
| 62 | Ga0070663_100508761 | 3300005455 | Bacteria | 1001 |
| 63 | Ga0070662_100115694 | 3300005457 | Bacteria | 2049 |
| 64 | Ga0070662_100356682 | 3300005457 | Bacteria | 1199 |
| 65 | Ga0068867_100043831 | 3300005459 | Bacteria | 3276 |
| 66 | Ga0068867_101096594 | 3300005459 | Bacteria | 727 |
| 67 | Ga0070685_10199875 | 3300005466 | Bacteria | 1298 |
| 68 | Ga0068855_100002390 | 3300005563 | Bacteria | 23146 |
| 69 | Ga0068855_100008403 | 3300005563 | Bacteria | 12484 |
| 70 | Ga0068855_100205705 | 3300005563 | Bacteria | 2214 |
| 71 | Ga0070664_100031977 | 3300005564 | Bacteria | 4401 |
| 72 | Ga0070664_100153990 | 3300005564 | Bacteria | 2030 |
| 73 | Ga0068857_100106766 | 3300005577 | Bacteria | 2514 |
| 74 | Ga0068857_100149585 | 3300005577 | Bacteria | 2115 |
| 75 | Ga0068857_100843308 | 3300005577 | Bacteria | 877 |
| 76 | Ga0068854_100020109 | 3300005578 | Bacteria | 4510 |
| 77 | Ga0070702_100403005 | 3300005615 | Bacteria | 979 |
| 78 | Ga0068852_100014663 | 3300005616 | Bacteria | 6044 |
| 79 | Ga0068859_100074769 | 3300005617 | Bacteria | 3427 |
| 80 | Ga0068851_10100841 | 3300005834 | Bacteria | 1532 |
| 81 | Ga0068851_10160807 | 3300005834 | Bacteria | 1233 |
| 82 | Ga0068871_100133073 | 3300006358 | Bacteria | 2110 |
| 83 | Ga0097620_100074766 | 3300006931 | Bacteria | 3427 |
| 84 | Ga0079104_1005980 | 3300006946 | Bacteria | 4718 |
| 85 | Ga0099826_10000003 | 3300006948 | Bacteria | 1067817 |
| 86 | Ga0105244_10002912 | 3300009036 | Bacteria | 12642 |
| 87 | Ga0105244_10013090 | 3300009036 | Bacteria | 4864 |
| 88 | Ga0105244_10028026 | 3300009036 | Bacteria | 3027 |
| 89 | Ga0105240_10018441 | 3300009093 | Bacteria | 9369 |
| 90 | Ga0105240_10069027 | 3300009093 | Bacteria | 4376 |
| 91 | Ga0105240_10159307 | 3300009093 | Bacteria | 2683 |
| 92 | Ga0105240_10763176 | 3300009093 | Bacteria | 1050 |
| 93 | Ga0105240_11032630 | 3300009093 | Bacteria | 878 |
| 94 | Ga0111539_10016114 | 3300009094 | Bacteria | 9274 |
| 95 | Ga0105243_10020624 | 3300009148 | Bacteria | 4997 |
| 96 | Ga0105241_10227329 | 3300009174 | Bacteria | 1571 |
| 97 | Ga0105242_10116936 | 3300009176 | Bacteria | 2282 |
| 98 | Ga0105237_10006499 | 3300009545 | Bacteria | 12955 |
| 99 | Ga0105237_10304152 | 3300009545 | Bacteria | 1598 |
| 100 | Ga0105238_10000255 | 3300009551 | Bacteria | 59531 |
| 101 | Ga0105238_10053531 | 3300009551 | Bacteria | 4055 |
| 102 | Ga0105239_10001561 | 3300010375 | Bacteria | 30314 |
| 103 | Ga0105239_10231888 | 3300010375 | Bacteria | 2071 |
| 104 | Ga0105239_10330143 | 3300010375 | Bacteria | 1720 |
| 105 | Ga0157373_10092631 | 3300013100 | Bacteria | 2128 |
| 106 | Ga0157373_10129519 | 3300013100 | Bacteria | 1774 |
| 107 | Ga0157370_10007558 | 3300013104 | Bacteria | 11806 |
| 108 | Ga0157372_10416221 | 3300013307 | Bacteria | 1566 |
| 109 | Ga0157372_10817923 | 3300013307 | Bacteria | 1082 |
| 110 | Ga0157375_10280728 | 3300013308 | Bacteria | 1828 |
| 111 | Ga0157375_10615177 | 3300013308 | Bacteria | 1245 |
| 112 | Ga0157380_10047811 | 3300014326 | Bacteria | 3367 |
| 113 | Ga0182008_10013109 | 3300014497 | Bacteria | 4360 |
| 114 | Ga0182008_10180962 | 3300014497 | Bacteria | 1067 |
| 115 | Ga0157377_10256914 | 3300014745 | Bacteria | 1135 |
| 116 | Ga0157376_10480967 | 3300014969 | Bacteria | 1217 |
| 117 | Ga0157376_10661087 | 3300014969 | Bacteria | 1046 |
| 118 | Ga0182006_1019052 | 3300015261 | Bacteria | 2894 |
| 119 | Ga0206356_11570456 | 3300020070 | Bacteria | 803 |
| 120 | Ga0213872_10000002 | 3300021361 | Bacteria | 554092 |
| 121 | Ga0213872_10000307 | 3300021361 | Bacteria | 41810 |
| 122 | Ga0213872_10000427 | 3300021361 | Bacteria | 34434 |
| 123 | Ga0213872_10000920 | 3300021361 | Bacteria | 20894 |
| 124 | Ga0213872_10005167 | 3300021361 | Bacteria | 6757 |
| 125 | Ga0213872_10011283 | 3300021361 | Bacteria | 4231 |
| 126 | Ga0213872_10022797 | 3300021361 | Bacteria | 2880 |
| 127 | Ga0209435_100079 | 3300025206 | Bacteria | 51612 |
| 128 | Ga0209435_100137 | 3300025206 | Bacteria | 24597 |
| 129 | Ga0209436_110345 | 3300025208 | Bacteria | 1713 |
| 130 | Ga0209784_100035 | 3300025224 | Bacteria | 299760 |
| 131 | Ga0209566_100040 | 3300025225 | Bacteria | 299760 |
| 132 | Ga0209674_100057 | 3300025226 | Bacteria | 299760 |
| 133 | Ga0209147_100060 | 3300025229 | Bacteria | 249588 |
| 134 | Ga0209563_100015 | 3300025230 | Bacteria | 879901 |
| 135 | Ga0209563_100059 | 3300025230 | Bacteria | 299760 |
| 136 | Ga0209437_100081 | 3300025233 | Bacteria | 271072 |
| 137 | Ga0209437_111330 | 3300025233 | Bacteria | 1334 |
| 138 | Ga0209258_100141 | 3300025242 | Bacteria | 166385 |
| 139 | Ga0207425_1000551 | 3300025245 | Bacteria | 22377 |
| 140 | Ga0209646_1000028 | 3300025246 | Bacteria | 387986 |
| 141 | Ga0209646_1000265 | 3300025246 | Bacteria | 50897 |
| 142 | Ga0209646_1000290 | 3300025246 | Bacteria | 42743 |
| 143 | Ga0209026_1000330 | 3300025250 | Bacteria | 47453 |
| 144 | Ga0209026_1002521 | 3300025250 | Bacteria | 6784 |
| 145 | Ga0209677_100036 | 3300025253 | Bacteria | 299760 |
| 146 | Ga0209677_101095 | 3300025253 | Bacteria | 12720 |
| 147 | Ga0209148_1000765 | 3300025254 | Bacteria | 24494 |
| 148 | Ga0209759_1000473 | 3300025256 | Bacteria | 44908 |
| 149 | Ga0209759_1000485 | 3300025256 | Bacteria | 43802 |
| 150 | Ga0209565_1000009 | 3300025263 | Bacteria | 751701 |
| 151 | Ga0209455_1000049 | 3300025272 | Bacteria | 374414 |
| 152 | Ga0209673_1000036 | 3300025273 | Bacteria | 323162 |
| 153 | Ga0209130_1000044 | 3300025284 | Bacteria | 241110 |
| 154 | Ga0209675_1000013 | 3300025291 | Bacteria | 448220 |
| 155 | Ga0209675_1011303 | 3300025291 | Bacteria | 2971 |
| 156 | Ga0209025_1012300 | 3300025294 | Bacteria | 5507 |
| 157 | Ga0209564_1000006 | 3300025295 | Bacteria | 1100927 |
| 158 | Ga0209564_1000038 | 3300025295 | Bacteria | 414357 |
| 159 | Ga0209564_1000122 | 3300025295 | Bacteria | 203709 |
| 160 | Ga0209564_1002158 | 3300025295 | Bacteria | 16591 |
| 161 | Ga0209564_1068754 | 3300025295 | Bacteria | 748 |
| 162 | Ga0209758_1000149 | 3300025297 | Bacteria | 163504 |
| 163 | Ga0209256_1000005 | 3300025299 | Bacteria | 1315082 |
| 164 | Ga0209256_1000106 | 3300025299 | Bacteria | 187258 |
| 165 | Ga0207655_1012507 | 3300025728 | Bacteria | 4953 |
| 166 | Ga0207655_1059957 | 3300025728 | Bacteria | 1477 |
| 167 | Ga0207713_1016732 | 3300025735 | Bacteria | 3711 |
| 168 | Ga0207705_10034934 | 3300025909 | Bacteria | 3596 |
| 169 | Ga0207705_10331377 | 3300025909 | Bacteria | 1171 |
| 170 | Ga0207705_10934439 | 3300025909 | Bacteria | 671 |
| 171 | Ga0207654_10282684 | 3300025911 | Bacteria | 1123 |
| 172 | Ga0207707_10607648 | 3300025912 | Bacteria | 925 |
| 173 | Ga0207695_10001345 | 3300025913 | Bacteria | 41663 |
| 174 | Ga0207695_10003241 | 3300025913 | Bacteria | 23170 |
| 175 | Ga0207695_10052058 | 3300025913 | Bacteria | 4292 |
| 176 | Ga0207695_10080349 | 3300025913 | Bacteria | 3302 |
| 177 | Ga0207671_10001558 | 3300025914 | Bacteria | 26243 |
| 178 | Ga0207657_10001495 | 3300025919 | Bacteria | 25015 |
| 179 | Ga0207657_10032958 | 3300025919 | Bacteria | 4674 |
| 180 | Ga0207649_10005902 | 3300025920 | Bacteria | 6639 |
| 181 | Ga0207649_10065752 | 3300025920 | Bacteria | 2296 |
| 182 | Ga0207652_10762404 | 3300025921 | Bacteria | 861 |
| 183 | Ga0207694_10000193 | 3300025924 | Bacteria | 61887 |
| 184 | Ga0207694_10166653 | 3300025924 | Bacteria | 1782 |
| 185 | Ga0207650_10009675 | 3300025925 | Bacteria | 6590 |
| 186 | Ga0207690_10009202 | 3300025932 | Bacteria | 5864 |
| 187 | Ga0207690_10019554 | 3300025932 | Bacteria | 4173 |
| 188 | Ga0207690_10021347 | 3300025932 | Bacteria | 4014 |
| 189 | Ga0207706_10043384 | 3300025933 | Bacteria | 3985 |
| 190 | Ga0207706_10046776 | 3300025933 | Bacteria | 3830 |
| 191 | Ga0207686_10007659 | 3300025934 | Bacteria | 5819 |
| 192 | Ga0207686_10247933 | 3300025934 | Bacteria | 1300 |
| 193 | Ga0207669_10136358 | 3300025937 | Bacteria | 1696 |
| 194 | Ga0207704_10072307 | 3300025938 | Bacteria | 2192 |
| 195 | Ga0207679_10016387 | 3300025945 | Bacteria | 4921 |
| 196 | Ga0207679_10044089 | 3300025945 | Bacteria | 3216 |
| 197 | Ga0207667_10000543 | 3300025949 | Bacteria | 49789 |
| 198 | Ga0207667_10000946 | 3300025949 | Bacteria | 37051 |
| 199 | Ga0207667_10010647 | 3300025949 | Bacteria | 10734 |
| 200 | Ga0207667_10023494 | 3300025949 | Bacteria | 6788 |
| 201 | Ga0207667_10908222 | 3300025949 | Bacteria | 872 |
| 202 | Ga0207640_10031586 | 3300025981 | Bacteria | 3274 |
| 203 | Ga0207678_10422718 | 3300026067 | Bacteria | 1156 |
| 204 | Ga0207708_10081624 | 3300026075 | Bacteria | 2485 |
| 205 | Ga0207648_10121752 | 3300026089 | Bacteria | 2294 |
| 206 | Ga0207648_10364738 | 3300026089 | Bacteria | 1304 |
| 207 | Ga0207674_10062454 | 3300026116 | Bacteria | 3763 |
| 208 | Ga0207674_10200977 | 3300026116 | Bacteria | 1942 |
| 209 | Ga0207698_10099486 | 3300026142 | Bacteria | 2406 |
| 210 | Ga0209281_1005655 | 3300027111 | Bacteria | 3419 |
| 211 | Ga0209282_1000002 | 3300027666 | Bacteria | 1067825 |
| 212 | Ga0207428_10145539 | 3300027907 | Bacteria | 1806 |
| 213 | Ga0207428_10192088 | 3300027907 | Bacteria | 1539 |
| 214 | Ga0316177_1181113 | 3300030731 | Bacteria | 4703 |
| 215 | Ga0316178_1151420 | 3300030735 | Bacteria | 1426 |
| 216 | Ga0316180_1113945 | 3300030736 | Bacteria | 2146 |
| 217 | Ga0316182_1150052 | 3300030745 | Bacteria | 3178 |
| 218 | Ga0307518_10008072 | 3300031838 | Bacteria | 7520 |
| 219 | Ga0307409_100781846 | 3300031995 | Bacteria | 961 |
| 220 | Ga0307416_100010843 | 3300032002 | Bacteria | 6042 |
| 221 | Ga0307416_101069069 | 3300032002 | Bacteria | 911 |
| 222 | Ga0307415_100328697 | 3300032126 | Bacteria | 1278 |
| 223 | Ga0373937_0100910 | 3300036401 | Bacteria | 2678 |
| 224 | Ga0373937_0336745 | 3300036401 | Bacteria | 1429 |
| 225 | Ga0395899_0000206 | 3300037312 | Bacteria | 86263 |
| 226 | Ga0395899_0001430 | 3300037312 | Bacteria | 20417 |
| 227 | Ga0395899_0002882 | 3300037312 | Bacteria | 13815 |
| 228 | Ga0395899_0029111 | 3300037312 | Bacteria | 4153 |
| 229 | Ga0395899_0039029 | 3300037312 | Bacteria | 3555 |
| 230 | Ga0395899_0046977 | 3300037312 | Bacteria | 3214 |
| 231 | Ga0395899_0201294 | 3300037312 | Bacteria | 1388 |
| 232 | Ga0395899_0231229 | 3300037312 | Bacteria | 1276 |
| 233 | Ga0395900_0000298 | 3300037418 | Bacteria | 74295 |
| 234 | Ga0395900_0001764 | 3300037418 | Bacteria | 24841 |
| 235 | Ga0395900_0005739 | 3300037418 | Bacteria | 12975 |
| 236 | Ga0395900_0010058 | 3300037418 | Bacteria | 9676 |
| 237 | Ga0395900_0022527 | 3300037418 | Bacteria | 6445 |
| 238 | Ga0395900_0076138 | 3300037418 | Bacteria | 3449 |
| 239 | Ga0395900_0080048 | 3300037418 | Bacteria | 3357 |
| 240 | Ga0395900_0217065 | 3300037418 | Bacteria | 1929 |
| 241 | Ga0395900_0279577 | 3300037418 | Bacteria | 1661 |
| 242 | Ga0395900_0498390 | 3300037418 | Bacteria | 1168 |
| 243 | Ga0395900_0525120 | 3300037418 | Bacteria | 1131 |
| 244 | Ga0395900_0529413 | 3300037418 | Bacteria | 1125 |
| 245 | Ga0395900_0572269 | 3300037418 | Bacteria | 1072 |
| 246 | Ga0395900_0578093 | 3300037418 | Bacteria | 1065 |
| 247 | Ga0395900_0868983 | 3300037418 | Bacteria | 826 |
| 248 | Ga0395898_0006001 | 3300037466 | Bacteria | 13041 |
| 249 | Ga0395898_0082226 | 3300037466 | Bacteria | 3104 |
| 250 | Ga0395898_0097732 | 3300037466 | Bacteria | 2820 |
| 251 | Ga0395898_0358522 | 3300037466 | Bacteria | 1390 |
| 252 | Ga0395898_0535902 | 3300037466 | Bacteria | 1112 |
| 253 | Ga0395898_0568060 | 3300037466 | Bacteria | 1077 |
| 254 | Ga0395905_0000549 | 3300037471 | Bacteria | 51321 |
| 255 | Ga0395905_0001839 | 3300037471 | Bacteria | 24502 |
| 256 | Ga0395905_0006051 | 3300037471 | Bacteria | 12254 |
| 257 | Ga0395905_0057719 | 3300037471 | Bacteria | 3630 |
| 258 | Ga0395905_0118515 | 3300037471 | Bacteria | 2488 |
| 259 | Ga0395905_0154863 | 3300037471 | Bacteria | 2155 |
| 260 | Ga0395905_0304307 | 3300037471 | Bacteria | 1482 |
| 261 | Ga0395905_0312296 | 3300037471 | Bacteria | 1460 |
| 262 | Ga0395905_0495067 | 3300037471 | Bacteria | 1122 |
| 263 | Ga0395901_0000508 | 3300038443 | Bacteria | 45081 |
| 264 | Ga0395901_0001421 | 3300038443 | Bacteria | 24983 |
| 265 | Ga0395901_0010350 | 3300038443 | Bacteria | 9447 |
| 266 | Ga0395901_0056215 | 3300038443 | Bacteria | 4093 |
| 267 | Ga0395901_0078091 | 3300038443 | Bacteria | 3456 |
| 268 | Ga0395901_0263518 | 3300038443 | Bacteria | 1793 |
| 269 | Ga0395901_0408517 | 3300038443 | Bacteria | 1394 |
| 270 | Ga0395901_0436655 | 3300038443 | Bacteria | 1341 |
| 271 | Ga0395901_0914796 | 3300038443 | Bacteria | 858 |
| 272 | Ga0400483_114212 | 3300039062 | Bacteria | 1521 |
| 273 | Ga0436361_0376382 | 3300039447 | Bacteria | 68820 |
| 274 | Ga0436361_0391791 | 3300039447 | Bacteria | 42494 |
| 275 | Ga0436361_0684212 | 3300039447 | Bacteria | 74853 |
| 276 | Ga0436361_0733741 | 3300039447 | Bacteria | 8972 |
| 277 | Ga0436361_0868581 | 3300039447 | Bacteria | 2610 |
| 278 | Ga0436361_1016700 | 3300039447 | Bacteria | 56598 |
| 279 | Ga0436361_1196357 | 3300039447 | Bacteria | 10171 |
| 280 | Ga0451843_1115385 | 3300041509 | Bacteria | 1120 |
| 281 | Ga0439448_0006029 | 3300042005 | Bacteria | 3472 |
| 282 | Ga0439449_0072104 | 3300042007 | Bacteria | 1272 |
| 283 | Ga0439455_0012451 | 3300042012 | Bacteria | 1910 |
| 284 | Ga0439455_0016438 | 3300042012 | Bacteria | 1711 |
| 285 | Ga0439462_0034206 | 3300042015 | Bacteria | 1349 |
| 286 | Ga0450904_001033 | 3300042139 | Bacteria | 4298 |
| 287 | Ga0439458_0032026 | 3300042157 | Bacteria | 1255 |
| 288 | Ga0451577_0007665 | 3300042876 | Bacteria | 10586 |
| 289 | Ga0466969_0060342 | 3300044656 | Bacteria | 1843 |
| 290 | Ga0466972_0000140 | 3300044658 | Bacteria | 59505 |
| 291 | Ga0466972_0017423 | 3300044658 | Bacteria | 3595 |
| 292 | Ga0466965_0000818 | 3300044683 | Bacteria | 11733 |
| 293 | Ga0466965_0003643 | 3300044683 | Bacteria | 6788 |
| 294 | Ga0466965_0033185 | 3300044683 | Bacteria | 2522 |
| 295 | Ga0466965_0040322 | 3300044683 | Bacteria | 2298 |
| 296 | Ga0466966_0057925 | 3300044684 | Bacteria | 2449 |
| 297 | Ga0466966_0060141 | 3300044684 | Bacteria | 2398 |
| 298 | Ga0466966_0112953 | 3300044684 | Bacteria | 1673 |
| 299 | Ga0466964_0000639 | 3300044706 | Bacteria | 11159 |
| 300 | Ga0466964_0002253 | 3300044706 | Bacteria | 6836 |
| 301 | Ga0466971_0052891 | 3300044719 | Bacteria | 1829 |
| 302 | Ga0466968_0018171 | 3300044735 | Bacteria | 2818 |
| 303 | Ga0466968_0032940 | 3300044735 | Bacteria | 2157 |
| 304 | Ga0466970_0031711 | 3300044765 | Bacteria | 2791 |
| 305 | Ga0466957_0003058 | 3300044842 | Bacteria | 9098 |
| 306 | Ga0466957_0106118 | 3300044842 | Bacteria | 1776 |
| 307 | Ga0466957_0114944 | 3300044842 | Bacteria | 1710 |
| 308 | Ga0466957_0127004 | 3300044842 | Bacteria | 1630 |
| 309 | Ga0466959_0085374 | 3300045049 | Bacteria | 2271 |
| 310 | Ga0466959_0140467 | 3300045049 | Bacteria | 1707 |
| 311 | Ga0466967_0059609 | 3300045976 | Bacteria | 3379 |
| 312 | Ga0495617_000002 | 3300046452 | Bacteria | 710121 |
| 313 | Ga0495617_000574 | 3300046452 | Bacteria | 18841 |
| 314 | Ga0495627_000350 | 3300046453 | Bacteria | 43486 |
| 315 | Ga0495603_0143924 | 3300046455 | Bacteria | 1386 |
| 316 | Ga0495590_0000025 | 3300046457 | Bacteria | 165221 |
| 317 | Ga0495590_0000052 | 3300046457 | Bacteria | 103480 |
| 318 | Ga0495590_0003125 | 3300046457 | Bacteria | 6772 |
| 319 | Ga0495590_0035970 | 3300046457 | Bacteria | 1728 |
| 320 | Ga0495591_000290 | 3300046458 | Bacteria | 46499 |
| 321 | Ga0495629_0018934 | 3300046459 | Bacteria | 4923 |
| 322 | Ga0495629_0022874 | 3300046459 | Bacteria | 4454 |
| 323 | Ga0495638_0000066 | 3300046460 | Bacteria | 168673 |
| 324 | Ga0495638_0007197 | 3300046460 | Bacteria | 8006 |
| 325 | Ga0495638_0034164 | 3300046460 | Bacteria | 3247 |
| 326 | Ga0495638_0055994 | 3300046460 | Bacteria | 2447 |
| 327 | Ga0495653_0000011 | 3300046463 | Bacteria | 272314 |
| 328 | Ga0495653_0005660 | 3300046463 | Bacteria | 10202 |
| 329 | Ga0495653_0008945 | 3300046463 | Bacteria | 8188 |
| 330 | Ga0495653_0034471 | 3300046463 | Bacteria | 4004 |
| 331 | Ga0495650_0000015 | 3300046471 | Bacteria | 557595 |
| 332 | Ga0495650_0000506 | 3300046471 | Bacteria | 58187 |
| 333 | Ga0495650_0000567 | 3300046471 | Bacteria | 51961 |
| 334 | Ga0495650_0000694 | 3300046471 | Bacteria | 43425 |
| 335 | Ga0495650_0000716 | 3300046471 | Bacteria | 42283 |
| 336 | Ga0495650_0000721 | 3300046471 | Bacteria | 41918 |
| 337 | Ga0495650_0012095 | 3300046471 | Bacteria | 4667 |
| 338 | Ga0495650_0012906 | 3300046471 | Bacteria | 4460 |
| 339 | Ga0495650_0115113 | 3300046471 | Bacteria | 994 |
| 340 | Ga0495580_0003141 | 3300046472 | Bacteria | 14151 |
| 341 | Ga0495580_0098195 | 3300046472 | Bacteria | 2037 |
| 342 | Ga0495582_0025473 | 3300046473 | Bacteria | 3240 |
| 343 | Ga0495582_0028174 | 3300046473 | Bacteria | 3082 |
| 344 | Ga0495582_0067515 | 3300046473 | Bacteria | 1976 |
| 345 | Ga0495605_0000003 | 3300046474 | Bacteria | 491502 |
| 346 | Ga0495605_0000034 | 3300046474 | Bacteria | 208277 |
| 347 | Ga0495605_0000474 | 3300046474 | Bacteria | 35493 |
| 348 | Ga0495605_0030905 | 3300046474 | Bacteria | 2740 |
| 349 | Ga0495605_0039401 | 3300046474 | Bacteria | 2367 |
| 350 | Ga0495605_0081458 | 3300046474 | Bacteria | 1513 |
| 351 | Ga0495605_0085899 | 3300046474 | Bacteria | 1464 |
| 352 | Ga0495639_0011637 | 3300046475 | Bacteria | 3795 |
| 353 | Ga0495639_0395440 | 3300046475 | Bacteria | 698 |
| 354 | Ga0495584_0000017 | 3300046491 | Bacteria | 149686 |
| 355 | Ga0495584_0004259 | 3300046491 | Bacteria | 7712 |
| 356 | Ga0495584_0010891 | 3300046491 | Bacteria | 4667 |
| 357 | Ga0495584_0027048 | 3300046491 | Bacteria | 2906 |
| 358 | Ga0495584_0027755 | 3300046491 | Bacteria | 2868 |
| 359 | Ga0495584_0032084 | 3300046491 | Bacteria | 2659 |
| 360 | Ga0495584_0051362 | 3300046491 | Bacteria | 2076 |
| 361 | Ga0495584_0071811 | 3300046491 | Bacteria | 1739 |
| 362 | Ga0495584_0076705 | 3300046491 | Bacteria | 1681 |
| 363 | Ga0495584_0185813 | 3300046491 | Bacteria | 1056 |
| 364 | Ga0495584_0242058 | 3300046491 | Bacteria | 917 |
| 365 | Ga0495585_0000006 | 3300046492 | Bacteria | 320556 |
| 366 | Ga0495585_0000064 | 3300046492 | Bacteria | 109302 |
| 367 | Ga0495585_0002287 | 3300046492 | Bacteria | 13818 |
| 368 | Ga0495585_0002576 | 3300046492 | Bacteria | 12824 |
| 369 | Ga0495585_0003985 | 3300046492 | Bacteria | 9734 |
| 370 | Ga0495585_0004342 | 3300046492 | Bacteria | 9218 |
| 371 | Ga0495585_0004490 | 3300046492 | Bacteria | 9036 |
| 372 | Ga0495585_0005798 | 3300046492 | Bacteria | 7745 |
| 373 | Ga0495585_0014043 | 3300046492 | Bacteria | 4676 |
| 374 | Ga0495585_0047820 | 3300046492 | Bacteria | 2380 |
| 375 | Ga0495585_0048409 | 3300046492 | Bacteria | 2363 |
| 376 | Ga0495585_0062085 | 3300046492 | Bacteria | 2052 |
| 377 | Ga0495585_0079079 | 3300046492 | Bacteria | 1783 |
| 378 | Ga0495585_0278465 | 3300046492 | Bacteria | 827 |
| 379 | Ga0495594_0010545 | 3300046499 | Bacteria | 4792 |
| 380 | Ga0495594_0013970 | 3300046499 | Bacteria | 4203 |
| 381 | Ga0495594_0032405 | 3300046499 | Bacteria | 2836 |
| 382 | Ga0495594_0072625 | 3300046499 | Bacteria | 1914 |
| 383 | Ga0495596_0000550 | 3300046500 | Bacteria | 23486 |
| 384 | Ga0495596_0002227 | 3300046500 | Bacteria | 10557 |
| 385 | Ga0495596_0004778 | 3300046500 | Bacteria | 6519 |
| 386 | Ga0495596_0008875 | 3300046500 | Bacteria | 4449 |
| 387 | Ga0495596_0009006 | 3300046500 | Bacteria | 4412 |
| 388 | Ga0495596_0017447 | 3300046500 | Bacteria | 2970 |
| 389 | Ga0495596_0021491 | 3300046500 | Bacteria | 2633 |
| 390 | Ga0495596_0025031 | 3300046500 | Bacteria | 2414 |
| 391 | Ga0495596_0096228 | 3300046500 | Bacteria | 1149 |
| 392 | Ga0495607_0002172 | 3300046501 | Bacteria | 16311 |
| 393 | Ga0495607_0003491 | 3300046501 | Bacteria | 12031 |
| 394 | Ga0495607_0006380 | 3300046501 | Bacteria | 8303 |
| 395 | Ga0495607_0007438 | 3300046501 | Bacteria | 7578 |
| 396 | Ga0495607_0008285 | 3300046501 | Bacteria | 7110 |
| 397 | Ga0495607_0018387 | 3300046501 | Bacteria | 4456 |
| 398 | Ga0495607_0023637 | 3300046501 | Bacteria | 3844 |
| 399 | Ga0495607_0032412 | 3300046501 | Bacteria | 3189 |
| 400 | Ga0495607_0043236 | 3300046501 | Bacteria | 2666 |
| 401 | Ga0495607_0052835 | 3300046501 | Bacteria | 2351 |
| 402 | Ga0495583_0000056 | 3300046506 | Bacteria | 200858 |
| 403 | Ga0495583_0000320 | 3300046506 | Bacteria | 76050 |
| 404 | Ga0495583_0000344 | 3300046506 | Bacteria | 73346 |
| 405 | Ga0495583_0000808 | 3300046506 | Bacteria | 38650 |
| 406 | Ga0495583_0000864 | 3300046506 | Bacteria | 36820 |
| 407 | Ga0495583_0002451 | 3300046506 | Bacteria | 15840 |
| 408 | Ga0495583_0004193 | 3300046506 | Bacteria | 10496 |
| 409 | Ga0495583_0004206 | 3300046506 | Bacteria | 10477 |
| 410 | Ga0495583_0025151 | 3300046506 | Bacteria | 2979 |
| 411 | Ga0495583_0026117 | 3300046506 | Bacteria | 2902 |
| 412 | Ga0495583_0028021 | 3300046506 | Bacteria | 2774 |
| 413 | Ga0495583_0061266 | 3300046506 | Bacteria | 1679 |
| 414 | Ga0495583_0087270 | 3300046506 | Bacteria | 1348 |
| 415 | Ga0495583_0127193 | 3300046506 | Bacteria | 1068 |
| 416 | Ga0495583_0138663 | 3300046506 | Bacteria | 1014 |
| 417 | Ga0495606_0000024 | 3300046507 | Bacteria | 262080 |
| 418 | Ga0495606_0000043 | 3300046507 | Bacteria | 214367 |
| 419 | Ga0495606_0000920 | 3300046507 | Bacteria | 43445 |
| 420 | Ga0495606_0001616 | 3300046507 | Bacteria | 29393 |
| 421 | Ga0495606_0003205 | 3300046507 | Bacteria | 17641 |
| 422 | Ga0495606_0003670 | 3300046507 | Bacteria | 16079 |
| 423 | Ga0495606_0003817 | 3300046507 | Bacteria | 15629 |
| 424 | Ga0495606_0008549 | 3300046507 | Bacteria | 8864 |
| 425 | Ga0495606_0014675 | 3300046507 | Bacteria | 6093 |
| 426 | Ga0495606_0035706 | 3300046507 | Bacteria | 3395 |
| 427 | Ga0495606_0041147 | 3300046507 | Bacteria | 3101 |
| 428 | Ga0495606_0139429 | 3300046507 | Bacteria | 1433 |
| 429 | Ga0495606_0251134 | 3300046507 | Bacteria | 981 |
| 430 | Ga0495610_0000004 | 3300046512 | Bacteria | 1006135 |
| 431 | Ga0495610_0000613 | 3300046512 | Bacteria | 35266 |
| 432 | Ga0495610_0005202 | 3300046512 | Bacteria | 9318 |
| 433 | Ga0495616_0000057 | 3300046513 | Bacteria | 100806 |
| 434 | Ga0495616_0000727 | 3300046513 | Bacteria | 24274 |
| 435 | Ga0495616_0000765 | 3300046513 | Bacteria | 23498 |
| 436 | Ga0495616_0001904 | 3300046513 | Bacteria | 14071 |
| 437 | Ga0495616_0003367 | 3300046513 | Bacteria | 10258 |
| 438 | Ga0495616_0009006 | 3300046513 | Bacteria | 5862 |
| 439 | Ga0495616_0010979 | 3300046513 | Bacteria | 5213 |
| 440 | Ga0495616_0013917 | 3300046513 | Bacteria | 4520 |
| 441 | Ga0495616_0017895 | 3300046513 | Bacteria | 3904 |
| 442 | Ga0495616_0018263 | 3300046513 | Bacteria | 3851 |
| 443 | Ga0495616_0036374 | 3300046513 | Bacteria | 2540 |
| 444 | Ga0495616_0037678 | 3300046513 | Bacteria | 2486 |
| 445 | Ga0495616_0172725 | 3300046513 | Bacteria | 965 |
| 446 | Ga0495630_0495929 | 3300046517 | Bacteria | 936 |
| 447 | Ga0495631_0000703 | 3300046518 | Bacteria | 21624 |
| 448 | Ga0495631_0001517 | 3300046518 | Bacteria | 14006 |
| 449 | Ga0495631_0003602 | 3300046518 | Bacteria | 8449 |
| 450 | Ga0495631_0003814 | 3300046518 | Bacteria | 8184 |
| 451 | Ga0495631_0015024 | 3300046518 | Bacteria | 3721 |
| 452 | Ga0495631_0015692 | 3300046518 | Bacteria | 3624 |
| 453 | Ga0495631_0032249 | 3300046518 | Bacteria | 2363 |
| 454 | Ga0495631_0051375 | 3300046518 | Bacteria | 1801 |
| 455 | Ga0495631_0073157 | 3300046518 | Bacteria | 1480 |
| 456 | Ga0495631_0130349 | 3300046518 | Bacteria | 1080 |
| 457 | Ga0495632_0000077 | 3300046519 | Bacteria | 100834 |
| 458 | Ga0495632_0001081 | 3300046519 | Bacteria | 23373 |
| 459 | Ga0495632_0004490 | 3300046519 | Bacteria | 9462 |
| 460 | Ga0495632_0222471 | 3300046519 | Bacteria | 853 |
| 461 | Ga0495637_0000126 | 3300046520 | Bacteria | 57018 |
| 462 | Ga0495637_0000327 | 3300046520 | Bacteria | 36965 |
| 463 | Ga0495637_0006099 | 3300046520 | Bacteria | 6069 |
| 464 | Ga0495637_0013723 | 3300046520 | Bacteria | 3841 |
| 465 | Ga0495637_0027938 | 3300046520 | Bacteria | 2521 |
| 466 | Ga0495637_0031293 | 3300046520 | Bacteria | 2355 |
| 467 | Ga0495643_0000415 | 3300046522 | Bacteria | 55824 |
| 468 | Ga0495643_0000747 | 3300046522 | Bacteria | 36826 |
| 469 | Ga0495643_0001870 | 3300046522 | Bacteria | 17847 |
| 470 | Ga0495643_0002987 | 3300046522 | Bacteria | 12778 |
| 471 | Ga0495643_0041150 | 3300046522 | Bacteria | 2520 |
| 472 | Ga0495643_0224312 | 3300046522 | Bacteria | 889 |
| 473 | Ga0495644_0003414 | 3300046523 | Bacteria | 6285 |
| 474 | Ga0495644_0006881 | 3300046523 | Bacteria | 4401 |
| 475 | Ga0495644_0010124 | 3300046523 | Bacteria | 3633 |
| 476 | Ga0495644_0017512 | 3300046523 | Bacteria | 2738 |
| 477 | Ga0495644_0019139 | 3300046523 | Bacteria | 2614 |
| 478 | Ga0495644_0052584 | 3300046523 | Bacteria | 1529 |
| 479 | Ga0495648_0000007 | 3300046524 | Bacteria | 347305 |
| 480 | Ga0495648_0000045 | 3300046524 | Bacteria | 172587 |
| 481 | Ga0495648_0000534 | 3300046524 | Bacteria | 40983 |
| 482 | Ga0495648_0000708 | 3300046524 | Bacteria | 35539 |
| 483 | Ga0495648_0002581 | 3300046524 | Bacteria | 16591 |
| 484 | Ga0495648_0008428 | 3300046524 | Bacteria | 8112 |
| 485 | Ga0495648_0024977 | 3300046524 | Bacteria | 4055 |
| 486 | Ga0495648_0054248 | 3300046524 | Bacteria | 2422 |
| 487 | Ga0495663_0011742 | 3300046525 | Bacteria | 2439 |
| 488 | Ga0495666_0000738 | 3300046526 | Bacteria | 15006 |
| 489 | Ga0495666_0003203 | 3300046526 | Bacteria | 8238 |
| 490 | Ga0495666_0043989 | 3300046526 | Bacteria | 2156 |
| 491 | Ga0495642_0000422 | 3300046528 | Bacteria | 22466 |
| 492 | Ga0495642_0000749 | 3300046528 | Bacteria | 16028 |
| 493 | Ga0495642_0006403 | 3300046528 | Bacteria | 4515 |
| 494 | Ga0495642_0017514 | 3300046528 | Bacteria | 2799 |
| 495 | Ga0495642_0020988 | 3300046528 | Bacteria | 2567 |
| 496 | Ga0495642_0033497 | 3300046528 | Bacteria | 2065 |
| 497 | Ga0495642_0044315 | 3300046528 | Bacteria | 1815 |
| 498 | Ga0495652_0020998 | 3300046529 | Bacteria | 5804 |
| 499 | Ga0495654_0000004 | 3300046530 | Bacteria | 515304 |
| 500 | Ga0495654_0005449 | 3300046530 | Bacteria | 7387 |
| 501 | Ga0495654_0058694 | 3300046530 | Bacteria | 1855 |
| 502 | Ga0495654_0103500 | 3300046530 | Bacteria | 1307 |
| 503 | Ga0495665_0006321 | 3300046531 | Bacteria | 6391 |
| 504 | Ga0495665_0028275 | 3300046531 | Bacteria | 3006 |
| 505 | Ga0495665_0174738 | 3300046531 | Bacteria | 1117 |
| 506 | Ga0495586_0010284 | 3300046535 | Bacteria | 4976 |
| 507 | Ga0495586_0038439 | 3300046535 | Bacteria | 2570 |
| 508 | Ga0495586_0075084 | 3300046535 | Bacteria | 1850 |
| 509 | Ga0495586_0108725 | 3300046535 | Bacteria | 1542 |
| 510 | Ga0495586_0170259 | 3300046535 | Bacteria | 1231 |
| 511 | Ga0495587_0020480 | 3300046536 | Bacteria | 4082 |
| 512 | Ga0495587_0065793 | 3300046536 | Bacteria | 2115 |
| 513 | Ga0495609_0000002 | 3300046538 | Bacteria | 739816 |
| 514 | Ga0495609_0000433 | 3300046538 | Bacteria | 34767 |
| 515 | Ga0495609_0010208 | 3300046538 | Bacteria | 4512 |
| 516 | Ga0495609_0013379 | 3300046538 | Bacteria | 3876 |
| 517 | Ga0495609_0015171 | 3300046538 | Bacteria | 3610 |
| 518 | Ga0495609_0020581 | 3300046538 | Bacteria | 3047 |
| 519 | Ga0495609_0022531 | 3300046538 | Bacteria | 2900 |
| 520 | Ga0495609_0029689 | 3300046538 | Bacteria | 2488 |
| 521 | Ga0495609_0072718 | 3300046538 | Bacteria | 1509 |
| 522 | Ga0495609_0126132 | 3300046538 | Bacteria | 1098 |
| 523 | Ga0495597_0000523 | 3300046542 | Bacteria | 31819 |
| 524 | Ga0495597_0001053 | 3300046542 | Bacteria | 21085 |
| 525 | Ga0495597_0001374 | 3300046542 | Bacteria | 17598 |
| 526 | Ga0495597_0002627 | 3300046542 | Bacteria | 11180 |
| 527 | Ga0495597_0010108 | 3300046542 | Bacteria | 4626 |
| 528 | Ga0495597_0016981 | 3300046542 | Bacteria | 3430 |
| 529 | Ga0495597_0066102 | 3300046542 | Bacteria | 1567 |
| 530 | Ga0495622_0002130 | 3300046557 | Bacteria | 9647 |
| 531 | Ga0495622_0026612 | 3300046557 | Bacteria | 2699 |
| 532 | Ga0495622_0036812 | 3300046557 | Bacteria | 2280 |
| 533 | Ga0495622_0040208 | 3300046557 | Bacteria | 2176 |
| 534 | Ga0495622_0147821 | 3300046557 | Bacteria | 1064 |
| 535 | Ga0495633_0000504 | 3300046558 | Bacteria | 39318 |
| 536 | Ga0495633_0001016 | 3300046558 | Bacteria | 22969 |
| 537 | Ga0495633_0004300 | 3300046558 | Bacteria | 9097 |
| 538 | Ga0495633_0005658 | 3300046558 | Bacteria | 7567 |
| 539 | Ga0495633_0007382 | 3300046558 | Bacteria | 6330 |
| 540 | Ga0495633_0012242 | 3300046558 | Bacteria | 4574 |
| 541 | Ga0495633_0013436 | 3300046558 | Bacteria | 4315 |
| 542 | Ga0495633_0015734 | 3300046558 | Bacteria | 3920 |
| 543 | Ga0495633_0019270 | 3300046558 | Bacteria | 3451 |
| 544 | Ga0495656_0017227 | 3300046615 | Bacteria | 2754 |
| 545 | Ga0495656_0023163 | 3300046615 | Bacteria | 2441 |
| 546 | Ga0495656_0025883 | 3300046615 | Bacteria | 2330 |
| 547 | Ga0495656_0229934 | 3300046615 | Bacteria | 930 |
| 548 | Ga0495668_0000025 | 3300046616 | Bacteria | 304546 |
| 549 | Ga0495668_0000126 | 3300046616 | Bacteria | 114185 |
| 550 | Ga0495668_0000810 | 3300046616 | Bacteria | 35815 |
| 551 | Ga0495668_0001707 | 3300046616 | Bacteria | 20270 |
| 552 | Ga0495668_0002549 | 3300046616 | Bacteria | 14816 |
| 553 | Ga0495668_0004065 | 3300046616 | Bacteria | 10620 |
| 554 | Ga0495668_0005188 | 3300046616 | Bacteria | 8946 |
| 555 | Ga0495668_0007538 | 3300046616 | Bacteria | 6943 |
| 556 | Ga0495668_0009246 | 3300046616 | Bacteria | 6062 |
| 557 | Ga0495668_0018131 | 3300046616 | Bacteria | 4071 |
| 558 | Ga0495668_0020835 | 3300046616 | Bacteria | 3765 |
| 559 | Ga0495668_0025258 | 3300046616 | Bacteria | 3376 |
| 560 | Ga0495668_0072635 | 3300046616 | Bacteria | 1890 |
| 561 | Ga0495668_0086465 | 3300046616 | Bacteria | 1719 |
| 562 | Ga0495668_0105530 | 3300046616 | Bacteria | 1541 |
| 563 | Ga0495634_0168123 | 3300046642 | Bacteria | 1379 |
| 564 | Ga0495611_0000551 | 3300046648 | Bacteria | 21888 |
| 565 | Ga0495611_0008248 | 3300046648 | Bacteria | 4419 |
| 566 | Ga0495611_0014670 | 3300046648 | Bacteria | 3349 |
| 567 | Ga0495611_0015059 | 3300046648 | Bacteria | 3305 |
| 568 | Ga0495611_0015669 | 3300046648 | Bacteria | 3240 |
| 569 | Ga0495611_0056131 | 3300046648 | Bacteria | 1782 |
| 570 | Ga0495611_0056343 | 3300046648 | Bacteria | 1779 |
| 571 | Ga0495611_0084660 | 3300046648 | Bacteria | 1462 |
| 572 | Ga0495625_0002773 | 3300046660 | Bacteria | 18494 |
| 573 | Ga0495625_0002810 | 3300046660 | Bacteria | 18329 |
| 574 | Ga0495625_0009260 | 3300046660 | Bacteria | 8262 |
| 575 | Ga0495625_0012218 | 3300046660 | Bacteria | 6964 |
| 576 | Ga0495625_0019633 | 3300046660 | Bacteria | 5234 |
| 577 | Ga0495625_0037296 | 3300046660 | Bacteria | 3567 |
| 578 | Ga0495625_0047348 | 3300046660 | Bacteria | 3100 |
| 579 | Ga0495625_0054637 | 3300046660 | Bacteria | 2851 |
| 580 | Ga0495625_0055425 | 3300046660 | Bacteria | 2827 |
| 581 | Ga0495625_0093667 | 3300046660 | Bacteria | 2073 |
| 582 | Ga0495659_0000445 | 3300046664 | Bacteria | 15457 |
| 583 | Ga0495659_0090261 | 3300046664 | Bacteria | 1175 |
| 584 | Ga0495659_0115358 | 3300046664 | Bacteria | 1053 |
| 585 | Ga0495661_0000859 | 3300046665 | Bacteria | 28295 |
| 586 | Ga0495661_0001479 | 3300046665 | Bacteria | 19638 |
| 587 | Ga0495661_0002355 | 3300046665 | Bacteria | 14587 |
| 588 | Ga0495661_0004983 | 3300046665 | Bacteria | 9482 |
| 589 | Ga0495661_0008804 | 3300046665 | Bacteria | 6961 |
| 590 | Ga0495661_0009671 | 3300046665 | Bacteria | 6604 |
| 591 | Ga0495661_0016891 | 3300046665 | Bacteria | 4823 |
| 592 | Ga0495661_0022952 | 3300046665 | Bacteria | 4055 |
| 593 | Ga0495661_0042189 | 3300046665 | Bacteria | 2814 |
| 594 | Ga0495661_0048547 | 3300046665 | Bacteria | 2578 |
| 595 | Ga0495661_0049026 | 3300046665 | Bacteria | 2563 |
| 596 | Ga0495661_0052103 | 3300046665 | Bacteria | 2467 |
| 597 | Ga0495661_0054316 | 3300046665 | Bacteria | 2405 |
| 598 | Ga0495661_0059265 | 3300046665 | Bacteria | 2279 |
| 599 | Ga0495661_0087706 | 3300046665 | Bacteria | 1778 |
| 600 | Ga0495661_0097057 | 3300046665 | Bacteria | 1665 |
| 601 | Ga0495661_0121558 | 3300046665 | Bacteria | 1442 |
| 602 | Ga0495661_0187558 | 3300046665 | Bacteria | 1091 |
| 603 | Ga0495661_0243383 | 3300046665 | Bacteria | 921 |
| 604 | Ga0495661_0335104 | 3300046665 | Bacteria | 748 |
| 605 | Ga0495588_0000067 | 3300046674 | Bacteria | 238958 |
| 606 | Ga0495588_0020049 | 3300046674 | Bacteria | 3280 |
| 607 | Ga0495588_0087213 | 3300046674 | Bacteria | 1632 |
| 608 | Ga0495657_0338102 | 3300046675 | Bacteria | 893 |
| 609 | Ga0495599_0297355 | 3300046678 | Bacteria | 975 |
| 610 | Ga0495623_0021263 | 3300046679 | Bacteria | 4190 |
| 611 | Ga0495623_0097997 | 3300046679 | Bacteria | 1790 |
| 612 | Ga0495623_0160321 | 3300046679 | Bacteria | 1323 |
| 613 | Ga0495646_0085121 | 3300046680 | Bacteria | 1835 |
| 614 | Ga0495646_0159490 | 3300046680 | Bacteria | 1250 |
| 615 | Ga0495646_0224371 | 3300046680 | Bacteria | 1015 |
| 616 | Ga0495669_0000401 | 3300046684 | Bacteria | 21231 |
| 617 | Ga0495669_0000712 | 3300046684 | Bacteria | 14461 |
| 618 | Ga0495669_0003709 | 3300046684 | Bacteria | 6282 |
| 619 | Ga0495669_0020327 | 3300046684 | Bacteria | 2872 |
| 620 | Ga0495669_0026832 | 3300046684 | Bacteria | 2517 |
| 621 | Ga0495613_0150896 | 3300046689 | Bacteria | 1657 |
| 622 | Ga0495624_0005808 | 3300046690 | Bacteria | 8836 |
| 623 | Ga0495624_0145508 | 3300046690 | Bacteria | 1450 |
| 624 | Ga0495670_0001953 | 3300046691 | Bacteria | 10152 |
| 625 | Ga0495670_0006207 | 3300046691 | Bacteria | 5868 |
| 626 | Ga0495670_0011529 | 3300046691 | Bacteria | 4348 |
| 627 | Ga0495670_0012966 | 3300046691 | Bacteria | 4097 |
| 628 | Ga0495670_0208416 | 3300046691 | Bacteria | 1036 |
| 629 | Ga0495670_0287688 | 3300046691 | Bacteria | 879 |
| 630 | Ga0495671_0000001 | 3300046692 | Bacteria | 1169494 |
| 631 | Ga0495671_0007128 | 3300046692 | Bacteria | 6404 |
| 632 | Ga0495671_0014118 | 3300046692 | Bacteria | 4306 |
| 633 | Ga0495671_0017617 | 3300046692 | Bacteria | 3800 |
| 634 | Ga0495671_0029571 | 3300046692 | Bacteria | 2812 |
| 635 | Ga0495671_0069513 | 3300046692 | Bacteria | 1731 |
| 636 | Ga0495671_0080435 | 3300046692 | Bacteria | 1596 |
| 637 | Ga0495671_0084987 | 3300046692 | Bacteria | 1550 |
| 638 | Ga0495649_0001061 | 3300046694 | Bacteria | 21490 |
| 639 | Ga0495649_0004351 | 3300046694 | Bacteria | 9283 |
| 640 | Ga0495649_0013688 | 3300046694 | Bacteria | 4675 |
| 641 | Ga0495649_0021684 | 3300046694 | Bacteria | 3598 |
| 642 | Ga0495649_0103004 | 3300046694 | Bacteria | 1516 |
| 643 | Ga0495589_0000324 | 3300046794 | Bacteria | 37487 |
| 644 | Ga0495589_0000701 | 3300046794 | Bacteria | 21813 |
| 645 | Ga0495589_0008247 | 3300046794 | Bacteria | 5442 |
| 646 | Ga0495589_0013146 | 3300046794 | Bacteria | 4272 |
| 647 | Ga0495589_0273682 | 3300046794 | Bacteria | 786 |
| 648 | Ga0495589_0275315 | 3300046794 | Bacteria | 783 |
| 649 | Ga0495660_0000026 | 3300046810 | Bacteria | 256223 |
| 650 | Ga0495660_0007088 | 3300046810 | Bacteria | 6603 |
| 651 | Ga0495660_0010717 | 3300046810 | Bacteria | 5327 |
| 652 | Ga0495660_0020096 | 3300046810 | Bacteria | 3830 |
| 653 | Ga0495660_0021269 | 3300046810 | Bacteria | 3715 |
| 654 | Ga0495660_0031785 | 3300046810 | Bacteria | 2966 |
| 655 | Ga0495660_0058419 | 3300046810 | Bacteria | 2078 |
| 656 | Ga0495581_0005532 | 3300047315 | Bacteria | 7318 |
| 657 | Ga0495581_0133366 | 3300047315 | Bacteria | 1447 |
| 658 | Ga0495604_0004090 | 3300047317 | Bacteria | 11589 |
| 659 | Ga0495636_0004150 | 3300047318 | Bacteria | 5679 |
| 660 | Ga0495636_0029856 | 3300047318 | Bacteria | 2226 |
| 661 | Ga0495674_0004640 | 3300047319 | Bacteria | 13210 |
| 662 | Ga0495672_0000041 | 3300047320 | Bacteria | 267545 |
| 663 | Ga0495672_0000050 | 3300047320 | Bacteria | 240336 |
| 664 | Ga0495672_0000454 | 3300047320 | Bacteria | 48596 |
| 665 | Ga0495672_0000505 | 3300047320 | Bacteria | 45047 |
| 666 | Ga0495672_0001726 | 3300047320 | Bacteria | 21137 |
| 667 | Ga0495672_0001789 | 3300047320 | Bacteria | 20634 |
| 668 | Ga0495672_0036121 | 3300047320 | Bacteria | 3036 |
| 669 | Ga0495672_0041549 | 3300047320 | Bacteria | 2780 |
| 670 | Ga0495672_0052171 | 3300047320 | Bacteria | 2403 |
| 671 | Ga0495672_0123916 | 3300047320 | Bacteria | 1369 |
| 672 | Ga0495676_0000235 | 3300047321 | Bacteria | 44374 |
| 673 | Ga0495676_0013662 | 3300047321 | Bacteria | 7287 |
| 674 | Ga0495676_0041757 | 3300047321 | Bacteria | 3772 |
| 675 | Ga0495680_0009334 | 3300047322 | Bacteria | 8833 |
| 676 | Ga0495683_0000203 | 3300047323 | Bacteria | 56418 |
| 677 | Ga0495683_0000434 | 3300047323 | Bacteria | 33166 |
| 678 | Ga0495683_0007966 | 3300047323 | Bacteria | 5687 |
| 679 | Ga0495683_0086209 | 3300047323 | Bacteria | 1526 |
| 680 | Ga0495683_0123035 | 3300047323 | Bacteria | 1229 |
| 681 | Ga0495687_000013 | 3300047443 | Bacteria | 371058 |
| 682 | Ga0495687_000127 | 3300047443 | Bacteria | 117520 |
| 683 | Ga0495687_000143 | 3300047443 | Bacteria | 108306 |
| 684 | Ga0495687_000871 | 3300047443 | Bacteria | 32002 |
| 685 | Ga0495687_005119 | 3300047443 | Bacteria | 8489 |
| 686 | Ga0495687_008376 | 3300047443 | Bacteria | 5924 |
| 687 | Ga0495687_008545 | 3300047443 | Bacteria | 5851 |
| 688 | Ga0495687_009637 | 3300047443 | Bacteria | 5377 |
| 689 | Ga0495675_0001313 | 3300047444 | Bacteria | 15070 |
| 690 | Ga0495677_0000098 | 3300047445 | Bacteria | 44329 |
| 691 | Ga0495677_0001073 | 3300047445 | Bacteria | 10973 |
| 692 | Ga0495677_0001928 | 3300047445 | Bacteria | 8292 |
| 693 | Ga0495677_0003237 | 3300047445 | Bacteria | 6351 |
| 694 | Ga0495677_0009863 | 3300047445 | Bacteria | 3517 |
| 695 | Ga0495677_0012011 | 3300047445 | Bacteria | 3161 |
| 696 | Ga0495677_0014037 | 3300047445 | Bacteria | 2916 |
| 697 | Ga0495677_0014123 | 3300047445 | Bacteria | 2908 |
| 698 | Ga0495677_0023046 | 3300047445 | Bacteria | 2260 |
| 699 | Ga0495677_0028793 | 3300047445 | Bacteria | 2019 |
| 700 | Ga0495677_0030832 | 3300047445 | Bacteria | 1951 |
| 701 | Ga0495677_0083203 | 3300047445 | Bacteria | 1201 |
| 702 | Ga0495679_002036 | 3300047446 | Bacteria | 10688 |
| 703 | Ga0495679_021491 | 3300047446 | Bacteria | 2226 |
| 704 | Ga0495679_025773 | 3300047446 | Bacteria | 1961 |
| 705 | Ga0495679_042088 | 3300047446 | Bacteria | 1410 |
| 706 | Ga0495685_000942 | 3300047447 | Bacteria | 8806 |
| 707 | Ga0495685_003481 | 3300047447 | Bacteria | 5028 |
| 708 | Ga0495685_016432 | 3300047447 | Bacteria | 2527 |
| 709 | Ga0495673_0000006 | 3300047469 | Bacteria | 908691 |
| 710 | Ga0495673_0000014 | 3300047469 | Bacteria | 599202 |
| 711 | Ga0495673_0000430 | 3300047469 | Bacteria | 47639 |
| 712 | Ga0495673_0058575 | 3300047469 | Bacteria | 1659 |
| 713 | Ga0495681_0000647 | 3300047470 | Bacteria | 26531 |
| 714 | Ga0495681_0005070 | 3300047470 | Bacteria | 8881 |
| 715 | Ga0495681_0006678 | 3300047470 | Bacteria | 7534 |
| 716 | Ga0495681_0008759 | 3300047470 | Bacteria | 6307 |
| 717 | Ga0495681_0021487 | 3300047470 | Bacteria | 3475 |
| 718 | Ga0495681_0031803 | 3300047470 | Bacteria | 2664 |
| 719 | Ga0495681_0041010 | 3300047470 | Bacteria | 2250 |
| 720 | Ga0495681_0041705 | 3300047470 | Bacteria | 2227 |
| 721 | Ga0495686_0000288 | 3300047472 | Bacteria | 88523 |
| 722 | Ga0495686_0001006 | 3300047472 | Bacteria | 34250 |
| 723 | Ga0495686_0001335 | 3300047472 | Bacteria | 27633 |
| 724 | Ga0495686_0001432 | 3300047472 | Bacteria | 26052 |
| 725 | Ga0495686_0023406 | 3300047472 | Bacteria | 4074 |
| 726 | Ga0495686_0045610 | 3300047472 | Bacteria | 2772 |
| 727 | Ga0495686_0125285 | 3300047472 | Bacteria | 1528 |
| 728 | Ga0495593_0005559 | 3300047673 | Bacteria | 7446 |
| 729 | Ga0495593_0015881 | 3300047673 | Bacteria | 4254 |
| 730 | Ga0495602_0030814 | 3300048088 | Bacteria | 5082 |
| 731 | Ga0495602_0032483 | 3300048088 | Bacteria | 4913 |
| 732 | Ga0495614_0010817 | 3300048089 | Bacteria | 4017 |
| 733 | Ga0495614_0021970 | 3300048089 | Bacteria | 2755 |
| 734 | Ga0495614_0025445 | 3300048089 | Bacteria | 2552 |
| 735 | Ga0495615_0004089 | 3300048090 | Bacteria | 2512 |
| 736 | Ga0495626_0000003 | 3300048091 | Bacteria | 427774 |
| 737 | Ga0495626_0000096 | 3300048091 | Bacteria | 114087 |
| 738 | Ga0495626_0001123 | 3300048091 | Bacteria | 22492 |
| 739 | Ga0495626_0002799 | 3300048091 | Bacteria | 11701 |
| 740 | Ga0495626_0003171 | 3300048091 | Bacteria | 10711 |
| 741 | Ga0495626_0010902 | 3300048091 | Bacteria | 4826 |
| 742 | Ga0495626_0010929 | 3300048091 | Bacteria | 4822 |
| 743 | Ga0495626_0010932 | 3300048091 | Bacteria | 4821 |
| 744 | Ga0495626_0013054 | 3300048091 | Bacteria | 4331 |
| 745 | Ga0495626_0018878 | 3300048091 | Bacteria | 3453 |
| 746 | Ga0495626_0020338 | 3300048091 | Bacteria | 3309 |
| 747 | Ga0495626_0028973 | 3300048091 | Bacteria | 2681 |
| 748 | Ga0495626_0049881 | 3300048091 | Bacteria | 1936 |
| 749 | Ga0495626_0102479 | 3300048091 | Bacteria | 1246 |
| 750 | Ga0496100_0027033 | 3300048903 | Bacteria | 3524 |
| 751 | Ga0496100_0275358 | 3300048903 | Bacteria | 1253 |
| 752 | Ga0496101_0073207 | 3300048904 | Bacteria | 2516 |
| 753 | Ga0496102_0000194 | 3300048905 | Bacteria | 83095 |
| 754 | Ga0496102_0072072 | 3300048905 | Bacteria | 3173 |
| 755 | Ga0496102_0717870 | 3300048905 | Bacteria | 922 |
| 756 | Ga0496103_0009176 | 3300048906 | Bacteria | 5857 |
| 757 | Ga0496103_0021055 | 3300048906 | Bacteria | 3922 |
| 758 | Ga0496103_0034059 | 3300048906 | Bacteria | 3114 |
| 759 | Ga0496106_0005315 | 3300048909 | Bacteria | 9537 |
| 760 | Ga0496107_0076728 | 3300048910 | Bacteria | 2434 |
| 761 | Ga0496108_0040462 | 3300048911 | Bacteria | 3886 |
| 762 | Ga0496109_0021209 | 3300048912 | Bacteria | 5743 |
| 763 | Ga0496110_0006349 | 3300048913 | Bacteria | 9344 |
| 764 | Ga0496110_0050784 | 3300048913 | Bacteria | 3643 |
| 765 | Ga0496112_0653524 | 3300048915 | Bacteria | 981 |
| 766 | Ga0496113_0626763 | 3300048916 | Bacteria | 861 |
| 767 | Ga0496114_0001342 | 3300048917 | Bacteria | 18646 |
| 768 | Ga0496114_0029253 | 3300048917 | Bacteria | 4526 |
| 769 | Ga0496114_0115921 | 3300048917 | Bacteria | 2299 |
| 770 | Ga0496114_0118714 | 3300048917 | Bacteria | 2272 |
| 771 | Ga0496115_0062650 | 3300048918 | Bacteria | 3000 |
| 772 | Ga0496115_0227964 | 3300048918 | Bacteria | 1537 |
| 773 | Ga0496116_0149178 | 3300048919 | Bacteria | 1302 |
| 774 | Ga0496118_0144473 | 3300048921 | Bacteria | 1501 |
| 775 | Ga0496120_0130363 | 3300048923 | Bacteria | 1288 |
| 776 | Ga0496121_0003188 | 3300048924 | Bacteria | 23647 |
| 777 | Ga0496121_0060430 | 3300048924 | Bacteria | 3117 |
| 778 | Ga0496121_0088120 | 3300048924 | Bacteria | 2434 |
| 779 | Ga0496122_0000445 | 3300048925 | Bacteria | 86566 |
| 780 | Ga0496122_0000968 | 3300048925 | Bacteria | 51537 |
| 781 | Ga0496122_0024024 | 3300048925 | Bacteria | 5347 |
| 782 | Ga0496122_0092819 | 3300048925 | Bacteria | 2050 |
| 783 | Ga0496123_0004226 | 3300048926 | Bacteria | 15322 |
| 784 | Ga0496123_0004825 | 3300048926 | Bacteria | 13907 |
| 785 | Ga0496123_0061417 | 3300048926 | Bacteria | 2414 |
| 786 | Ga0496123_0087936 | 3300048926 | Bacteria | 1857 |
| 787 | Ga0496124_0009111 | 3300048927 | Bacteria | 10260 |
| 788 | Ga0496124_0041731 | 3300048927 | Bacteria | 3956 |
| 789 | Ga0496124_0085319 | 3300048927 | Bacteria | 2588 |
| 790 | Ga0496124_0118207 | 3300048927 | Bacteria | 2122 |
| 791 | Ga0496124_0278419 | 3300048927 | Bacteria | 1221 |
| 792 | Ga0496125_0004258 | 3300048928 | Bacteria | 16661 |
| 793 | Ga0496125_0017185 | 3300048928 | Bacteria | 6913 |
| 794 | Ga0496126_0015414 | 3300048929 | Bacteria | 7690 |
| 795 | Ga0495678_000408 | 3300049459 | Bacteria | 43359 |
| 796 | Ga0495678_000910 | 3300049459 | Bacteria | 25989 |
| 797 | Ga0495678_001706 | 3300049459 | Bacteria | 16499 |
| 798 | Ga0495678_001938 | 3300049459 | Bacteria | 14980 |
| 799 | Ga0495678_003948 | 3300049459 | Bacteria | 8874 |
| 800 | Ga0495678_005643 | 3300049459 | Bacteria | 6836 |
| 801 | Ga0495678_041648 | 3300049459 | Bacteria | 1836 |
| 802 | Ga0495678_117639 | 3300049459 | Bacteria | 897 |
| 803 | Ga0495682_0000351 | 3300049460 | Bacteria | 33719 |
| 804 | Ga0495682_0001002 | 3300049460 | Bacteria | 16842 |
| 805 | Ga0495682_0010776 | 3300049460 | Bacteria | 3528 |
| 806 | Ga0495682_0014757 | 3300049460 | Bacteria | 2961 |
| 807 | Ga0495682_0018316 | 3300049460 | Bacteria | 2638 |
| 808 | Ga0495682_0099491 | 3300049460 | Bacteria | 1043 |
| 809 | Ga0501031_0004117 | 3300049568 | Bacteria | 9389 |
| 810 | Ga0501031_0015053 | 3300049568 | Bacteria | 5023 |
| 811 | Ga0501032_0002455 | 3300049569 | Bacteria | 14482 |
| 812 | Ga0501032_0013401 | 3300049569 | Bacteria | 5832 |
| 813 | Ga0501033_0002230 | 3300049570 | Bacteria | 16664 |
| 814 | Ga0501033_0004514 | 3300049570 | Bacteria | 11142 |
| 815 | Ga0501033_0004903 | 3300049570 | Bacteria | 10648 |
| 816 | Ga0501036_0009324 | 3300049572 | Bacteria | 8072 |
| 817 | Ga0501036_0306886 | 3300049572 | Bacteria | 1327 |
| 818 | Ga0501037_0063335 | 3300049573 | Bacteria | 2695 |
| 819 | Ga0501037_0269985 | 3300049573 | Bacteria | 1187 |
| 820 | Ga0501038_0015899 | 3300049574 | Bacteria | 6837 |
| 821 | Ga0501038_0040448 | 3300049574 | Bacteria | 4071 |
| 822 | Ga0501038_0041437 | 3300049574 | Bacteria | 4015 |
| 823 | Ga0501039_0106454 | 3300049575 | Bacteria | 2190 |
| 824 | Ga0501039_0172274 | 3300049575 | Bacteria | 1701 |
| 825 | Ga0501040_0002743 | 3300049576 | Bacteria | 11343 |
| 826 | Ga0501042_0009794 | 3300049578 | Bacteria | 6402 |
| 827 | Ga0501043_0005656 | 3300049579 | Bacteria | 10072 |
| 828 | Ga0501043_0007467 | 3300049579 | Bacteria | 8682 |
| 829 | Ga0501043_0085602 | 3300049579 | Bacteria | 2477 |
| 830 | Ga0501043_0321037 | 3300049579 | Bacteria | 1181 |
| 831 | Ga0501046_0006116 | 3300049580 | Bacteria | 10698 |
| 832 | Ga0501046_0046835 | 3300049580 | Bacteria | 3430 |
| 833 | Ga0501046_0509580 | 3300049580 | Bacteria | 861 |
| 834 | Ga0501047_0091996 | 3300049581 | Bacteria | 2911 |
| 835 | Ga0501047_0306976 | 3300049581 | Bacteria | 1428 |
| 836 | Ga0501048_0030133 | 3300049582 | Bacteria | 3928 |
| 837 | Ga0501068_0003678 | 3300049584 | Bacteria | 8297 |
| 838 | Ga0501238_002802 | 3300049671 | Bacteria | 2110 |
| 839 | Ga0501249_005902 | 3300049679 | Bacteria | 2508 |
| 840 | Ga0501269_001331 | 3300049766 | Bacteria | 3274 |
| 841 | Ga0501035_0001124 | 3300049822 | Bacteria | 27956 |
| 842 | Ga0501035_0002256 | 3300049822 | Bacteria | 19064 |
| 843 | Ga0501035_0057071 | 3300049822 | Bacteria | 3481 |
| 844 | Ga0501044_0010900 | 3300049823 | Bacteria | 9865 |
| 845 | Ga0501044_0015152 | 3300049823 | Bacteria | 8308 |
| 846 | Ga0501044_0028349 | 3300049823 | Bacteria | 5910 |
| 847 | Ga0501045_0004780 | 3300049824 | Bacteria | 9358 |
| 848 | nmdc:mga08y16_15265_c1 | 3300050511 | Bacteria | 8080 |
| 849 | nmdc:mga08y16_256392_c1 | 3300050511 | Bacteria | 1807 |
| 850 | Ga0500594_0008642 | 3300053118 | Bacteria | 2326 |
| 851 | Ga0500618_000426 | 3300053125 | Bacteria | 28249 |
| 852 | Ga0500618_001765 | 3300053125 | Bacteria | 9153 |
| 853 | Ga0500618_003076 | 3300053125 | Bacteria | 5904 |
| 854 | Ga0500586_001291 | 3300053145 | Bacteria | 5258 |
| 855 | Ga0500616_0079532 | 3300053153 | Bacteria | 1650 |
| 856 | Ga0587066_017614 | 3300059490 | Bacteria | 1140 |
| 857 | Ga0587070_032462 | 3300059491 | Bacteria | 955 |
| 858 | Ga0587083_0001536 | 3300059505 | Bacteria | 2628 |
| 859 | Ga0587090_015677 | 3300059510 | Bacteria | 1124 |
| 860 | Ga0587090_054793 | 3300059510 | Bacteria | 741 |
| 861 | Ga0587091_018907 | 3300059511 | Bacteria | 1178 |
| 862 | Ga0587092_047516 | 3300059512 | Bacteria | 767 |
| 863 | Ga0587106_043474 | 3300059605 | Bacteria | 771 |
| 864 | Ga0587101_007192 | 3300059623 | Bacteria | 1306 |
| 865 | Ga0587113_004574 | 3300059625 | Bacteria | 1106 |
| 866 | Ga0587067_013242 | 3300059640 | Bacteria | 1302 |
| 867 | Ga0587068_006947 | 3300059641 | Bacteria | 1600 |
| 868 | Ga0587078_018517 | 3300059646 | Bacteria | 863 |
| 869 | Ga0587071_018029 | 3300060344 | Bacteria | 1265 |
| 870 | Ga0587071_045861 | 3300060344 | Bacteria | 890 |
| 871 | Ga0466962_0109336 | 3300061719 | Bacteria | 1330 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025937 | Ga0207669_10136358 | Ga0207669_101363582 | 201 |
| 2 | 3300013308 | Ga0157375_10615177 | Ga0157375_106151772 | 204 |
| 3 | 3300009551 | Ga0105238_10053531 | Ga0105238_100535312 | 206 |
| 4 | iso_pu_bacteria | 2952252522 | 2952256059 | 207 |
| 5 | 3300005290 | Ga0065712_10165081 | Ga0065712_101650811 | 208 |
| 6 | 3300005293 | Ga0065715_10228053 | Ga0065715_102280532 | 208 |
| 7 | 3300005331 | Ga0070670_100019310 | Ga0070670_1000193104 | 208 |
| 8 | 3300005334 | Ga0068869_100100111 | Ga0068869_1001001112 | 208 |
| 9 | 3300005365 | Ga0070688_100204107 | Ga0070688_1002041072 | 208 |
| 10 | 3300005438 | Ga0070701_10204655 | Ga0070701_102046551 | 208 |
| 11 | 3300005459 | Ga0068867_100043831 | Ga0068867_1000438312 | 208 |
| 12 | 3300005466 | Ga0070685_10199875 | Ga0070685_101998752 | 208 |
| 13 | 3300005577 | Ga0068857_100106766 | Ga0068857_1001067662 | 208 |
| 14 | 3300005617 | Ga0068859_100074769 | Ga0068859_1000747692 | 208 |
| 15 | 3300006931 | Ga0097620_100074766 | Ga0097620_1000747662 | 208 |
| 16 | 3300014326 | Ga0157380_10047811 | Ga0157380_100478112 | 208 |
| 17 | 3300014745 | Ga0157377_10256914 | Ga0157377_102569141 | 208 |
| 18 | 3300025925 | Ga0207650_10009675 | Ga0207650_100096751 | 208 |
| 19 | 3300025934 | Ga0207686_10247933 | Ga0207686_102479331 | 208 |
| 20 | 3300026075 | Ga0207708_10081624 | Ga0207708_100816242 | 208 |
| 21 | 3300026089 | Ga0207648_10121752 | Ga0207648_101217522 | 208 |
| 22 | 3300026116 | Ga0207674_10062454 | Ga0207674_100624542 | 208 |
| 23 | 3300046499 | Ga0495594_0013970 | Ga0495594_0013970_3166_3792 | 208 |
| 24 | 3300046506 | Ga0495583_0127193 | Ga0495583_0127193_187_819 | 208 |
| 25 | 3300046535 | Ga0495586_0170259 | Ga0495586_0170259_202_828 | 208 |
| 26 | 3300046557 | Ga0495622_0147821 | Ga0495622_0147821_420_1046 | 208 |
| 27 | 3300047321 | Ga0495676_0041757 | Ga0495676_0041757_1661_2287 | 208 |
| 28 | 3300048928 | Ga0496125_0017185 | Ga0496125_0017185_4113_4739 | 208 |
| 29 | iso_pu_bacteria | 2511231003 | 2511247471 | 208 |
| 30 | iso_pu_bacteria | 2521172590 | 2521560889 | 208 |
| 31 | iso_pu_bacteria | 2551306416 | 2553007600 | 208 |
| 32 | iso_pu_bacteria | 2643221556 | 2643798159 | 208 |
| 33 | iso_pu_bacteria | 2643221603 | 2644026956 | 208 |
| 34 | iso_pu_bacteria | 2643221684 | 2644475156 | 208 |
| 35 | iso_pu_bacteria | 2738541297 | 2738825132 | 208 |
| 36 | iso_pu_bacteria | 2738541357 | 2739148929 | 208 |
| 37 | iso_pu_bacteria | 2738543003 | 2739190848 | 208 |
| 38 | iso_pu_bacteria | 2738543026 | 2739317325 | 208 |
| 39 | iso_pu_bacteria | 2738543029 | 2739335566 | 208 |
| 40 | iso_pu_bacteria | 2765235838 | 2765567326 | 208 |
| 41 | iso_pu_bacteria | 2808606386 | 2808984235 | 208 |
| 42 | iso_pu_bacteria | 2808606415 | 2809132039 | 208 |
| 43 | iso_pu_bacteria | 2808606418 | 2809144607 | 208 |
| 44 | iso_pu_bacteria | 2808606419 | 2809151662 | 208 |
| 45 | iso_pu_bacteria | 2818991445 | 2819594334 | 208 |
| 46 | iso_pu_bacteria | 2818991449 | 2819618761 | 208 |
| 47 | iso_pu_bacteria | 2821131069 | 2821133729 | 208 |
| 48 | iso_pu_bacteria | 2831426010 | 2831426403 | 208 |
| 49 | iso_pu_bacteria | 2839094727 | 2839095410 | 208 |
| 50 | iso_pu_bacteria | 2842711865 | 2842717207 | 208 |
| 51 | iso_pu_bacteria | 2848694841 | 2848697939 | 208 |
| 52 | iso_pu_bacteria | 2849660919 | 2849665533 | 208 |
| 53 | iso_pu_bacteria | 2852618963 | 2852622878 | 208 |
| 54 | iso_pu_bacteria | 2857558681 | 2857560375 | 208 |
| 55 | iso_pu_bacteria | 2857564685 | 2857565522 | 208 |
| 56 | iso_pu_bacteria | 2884811622 | 2884814037 | 208 |
| 57 | iso_pu_bacteria | 2884836552 | 2884840731 | 208 |
| 58 | iso_pu_bacteria | 2884852848 | 2884857673 | 208 |
| 59 | iso_pu_bacteria | 2886627955 | 2886634677 | 208 |
| 60 | iso_pu_bacteria | 2896154374 | 2896158613 | 208 |
| 61 | iso_pu_bacteria | 2904424332 | 2904430578 | 208 |
| 62 | iso_pu_bacteria | 2904434214 | 2904438194 | 208 |
| 63 | iso_pu_bacteria | 2904439833 | 2904442494 | 208 |
| 64 | iso_pu_bacteria | 2904530477 | 2904533752 | 208 |
| 65 | iso_pu_bacteria | 2904584206 | 2904589411 | 208 |
| 66 | iso_pu_bacteria | 2904589729 | 2904595114 | 208 |
| 67 | iso_pu_bacteria | 2904601388 | 2904602384 | 208 |
| 68 | iso_pu_bacteria | 2913844669 | 2913847959 | 208 |
| 69 | iso_pu_bacteria | 2919046199 | 2919050733 | 208 |
| 70 | iso_pu_bacteria | 2919079590 | 2919084927 | 208 |
| 71 | iso_pu_bacteria | 2923510766 | 2923514731 | 208 |
| 72 | iso_pu_bacteria | 2928130867 | 2928135667 | 208 |
| 73 | iso_pu_bacteria | 8047673197 | 8047678168 | 208 |
| 74 | 3300048916 | Ga0496113_0626763 | Ga0496113_0626763_23_652 | 209 |
| 75 | iso_pu_bacteria | 2643221628 | 2644163225 | 209 |
| 76 | iso_pu_bacteria | 2842677519 | 2842679666 | 209 |
| 77 | iso_pu_bacteria | 2842747753 | 2842751158 | 209 |
| 78 | iso_pu_bacteria | 2919462493 | 2919467243 | 209 |
| 79 | iso_pu_bacteria | 2929520902 | 2929522752 | 209 |
| 80 | iso_pu_bacteria | 2945945610 | 2945947702 | 209 |
| 81 | iso_pu_bacteria | 2954767861 | 2954772458 | 209 |
| 82 | 3300036401 | Ga0373937_0336745 | Ga0373937_0336745_47_706 | 210 |
| 83 | 3300046531 | Ga0495665_0174738 | Ga0495665_0174738_424_1056 | 210 |
| 84 | 3300005563 | Ga0068855_100008403 | Ga0068855_1000084036 | 211 |
| 85 | 3300009093 | Ga0105240_10159307 | Ga0105240_101593072 | 211 |
| 86 | 3300020070 | Ga0206356_11570456 | Ga0206356_115704561 | 211 |
| 87 | 3300021361 | Ga0213872_10000920 | Ga0213872_1000092012 | 211 |
| 88 | 3300025912 | Ga0207707_10607648 | Ga0207707_106076481 | 211 |
| 89 | 3300025913 | Ga0207695_10080349 | Ga0207695_100803493 | 211 |
| 90 | 3300025949 | Ga0207667_10000543 | Ga0207667_1000054330 | 211 |
| 91 | 3300031995 | Ga0307409_100781846 | Ga0307409_1007818462 | 211 |
| 92 | 3300032002 | Ga0307416_101069069 | Ga0307416_1010690691 | 211 |
| 93 | 3300032126 | Ga0307415_100328697 | Ga0307415_1003286972 | 211 |
| 94 | 3300039062 | Ga0400483_114212 | Ga0400483_114212_321_956 | 211 |
| 95 | 3300041509 | Ga0451843_1115385 | Ga0451843_1115385_54_689 | 211 |
| 96 | 3300002704 | JGI25155J39150_1000170 | JGI25155J39150_10001706 | 212 |
| 97 | 3300002704 | JGI25155J39150_1000318 | JGI25155J39150_100031815 | 212 |
| 98 | 3300002705 | JGI25156J39149_1000293 | JGI25156J39149_100029328 | 212 |
| 99 | 3300002705 | JGI25156J39149_1001177 | JGI25156J39149_10011779 | 212 |
| 100 | 3300002737 | JGI25162J39368_1004661 | JGI25162J39368_10046613 | 212 |
| 101 | 3300002738 | JGI25154J39366_1000260 | JGI25154J39366_100026028 | 212 |
| 102 | 3300002738 | JGI25154J39366_1000267 | JGI25154J39366_10002676 | 212 |
| 103 | 3300002738 | JGI25154J39366_1000581 | JGI25154J39366_100058112 | 212 |
| 104 | 3300002741 | JGI25157J39369_1000327 | JGI25157J39369_100032728 | 212 |
| 105 | 3300002774 | JGI25150J39212_1005529 | JGI25150J39212_10055293 | 212 |
| 106 | 3300002774 | JGI25150J39212_1012921 | JGI25150J39212_10129212 | 212 |
| 107 | 3300002987 | JGI25159J45721_1003120 | JGI25159J45721_10031202 | 212 |
| 108 | 3300003187 | JGI25151J46595_10035960 | JGI25151J46595_100359601 | 212 |
| 109 | 3300003215 | JGI25153J46596_10009537 | JGI25153J46596_100095375 | 212 |
| 110 | 3300003544 | Ga0007417J51691_1076888 | Ga0007417J51691_10768881 | 212 |
| 111 | 3300003574 | Ga0007410J51695_1013512 | Ga0007410J51695_10135122 | 212 |
| 112 | 3300003575 | Ga0007409J51694_1005946 | Ga0007409J51694_10059464 | 212 |
| 113 | 3300003575 | Ga0007409J51694_1006985 | Ga0007409J51694_10069852 | 212 |
| 114 | 3300003577 | Ga0007416J51690_1007671 | Ga0007416J51690_10076713 | 212 |
| 115 | 3300003693 | Ga0032354_1018852 | Ga0032354_10188522 | 212 |
| 116 | 3300003751 | Ga0055538_1000138 | Ga0055538_100013832 | 212 |
| 117 | 3300003752 | Ga0055539_1000187 | Ga0055539_100018732 | 212 |
| 118 | 3300003756 | Ga0055533_1000189 | Ga0055533_100018932 | 212 |
| 119 | 3300003758 | Ga0055532_1000184 | Ga0055532_100018436 | 212 |
| 120 | 3300003759 | Ga0055525_1000133 | Ga0055525_100013337 | 212 |
| 121 | 3300003759 | Ga0055525_1000254 | Ga0055525_100025432 | 212 |
| 122 | 3300003761 | Ga0055535_1009076 | Ga0055535_10090762 | 212 |
| 123 | 3300003763 | Ga0055529_1000154 | Ga0055529_100015435 | 212 |
| 124 | 3300003771 | Ga0055526_1000237 | Ga0055526_100023734 | 212 |
| 125 | 3300003771 | Ga0055526_1000525 | Ga0055526_100052515 | 212 |
| 126 | 3300003773 | Ga0055537_1000111 | Ga0055537_100011146 | 212 |
| 127 | 3300003773 | Ga0055537_1014742 | Ga0055537_10147421 | 212 |
| 128 | 3300003775 | Ga0055524_1000015 | Ga0055524_1000015203 | 212 |
| 129 | 3300003775 | Ga0055524_1004885 | Ga0055524_10048856 | 212 |
| 130 | 3300003775 | Ga0055524_1008329 | Ga0055524_10083293 | 212 |
| 131 | 3300003784 | Ga0055534_1000509 | Ga0055534_10005098 | 212 |
| 132 | 3300003784 | Ga0055534_1001874 | Ga0055534_10018749 | 212 |
| 133 | 3300003790 | Ga0055528_1000178 | Ga0055528_10001786 | 212 |
| 134 | 3300003841 | Ga0055541_1000122 | Ga0055541_100012234 | 212 |
| 135 | 3300004625 | Ga0055543_1002600 | Ga0055543_10026007 | 212 |
| 136 | 3300005262 | Ga0065165_1000286 | Ga0065165_100028677 | 212 |
| 137 | 3300005262 | Ga0065165_1000465 | Ga0065165_100046517 | 212 |
| 138 | 3300005262 | Ga0065165_1092670 | Ga0065165_10926701 | 212 |
| 139 | 3300005327 | Ga0070658_10825019 | Ga0070658_108250191 | 212 |
| 140 | 3300005331 | Ga0070670_100013536 | Ga0070670_1000135365 | 212 |
| 141 | 3300005337 | Ga0070682_100001863 | Ga0070682_1000018636 | 212 |
| 142 | 3300005337 | Ga0070682_100143786 | Ga0070682_1001437862 | 212 |
| 143 | 3300005339 | Ga0070660_100001978 | Ga0070660_10000197822 | 212 |
| 144 | 3300005339 | Ga0070660_100056850 | Ga0070660_1000568503 | 212 |
| 145 | 3300005339 | Ga0070660_100102515 | Ga0070660_1001025152 | 212 |
| 146 | 3300005344 | Ga0070661_100122751 | Ga0070661_1001227512 | 212 |
| 147 | 3300005344 | Ga0070661_100126061 | Ga0070661_1001260612 | 212 |
| 148 | 3300005366 | Ga0070659_100001966 | Ga0070659_10000196613 | 212 |
| 149 | 3300005366 | Ga0070659_100327545 | Ga0070659_1003275451 | 212 |
| 150 | 3300005436 | Ga0070713_100664514 | Ga0070713_1006645141 | 212 |
| 151 | 3300005455 | Ga0070663_100508761 | Ga0070663_1005087611 | 212 |
| 152 | 3300005457 | Ga0070662_100115694 | Ga0070662_1001156941 | 212 |
| 153 | 3300005457 | Ga0070662_100356682 | Ga0070662_1003566822 | 212 |
| 154 | 3300005459 | Ga0068867_101096594 | Ga0068867_1010965941 | 212 |
| 155 | 3300005563 | Ga0068855_100002390 | Ga0068855_1000023904 | 212 |
| 156 | 3300005563 | Ga0068855_100205705 | Ga0068855_1002057053 | 212 |
| 157 | 3300005564 | Ga0070664_100031977 | Ga0070664_1000319772 | 212 |
| 158 | 3300005564 | Ga0070664_100153990 | Ga0070664_1001539902 | 212 |
| 159 | 3300005577 | Ga0068857_100149585 | Ga0068857_1001495852 | 212 |
| 160 | 3300005577 | Ga0068857_100843308 | Ga0068857_1008433081 | 212 |
| 161 | 3300005578 | Ga0068854_100020109 | Ga0068854_1000201093 | 212 |
| 162 | 3300005615 | Ga0070702_100403005 | Ga0070702_1004030051 | 212 |
| 163 | 3300005616 | Ga0068852_100014663 | Ga0068852_1000146635 | 212 |
| 164 | 3300005834 | Ga0068851_10100841 | Ga0068851_101008412 | 212 |
| 165 | 3300005834 | Ga0068851_10160807 | Ga0068851_101608071 | 212 |
| 166 | 3300006358 | Ga0068871_100133073 | Ga0068871_1001330733 | 212 |
| 167 | 3300006946 | Ga0079104_1005980 | Ga0079104_10059804 | 212 |
| 168 | 3300006948 | Ga0099826_10000003 | Ga0099826_10000003219 | 212 |
| 169 | 3300009036 | Ga0105244_10002912 | Ga0105244_100029129 | 212 |
| 170 | 3300009036 | Ga0105244_10013090 | Ga0105244_100130905 | 212 |
| 171 | 3300009036 | Ga0105244_10028026 | Ga0105244_100280262 | 212 |
| 172 | 3300009093 | Ga0105240_10018441 | Ga0105240_1001844110 | 212 |
| 173 | 3300009093 | Ga0105240_10069027 | Ga0105240_100690274 | 212 |
| 174 | 3300009093 | Ga0105240_10763176 | Ga0105240_107631762 | 212 |
| 175 | 3300009093 | Ga0105240_11032630 | Ga0105240_110326301 | 212 |
| 176 | 3300009094 | Ga0111539_10016114 | Ga0111539_100161143 | 212 |
| 177 | 3300009148 | Ga0105243_10020624 | Ga0105243_100206242 | 212 |
| 178 | 3300009174 | Ga0105241_10227329 | Ga0105241_102273291 | 212 |
| 179 | 3300009176 | Ga0105242_10116936 | Ga0105242_101169363 | 212 |
| 180 | 3300009545 | Ga0105237_10006499 | Ga0105237_1000649910 | 212 |
| 181 | 3300009545 | Ga0105237_10304152 | Ga0105237_103041522 | 212 |
| 182 | 3300009551 | Ga0105238_10000255 | Ga0105238_1000025534 | 212 |
| 183 | 3300010375 | Ga0105239_10001561 | Ga0105239_1000156113 | 212 |
| 184 | 3300010375 | Ga0105239_10231888 | Ga0105239_102318881 | 212 |
| 185 | 3300010375 | Ga0105239_10330143 | Ga0105239_103301432 | 212 |
| 186 | 3300013100 | Ga0157373_10092631 | Ga0157373_100926312 | 212 |
| 187 | 3300013100 | Ga0157373_10129519 | Ga0157373_101295192 | 212 |
| 188 | 3300013104 | Ga0157370_10007558 | Ga0157370_100075584 | 212 |
| 189 | 3300013307 | Ga0157372_10416221 | Ga0157372_104162212 | 212 |
| 190 | 3300013307 | Ga0157372_10817923 | Ga0157372_108179232 | 212 |
| 191 | 3300013308 | Ga0157375_10280728 | Ga0157375_102807282 | 212 |
| 192 | 3300014497 | Ga0182008_10013109 | Ga0182008_100131093 | 212 |
| 193 | 3300014497 | Ga0182008_10180962 | Ga0182008_101809622 | 212 |
| 194 | 3300014969 | Ga0157376_10480967 | Ga0157376_104809672 | 212 |
| 195 | 3300014969 | Ga0157376_10661087 | Ga0157376_106610872 | 212 |
| 196 | 3300015261 | Ga0182006_1019052 | Ga0182006_10190522 | 212 |
| 197 | 3300021361 | Ga0213872_10000002 | Ga0213872_10000002217 | 212 |
| 198 | 3300021361 | Ga0213872_10000307 | Ga0213872_1000030715 | 212 |
| 199 | 3300021361 | Ga0213872_10000427 | Ga0213872_1000042711 | 212 |
| 200 | 3300021361 | Ga0213872_10005167 | Ga0213872_100051674 | 212 |
| 201 | 3300021361 | Ga0213872_10011283 | Ga0213872_100112835 | 212 |
| 202 | 3300021361 | Ga0213872_10022797 | Ga0213872_100227971 | 212 |
| 203 | 3300025206 | Ga0209435_100079 | Ga0209435_10007933 | 212 |
| 204 | 3300025206 | Ga0209435_100137 | Ga0209435_10013711 | 212 |
| 205 | 3300025208 | Ga0209436_110345 | Ga0209436_1103452 | 212 |
| 206 | 3300025224 | Ga0209784_100035 | Ga0209784_100035164 | 212 |
| 207 | 3300025225 | Ga0209566_100040 | Ga0209566_100040164 | 212 |
| 208 | 3300025226 | Ga0209674_100057 | Ga0209674_100057164 | 212 |
| 209 | 3300025229 | Ga0209147_100060 | Ga0209147_100060214 | 212 |
| 210 | 3300025230 | Ga0209563_100015 | Ga0209563_10001567 | 212 |
| 211 | 3300025230 | Ga0209563_100059 | Ga0209563_100059164 | 212 |
| 212 | 3300025233 | Ga0209437_100081 | Ga0209437_100081237 | 212 |
| 213 | 3300025233 | Ga0209437_111330 | Ga0209437_1113302 | 212 |
| 214 | 3300025242 | Ga0209258_100141 | Ga0209258_10014122 | 212 |
| 215 | 3300025245 | Ga0207425_1000551 | Ga0207425_100055122 | 212 |
| 216 | 3300025246 | Ga0209646_1000028 | Ga0209646_1000028145 | 212 |
| 217 | 3300025246 | Ga0209646_1000265 | Ga0209646_100026532 | 212 |
| 218 | 3300025246 | Ga0209646_1000290 | Ga0209646_100029031 | 212 |
| 219 | 3300025250 | Ga0209026_1000330 | Ga0209026_100033032 | 212 |
| 220 | 3300025250 | Ga0209026_1002521 | Ga0209026_10025216 | 212 |
| 221 | 3300025253 | Ga0209677_100036 | Ga0209677_100036164 | 212 |
| 222 | 3300025253 | Ga0209677_101095 | Ga0209677_1010953 | 212 |
| 223 | 3300025254 | Ga0209148_1000765 | Ga0209148_100076518 | 212 |
| 224 | 3300025256 | Ga0209759_1000473 | Ga0209759_100047320 | 212 |
| 225 | 3300025256 | Ga0209759_1000485 | Ga0209759_100048512 | 212 |
| 226 | 3300025263 | Ga0209565_1000009 | Ga0209565_1000009553 | 212 |
| 227 | 3300025272 | Ga0209455_1000049 | Ga0209455_1000049188 | 212 |
| 228 | 3300025273 | Ga0209673_1000036 | Ga0209673_1000036129 | 212 |
| 229 | 3300025284 | Ga0209130_1000044 | Ga0209130_1000044176 | 212 |
| 230 | 3300025291 | Ga0209675_1000013 | Ga0209675_1000013129 | 212 |
| 231 | 3300025291 | Ga0209675_1011303 | Ga0209675_10113031 | 212 |
| 232 | 3300025294 | Ga0209025_1012300 | Ga0209025_10123006 | 212 |
| 233 | 3300025295 | Ga0209564_1000006 | Ga0209564_100000653 | 212 |
| 234 | 3300025295 | Ga0209564_1000038 | Ga0209564_100003833 | 212 |
| 235 | 3300025295 | Ga0209564_1000122 | Ga0209564_1000122129 | 212 |
| 236 | 3300025295 | Ga0209564_1002158 | Ga0209564_10021582 | 212 |
| 237 | 3300025295 | Ga0209564_1068754 | Ga0209564_10687541 | 212 |
| 238 | 3300025297 | Ga0209758_1000149 | Ga0209758_1000149110 | 212 |
| 239 | 3300025299 | Ga0209256_1000005 | Ga0209256_1000005204 | 212 |
| 240 | 3300025299 | Ga0209256_1000106 | Ga0209256_100010646 | 212 |
| 241 | 3300025728 | Ga0207655_1012507 | Ga0207655_10125075 | 212 |
| 242 | 3300025728 | Ga0207655_1059957 | Ga0207655_10599572 | 212 |
| 243 | 3300025735 | Ga0207713_1016732 | Ga0207713_10167324 | 212 |
| 244 | 3300025909 | Ga0207705_10034934 | Ga0207705_100349341 | 212 |
| 245 | 3300025909 | Ga0207705_10331377 | Ga0207705_103313771 | 212 |
| 246 | 3300025909 | Ga0207705_10934439 | Ga0207705_109344391 | 212 |
| 247 | 3300025911 | Ga0207654_10282684 | Ga0207654_102826841 | 212 |
| 248 | 3300025913 | Ga0207695_10001345 | Ga0207695_1000134534 | 212 |
| 249 | 3300025913 | Ga0207695_10003241 | Ga0207695_100032412 | 212 |
| 250 | 3300025913 | Ga0207695_10052058 | Ga0207695_100520584 | 212 |
| 251 | 3300025914 | Ga0207671_10001558 | Ga0207671_1000155813 | 212 |
| 252 | 3300025919 | Ga0207657_10001495 | Ga0207657_1000149512 | 212 |
| 253 | 3300025919 | Ga0207657_10032958 | Ga0207657_100329583 | 212 |
| 254 | 3300025920 | Ga0207649_10005902 | Ga0207649_100059026 | 212 |
| 255 | 3300025920 | Ga0207649_10065752 | Ga0207649_100657523 | 212 |
| 256 | 3300025921 | Ga0207652_10762404 | Ga0207652_107624042 | 212 |
| 257 | 3300025924 | Ga0207694_10000193 | Ga0207694_1000019345 | 212 |
| 258 | 3300025924 | Ga0207694_10166653 | Ga0207694_101666532 | 212 |
| 259 | 3300025932 | Ga0207690_10009202 | Ga0207690_100092022 | 212 |
| 260 | 3300025932 | Ga0207690_10019554 | Ga0207690_100195543 | 212 |
| 261 | 3300025932 | Ga0207690_10021347 | Ga0207690_100213473 | 212 |
| 262 | 3300025933 | Ga0207706_10043384 | Ga0207706_100433843 | 212 |
| 263 | 3300025933 | Ga0207706_10046776 | Ga0207706_100467761 | 212 |
| 264 | 3300025934 | Ga0207686_10007659 | Ga0207686_100076594 | 212 |
| 265 | 3300025938 | Ga0207704_10072307 | Ga0207704_100723071 | 212 |
| 266 | 3300025945 | Ga0207679_10016387 | Ga0207679_100163872 | 212 |
| 267 | 3300025945 | Ga0207679_10044089 | Ga0207679_100440892 | 212 |
| 268 | 3300025949 | Ga0207667_10000946 | Ga0207667_100009464 | 212 |
| 269 | 3300025949 | Ga0207667_10010647 | Ga0207667_100106478 | 212 |
| 270 | 3300025949 | Ga0207667_10023494 | Ga0207667_100234946 | 212 |
| 271 | 3300025949 | Ga0207667_10908222 | Ga0207667_109082221 | 212 |
| 272 | 3300025981 | Ga0207640_10031586 | Ga0207640_100315862 | 212 |
| 273 | 3300026067 | Ga0207678_10422718 | Ga0207678_104227182 | 212 |
| 274 | 3300026089 | Ga0207648_10364738 | Ga0207648_103647382 | 212 |
| 275 | 3300026116 | Ga0207674_10200977 | Ga0207674_102009772 | 212 |
| 276 | 3300026142 | Ga0207698_10099486 | Ga0207698_100994862 | 212 |
| 277 | 3300027111 | Ga0209281_1005655 | Ga0209281_10056552 | 212 |
| 278 | 3300027666 | Ga0209282_1000002 | Ga0209282_1000002778 | 212 |
| 279 | 3300027907 | Ga0207428_10145539 | Ga0207428_101455392 | 212 |
| 280 | 3300027907 | Ga0207428_10192088 | Ga0207428_101920882 | 212 |
| 281 | 3300030731 | Ga0316177_1181113 | Ga0316177_11811131 | 212 |
| 282 | 3300030735 | Ga0316178_1151420 | Ga0316178_11514202 | 212 |
| 283 | 3300030736 | Ga0316180_1113945 | Ga0316180_11139452 | 212 |
| 284 | 3300030745 | Ga0316182_1150052 | Ga0316182_11500522 | 212 |
| 285 | 3300031838 | Ga0307518_10008072 | Ga0307518_100080725 | 212 |
| 286 | 3300032002 | Ga0307416_100010843 | Ga0307416_1000108436 | 212 |
| 287 | 3300036401 | Ga0373937_0100910 | Ga0373937_0100910_1997_2635 | 212 |
| 288 | 3300037312 | Ga0395899_0000206 | Ga0395899_0000206_49954_50598 | 212 |
| 289 | 3300037312 | Ga0395899_0001430 | Ga0395899_0001430_8689_9369 | 212 |
| 290 | 3300037312 | Ga0395899_0002882 | Ga0395899_0002882_10442_11080 | 212 |
| 291 | 3300037312 | Ga0395899_0029111 | Ga0395899_0029111_1306_1950 | 212 |
| 292 | 3300037312 | Ga0395899_0039029 | Ga0395899_0039029_1008_1652 | 212 |
| 293 | 3300037312 | Ga0395899_0046977 | Ga0395899_0046977_536_1174 | 212 |
| 294 | 3300037312 | Ga0395899_0201294 | Ga0395899_0201294_223_861 | 212 |
| 295 | 3300037312 | Ga0395899_0231229 | Ga0395899_0231229_460_1101 | 212 |
| 296 | 3300037418 | Ga0395900_0000298 | Ga0395900_0000298_18566_19210 | 212 |
| 297 | 3300037418 | Ga0395900_0001764 | Ga0395900_0001764_19343_19984 | 212 |
| 298 | 3300037418 | Ga0395900_0005739 | Ga0395900_0005739_4729_5373 | 212 |
| 299 | 3300037418 | Ga0395900_0010058 | Ga0395900_0010058_3428_4066 | 212 |
| 300 | 3300037418 | Ga0395900_0022527 | Ga0395900_0022527_4229_4867 | 212 |
| 301 | 3300037418 | Ga0395900_0076138 | Ga0395900_0076138_2382_3020 | 212 |
| 302 | 3300037418 | Ga0395900_0080048 | Ga0395900_0080048_1732_2376 | 212 |
| 303 | 3300037418 | Ga0395900_0217065 | Ga0395900_0217065_310_951 | 212 |
| 304 | 3300037418 | Ga0395900_0279577 | Ga0395900_0279577_625_1263 | 212 |
| 305 | 3300037418 | Ga0395900_0498390 | Ga0395900_0498390_278_922 | 212 |
| 306 | 3300037418 | Ga0395900_0525120 | Ga0395900_0525120_483_1121 | 212 |
| 307 | 3300037418 | Ga0395900_0529413 | Ga0395900_0529413_240_878 | 212 |
| 308 | 3300037418 | Ga0395900_0572269 | Ga0395900_0572269_135_773 | 212 |
| 309 | 3300037418 | Ga0395900_0578093 | Ga0395900_0578093_123_764 | 212 |
| 310 | 3300037418 | Ga0395900_0868983 | Ga0395900_0868983_128_766 | 212 |
| 311 | 3300037466 | Ga0395898_0006001 | Ga0395898_0006001_7314_7952 | 212 |
| 312 | 3300037466 | Ga0395898_0082226 | Ga0395898_0082226_1606_2250 | 212 |
| 313 | 3300037466 | Ga0395898_0097732 | Ga0395898_0097732_1100_1738 | 212 |
| 314 | 3300037466 | Ga0395898_0358522 | Ga0395898_0358522_192_836 | 212 |
| 315 | 3300037466 | Ga0395898_0535902 | Ga0395898_0535902_456_1100 | 212 |
| 316 | 3300037466 | Ga0395898_0568060 | Ga0395898_0568060_234_875 | 212 |
| 317 | 3300037471 | Ga0395905_0000549 | Ga0395905_0000549_12643_13281 | 212 |
| 318 | 3300037471 | Ga0395905_0001839 | Ga0395905_0001839_17722_18360 | 212 |
| 319 | 3300037471 | Ga0395905_0006051 | Ga0395905_0006051_11274_11912 | 212 |
| 320 | 3300037471 | Ga0395905_0057719 | Ga0395905_0057719_1323_1964 | 212 |
| 321 | 3300037471 | Ga0395905_0118515 | Ga0395905_0118515_662_1306 | 212 |
| 322 | 3300037471 | Ga0395905_0154863 | Ga0395905_0154863_1012_1650 | 212 |
| 323 | 3300037471 | Ga0395905_0304307 | Ga0395905_0304307_34_672 | 212 |
| 324 | 3300037471 | Ga0395905_0312296 | Ga0395905_0312296_400_1041 | 212 |
| 325 | 3300037471 | Ga0395905_0495067 | Ga0395905_0495067_465_1103 | 212 |
| 326 | 3300038443 | Ga0395901_0000508 | Ga0395901_0000508_20289_20930 | 212 |
| 327 | 3300038443 | Ga0395901_0001421 | Ga0395901_0001421_14122_14760 | 212 |
| 328 | 3300038443 | Ga0395901_0010350 | Ga0395901_0010350_1970_2608 | 212 |
| 329 | 3300038443 | Ga0395901_0056215 | Ga0395901_0056215_1801_2445 | 212 |
| 330 | 3300038443 | Ga0395901_0078091 | Ga0395901_0078091_1483_2121 | 212 |
| 331 | 3300038443 | Ga0395901_0263518 | Ga0395901_0263518_743_1387 | 212 |
| 332 | 3300038443 | Ga0395901_0408517 | Ga0395901_0408517_275_913 | 212 |
| 333 | 3300038443 | Ga0395901_0436655 | Ga0395901_0436655_592_1230 | 212 |
| 334 | 3300038443 | Ga0395901_0914796 | Ga0395901_0914796_131_769 | 212 |
| 335 | 3300039447 | Ga0436361_0376382 | Ga0436361_0376382_14083_14721 | 212 |
| 336 | 3300039447 | Ga0436361_0391791 | Ga0436361_0391791_17306_17944 | 212 |
| 337 | 3300039447 | Ga0436361_0684212 | Ga0436361_0684212_4716_5354 | 212 |
| 338 | 3300039447 | Ga0436361_0733741 | Ga0436361_0733741_5615_6253 | 212 |
| 339 | 3300039447 | Ga0436361_0868581 | Ga0436361_0868581_132_770 | 212 |
| 340 | 3300039447 | Ga0436361_1016700 | Ga0436361_1016700_17919_18557 | 212 |
| 341 | 3300039447 | Ga0436361_1196357 | Ga0436361_1196357_2399_3037 | 212 |
| 342 | 3300042005 | Ga0439448_0006029 | Ga0439448_0006029_2487_3125 | 212 |
| 343 | 3300042007 | Ga0439449_0072104 | Ga0439449_0072104_347_991 | 212 |
| 344 | 3300042012 | Ga0439455_0012451 | Ga0439455_0012451_562_1200 | 212 |
| 345 | 3300042012 | Ga0439455_0016438 | Ga0439455_0016438_427_1071 | 212 |
| 346 | 3300042015 | Ga0439462_0034206 | Ga0439462_0034206_631_1272 | 212 |
| 347 | 3300042139 | Ga0450904_001033 | Ga0450904_001033_913_1563 | 212 |
| 348 | 3300042157 | Ga0439458_0032026 | Ga0439458_0032026_262_906 | 212 |
| 349 | 3300042876 | Ga0451577_0007665 | Ga0451577_0007665_8165_8803 | 212 |
| 350 | 3300044656 | Ga0466969_0060342 | Ga0466969_0060342_911_1549 | 212 |
| 351 | 3300044658 | Ga0466972_0000140 | Ga0466972_0000140_45515_46153 | 212 |
| 352 | 3300044658 | Ga0466972_0017423 | Ga0466972_0017423_46_687 | 212 |
| 353 | 3300044683 | Ga0466965_0000818 | Ga0466965_0000818_5117_5755 | 212 |
| 354 | 3300044683 | Ga0466965_0003643 | Ga0466965_0003643_2360_3001 | 212 |
| 355 | 3300044683 | Ga0466965_0033185 | Ga0466965_0033185_78_716 | 212 |
| 356 | 3300044683 | Ga0466965_0040322 | Ga0466965_0040322_1088_1726 | 212 |
| 357 | 3300044684 | Ga0466966_0057925 | Ga0466966_0057925_861_1505 | 212 |
| 358 | 3300044684 | Ga0466966_0060141 | Ga0466966_0060141_1634_2272 | 212 |
| 359 | 3300044684 | Ga0466966_0112953 | Ga0466966_0112953_818_1456 | 212 |
| 360 | 3300044706 | Ga0466964_0000639 | Ga0466964_0000639_773_1417 | 212 |
| 361 | 3300044706 | Ga0466964_0002253 | Ga0466964_0002253_5317_5958 | 212 |
| 362 | 3300044719 | Ga0466971_0052891 | Ga0466971_0052891_413_1051 | 212 |
| 363 | 3300044735 | Ga0466968_0018171 | Ga0466968_0018171_1885_2526 | 212 |
| 364 | 3300044735 | Ga0466968_0032940 | Ga0466968_0032940_893_1531 | 212 |
| 365 | 3300044765 | Ga0466970_0031711 | Ga0466970_0031711_603_1241 | 212 |
| 366 | 3300044842 | Ga0466957_0003058 | Ga0466957_0003058_1807_2445 | 212 |
| 367 | 3300044842 | Ga0466957_0106118 | Ga0466957_0106118_574_1218 | 212 |
| 368 | 3300044842 | Ga0466957_0114944 | Ga0466957_0114944_158_802 | 212 |
| 369 | 3300044842 | Ga0466957_0127004 | Ga0466957_0127004_628_1272 | 212 |
| 370 | 3300045049 | Ga0466959_0085374 | Ga0466959_0085374_407_1051 | 212 |
| 371 | 3300045049 | Ga0466959_0140467 | Ga0466959_0140467_101_739 | 212 |
| 372 | 3300045976 | Ga0466967_0059609 | Ga0466967_0059609_2475_3119 | 212 |
| 373 | 3300046452 | Ga0495617_000002 | Ga0495617_000002_664306_664944 | 212 |
| 374 | 3300046452 | Ga0495617_000574 | Ga0495617_000574_6526_7164 | 212 |
| 375 | 3300046453 | Ga0495627_000350 | Ga0495627_000350_17533_18171 | 212 |
| 376 | 3300046455 | Ga0495603_0143924 | Ga0495603_0143924_395_1033 | 212 |
| 377 | 3300046457 | Ga0495590_0000025 | Ga0495590_0000025_45962_46600 | 212 |
| 378 | 3300046457 | Ga0495590_0000052 | Ga0495590_0000052_60454_61092 | 212 |
| 379 | 3300046457 | Ga0495590_0003125 | Ga0495590_0003125_6060_6698 | 212 |
| 380 | 3300046457 | Ga0495590_0035970 | Ga0495590_0035970_667_1305 | 212 |
| 381 | 3300046458 | Ga0495591_000290 | Ga0495591_000290_18657_19295 | 212 |
| 382 | 3300046459 | Ga0495629_0018934 | Ga0495629_0018934_974_1618 | 212 |
| 383 | 3300046459 | Ga0495629_0022874 | Ga0495629_0022874_2726_3364 | 212 |
| 384 | 3300046460 | Ga0495638_0000066 | Ga0495638_0000066_64545_65189 | 212 |
| 385 | 3300046460 | Ga0495638_0007197 | Ga0495638_0007197_2693_3331 | 212 |
| 386 | 3300046460 | Ga0495638_0034164 | Ga0495638_0034164_264_902 | 212 |
| 387 | 3300046460 | Ga0495638_0055994 | Ga0495638_0055994_785_1465 | 212 |
| 388 | 3300046463 | Ga0495653_0000011 | Ga0495653_0000011_242658_243296 | 212 |
| 389 | 3300046463 | Ga0495653_0005660 | Ga0495653_0005660_5999_6637 | 212 |
| 390 | 3300046463 | Ga0495653_0008945 | Ga0495653_0008945_1150_1788 | 212 |
| 391 | 3300046463 | Ga0495653_0034471 | Ga0495653_0034471_2743_3381 | 212 |
| 392 | 3300046471 | Ga0495650_0000015 | Ga0495650_0000015_260925_261566 | 212 |
| 393 | 3300046471 | Ga0495650_0000506 | Ga0495650_0000506_13200_13838 | 212 |
| 394 | 3300046471 | Ga0495650_0000567 | Ga0495650_0000567_36384_37064 | 212 |
| 395 | 3300046471 | Ga0495650_0000694 | Ga0495650_0000694_13248_13886 | 212 |
| 396 | 3300046471 | Ga0495650_0000716 | Ga0495650_0000716_17324_17962 | 212 |
| 397 | 3300046471 | Ga0495650_0000721 | Ga0495650_0000721_40264_40902 | 212 |
| 398 | 3300046471 | Ga0495650_0012095 | Ga0495650_0012095_2862_3500 | 212 |
| 399 | 3300046471 | Ga0495650_0012906 | Ga0495650_0012906_2377_3015 | 212 |
| 400 | 3300046471 | Ga0495650_0115113 | Ga0495650_0115113_216_854 | 212 |
| 401 | 3300046472 | Ga0495580_0003141 | Ga0495580_0003141_10605_11243 | 212 |
| 402 | 3300046472 | Ga0495580_0098195 | Ga0495580_0098195_43_681 | 212 |
| 403 | 3300046473 | Ga0495582_0025473 | Ga0495582_0025473_545_1183 | 212 |
| 404 | 3300046473 | Ga0495582_0028174 | Ga0495582_0028174_886_1530 | 212 |
| 405 | 3300046473 | Ga0495582_0067515 | Ga0495582_0067515_272_910 | 212 |
| 406 | 3300046474 | Ga0495605_0000003 | Ga0495605_0000003_349382_350020 | 212 |
| 407 | 3300046474 | Ga0495605_0000034 | Ga0495605_0000034_118562_119200 | 212 |
| 408 | 3300046474 | Ga0495605_0000474 | Ga0495605_0000474_21895_22533 | 212 |
| 409 | 3300046474 | Ga0495605_0030905 | Ga0495605_0030905_1457_2095 | 212 |
| 410 | 3300046474 | Ga0495605_0039401 | Ga0495605_0039401_690_1328 | 212 |
| 411 | 3300046474 | Ga0495605_0081458 | Ga0495605_0081458_425_1063 | 212 |
| 412 | 3300046474 | Ga0495605_0085899 | Ga0495605_0085899_217_855 | 212 |
| 413 | 3300046475 | Ga0495639_0011637 | Ga0495639_0011637_2119_2763 | 212 |
| 414 | 3300046475 | Ga0495639_0395440 | Ga0495639_0395440_13_651 | 212 |
| 415 | 3300046491 | Ga0495584_0000017 | Ga0495584_0000017_123536_124174 | 212 |
| 416 | 3300046491 | Ga0495584_0004259 | Ga0495584_0004259_480_1118 | 212 |
| 417 | 3300046491 | Ga0495584_0010891 | Ga0495584_0010891_1142_1780 | 212 |
| 418 | 3300046491 | Ga0495584_0027048 | Ga0495584_0027048_357_995 | 212 |
| 419 | 3300046491 | Ga0495584_0027755 | Ga0495584_0027755_1948_2586 | 212 |
| 420 | 3300046491 | Ga0495584_0032084 | Ga0495584_0032084_1392_2030 | 212 |
| 421 | 3300046491 | Ga0495584_0051362 | Ga0495584_0051362_1389_2033 | 212 |
| 422 | 3300046491 | Ga0495584_0071811 | Ga0495584_0071811_991_1629 | 212 |
| 423 | 3300046491 | Ga0495584_0076705 | Ga0495584_0076705_467_1111 | 212 |
| 424 | 3300046491 | Ga0495584_0185813 | Ga0495584_0185813_87_725 | 212 |
| 425 | 3300046491 | Ga0495584_0242058 | Ga0495584_0242058_67_705 | 212 |
| 426 | 3300046492 | Ga0495585_0000006 | Ga0495585_0000006_314781_315419 | 212 |
| 427 | 3300046492 | Ga0495585_0000064 | Ga0495585_0000064_53437_54075 | 212 |
| 428 | 3300046492 | Ga0495585_0002287 | Ga0495585_0002287_12668_13306 | 212 |
| 429 | 3300046492 | Ga0495585_0002576 | Ga0495585_0002576_402_1040 | 212 |
| 430 | 3300046492 | Ga0495585_0003985 | Ga0495585_0003985_6710_7390 | 212 |
| 431 | 3300046492 | Ga0495585_0004342 | Ga0495585_0004342_3778_4416 | 212 |
| 432 | 3300046492 | Ga0495585_0004490 | Ga0495585_0004490_5952_6590 | 212 |
| 433 | 3300046492 | Ga0495585_0005798 | Ga0495585_0005798_5304_5942 | 212 |
| 434 | 3300046492 | Ga0495585_0014043 | Ga0495585_0014043_1180_1818 | 212 |
| 435 | 3300046492 | Ga0495585_0047820 | Ga0495585_0047820_175_813 | 212 |
| 436 | 3300046492 | Ga0495585_0048409 | Ga0495585_0048409_1056_1700 | 212 |
| 437 | 3300046492 | Ga0495585_0062085 | Ga0495585_0062085_182_820 | 212 |
| 438 | 3300046492 | Ga0495585_0079079 | Ga0495585_0079079_693_1331 | 212 |
| 439 | 3300046492 | Ga0495585_0278465 | Ga0495585_0278465_136_774 | 212 |
| 440 | 3300046499 | Ga0495594_0010545 | Ga0495594_0010545_4003_4647 | 212 |
| 441 | 3300046499 | Ga0495594_0032405 | Ga0495594_0032405_1308_1946 | 212 |
| 442 | 3300046499 | Ga0495594_0072625 | Ga0495594_0072625_30_668 | 212 |
| 443 | 3300046500 | Ga0495596_0000550 | Ga0495596_0000550_5516_6154 | 212 |
| 444 | 3300046500 | Ga0495596_0002227 | Ga0495596_0002227_7418_8056 | 212 |
| 445 | 3300046500 | Ga0495596_0004778 | Ga0495596_0004778_3454_4092 | 212 |
| 446 | 3300046500 | Ga0495596_0008875 | Ga0495596_0008875_2961_3605 | 212 |
| 447 | 3300046500 | Ga0495596_0009006 | Ga0495596_0009006_2754_3392 | 212 |
| 448 | 3300046500 | Ga0495596_0017447 | Ga0495596_0017447_377_1015 | 212 |
| 449 | 3300046500 | Ga0495596_0021491 | Ga0495596_0021491_1379_2017 | 212 |
| 450 | 3300046500 | Ga0495596_0025031 | Ga0495596_0025031_841_1479 | 212 |
| 451 | 3300046500 | Ga0495596_0096228 | Ga0495596_0096228_352_990 | 212 |
| 452 | 3300046501 | Ga0495607_0002172 | Ga0495607_0002172_2380_3018 | 212 |
| 453 | 3300046501 | Ga0495607_0003491 | Ga0495607_0003491_2935_3573 | 212 |
| 454 | 3300046501 | Ga0495607_0006380 | Ga0495607_0006380_810_1448 | 212 |
| 455 | 3300046501 | Ga0495607_0007438 | Ga0495607_0007438_3754_4392 | 212 |
| 456 | 3300046501 | Ga0495607_0008285 | Ga0495607_0008285_5008_5646 | 212 |
| 457 | 3300046501 | Ga0495607_0018387 | Ga0495607_0018387_1390_2028 | 212 |
| 458 | 3300046501 | Ga0495607_0023637 | Ga0495607_0023637_3039_3677 | 212 |
| 459 | 3300046501 | Ga0495607_0032412 | Ga0495607_0032412_2413_3051 | 212 |
| 460 | 3300046501 | Ga0495607_0043236 | Ga0495607_0043236_1863_2513 | 212 |
| 461 | 3300046501 | Ga0495607_0052835 | Ga0495607_0052835_1241_1879 | 212 |
| 462 | 3300046506 | Ga0495583_0000056 | Ga0495583_0000056_141054_141692 | 212 |
| 463 | 3300046506 | Ga0495583_0000320 | Ga0495583_0000320_60498_61136 | 212 |
| 464 | 3300046506 | Ga0495583_0000344 | Ga0495583_0000344_67077_67715 | 212 |
| 465 | 3300046506 | Ga0495583_0000808 | Ga0495583_0000808_34734_35372 | 212 |
| 466 | 3300046506 | Ga0495583_0000864 | Ga0495583_0000864_13355_13993 | 212 |
| 467 | 3300046506 | Ga0495583_0002451 | Ga0495583_0002451_12198_12836 | 212 |
| 468 | 3300046506 | Ga0495583_0004193 | Ga0495583_0004193_2206_2886 | 212 |
| 469 | 3300046506 | Ga0495583_0004206 | Ga0495583_0004206_6705_7343 | 212 |
| 470 | 3300046506 | Ga0495583_0025151 | Ga0495583_0025151_1391_2029 | 212 |
| 471 | 3300046506 | Ga0495583_0026117 | Ga0495583_0026117_2105_2743 | 212 |
| 472 | 3300046506 | Ga0495583_0028021 | Ga0495583_0028021_846_1484 | 212 |
| 473 | 3300046506 | Ga0495583_0061266 | Ga0495583_0061266_575_1213 | 212 |
| 474 | 3300046506 | Ga0495583_0087270 | Ga0495583_0087270_294_932 | 212 |
| 475 | 3300046506 | Ga0495583_0138663 | Ga0495583_0138663_31_669 | 212 |
| 476 | 3300046507 | Ga0495606_0000024 | Ga0495606_0000024_53509_54147 | 212 |
| 477 | 3300046507 | Ga0495606_0000043 | Ga0495606_0000043_50788_51426 | 212 |
| 478 | 3300046507 | Ga0495606_0000920 | Ga0495606_0000920_29470_30108 | 212 |
| 479 | 3300046507 | Ga0495606_0001616 | Ga0495606_0001616_20419_21057 | 212 |
| 480 | 3300046507 | Ga0495606_0003205 | Ga0495606_0003205_9056_9694 | 212 |
| 481 | 3300046507 | Ga0495606_0003670 | Ga0495606_0003670_13116_13754 | 212 |
| 482 | 3300046507 | Ga0495606_0003817 | Ga0495606_0003817_1533_2171 | 212 |
| 483 | 3300046507 | Ga0495606_0008549 | Ga0495606_0008549_2631_3329 | 212 |
| 484 | 3300046507 | Ga0495606_0014675 | Ga0495606_0014675_3084_3722 | 212 |
| 485 | 3300046507 | Ga0495606_0035706 | Ga0495606_0035706_2411_3049 | 212 |
| 486 | 3300046507 | Ga0495606_0041147 | Ga0495606_0041147_1958_2596 | 212 |
| 487 | 3300046507 | Ga0495606_0139429 | Ga0495606_0139429_452_1150 | 212 |
| 488 | 3300046507 | Ga0495606_0251134 | Ga0495606_0251134_205_843 | 212 |
| 489 | 3300046512 | Ga0495610_0000004 | Ga0495610_0000004_366344_366982 | 212 |
| 490 | 3300046512 | Ga0495610_0000613 | Ga0495610_0000613_18664_19302 | 212 |
| 491 | 3300046512 | Ga0495610_0005202 | Ga0495610_0005202_1416_2054 | 212 |
| 492 | 3300046513 | Ga0495616_0000057 | Ga0495616_0000057_44702_45382 | 212 |
| 493 | 3300046513 | Ga0495616_0000727 | Ga0495616_0000727_11678_12316 | 212 |
| 494 | 3300046513 | Ga0495616_0000765 | Ga0495616_0000765_22536_23174 | 212 |
| 495 | 3300046513 | Ga0495616_0001904 | Ga0495616_0001904_1780_2418 | 212 |
| 496 | 3300046513 | Ga0495616_0003367 | Ga0495616_0003367_2480_3118 | 212 |
| 497 | 3300046513 | Ga0495616_0009006 | Ga0495616_0009006_2859_3497 | 212 |
| 498 | 3300046513 | Ga0495616_0010979 | Ga0495616_0010979_1386_2030 | 212 |
| 499 | 3300046513 | Ga0495616_0013917 | Ga0495616_0013917_2957_3595 | 212 |
| 500 | 3300046513 | Ga0495616_0017895 | Ga0495616_0017895_1098_1736 | 212 |
| 501 | 3300046513 | Ga0495616_0018263 | Ga0495616_0018263_1656_2294 | 212 |
| 502 | 3300046513 | Ga0495616_0036374 | Ga0495616_0036374_1020_1658 | 212 |
| 503 | 3300046513 | Ga0495616_0037678 | Ga0495616_0037678_635_1273 | 212 |
| 504 | 3300046513 | Ga0495616_0172725 | Ga0495616_0172725_271_909 | 212 |
| 505 | 3300046517 | Ga0495630_0495929 | Ga0495630_0495929_80_718 | 212 |
| 506 | 3300046518 | Ga0495631_0000703 | Ga0495631_0000703_2648_3286 | 212 |
| 507 | 3300046518 | Ga0495631_0001517 | Ga0495631_0001517_7811_8449 | 212 |
| 508 | 3300046518 | Ga0495631_0003602 | Ga0495631_0003602_7649_8287 | 212 |
| 509 | 3300046518 | Ga0495631_0003814 | Ga0495631_0003814_3220_3858 | 212 |
| 510 | 3300046518 | Ga0495631_0015024 | Ga0495631_0015024_1336_1980 | 212 |
| 511 | 3300046518 | Ga0495631_0015692 | Ga0495631_0015692_2860_3498 | 212 |
| 512 | 3300046518 | Ga0495631_0032249 | Ga0495631_0032249_187_825 | 212 |
| 513 | 3300046518 | Ga0495631_0051375 | Ga0495631_0051375_654_1292 | 212 |
| 514 | 3300046518 | Ga0495631_0073157 | Ga0495631_0073157_547_1245 | 212 |
| 515 | 3300046518 | Ga0495631_0130349 | Ga0495631_0130349_381_1025 | 212 |
| 516 | 3300046519 | Ga0495632_0000077 | Ga0495632_0000077_14091_14729 | 212 |
| 517 | 3300046519 | Ga0495632_0001081 | Ga0495632_0001081_20269_20907 | 212 |
| 518 | 3300046519 | Ga0495632_0004490 | Ga0495632_0004490_1786_2424 | 212 |
| 519 | 3300046519 | Ga0495632_0222471 | Ga0495632_0222471_68_706 | 212 |
| 520 | 3300046520 | Ga0495637_0000126 | Ga0495637_0000126_15723_16361 | 212 |
| 521 | 3300046520 | Ga0495637_0000327 | Ga0495637_0000327_13207_13845 | 212 |
| 522 | 3300046520 | Ga0495637_0006099 | Ga0495637_0006099_2226_2864 | 212 |
| 523 | 3300046520 | Ga0495637_0013723 | Ga0495637_0013723_1757_2401 | 212 |
| 524 | 3300046520 | Ga0495637_0027938 | Ga0495637_0027938_820_1458 | 212 |
| 525 | 3300046520 | Ga0495637_0031293 | Ga0495637_0031293_263_901 | 212 |
| 526 | 3300046522 | Ga0495643_0000415 | Ga0495643_0000415_52396_53076 | 212 |
| 527 | 3300046522 | Ga0495643_0000747 | Ga0495643_0000747_21660_22328 | 212 |
| 528 | 3300046522 | Ga0495643_0001870 | Ga0495643_0001870_6671_7309 | 212 |
| 529 | 3300046522 | Ga0495643_0002987 | Ga0495643_0002987_1086_1724 | 212 |
| 530 | 3300046522 | Ga0495643_0041150 | Ga0495643_0041150_1482_2120 | 212 |
| 531 | 3300046522 | Ga0495643_0224312 | Ga0495643_0224312_156_800 | 212 |
| 532 | 3300046523 | Ga0495644_0003414 | Ga0495644_0003414_3308_3946 | 212 |
| 533 | 3300046523 | Ga0495644_0006881 | Ga0495644_0006881_1335_1973 | 212 |
| 534 | 3300046523 | Ga0495644_0010124 | Ga0495644_0010124_2403_3041 | 212 |
| 535 | 3300046523 | Ga0495644_0017512 | Ga0495644_0017512_976_1614 | 212 |
| 536 | 3300046523 | Ga0495644_0019139 | Ga0495644_0019139_743_1387 | 212 |
| 537 | 3300046523 | Ga0495644_0052584 | Ga0495644_0052584_275_913 | 212 |
| 538 | 3300046524 | Ga0495648_0000007 | Ga0495648_0000007_278302_278940 | 212 |
| 539 | 3300046524 | Ga0495648_0000045 | Ga0495648_0000045_120497_121141 | 212 |
| 540 | 3300046524 | Ga0495648_0000534 | Ga0495648_0000534_32444_33082 | 212 |
| 541 | 3300046524 | Ga0495648_0000708 | Ga0495648_0000708_25300_25938 | 212 |
| 542 | 3300046524 | Ga0495648_0002581 | Ga0495648_0002581_10469_11107 | 212 |
| 543 | 3300046524 | Ga0495648_0008428 | Ga0495648_0008428_1466_2146 | 212 |
| 544 | 3300046524 | Ga0495648_0024977 | Ga0495648_0024977_1965_2603 | 212 |
| 545 | 3300046524 | Ga0495648_0054248 | Ga0495648_0054248_1484_2122 | 212 |
| 546 | 3300046525 | Ga0495663_0011742 | Ga0495663_0011742_1059_1697 | 212 |
| 547 | 3300046526 | Ga0495666_0000738 | Ga0495666_0000738_13360_13998 | 212 |
| 548 | 3300046526 | Ga0495666_0003203 | Ga0495666_0003203_4029_4667 | 212 |
| 549 | 3300046526 | Ga0495666_0043989 | Ga0495666_0043989_272_916 | 212 |
| 550 | 3300046528 | Ga0495642_0000422 | Ga0495642_0000422_12226_12864 | 212 |
| 551 | 3300046528 | Ga0495642_0000749 | Ga0495642_0000749_6031_6669 | 212 |
| 552 | 3300046528 | Ga0495642_0006403 | Ga0495642_0006403_1195_1833 | 212 |
| 553 | 3300046528 | Ga0495642_0017514 | Ga0495642_0017514_510_1148 | 212 |
| 554 | 3300046528 | Ga0495642_0020988 | Ga0495642_0020988_1492_2169 | 212 |
| 555 | 3300046528 | Ga0495642_0033497 | Ga0495642_0033497_399_1097 | 212 |
| 556 | 3300046528 | Ga0495642_0044315 | Ga0495642_0044315_843_1481 | 212 |
| 557 | 3300046529 | Ga0495652_0020998 | Ga0495652_0020998_491_1129 | 212 |
| 558 | 3300046530 | Ga0495654_0000004 | Ga0495654_0000004_101650_102288 | 212 |
| 559 | 3300046530 | Ga0495654_0005449 | Ga0495654_0005449_4899_5537 | 212 |
| 560 | 3300046530 | Ga0495654_0058694 | Ga0495654_0058694_257_895 | 212 |
| 561 | 3300046530 | Ga0495654_0103500 | Ga0495654_0103500_79_717 | 212 |
| 562 | 3300046531 | Ga0495665_0006321 | Ga0495665_0006321_2470_3108 | 212 |
| 563 | 3300046531 | Ga0495665_0028275 | Ga0495665_0028275_2090_2734 | 212 |
| 564 | 3300046535 | Ga0495586_0010284 | Ga0495586_0010284_28_666 | 212 |
| 565 | 3300046535 | Ga0495586_0038439 | Ga0495586_0038439_1559_2203 | 212 |
| 566 | 3300046535 | Ga0495586_0075084 | Ga0495586_0075084_713_1351 | 212 |
| 567 | 3300046535 | Ga0495586_0108725 | Ga0495586_0108725_101_823 | 212 |
| 568 | 3300046536 | Ga0495587_0020480 | Ga0495587_0020480_2817_3455 | 212 |
| 569 | 3300046536 | Ga0495587_0065793 | Ga0495587_0065793_157_795 | 212 |
| 570 | 3300046538 | Ga0495609_0000002 | Ga0495609_0000002_436919_437557 | 212 |
| 571 | 3300046538 | Ga0495609_0000433 | Ga0495609_0000433_13228_13866 | 212 |
| 572 | 3300046538 | Ga0495609_0010208 | Ga0495609_0010208_2456_3094 | 212 |
| 573 | 3300046538 | Ga0495609_0013379 | Ga0495609_0013379_2737_3375 | 212 |
| 574 | 3300046538 | Ga0495609_0015171 | Ga0495609_0015171_2526_3164 | 212 |
| 575 | 3300046538 | Ga0495609_0020581 | Ga0495609_0020581_2338_2976 | 212 |
| 576 | 3300046538 | Ga0495609_0022531 | Ga0495609_0022531_1956_2600 | 212 |
| 577 | 3300046538 | Ga0495609_0029689 | Ga0495609_0029689_1690_2328 | 212 |
| 578 | 3300046538 | Ga0495609_0072718 | Ga0495609_0072718_800_1438 | 212 |
| 579 | 3300046538 | Ga0495609_0126132 | Ga0495609_0126132_160_798 | 212 |
| 580 | 3300046542 | Ga0495597_0000523 | Ga0495597_0000523_15175_15813 | 212 |
| 581 | 3300046542 | Ga0495597_0001053 | Ga0495597_0001053_13844_14482 | 212 |
| 582 | 3300046542 | Ga0495597_0001374 | Ga0495597_0001374_5964_6602 | 212 |
| 583 | 3300046542 | Ga0495597_0002627 | Ga0495597_0002627_3319_3957 | 212 |
| 584 | 3300046542 | Ga0495597_0010108 | Ga0495597_0010108_1608_2246 | 212 |
| 585 | 3300046542 | Ga0495597_0016981 | Ga0495597_0016981_1696_2334 | 212 |
| 586 | 3300046542 | Ga0495597_0066102 | Ga0495597_0066102_897_1535 | 212 |
| 587 | 3300046557 | Ga0495622_0002130 | Ga0495622_0002130_2186_2830 | 212 |
| 588 | 3300046557 | Ga0495622_0026612 | Ga0495622_0026612_1518_2156 | 212 |
| 589 | 3300046557 | Ga0495622_0036812 | Ga0495622_0036812_270_914 | 212 |
| 590 | 3300046557 | Ga0495622_0040208 | Ga0495622_0040208_1034_1678 | 212 |
| 591 | 3300046558 | Ga0495633_0000504 | Ga0495633_0000504_14025_14693 | 212 |
| 592 | 3300046558 | Ga0495633_0001016 | Ga0495633_0001016_7865_8509 | 212 |
| 593 | 3300046558 | Ga0495633_0004300 | Ga0495633_0004300_6193_6831 | 212 |
| 594 | 3300046558 | Ga0495633_0005658 | Ga0495633_0005658_4377_5015 | 212 |
| 595 | 3300046558 | Ga0495633_0007382 | Ga0495633_0007382_2933_3571 | 212 |
| 596 | 3300046558 | Ga0495633_0012242 | Ga0495633_0012242_663_1301 | 212 |
| 597 | 3300046558 | Ga0495633_0013436 | Ga0495633_0013436_3313_3957 | 212 |
| 598 | 3300046558 | Ga0495633_0015734 | Ga0495633_0015734_3162_3800 | 212 |
| 599 | 3300046558 | Ga0495633_0019270 | Ga0495633_0019270_1335_1973 | 212 |
| 600 | 3300046615 | Ga0495656_0017227 | Ga0495656_0017227_1671_2309 | 212 |
| 601 | 3300046615 | Ga0495656_0023163 | Ga0495656_0023163_429_1067 | 212 |
| 602 | 3300046615 | Ga0495656_0025883 | Ga0495656_0025883_81_719 | 212 |
| 603 | 3300046615 | Ga0495656_0229934 | Ga0495656_0229934_75_713 | 212 |
| 604 | 3300046616 | Ga0495668_0000025 | Ga0495668_0000025_242365_243003 | 212 |
| 605 | 3300046616 | Ga0495668_0000126 | Ga0495668_0000126_73453_74121 | 212 |
| 606 | 3300046616 | Ga0495668_0000810 | Ga0495668_0000810_8106_8744 | 212 |
| 607 | 3300046616 | Ga0495668_0001707 | Ga0495668_0001707_14655_15293 | 212 |
| 608 | 3300046616 | Ga0495668_0002549 | Ga0495668_0002549_1280_1918 | 212 |
| 609 | 3300046616 | Ga0495668_0004065 | Ga0495668_0004065_6653_7333 | 212 |
| 610 | 3300046616 | Ga0495668_0005188 | Ga0495668_0005188_5011_5649 | 212 |
| 611 | 3300046616 | Ga0495668_0007538 | Ga0495668_0007538_1412_2050 | 212 |
| 612 | 3300046616 | Ga0495668_0009246 | Ga0495668_0009246_3080_3718 | 212 |
| 613 | 3300046616 | Ga0495668_0018131 | Ga0495668_0018131_3097_3735 | 212 |
| 614 | 3300046616 | Ga0495668_0020835 | Ga0495668_0020835_850_1488 | 212 |
| 615 | 3300046616 | Ga0495668_0025258 | Ga0495668_0025258_1232_1870 | 212 |
| 616 | 3300046616 | Ga0495668_0072635 | Ga0495668_0072635_511_1149 | 212 |
| 617 | 3300046616 | Ga0495668_0086465 | Ga0495668_0086465_833_1471 | 212 |
| 618 | 3300046616 | Ga0495668_0105530 | Ga0495668_0105530_518_1216 | 212 |
| 619 | 3300046642 | Ga0495634_0168123 | Ga0495634_0168123_239_877 | 212 |
| 620 | 3300046648 | Ga0495611_0000551 | Ga0495611_0000551_2890_3528 | 212 |
| 621 | 3300046648 | Ga0495611_0008248 | Ga0495611_0008248_3749_4387 | 212 |
| 622 | 3300046648 | Ga0495611_0014670 | Ga0495611_0014670_1649_2287 | 212 |
| 623 | 3300046648 | Ga0495611_0015059 | Ga0495611_0015059_737_1375 | 212 |
| 624 | 3300046648 | Ga0495611_0015669 | Ga0495611_0015669_1032_1670 | 212 |
| 625 | 3300046648 | Ga0495611_0056131 | Ga0495611_0056131_473_1111 | 212 |
| 626 | 3300046648 | Ga0495611_0056343 | Ga0495611_0056343_707_1351 | 212 |
| 627 | 3300046648 | Ga0495611_0084660 | Ga0495611_0084660_245_883 | 212 |
| 628 | 3300046660 | Ga0495625_0002773 | Ga0495625_0002773_4582_5220 | 212 |
| 629 | 3300046660 | Ga0495625_0002810 | Ga0495625_0002810_10890_11534 | 212 |
| 630 | 3300046660 | Ga0495625_0009260 | Ga0495625_0009260_5854_6528 | 212 |
| 631 | 3300046660 | Ga0495625_0012218 | Ga0495625_0012218_6017_6655 | 212 |
| 632 | 3300046660 | Ga0495625_0019633 | Ga0495625_0019633_1317_1955 | 212 |
| 633 | 3300046660 | Ga0495625_0037296 | Ga0495625_0037296_2108_2746 | 212 |
| 634 | 3300046660 | Ga0495625_0047348 | Ga0495625_0047348_444_1082 | 212 |
| 635 | 3300046660 | Ga0495625_0054637 | Ga0495625_0054637_1162_1830 | 212 |
| 636 | 3300046660 | Ga0495625_0055425 | Ga0495625_0055425_1000_1683 | 212 |
| 637 | 3300046660 | Ga0495625_0093667 | Ga0495625_0093667_100_738 | 212 |
| 638 | 3300046664 | Ga0495659_0000445 | Ga0495659_0000445_11550_12188 | 212 |
| 639 | 3300046664 | Ga0495659_0090261 | Ga0495659_0090261_320_958 | 212 |
| 640 | 3300046664 | Ga0495659_0115358 | Ga0495659_0115358_183_821 | 212 |
| 641 | 3300046665 | Ga0495661_0000859 | Ga0495661_0000859_5130_5768 | 212 |
| 642 | 3300046665 | Ga0495661_0001479 | Ga0495661_0001479_6962_7636 | 212 |
| 643 | 3300046665 | Ga0495661_0002355 | Ga0495661_0002355_6584_7222 | 212 |
| 644 | 3300046665 | Ga0495661_0004983 | Ga0495661_0004983_1404_2048 | 212 |
| 645 | 3300046665 | Ga0495661_0008804 | Ga0495661_0008804_2719_3357 | 212 |
| 646 | 3300046665 | Ga0495661_0009671 | Ga0495661_0009671_182_820 | 212 |
| 647 | 3300046665 | Ga0495661_0016891 | Ga0495661_0016891_1792_2430 | 212 |
| 648 | 3300046665 | Ga0495661_0022952 | Ga0495661_0022952_1400_2038 | 212 |
| 649 | 3300046665 | Ga0495661_0042189 | Ga0495661_0042189_16_654 | 212 |
| 650 | 3300046665 | Ga0495661_0048547 | Ga0495661_0048547_142_780 | 212 |
| 651 | 3300046665 | Ga0495661_0049026 | Ga0495661_0049026_345_1025 | 212 |
| 652 | 3300046665 | Ga0495661_0052103 | Ga0495661_0052103_867_1565 | 212 |
| 653 | 3300046665 | Ga0495661_0054316 | Ga0495661_0054316_194_832 | 212 |
| 654 | 3300046665 | Ga0495661_0059265 | Ga0495661_0059265_982_1620 | 212 |
| 655 | 3300046665 | Ga0495661_0087706 | Ga0495661_0087706_739_1377 | 212 |
| 656 | 3300046665 | Ga0495661_0097057 | Ga0495661_0097057_49_747 | 212 |
| 657 | 3300046665 | Ga0495661_0121558 | Ga0495661_0121558_747_1421 | 212 |
| 658 | 3300046665 | Ga0495661_0187558 | Ga0495661_0187558_160_798 | 212 |
| 659 | 3300046665 | Ga0495661_0243383 | Ga0495661_0243383_54_692 | 212 |
| 660 | 3300046665 | Ga0495661_0335104 | Ga0495661_0335104_51_689 | 212 |
| 661 | 3300046674 | Ga0495588_0000067 | Ga0495588_0000067_219144_219782 | 212 |
| 662 | 3300046674 | Ga0495588_0020049 | Ga0495588_0020049_136_774 | 212 |
| 663 | 3300046674 | Ga0495588_0087213 | Ga0495588_0087213_65_742 | 212 |
| 664 | 3300046675 | Ga0495657_0338102 | Ga0495657_0338102_114_752 | 212 |
| 665 | 3300046678 | Ga0495599_0297355 | Ga0495599_0297355_42_680 | 212 |
| 666 | 3300046679 | Ga0495623_0021263 | Ga0495623_0021263_493_1131 | 212 |
| 667 | 3300046679 | Ga0495623_0097997 | Ga0495623_0097997_29_667 | 212 |
| 668 | 3300046679 | Ga0495623_0160321 | Ga0495623_0160321_481_1119 | 212 |
| 669 | 3300046680 | Ga0495646_0085121 | Ga0495646_0085121_884_1522 | 212 |
| 670 | 3300046680 | Ga0495646_0159490 | Ga0495646_0159490_547_1185 | 212 |
| 671 | 3300046680 | Ga0495646_0224371 | Ga0495646_0224371_109_747 | 212 |
| 672 | 3300046684 | Ga0495669_0000401 | Ga0495669_0000401_17624_18268 | 212 |
| 673 | 3300046684 | Ga0495669_0000712 | Ga0495669_0000712_4470_5108 | 212 |
| 674 | 3300046684 | Ga0495669_0003709 | Ga0495669_0003709_3071_3709 | 212 |
| 675 | 3300046684 | Ga0495669_0020327 | Ga0495669_0020327_1366_2004 | 212 |
| 676 | 3300046684 | Ga0495669_0026832 | Ga0495669_0026832_1141_1779 | 212 |
| 677 | 3300046689 | Ga0495613_0150896 | Ga0495613_0150896_46_690 | 212 |
| 678 | 3300046690 | Ga0495624_0005808 | Ga0495624_0005808_1220_1858 | 212 |
| 679 | 3300046690 | Ga0495624_0145508 | Ga0495624_0145508_751_1389 | 212 |
| 680 | 3300046691 | Ga0495670_0001953 | Ga0495670_0001953_1687_2325 | 212 |
| 681 | 3300046691 | Ga0495670_0006207 | Ga0495670_0006207_762_1400 | 212 |
| 682 | 3300046691 | Ga0495670_0011529 | Ga0495670_0011529_118_756 | 212 |
| 683 | 3300046691 | Ga0495670_0012966 | Ga0495670_0012966_268_906 | 212 |
| 684 | 3300046691 | Ga0495670_0208416 | Ga0495670_0208416_89_727 | 212 |
| 685 | 3300046691 | Ga0495670_0287688 | Ga0495670_0287688_182_820 | 212 |
| 686 | 3300046692 | Ga0495671_0000001 | Ga0495671_0000001_1014075_1014713 | 212 |
| 687 | 3300046692 | Ga0495671_0007128 | Ga0495671_0007128_4682_5362 | 212 |
| 688 | 3300046692 | Ga0495671_0014118 | Ga0495671_0014118_2544_3182 | 212 |
| 689 | 3300046692 | Ga0495671_0017617 | Ga0495671_0017617_2363_3001 | 212 |
| 690 | 3300046692 | Ga0495671_0029571 | Ga0495671_0029571_304_1002 | 212 |
| 691 | 3300046692 | Ga0495671_0069513 | Ga0495671_0069513_65_706 | 212 |
| 692 | 3300046692 | Ga0495671_0080435 | Ga0495671_0080435_621_1259 | 212 |
| 693 | 3300046692 | Ga0495671_0084987 | Ga0495671_0084987_595_1233 | 212 |
| 694 | 3300046694 | Ga0495649_0001061 | Ga0495649_0001061_18377_19015 | 212 |
| 695 | 3300046694 | Ga0495649_0004351 | Ga0495649_0004351_7579_8217 | 212 |
| 696 | 3300046694 | Ga0495649_0013688 | Ga0495649_0013688_1862_2500 | 212 |
| 697 | 3300046694 | Ga0495649_0021684 | Ga0495649_0021684_1380_2018 | 212 |
| 698 | 3300046694 | Ga0495649_0103004 | Ga0495649_0103004_102_743 | 212 |
| 699 | 3300046794 | Ga0495589_0000324 | Ga0495589_0000324_12306_12944 | 212 |
| 700 | 3300046794 | Ga0495589_0000701 | Ga0495589_0000701_4954_5592 | 212 |
| 701 | 3300046794 | Ga0495589_0008247 | Ga0495589_0008247_2500_3138 | 212 |
| 702 | 3300046794 | Ga0495589_0013146 | Ga0495589_0013146_2516_3154 | 212 |
| 703 | 3300046794 | Ga0495589_0273682 | Ga0495589_0273682_92_730 | 212 |
| 704 | 3300046794 | Ga0495589_0275315 | Ga0495589_0275315_14_652 | 212 |
| 705 | 3300046810 | Ga0495660_0000026 | Ga0495660_0000026_146337_146975 | 212 |
| 706 | 3300046810 | Ga0495660_0007088 | Ga0495660_0007088_1369_2007 | 212 |
| 707 | 3300046810 | Ga0495660_0010717 | Ga0495660_0010717_3467_4105 | 212 |
| 708 | 3300046810 | Ga0495660_0020096 | Ga0495660_0020096_791_1429 | 212 |
| 709 | 3300046810 | Ga0495660_0021269 | Ga0495660_0021269_542_1180 | 212 |
| 710 | 3300046810 | Ga0495660_0031785 | Ga0495660_0031785_1978_2616 | 212 |
| 711 | 3300046810 | Ga0495660_0058419 | Ga0495660_0058419_558_1196 | 212 |
| 712 | 3300047315 | Ga0495581_0005532 | Ga0495581_0005532_3352_3990 | 212 |
| 713 | 3300047315 | Ga0495581_0133366 | Ga0495581_0133366_290_934 | 212 |
| 714 | 3300047317 | Ga0495604_0004090 | Ga0495604_0004090_2874_3512 | 212 |
| 715 | 3300047318 | Ga0495636_0004150 | Ga0495636_0004150_2592_3230 | 212 |
| 716 | 3300047318 | Ga0495636_0029856 | Ga0495636_0029856_1269_1907 | 212 |
| 717 | 3300047319 | Ga0495674_0004640 | Ga0495674_0004640_3520_4164 | 212 |
| 718 | 3300047320 | Ga0495672_0000041 | Ga0495672_0000041_230087_230725 | 212 |
| 719 | 3300047320 | Ga0495672_0000050 | Ga0495672_0000050_151440_152078 | 212 |
| 720 | 3300047320 | Ga0495672_0000454 | Ga0495672_0000454_24205_24843 | 212 |
| 721 | 3300047320 | Ga0495672_0000505 | Ga0495672_0000505_2429_3097 | 212 |
| 722 | 3300047320 | Ga0495672_0001726 | Ga0495672_0001726_17998_18636 | 212 |
| 723 | 3300047320 | Ga0495672_0001789 | Ga0495672_0001789_5307_5945 | 212 |
| 724 | 3300047320 | Ga0495672_0036121 | Ga0495672_0036121_1174_1812 | 212 |
| 725 | 3300047320 | Ga0495672_0041549 | Ga0495672_0041549_823_1461 | 212 |
| 726 | 3300047320 | Ga0495672_0052171 | Ga0495672_0052171_406_1044 | 212 |
| 727 | 3300047320 | Ga0495672_0123916 | Ga0495672_0123916_453_1091 | 212 |
| 728 | 3300047321 | Ga0495676_0000235 | Ga0495676_0000235_25513_26151 | 212 |
| 729 | 3300047321 | Ga0495676_0013662 | Ga0495676_0013662_2197_2841 | 212 |
| 730 | 3300047322 | Ga0495680_0009334 | Ga0495680_0009334_8153_8797 | 212 |
| 731 | 3300047323 | Ga0495683_0000203 | Ga0495683_0000203_52836_53474 | 212 |
| 732 | 3300047323 | Ga0495683_0000434 | Ga0495683_0000434_24955_25593 | 212 |
| 733 | 3300047323 | Ga0495683_0007966 | Ga0495683_0007966_4836_5474 | 212 |
| 734 | 3300047323 | Ga0495683_0086209 | Ga0495683_0086209_782_1420 | 212 |
| 735 | 3300047323 | Ga0495683_0123035 | Ga0495683_0123035_466_1104 | 212 |
| 736 | 3300047443 | Ga0495687_000013 | Ga0495687_000013_299299_299937 | 212 |
| 737 | 3300047443 | Ga0495687_000127 | Ga0495687_000127_52203_52847 | 212 |
| 738 | 3300047443 | Ga0495687_000143 | Ga0495687_000143_55758_56396 | 212 |
| 739 | 3300047443 | Ga0495687_000871 | Ga0495687_000871_7902_8540 | 212 |
| 740 | 3300047443 | Ga0495687_005119 | Ga0495687_005119_2303_2941 | 212 |
| 741 | 3300047443 | Ga0495687_008376 | Ga0495687_008376_5015_5653 | 212 |
| 742 | 3300047443 | Ga0495687_008545 | Ga0495687_008545_4896_5534 | 212 |
| 743 | 3300047443 | Ga0495687_009637 | Ga0495687_009637_4639_5277 | 212 |
| 744 | 3300047444 | Ga0495675_0001313 | Ga0495675_0001313_14014_14652 | 212 |
| 745 | 3300047445 | Ga0495677_0000098 | Ga0495677_0000098_30561_31199 | 212 |
| 746 | 3300047445 | Ga0495677_0001073 | Ga0495677_0001073_9194_9832 | 212 |
| 747 | 3300047445 | Ga0495677_0001928 | Ga0495677_0001928_5130_5768 | 212 |
| 748 | 3300047445 | Ga0495677_0003237 | Ga0495677_0003237_5590_6228 | 212 |
| 749 | 3300047445 | Ga0495677_0009863 | Ga0495677_0009863_292_930 | 212 |
| 750 | 3300047445 | Ga0495677_0012011 | Ga0495677_0012011_325_963 | 212 |
| 751 | 3300047445 | Ga0495677_0014037 | Ga0495677_0014037_572_1216 | 212 |
| 752 | 3300047445 | Ga0495677_0014123 | Ga0495677_0014123_1035_1673 | 212 |
| 753 | 3300047445 | Ga0495677_0023046 | Ga0495677_0023046_770_1408 | 212 |
| 754 | 3300047445 | Ga0495677_0028793 | Ga0495677_0028793_165_803 | 212 |
| 755 | 3300047445 | Ga0495677_0030832 | Ga0495677_0030832_625_1263 | 212 |
| 756 | 3300047445 | Ga0495677_0083203 | Ga0495677_0083203_250_894 | 212 |
| 757 | 3300047446 | Ga0495679_002036 | Ga0495679_002036_2529_3167 | 212 |
| 758 | 3300047446 | Ga0495679_021491 | Ga0495679_021491_1040_1720 | 212 |
| 759 | 3300047446 | Ga0495679_025773 | Ga0495679_025773_1014_1652 | 212 |
| 760 | 3300047446 | Ga0495679_042088 | Ga0495679_042088_725_1363 | 212 |
| 761 | 3300047447 | Ga0495685_000942 | Ga0495685_000942_4091_4729 | 212 |
| 762 | 3300047447 | Ga0495685_003481 | Ga0495685_003481_2444_3082 | 212 |
| 763 | 3300047447 | Ga0495685_016432 | Ga0495685_016432_801_1445 | 212 |
| 764 | 3300047469 | Ga0495673_0000006 | Ga0495673_0000006_163946_164584 | 212 |
| 765 | 3300047469 | Ga0495673_0000014 | Ga0495673_0000014_306396_307034 | 212 |
| 766 | 3300047469 | Ga0495673_0000430 | Ga0495673_0000430_33129_33809 | 212 |
| 767 | 3300047469 | Ga0495673_0058575 | Ga0495673_0058575_23_661 | 212 |
| 768 | 3300047470 | Ga0495681_0000647 | Ga0495681_0000647_11956_12594 | 212 |
| 769 | 3300047470 | Ga0495681_0005070 | Ga0495681_0005070_5488_6126 | 212 |
| 770 | 3300047470 | Ga0495681_0006678 | Ga0495681_0006678_1567_2211 | 212 |
| 771 | 3300047470 | Ga0495681_0008759 | Ga0495681_0008759_1031_1669 | 212 |
| 772 | 3300047470 | Ga0495681_0021487 | Ga0495681_0021487_538_1176 | 212 |
| 773 | 3300047470 | Ga0495681_0031803 | Ga0495681_0031803_1239_1877 | 212 |
| 774 | 3300047470 | Ga0495681_0041010 | Ga0495681_0041010_1528_2166 | 212 |
| 775 | 3300047470 | Ga0495681_0041705 | Ga0495681_0041705_1133_1771 | 212 |
| 776 | 3300047472 | Ga0495686_0000288 | Ga0495686_0000288_31633_32271 | 212 |
| 777 | 3300047472 | Ga0495686_0001006 | Ga0495686_0001006_20295_20933 | 212 |
| 778 | 3300047472 | Ga0495686_0001335 | Ga0495686_0001335_19157_19795 | 212 |
| 779 | 3300047472 | Ga0495686_0001432 | Ga0495686_0001432_6239_6877 | 212 |
| 780 | 3300047472 | Ga0495686_0023406 | Ga0495686_0023406_2755_3393 | 212 |
| 781 | 3300047472 | Ga0495686_0045610 | Ga0495686_0045610_1452_2090 | 212 |
| 782 | 3300047472 | Ga0495686_0125285 | Ga0495686_0125285_727_1407 | 212 |
| 783 | 3300047673 | Ga0495593_0005559 | Ga0495593_0005559_3280_3918 | 212 |
| 784 | 3300047673 | Ga0495593_0015881 | Ga0495593_0015881_2237_2875 | 212 |
| 785 | 3300048088 | Ga0495602_0030814 | Ga0495602_0030814_171_809 | 212 |
| 786 | 3300048088 | Ga0495602_0032483 | Ga0495602_0032483_574_1212 | 212 |
| 787 | 3300048089 | Ga0495614_0010817 | Ga0495614_0010817_1375_2013 | 212 |
| 788 | 3300048089 | Ga0495614_0021970 | Ga0495614_0021970_1046_1768 | 212 |
| 789 | 3300048089 | Ga0495614_0025445 | Ga0495614_0025445_326_964 | 212 |
| 790 | 3300048090 | Ga0495615_0004089 | Ga0495615_0004089_1613_2251 | 212 |
| 791 | 3300048091 | Ga0495626_0000003 | Ga0495626_0000003_362461_363099 | 212 |
| 792 | 3300048091 | Ga0495626_0000096 | Ga0495626_0000096_88337_88975 | 212 |
| 793 | 3300048091 | Ga0495626_0001123 | Ga0495626_0001123_13055_13693 | 212 |
| 794 | 3300048091 | Ga0495626_0002799 | Ga0495626_0002799_4279_4917 | 212 |
| 795 | 3300048091 | Ga0495626_0003171 | Ga0495626_0003171_1253_1891 | 212 |
| 796 | 3300048091 | Ga0495626_0010902 | Ga0495626_0010902_2311_2949 | 212 |
| 797 | 3300048091 | Ga0495626_0010929 | Ga0495626_0010929_2835_3479 | 212 |
| 798 | 3300048091 | Ga0495626_0010932 | Ga0495626_0010932_3072_3710 | 212 |
| 799 | 3300048091 | Ga0495626_0013054 | Ga0495626_0013054_1213_1851 | 212 |
| 800 | 3300048091 | Ga0495626_0018878 | Ga0495626_0018878_2084_2722 | 212 |
| 801 | 3300048091 | Ga0495626_0020338 | Ga0495626_0020338_2516_3154 | 212 |
| 802 | 3300048091 | Ga0495626_0028973 | Ga0495626_0028973_1668_2306 | 212 |
| 803 | 3300048091 | Ga0495626_0049881 | Ga0495626_0049881_222_860 | 212 |
| 804 | 3300048091 | Ga0495626_0102479 | Ga0495626_0102479_45_683 | 212 |
| 805 | 3300048903 | Ga0496100_0027033 | Ga0496100_0027033_2689_3327 | 212 |
| 806 | 3300048903 | Ga0496100_0275358 | Ga0496100_0275358_486_1130 | 212 |
| 807 | 3300048904 | Ga0496101_0073207 | Ga0496101_0073207_58_696 | 212 |
| 808 | 3300048905 | Ga0496102_0000194 | Ga0496102_0000194_17528_18166 | 212 |
| 809 | 3300048905 | Ga0496102_0072072 | Ga0496102_0072072_379_1056 | 212 |
| 810 | 3300048905 | Ga0496102_0717870 | Ga0496102_0717870_137_781 | 212 |
| 811 | 3300048906 | Ga0496103_0009176 | Ga0496103_0009176_3886_4563 | 212 |
| 812 | 3300048906 | Ga0496103_0021055 | Ga0496103_0021055_1657_2295 | 212 |
| 813 | 3300048906 | Ga0496103_0034059 | Ga0496103_0034059_2104_2742 | 212 |
| 814 | 3300048909 | Ga0496106_0005315 | Ga0496106_0005315_3476_4117 | 212 |
| 815 | 3300048910 | Ga0496107_0076728 | Ga0496107_0076728_102_743 | 212 |
| 816 | 3300048911 | Ga0496108_0040462 | Ga0496108_0040462_1827_2465 | 212 |
| 817 | 3300048912 | Ga0496109_0021209 | Ga0496109_0021209_1848_2486 | 212 |
| 818 | 3300048913 | Ga0496110_0006349 | Ga0496110_0006349_3135_3773 | 212 |
| 819 | 3300048913 | Ga0496110_0050784 | Ga0496110_0050784_1377_2015 | 212 |
| 820 | 3300048915 | Ga0496112_0653524 | Ga0496112_0653524_43_681 | 212 |
| 821 | 3300048917 | Ga0496114_0001342 | Ga0496114_0001342_4925_5563 | 212 |
| 822 | 3300048917 | Ga0496114_0029253 | Ga0496114_0029253_1709_2347 | 212 |
| 823 | 3300048917 | Ga0496114_0115921 | Ga0496114_0115921_1349_1987 | 212 |
| 824 | 3300048917 | Ga0496114_0118714 | Ga0496114_0118714_825_1469 | 212 |
| 825 | 3300048918 | Ga0496115_0062650 | Ga0496115_0062650_285_923 | 212 |
| 826 | 3300048918 | Ga0496115_0227964 | Ga0496115_0227964_851_1489 | 212 |
| 827 | 3300048919 | Ga0496116_0149178 | Ga0496116_0149178_554_1192 | 212 |
| 828 | 3300048921 | Ga0496118_0144473 | Ga0496118_0144473_808_1446 | 212 |
| 829 | 3300048923 | Ga0496120_0130363 | Ga0496120_0130363_618_1256 | 212 |
| 830 | 3300048924 | Ga0496121_0003188 | Ga0496121_0003188_1702_2340 | 212 |
| 831 | 3300048924 | Ga0496121_0060430 | Ga0496121_0060430_2324_2962 | 212 |
| 832 | 3300048924 | Ga0496121_0088120 | Ga0496121_0088120_1670_2308 | 212 |
| 833 | 3300048925 | Ga0496122_0000445 | Ga0496122_0000445_23369_24007 | 212 |
| 834 | 3300048925 | Ga0496122_0000968 | Ga0496122_0000968_15159_15797 | 212 |
| 835 | 3300048925 | Ga0496122_0024024 | Ga0496122_0024024_3679_4317 | 212 |
| 836 | 3300048925 | Ga0496122_0092819 | Ga0496122_0092819_727_1365 | 212 |
| 837 | 3300048926 | Ga0496123_0004226 | Ga0496123_0004226_6609_7247 | 212 |
| 838 | 3300048926 | Ga0496123_0004825 | Ga0496123_0004825_13036_13674 | 212 |
| 839 | 3300048926 | Ga0496123_0061417 | Ga0496123_0061417_821_1459 | 212 |
| 840 | 3300048926 | Ga0496123_0087936 | Ga0496123_0087936_73_717 | 212 |
| 841 | 3300048927 | Ga0496124_0009111 | Ga0496124_0009111_4909_5547 | 212 |
| 842 | 3300048927 | Ga0496124_0041731 | Ga0496124_0041731_2286_2930 | 212 |
| 843 | 3300048927 | Ga0496124_0085319 | Ga0496124_0085319_601_1239 | 212 |
| 844 | 3300048927 | Ga0496124_0118207 | Ga0496124_0118207_948_1586 | 212 |
| 845 | 3300048927 | Ga0496124_0278419 | Ga0496124_0278419_346_984 | 212 |
| 846 | 3300048928 | Ga0496125_0004258 | Ga0496125_0004258_14331_14969 | 212 |
| 847 | 3300048929 | Ga0496126_0015414 | Ga0496126_0015414_2863_3501 | 212 |
| 848 | 3300049459 | Ga0495678_000408 | Ga0495678_000408_24359_24997 | 212 |
| 849 | 3300049459 | Ga0495678_000910 | Ga0495678_000910_14490_15158 | 212 |
| 850 | 3300049459 | Ga0495678_001706 | Ga0495678_001706_6995_7678 | 212 |
| 851 | 3300049459 | Ga0495678_001938 | Ga0495678_001938_253_891 | 212 |
| 852 | 3300049459 | Ga0495678_003948 | Ga0495678_003948_5423_6061 | 212 |
| 853 | 3300049459 | Ga0495678_005643 | Ga0495678_005643_3081_3719 | 212 |
| 854 | 3300049459 | Ga0495678_041648 | Ga0495678_041648_1113_1751 | 212 |
| 855 | 3300049459 | Ga0495678_117639 | Ga0495678_117639_112_798 | 212 |
| 856 | 3300049460 | Ga0495682_0000351 | Ga0495682_0000351_24223_24861 | 212 |
| 857 | 3300049460 | Ga0495682_0001002 | Ga0495682_0001002_4017_4655 | 212 |
| 858 | 3300049460 | Ga0495682_0010776 | Ga0495682_0010776_2723_3361 | 212 |
| 859 | 3300049460 | Ga0495682_0014757 | Ga0495682_0014757_1122_1760 | 212 |
| 860 | 3300049460 | Ga0495682_0018316 | Ga0495682_0018316_148_786 | 212 |
| 861 | 3300049460 | Ga0495682_0099491 | Ga0495682_0099491_52_720 | 212 |
| 862 | 3300049568 | Ga0501031_0004117 | Ga0501031_0004117_3796_4434 | 212 |
| 863 | 3300049568 | Ga0501031_0015053 | Ga0501031_0015053_878_1516 | 212 |
| 864 | 3300049569 | Ga0501032_0002455 | Ga0501032_0002455_3505_4143 | 212 |
| 865 | 3300049569 | Ga0501032_0013401 | Ga0501032_0013401_1385_2023 | 212 |
| 866 | 3300049570 | Ga0501033_0002230 | Ga0501033_0002230_7946_8584 | 212 |
| 867 | 3300049570 | Ga0501033_0004514 | Ga0501033_0004514_7807_8445 | 212 |
| 868 | 3300049570 | Ga0501033_0004903 | Ga0501033_0004903_7775_8413 | 212 |
| 869 | 3300049572 | Ga0501036_0009324 | Ga0501036_0009324_5560_6198 | 212 |
| 870 | 3300049572 | Ga0501036_0306886 | Ga0501036_0306886_425_1063 | 212 |
| 871 | 3300049573 | Ga0501037_0063335 | Ga0501037_0063335_341_979 | 212 |
| 872 | 3300049573 | Ga0501037_0269985 | Ga0501037_0269985_113_751 | 212 |
| 873 | 3300049574 | Ga0501038_0015899 | Ga0501038_0015899_3160_3798 | 212 |
| 874 | 3300049574 | Ga0501038_0040448 | Ga0501038_0040448_1737_2375 | 212 |
| 875 | 3300049574 | Ga0501038_0041437 | Ga0501038_0041437_213_851 | 212 |
| 876 | 3300049575 | Ga0501039_0106454 | Ga0501039_0106454_1359_1997 | 212 |
| 877 | 3300049575 | Ga0501039_0172274 | Ga0501039_0172274_876_1514 | 212 |
| 878 | 3300049576 | Ga0501040_0002743 | Ga0501040_0002743_3182_3820 | 212 |
| 879 | 3300049578 | Ga0501042_0009794 | Ga0501042_0009794_1828_2466 | 212 |
| 880 | 3300049579 | Ga0501043_0005656 | Ga0501043_0005656_2697_3335 | 212 |
| 881 | 3300049579 | Ga0501043_0007467 | Ga0501043_0007467_2376_3014 | 212 |
| 882 | 3300049579 | Ga0501043_0085602 | Ga0501043_0085602_327_965 | 212 |
| 883 | 3300049579 | Ga0501043_0321037 | Ga0501043_0321037_402_1040 | 212 |
| 884 | 3300049580 | Ga0501046_0006116 | Ga0501046_0006116_8043_8681 | 212 |
| 885 | 3300049580 | Ga0501046_0046835 | Ga0501046_0046835_1794_2432 | 212 |
| 886 | 3300049580 | Ga0501046_0509580 | Ga0501046_0509580_32_670 | 212 |
| 887 | 3300049581 | Ga0501047_0091996 | Ga0501047_0091996_341_979 | 212 |
| 888 | 3300049581 | Ga0501047_0306976 | Ga0501047_0306976_386_1024 | 212 |
| 889 | 3300049582 | Ga0501048_0030133 | Ga0501048_0030133_2952_3590 | 212 |
| 890 | 3300049584 | Ga0501068_0003678 | Ga0501068_0003678_1812_2450 | 212 |
| 891 | 3300049671 | Ga0501238_002802 | Ga0501238_002802_997_1635 | 212 |
| 892 | 3300049679 | Ga0501249_005902 | Ga0501249_005902_1168_1806 | 212 |
| 893 | 3300049766 | Ga0501269_001331 | Ga0501269_001331_912_1550 | 212 |
| 894 | 3300049822 | Ga0501035_0001124 | Ga0501035_0001124_7971_8609 | 212 |
| 895 | 3300049822 | Ga0501035_0002256 | Ga0501035_0002256_18402_19043 | 212 |
| 896 | 3300049822 | Ga0501035_0057071 | Ga0501035_0057071_1235_1873 | 212 |
| 897 | 3300049823 | Ga0501044_0010900 | Ga0501044_0010900_3810_4448 | 212 |
| 898 | 3300049823 | Ga0501044_0015152 | Ga0501044_0015152_6016_6654 | 212 |
| 899 | 3300049823 | Ga0501044_0028349 | Ga0501044_0028349_2195_2833 | 212 |
| 900 | 3300049824 | Ga0501045_0004780 | Ga0501045_0004780_1845_2483 | 212 |
| 901 | 3300050511 | nmdc:mga08y16_15265_c1 | nmdc:mga08y16_15265_c1_826_1464 | 212 |
| 902 | 3300050511 | nmdc:mga08y16_256392_c1 | nmdc:mga08y16_256392_c1_495_1133 | 212 |
| 903 | 3300053118 | Ga0500594_0008642 | Ga0500594_0008642_854_1531 | 212 |
| 904 | 3300053125 | Ga0500618_000426 | Ga0500618_000426_27538_28203 | 212 |
| 905 | 3300053125 | Ga0500618_001765 | Ga0500618_001765_4315_4953 | 212 |
| 906 | 3300053125 | Ga0500618_003076 | Ga0500618_003076_2569_3399 | 212 |
| 907 | 3300053145 | Ga0500586_001291 | Ga0500586_001291_2364_3002 | 212 |
| 908 | 3300053153 | Ga0500616_0079532 | Ga0500616_0079532_42_680 | 212 |
| 909 | 3300059490 | Ga0587066_017614 | Ga0587066_017614_320_958 | 212 |
| 910 | 3300059491 | Ga0587070_032462 | Ga0587070_032462_138_776 | 212 |
| 911 | 3300059505 | Ga0587083_0001536 | Ga0587083_0001536_1410_2054 | 212 |
| 912 | 3300059510 | Ga0587090_015677 | Ga0587090_015677_445_1083 | 212 |
| 913 | 3300059510 | Ga0587090_054793 | Ga0587090_054793_85_723 | 212 |
| 914 | 3300059511 | Ga0587091_018907 | Ga0587091_018907_488_1132 | 212 |
| 915 | 3300059512 | Ga0587092_047516 | Ga0587092_047516_68_706 | 212 |
| 916 | 3300059605 | Ga0587106_043474 | Ga0587106_043474_44_682 | 212 |
| 917 | 3300059623 | Ga0587101_007192 | Ga0587101_007192_457_1095 | 212 |
| 918 | 3300059625 | Ga0587113_004574 | Ga0587113_004574_263_970 | 212 |
| 919 | 3300059640 | Ga0587067_013242 | Ga0587067_013242_157_801 | 212 |
| 920 | 3300059641 | Ga0587068_006947 | Ga0587068_006947_535_1176 | 212 |
| 921 | 3300059646 | Ga0587078_018517 | Ga0587078_018517_175_813 | 212 |
| 922 | 3300060344 | Ga0587071_018029 | Ga0587071_018029_101_739 | 212 |
| 923 | 3300060344 | Ga0587071_045861 | Ga0587071_045861_101_739 | 212 |
| 924 | 3300061719 | Ga0466962_0109336 | Ga0466962_0109336_45_689 | 212 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7kuu-assembly1.cif.gz_B | lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form | 0.9786 | 3 | 211 |
| 7kuu-assembly1.cif.gz_B | lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form | 0.9738 | 3 | 211 |
| 6p0w-assembly1.cif.gz_A-2 | lsfa from p. aeruginosa, a 1-cys prx in reduced form | 0.9696 | 2 | 211 |
| 6p0w-assembly1.cif.gz_A-2 | lsfa from p. aeruginosa, a 1-cys prx in reduced form | 0.9649 | 2 | 211 |
| 1xcc-assembly2.cif.gz_D | 1-cys peroxidoxin from plasmodium yoelli | 0.9388 | 5 | 208 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54SE2_176_239_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9644 | 146 | 209 | 3.30.1020.10 |
| af_A0A0R0K508_6_109_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9542 | 5 | 106 | 3.40.30.10 |
| af_P34227_199_260_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.941 | 146 | 208 | 3.30.1020.10 |
| 3a2vB01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9403 | 1 | 141 | 3.40.30.10 |
| af_Q54SE2_176_239_3.30.1020.10 | Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 | 0.9357 | 146 | 209 | 3.30.1020.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H2PQ68-F1-model_v4 | Alkyl hydroperoxide reductase subunit AhpC (Peroxiredoxin) | 0.9873 | 1 | 212 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A4Q3TGA5-F1-model_v4 | Peroxidase | 0.9867 | 137 | 212 |
GO:0051920
|
| AF-A0A7Z1KZL8-F1-model_v4 | deleted | 0.9834 | 1 | 212 |
|
| AF-A0A0M2WDS2-F1-model_v4 | Selenocysteine-containing peroxiredoxin PrxU (EC 1.11.1.15) | 0.9829 | 1 | 212 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
| AF-A0A1H2PQ68-F1-model_v4 | Alkyl hydroperoxide reductase subunit AhpC (Peroxiredoxin) | 0.9827 | 1 | 212 |
GO:0005829
GO:0006979 GO:0008379 GO:0033554 GO:0042744 GO:0045454 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar