F485872

General Info

Members Datasets Scaffolds Average Seq Length
924 362 871 213

Family's Representative Sequence

Representative Sequence 3300053125|Ga0500618_003076|Ga0500618_003076_2569_3399
Length 253
Sequence MARRTGMLPSASTASRQLCGNFETALRLLGTCFPHRNKEFDMTIFLGDTAPDFEQDSSIGPLHFHEWAGDAWVVLFSHPADFTPVCTTELGLTAKLKPEFDKRHVKAVALSVDDATSHTEWIKDIEATQKTVVGFPIIADHDRKVATLYGMIHPNQSATATVRSVFIIDPKKKVRLSLTYPMSTGRNFDEILRVIDALQLTDGYSVATPGNWKDGDDVIIPLTIKDEAELKQKFPKGYKAERPYLRLTPQPNK

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
3 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
4 2643221556 Massilia sp. Root1485 Isolate Unclassified
5 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
6 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
7 2643221684 Massilia sp. Root133 Isolate Unclassified
8 2738541297 Duganella sp. GV083 Isolate Unclassified
9 2738541357 Duganella sp. GV053 Isolate Unclassified
10 2738543003 Duganella sp. GV066 Isolate Unclassified
11 2738543026 Duganella sp. GV089 Isolate Unclassified
12 2738543029 Duganella sp. GV039 Isolate Unclassified
13 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
14 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
15 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
16 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
17 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
18 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
19 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
20 2821131069 Duganella sp. 1224 Isolate Unclassified
21 2831426010 Nostoc sp. 106C Isolate Unclassified
22 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
23 2842677519 Variovorax sp. R-72495 Isolate Unclassified
24 2842711865 Duganella sp. R-73148 Isolate Unclassified
25 2842747753 Variovorax sp. R-72060 Isolate Unclassified
26 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
27 2849660919 Nostoc sp. T09 Isolate Unclassified
28 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
29 2857558681 Duganella sp. R-74565 Isolate Unclassified
30 2857564685 Duganella sp. R-74599 Isolate Unclassified
31 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
32 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
33 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
34 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
35 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
36 2904424332 Duganella sp. 1411 Isolate Rhizosphere
37 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
38 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
39 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
40 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
41 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
42 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
43 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
44 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
45 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
46 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
47 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
48 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
49 2929520902 Variovorax beijingensis 502 Isolate Unclassified
50 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
51 2952252522 Salinicola sp. DM10 Isolate Unclassified
52 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
53 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
54 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
55 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
56 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
57 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
58 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
59 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
60 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
61 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
62 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
63 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
64 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
65 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
66 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
68 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
69 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
70 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
71 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
72 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
73 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
74 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
75 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
76 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
77 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
78 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
79 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
80 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
81 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
82 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
83 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
84 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
85 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
86 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
87 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
88 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
89 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
90 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
91 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
92 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
93 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
94 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
95 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
96 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
97 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
98 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
99 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
100 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
101 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
102 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
103 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
104 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
105 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
106 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
109 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
110 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
111 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
112 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
128 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
130 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
131 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
132 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
138 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
140 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
141 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
142 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
145 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
149 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
153 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
180 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
183 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
184 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
185 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
186 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
197 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
198 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
199 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
200 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
201 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
202 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
203 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
204 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
205 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
206 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
207 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
208 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
211 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
212 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
213 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
218 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
221 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
224 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
225 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
226 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
227 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
228 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
229 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
230 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
231 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
232 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
233 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
234 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
235 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
236 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
237 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
238 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
239 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
240 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
241 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
242 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
243 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
244 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
245 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
246 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
247 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
248 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
249 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
250 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
251 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
252 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
253 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
254 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
255 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
256 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
257 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
258 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
259 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
260 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
261 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
262 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
263 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
264 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
265 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
266 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
267 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
268 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
269 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
270 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
271 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
272 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
273 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
274 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
275 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
276 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
277 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
278 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
279 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
280 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
281 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
282 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
283 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
284 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
285 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
286 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
287 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
288 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
289 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
290 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
291 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
292 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
293 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
294 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
295 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
296 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
297 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
298 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
299 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
300 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
301 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
302 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
303 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
304 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
305 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
306 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
307 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
308 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
309 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
310 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
311 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
312 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
313 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
314 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
315 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
316 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
317 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
318 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
319 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
320 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
321 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
322 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
323 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
337 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
338 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
339 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
340 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
343 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
344 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
345 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
346 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
347 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
348 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
362 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.88
Metatranscriptomes 2.38
Isolates 5.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.93
Nodule 0.65
Rhizoplane 2.49
Rhizosphere 81.6
Stem 0
Stem Tuber 0
Unclassified 8.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000170 3300002704 Bacteria 28479
2 JGI25155J39150_1000318 3300002704 Bacteria 16164
3 JGI25156J39149_1000293 3300002705 Bacteria 33788
4 JGI25156J39149_1001177 3300002705 Bacteria 11650
5 JGI25162J39368_1004661 3300002737 Bacteria 3072
6 JGI25154J39366_1000260 3300002738 Bacteria 33788
7 JGI25154J39366_1000267 3300002738 Bacteria 32817
8 JGI25154J39366_1000581 3300002738 Bacteria 17734
9 JGI25157J39369_1000327 3300002741 Bacteria 33804
10 JGI25150J39212_1005529 3300002774 Bacteria 2688
11 JGI25150J39212_1012921 3300002774 Bacteria 1461
12 JGI25159J45721_1003120 3300002987 Bacteria 5970
13 JGI25151J46595_10035960 3300003187 Bacteria 1874
14 JGI25153J46596_10009537 3300003215 Bacteria 4495
15 Ga0007417J51691_1076888 3300003544 Bacteria 852
16 Ga0007410J51695_1013512 3300003574 Bacteria 910
17 Ga0007409J51694_1005946 3300003575 Bacteria 3452
18 Ga0007409J51694_1006985 3300003575 Bacteria 1017
19 Ga0007416J51690_1007671 3300003577 Bacteria 1268
20 Ga0032354_1018852 3300003693 Bacteria 1041
21 Ga0055538_1000138 3300003751 Bacteria 51369
22 Ga0055539_1000187 3300003752 Bacteria 51369
23 Ga0055533_1000189 3300003756 Bacteria 51369
24 Ga0055532_1000184 3300003758 Bacteria 52595
25 Ga0055525_1000133 3300003759 Bacteria 109627
26 Ga0055525_1000254 3300003759 Bacteria 51369
27 Ga0055535_1009076 3300003761 Bacteria 1740
28 Ga0055529_1000154 3300003763 Bacteria 94292
29 Ga0055526_1000237 3300003771 Bacteria 46547
30 Ga0055526_1000525 3300003771 Bacteria 30396
31 Ga0055537_1000111 3300003773 Bacteria 61884
32 Ga0055537_1014742 3300003773 Bacteria 1404
33 Ga0055524_1000015 3300003775 Bacteria 246493
34 Ga0055524_1004885 3300003775 Bacteria 6089
35 Ga0055524_1008329 3300003775 Bacteria 4314
36 Ga0055534_1000509 3300003784 Bacteria 21144
37 Ga0055534_1001874 3300003784 Bacteria 7802
38 Ga0055528_1000178 3300003790 Bacteria 53709
39 Ga0055541_1000122 3300003841 Bacteria 51369
40 Ga0055543_1002600 3300004625 Bacteria 5838
41 Ga0065165_1000286 3300005262 Bacteria 85993
42 Ga0065165_1000465 3300005262 Bacteria 63558
43 Ga0065165_1092670 3300005262 Bacteria 767
44 Ga0065712_10165081 3300005290 Bacteria 1277
45 Ga0065715_10228053 3300005293 Bacteria 1245
46 Ga0070658_10825019 3300005327 Bacteria 806
47 Ga0070670_100013536 3300005331 Bacteria 6991
48 Ga0070670_100019310 3300005331 Bacteria 5847
49 Ga0068869_100100111 3300005334 Bacteria 2191
50 Ga0070682_100001863 3300005337 Bacteria 11766
51 Ga0070682_100143786 3300005337 Bacteria 1629
52 Ga0070660_100001978 3300005339 Bacteria 14153
53 Ga0070660_100056850 3300005339 Bacteria 3028
54 Ga0070660_100102515 3300005339 Bacteria 2268
55 Ga0070661_100122751 3300005344 Bacteria 1946
56 Ga0070661_100126061 3300005344 Bacteria 1921
57 Ga0070688_100204107 3300005365 Bacteria 1384
58 Ga0070659_100001966 3300005366 Bacteria 14673
59 Ga0070659_100327545 3300005366 Bacteria 1281
60 Ga0070713_100664514 3300005436 Bacteria 993
61 Ga0070701_10204655 3300005438 Bacteria 1168
62 Ga0070663_100508761 3300005455 Bacteria 1001
63 Ga0070662_100115694 3300005457 Bacteria 2049
64 Ga0070662_100356682 3300005457 Bacteria 1199
65 Ga0068867_100043831 3300005459 Bacteria 3276
66 Ga0068867_101096594 3300005459 Bacteria 727
67 Ga0070685_10199875 3300005466 Bacteria 1298
68 Ga0068855_100002390 3300005563 Bacteria 23146
69 Ga0068855_100008403 3300005563 Bacteria 12484
70 Ga0068855_100205705 3300005563 Bacteria 2214
71 Ga0070664_100031977 3300005564 Bacteria 4401
72 Ga0070664_100153990 3300005564 Bacteria 2030
73 Ga0068857_100106766 3300005577 Bacteria 2514
74 Ga0068857_100149585 3300005577 Bacteria 2115
75 Ga0068857_100843308 3300005577 Bacteria 877
76 Ga0068854_100020109 3300005578 Bacteria 4510
77 Ga0070702_100403005 3300005615 Bacteria 979
78 Ga0068852_100014663 3300005616 Bacteria 6044
79 Ga0068859_100074769 3300005617 Bacteria 3427
80 Ga0068851_10100841 3300005834 Bacteria 1532
81 Ga0068851_10160807 3300005834 Bacteria 1233
82 Ga0068871_100133073 3300006358 Bacteria 2110
83 Ga0097620_100074766 3300006931 Bacteria 3427
84 Ga0079104_1005980 3300006946 Bacteria 4718
85 Ga0099826_10000003 3300006948 Bacteria 1067817
86 Ga0105244_10002912 3300009036 Bacteria 12642
87 Ga0105244_10013090 3300009036 Bacteria 4864
88 Ga0105244_10028026 3300009036 Bacteria 3027
89 Ga0105240_10018441 3300009093 Bacteria 9369
90 Ga0105240_10069027 3300009093 Bacteria 4376
91 Ga0105240_10159307 3300009093 Bacteria 2683
92 Ga0105240_10763176 3300009093 Bacteria 1050
93 Ga0105240_11032630 3300009093 Bacteria 878
94 Ga0111539_10016114 3300009094 Bacteria 9274
95 Ga0105243_10020624 3300009148 Bacteria 4997
96 Ga0105241_10227329 3300009174 Bacteria 1571
97 Ga0105242_10116936 3300009176 Bacteria 2282
98 Ga0105237_10006499 3300009545 Bacteria 12955
99 Ga0105237_10304152 3300009545 Bacteria 1598
100 Ga0105238_10000255 3300009551 Bacteria 59531
101 Ga0105238_10053531 3300009551 Bacteria 4055
102 Ga0105239_10001561 3300010375 Bacteria 30314
103 Ga0105239_10231888 3300010375 Bacteria 2071
104 Ga0105239_10330143 3300010375 Bacteria 1720
105 Ga0157373_10092631 3300013100 Bacteria 2128
106 Ga0157373_10129519 3300013100 Bacteria 1774
107 Ga0157370_10007558 3300013104 Bacteria 11806
108 Ga0157372_10416221 3300013307 Bacteria 1566
109 Ga0157372_10817923 3300013307 Bacteria 1082
110 Ga0157375_10280728 3300013308 Bacteria 1828
111 Ga0157375_10615177 3300013308 Bacteria 1245
112 Ga0157380_10047811 3300014326 Bacteria 3367
113 Ga0182008_10013109 3300014497 Bacteria 4360
114 Ga0182008_10180962 3300014497 Bacteria 1067
115 Ga0157377_10256914 3300014745 Bacteria 1135
116 Ga0157376_10480967 3300014969 Bacteria 1217
117 Ga0157376_10661087 3300014969 Bacteria 1046
118 Ga0182006_1019052 3300015261 Bacteria 2894
119 Ga0206356_11570456 3300020070 Bacteria 803
120 Ga0213872_10000002 3300021361 Bacteria 554092
121 Ga0213872_10000307 3300021361 Bacteria 41810
122 Ga0213872_10000427 3300021361 Bacteria 34434
123 Ga0213872_10000920 3300021361 Bacteria 20894
124 Ga0213872_10005167 3300021361 Bacteria 6757
125 Ga0213872_10011283 3300021361 Bacteria 4231
126 Ga0213872_10022797 3300021361 Bacteria 2880
127 Ga0209435_100079 3300025206 Bacteria 51612
128 Ga0209435_100137 3300025206 Bacteria 24597
129 Ga0209436_110345 3300025208 Bacteria 1713
130 Ga0209784_100035 3300025224 Bacteria 299760
131 Ga0209566_100040 3300025225 Bacteria 299760
132 Ga0209674_100057 3300025226 Bacteria 299760
133 Ga0209147_100060 3300025229 Bacteria 249588
134 Ga0209563_100015 3300025230 Bacteria 879901
135 Ga0209563_100059 3300025230 Bacteria 299760
136 Ga0209437_100081 3300025233 Bacteria 271072
137 Ga0209437_111330 3300025233 Bacteria 1334
138 Ga0209258_100141 3300025242 Bacteria 166385
139 Ga0207425_1000551 3300025245 Bacteria 22377
140 Ga0209646_1000028 3300025246 Bacteria 387986
141 Ga0209646_1000265 3300025246 Bacteria 50897
142 Ga0209646_1000290 3300025246 Bacteria 42743
143 Ga0209026_1000330 3300025250 Bacteria 47453
144 Ga0209026_1002521 3300025250 Bacteria 6784
145 Ga0209677_100036 3300025253 Bacteria 299760
146 Ga0209677_101095 3300025253 Bacteria 12720
147 Ga0209148_1000765 3300025254 Bacteria 24494
148 Ga0209759_1000473 3300025256 Bacteria 44908
149 Ga0209759_1000485 3300025256 Bacteria 43802
150 Ga0209565_1000009 3300025263 Bacteria 751701
151 Ga0209455_1000049 3300025272 Bacteria 374414
152 Ga0209673_1000036 3300025273 Bacteria 323162
153 Ga0209130_1000044 3300025284 Bacteria 241110
154 Ga0209675_1000013 3300025291 Bacteria 448220
155 Ga0209675_1011303 3300025291 Bacteria 2971
156 Ga0209025_1012300 3300025294 Bacteria 5507
157 Ga0209564_1000006 3300025295 Bacteria 1100927
158 Ga0209564_1000038 3300025295 Bacteria 414357
159 Ga0209564_1000122 3300025295 Bacteria 203709
160 Ga0209564_1002158 3300025295 Bacteria 16591
161 Ga0209564_1068754 3300025295 Bacteria 748
162 Ga0209758_1000149 3300025297 Bacteria 163504
163 Ga0209256_1000005 3300025299 Bacteria 1315082
164 Ga0209256_1000106 3300025299 Bacteria 187258
165 Ga0207655_1012507 3300025728 Bacteria 4953
166 Ga0207655_1059957 3300025728 Bacteria 1477
167 Ga0207713_1016732 3300025735 Bacteria 3711
168 Ga0207705_10034934 3300025909 Bacteria 3596
169 Ga0207705_10331377 3300025909 Bacteria 1171
170 Ga0207705_10934439 3300025909 Bacteria 671
171 Ga0207654_10282684 3300025911 Bacteria 1123
172 Ga0207707_10607648 3300025912 Bacteria 925
173 Ga0207695_10001345 3300025913 Bacteria 41663
174 Ga0207695_10003241 3300025913 Bacteria 23170
175 Ga0207695_10052058 3300025913 Bacteria 4292
176 Ga0207695_10080349 3300025913 Bacteria 3302
177 Ga0207671_10001558 3300025914 Bacteria 26243
178 Ga0207657_10001495 3300025919 Bacteria 25015
179 Ga0207657_10032958 3300025919 Bacteria 4674
180 Ga0207649_10005902 3300025920 Bacteria 6639
181 Ga0207649_10065752 3300025920 Bacteria 2296
182 Ga0207652_10762404 3300025921 Bacteria 861
183 Ga0207694_10000193 3300025924 Bacteria 61887
184 Ga0207694_10166653 3300025924 Bacteria 1782
185 Ga0207650_10009675 3300025925 Bacteria 6590
186 Ga0207690_10009202 3300025932 Bacteria 5864
187 Ga0207690_10019554 3300025932 Bacteria 4173
188 Ga0207690_10021347 3300025932 Bacteria 4014
189 Ga0207706_10043384 3300025933 Bacteria 3985
190 Ga0207706_10046776 3300025933 Bacteria 3830
191 Ga0207686_10007659 3300025934 Bacteria 5819
192 Ga0207686_10247933 3300025934 Bacteria 1300
193 Ga0207669_10136358 3300025937 Bacteria 1696
194 Ga0207704_10072307 3300025938 Bacteria 2192
195 Ga0207679_10016387 3300025945 Bacteria 4921
196 Ga0207679_10044089 3300025945 Bacteria 3216
197 Ga0207667_10000543 3300025949 Bacteria 49789
198 Ga0207667_10000946 3300025949 Bacteria 37051
199 Ga0207667_10010647 3300025949 Bacteria 10734
200 Ga0207667_10023494 3300025949 Bacteria 6788
201 Ga0207667_10908222 3300025949 Bacteria 872
202 Ga0207640_10031586 3300025981 Bacteria 3274
203 Ga0207678_10422718 3300026067 Bacteria 1156
204 Ga0207708_10081624 3300026075 Bacteria 2485
205 Ga0207648_10121752 3300026089 Bacteria 2294
206 Ga0207648_10364738 3300026089 Bacteria 1304
207 Ga0207674_10062454 3300026116 Bacteria 3763
208 Ga0207674_10200977 3300026116 Bacteria 1942
209 Ga0207698_10099486 3300026142 Bacteria 2406
210 Ga0209281_1005655 3300027111 Bacteria 3419
211 Ga0209282_1000002 3300027666 Bacteria 1067825
212 Ga0207428_10145539 3300027907 Bacteria 1806
213 Ga0207428_10192088 3300027907 Bacteria 1539
214 Ga0316177_1181113 3300030731 Bacteria 4703
215 Ga0316178_1151420 3300030735 Bacteria 1426
216 Ga0316180_1113945 3300030736 Bacteria 2146
217 Ga0316182_1150052 3300030745 Bacteria 3178
218 Ga0307518_10008072 3300031838 Bacteria 7520
219 Ga0307409_100781846 3300031995 Bacteria 961
220 Ga0307416_100010843 3300032002 Bacteria 6042
221 Ga0307416_101069069 3300032002 Bacteria 911
222 Ga0307415_100328697 3300032126 Bacteria 1278
223 Ga0373937_0100910 3300036401 Bacteria 2678
224 Ga0373937_0336745 3300036401 Bacteria 1429
225 Ga0395899_0000206 3300037312 Bacteria 86263
226 Ga0395899_0001430 3300037312 Bacteria 20417
227 Ga0395899_0002882 3300037312 Bacteria 13815
228 Ga0395899_0029111 3300037312 Bacteria 4153
229 Ga0395899_0039029 3300037312 Bacteria 3555
230 Ga0395899_0046977 3300037312 Bacteria 3214
231 Ga0395899_0201294 3300037312 Bacteria 1388
232 Ga0395899_0231229 3300037312 Bacteria 1276
233 Ga0395900_0000298 3300037418 Bacteria 74295
234 Ga0395900_0001764 3300037418 Bacteria 24841
235 Ga0395900_0005739 3300037418 Bacteria 12975
236 Ga0395900_0010058 3300037418 Bacteria 9676
237 Ga0395900_0022527 3300037418 Bacteria 6445
238 Ga0395900_0076138 3300037418 Bacteria 3449
239 Ga0395900_0080048 3300037418 Bacteria 3357
240 Ga0395900_0217065 3300037418 Bacteria 1929
241 Ga0395900_0279577 3300037418 Bacteria 1661
242 Ga0395900_0498390 3300037418 Bacteria 1168
243 Ga0395900_0525120 3300037418 Bacteria 1131
244 Ga0395900_0529413 3300037418 Bacteria 1125
245 Ga0395900_0572269 3300037418 Bacteria 1072
246 Ga0395900_0578093 3300037418 Bacteria 1065
247 Ga0395900_0868983 3300037418 Bacteria 826
248 Ga0395898_0006001 3300037466 Bacteria 13041
249 Ga0395898_0082226 3300037466 Bacteria 3104
250 Ga0395898_0097732 3300037466 Bacteria 2820
251 Ga0395898_0358522 3300037466 Bacteria 1390
252 Ga0395898_0535902 3300037466 Bacteria 1112
253 Ga0395898_0568060 3300037466 Bacteria 1077
254 Ga0395905_0000549 3300037471 Bacteria 51321
255 Ga0395905_0001839 3300037471 Bacteria 24502
256 Ga0395905_0006051 3300037471 Bacteria 12254
257 Ga0395905_0057719 3300037471 Bacteria 3630
258 Ga0395905_0118515 3300037471 Bacteria 2488
259 Ga0395905_0154863 3300037471 Bacteria 2155
260 Ga0395905_0304307 3300037471 Bacteria 1482
261 Ga0395905_0312296 3300037471 Bacteria 1460
262 Ga0395905_0495067 3300037471 Bacteria 1122
263 Ga0395901_0000508 3300038443 Bacteria 45081
264 Ga0395901_0001421 3300038443 Bacteria 24983
265 Ga0395901_0010350 3300038443 Bacteria 9447
266 Ga0395901_0056215 3300038443 Bacteria 4093
267 Ga0395901_0078091 3300038443 Bacteria 3456
268 Ga0395901_0263518 3300038443 Bacteria 1793
269 Ga0395901_0408517 3300038443 Bacteria 1394
270 Ga0395901_0436655 3300038443 Bacteria 1341
271 Ga0395901_0914796 3300038443 Bacteria 858
272 Ga0400483_114212 3300039062 Bacteria 1521
273 Ga0436361_0376382 3300039447 Bacteria 68820
274 Ga0436361_0391791 3300039447 Bacteria 42494
275 Ga0436361_0684212 3300039447 Bacteria 74853
276 Ga0436361_0733741 3300039447 Bacteria 8972
277 Ga0436361_0868581 3300039447 Bacteria 2610
278 Ga0436361_1016700 3300039447 Bacteria 56598
279 Ga0436361_1196357 3300039447 Bacteria 10171
280 Ga0451843_1115385 3300041509 Bacteria 1120
281 Ga0439448_0006029 3300042005 Bacteria 3472
282 Ga0439449_0072104 3300042007 Bacteria 1272
283 Ga0439455_0012451 3300042012 Bacteria 1910
284 Ga0439455_0016438 3300042012 Bacteria 1711
285 Ga0439462_0034206 3300042015 Bacteria 1349
286 Ga0450904_001033 3300042139 Bacteria 4298
287 Ga0439458_0032026 3300042157 Bacteria 1255
288 Ga0451577_0007665 3300042876 Bacteria 10586
289 Ga0466969_0060342 3300044656 Bacteria 1843
290 Ga0466972_0000140 3300044658 Bacteria 59505
291 Ga0466972_0017423 3300044658 Bacteria 3595
292 Ga0466965_0000818 3300044683 Bacteria 11733
293 Ga0466965_0003643 3300044683 Bacteria 6788
294 Ga0466965_0033185 3300044683 Bacteria 2522
295 Ga0466965_0040322 3300044683 Bacteria 2298
296 Ga0466966_0057925 3300044684 Bacteria 2449
297 Ga0466966_0060141 3300044684 Bacteria 2398
298 Ga0466966_0112953 3300044684 Bacteria 1673
299 Ga0466964_0000639 3300044706 Bacteria 11159
300 Ga0466964_0002253 3300044706 Bacteria 6836
301 Ga0466971_0052891 3300044719 Bacteria 1829
302 Ga0466968_0018171 3300044735 Bacteria 2818
303 Ga0466968_0032940 3300044735 Bacteria 2157
304 Ga0466970_0031711 3300044765 Bacteria 2791
305 Ga0466957_0003058 3300044842 Bacteria 9098
306 Ga0466957_0106118 3300044842 Bacteria 1776
307 Ga0466957_0114944 3300044842 Bacteria 1710
308 Ga0466957_0127004 3300044842 Bacteria 1630
309 Ga0466959_0085374 3300045049 Bacteria 2271
310 Ga0466959_0140467 3300045049 Bacteria 1707
311 Ga0466967_0059609 3300045976 Bacteria 3379
312 Ga0495617_000002 3300046452 Bacteria 710121
313 Ga0495617_000574 3300046452 Bacteria 18841
314 Ga0495627_000350 3300046453 Bacteria 43486
315 Ga0495603_0143924 3300046455 Bacteria 1386
316 Ga0495590_0000025 3300046457 Bacteria 165221
317 Ga0495590_0000052 3300046457 Bacteria 103480
318 Ga0495590_0003125 3300046457 Bacteria 6772
319 Ga0495590_0035970 3300046457 Bacteria 1728
320 Ga0495591_000290 3300046458 Bacteria 46499
321 Ga0495629_0018934 3300046459 Bacteria 4923
322 Ga0495629_0022874 3300046459 Bacteria 4454
323 Ga0495638_0000066 3300046460 Bacteria 168673
324 Ga0495638_0007197 3300046460 Bacteria 8006
325 Ga0495638_0034164 3300046460 Bacteria 3247
326 Ga0495638_0055994 3300046460 Bacteria 2447
327 Ga0495653_0000011 3300046463 Bacteria 272314
328 Ga0495653_0005660 3300046463 Bacteria 10202
329 Ga0495653_0008945 3300046463 Bacteria 8188
330 Ga0495653_0034471 3300046463 Bacteria 4004
331 Ga0495650_0000015 3300046471 Bacteria 557595
332 Ga0495650_0000506 3300046471 Bacteria 58187
333 Ga0495650_0000567 3300046471 Bacteria 51961
334 Ga0495650_0000694 3300046471 Bacteria 43425
335 Ga0495650_0000716 3300046471 Bacteria 42283
336 Ga0495650_0000721 3300046471 Bacteria 41918
337 Ga0495650_0012095 3300046471 Bacteria 4667
338 Ga0495650_0012906 3300046471 Bacteria 4460
339 Ga0495650_0115113 3300046471 Bacteria 994
340 Ga0495580_0003141 3300046472 Bacteria 14151
341 Ga0495580_0098195 3300046472 Bacteria 2037
342 Ga0495582_0025473 3300046473 Bacteria 3240
343 Ga0495582_0028174 3300046473 Bacteria 3082
344 Ga0495582_0067515 3300046473 Bacteria 1976
345 Ga0495605_0000003 3300046474 Bacteria 491502
346 Ga0495605_0000034 3300046474 Bacteria 208277
347 Ga0495605_0000474 3300046474 Bacteria 35493
348 Ga0495605_0030905 3300046474 Bacteria 2740
349 Ga0495605_0039401 3300046474 Bacteria 2367
350 Ga0495605_0081458 3300046474 Bacteria 1513
351 Ga0495605_0085899 3300046474 Bacteria 1464
352 Ga0495639_0011637 3300046475 Bacteria 3795
353 Ga0495639_0395440 3300046475 Bacteria 698
354 Ga0495584_0000017 3300046491 Bacteria 149686
355 Ga0495584_0004259 3300046491 Bacteria 7712
356 Ga0495584_0010891 3300046491 Bacteria 4667
357 Ga0495584_0027048 3300046491 Bacteria 2906
358 Ga0495584_0027755 3300046491 Bacteria 2868
359 Ga0495584_0032084 3300046491 Bacteria 2659
360 Ga0495584_0051362 3300046491 Bacteria 2076
361 Ga0495584_0071811 3300046491 Bacteria 1739
362 Ga0495584_0076705 3300046491 Bacteria 1681
363 Ga0495584_0185813 3300046491 Bacteria 1056
364 Ga0495584_0242058 3300046491 Bacteria 917
365 Ga0495585_0000006 3300046492 Bacteria 320556
366 Ga0495585_0000064 3300046492 Bacteria 109302
367 Ga0495585_0002287 3300046492 Bacteria 13818
368 Ga0495585_0002576 3300046492 Bacteria 12824
369 Ga0495585_0003985 3300046492 Bacteria 9734
370 Ga0495585_0004342 3300046492 Bacteria 9218
371 Ga0495585_0004490 3300046492 Bacteria 9036
372 Ga0495585_0005798 3300046492 Bacteria 7745
373 Ga0495585_0014043 3300046492 Bacteria 4676
374 Ga0495585_0047820 3300046492 Bacteria 2380
375 Ga0495585_0048409 3300046492 Bacteria 2363
376 Ga0495585_0062085 3300046492 Bacteria 2052
377 Ga0495585_0079079 3300046492 Bacteria 1783
378 Ga0495585_0278465 3300046492 Bacteria 827
379 Ga0495594_0010545 3300046499 Bacteria 4792
380 Ga0495594_0013970 3300046499 Bacteria 4203
381 Ga0495594_0032405 3300046499 Bacteria 2836
382 Ga0495594_0072625 3300046499 Bacteria 1914
383 Ga0495596_0000550 3300046500 Bacteria 23486
384 Ga0495596_0002227 3300046500 Bacteria 10557
385 Ga0495596_0004778 3300046500 Bacteria 6519
386 Ga0495596_0008875 3300046500 Bacteria 4449
387 Ga0495596_0009006 3300046500 Bacteria 4412
388 Ga0495596_0017447 3300046500 Bacteria 2970
389 Ga0495596_0021491 3300046500 Bacteria 2633
390 Ga0495596_0025031 3300046500 Bacteria 2414
391 Ga0495596_0096228 3300046500 Bacteria 1149
392 Ga0495607_0002172 3300046501 Bacteria 16311
393 Ga0495607_0003491 3300046501 Bacteria 12031
394 Ga0495607_0006380 3300046501 Bacteria 8303
395 Ga0495607_0007438 3300046501 Bacteria 7578
396 Ga0495607_0008285 3300046501 Bacteria 7110
397 Ga0495607_0018387 3300046501 Bacteria 4456
398 Ga0495607_0023637 3300046501 Bacteria 3844
399 Ga0495607_0032412 3300046501 Bacteria 3189
400 Ga0495607_0043236 3300046501 Bacteria 2666
401 Ga0495607_0052835 3300046501 Bacteria 2351
402 Ga0495583_0000056 3300046506 Bacteria 200858
403 Ga0495583_0000320 3300046506 Bacteria 76050
404 Ga0495583_0000344 3300046506 Bacteria 73346
405 Ga0495583_0000808 3300046506 Bacteria 38650
406 Ga0495583_0000864 3300046506 Bacteria 36820
407 Ga0495583_0002451 3300046506 Bacteria 15840
408 Ga0495583_0004193 3300046506 Bacteria 10496
409 Ga0495583_0004206 3300046506 Bacteria 10477
410 Ga0495583_0025151 3300046506 Bacteria 2979
411 Ga0495583_0026117 3300046506 Bacteria 2902
412 Ga0495583_0028021 3300046506 Bacteria 2774
413 Ga0495583_0061266 3300046506 Bacteria 1679
414 Ga0495583_0087270 3300046506 Bacteria 1348
415 Ga0495583_0127193 3300046506 Bacteria 1068
416 Ga0495583_0138663 3300046506 Bacteria 1014
417 Ga0495606_0000024 3300046507 Bacteria 262080
418 Ga0495606_0000043 3300046507 Bacteria 214367
419 Ga0495606_0000920 3300046507 Bacteria 43445
420 Ga0495606_0001616 3300046507 Bacteria 29393
421 Ga0495606_0003205 3300046507 Bacteria 17641
422 Ga0495606_0003670 3300046507 Bacteria 16079
423 Ga0495606_0003817 3300046507 Bacteria 15629
424 Ga0495606_0008549 3300046507 Bacteria 8864
425 Ga0495606_0014675 3300046507 Bacteria 6093
426 Ga0495606_0035706 3300046507 Bacteria 3395
427 Ga0495606_0041147 3300046507 Bacteria 3101
428 Ga0495606_0139429 3300046507 Bacteria 1433
429 Ga0495606_0251134 3300046507 Bacteria 981
430 Ga0495610_0000004 3300046512 Bacteria 1006135
431 Ga0495610_0000613 3300046512 Bacteria 35266
432 Ga0495610_0005202 3300046512 Bacteria 9318
433 Ga0495616_0000057 3300046513 Bacteria 100806
434 Ga0495616_0000727 3300046513 Bacteria 24274
435 Ga0495616_0000765 3300046513 Bacteria 23498
436 Ga0495616_0001904 3300046513 Bacteria 14071
437 Ga0495616_0003367 3300046513 Bacteria 10258
438 Ga0495616_0009006 3300046513 Bacteria 5862
439 Ga0495616_0010979 3300046513 Bacteria 5213
440 Ga0495616_0013917 3300046513 Bacteria 4520
441 Ga0495616_0017895 3300046513 Bacteria 3904
442 Ga0495616_0018263 3300046513 Bacteria 3851
443 Ga0495616_0036374 3300046513 Bacteria 2540
444 Ga0495616_0037678 3300046513 Bacteria 2486
445 Ga0495616_0172725 3300046513 Bacteria 965
446 Ga0495630_0495929 3300046517 Bacteria 936
447 Ga0495631_0000703 3300046518 Bacteria 21624
448 Ga0495631_0001517 3300046518 Bacteria 14006
449 Ga0495631_0003602 3300046518 Bacteria 8449
450 Ga0495631_0003814 3300046518 Bacteria 8184
451 Ga0495631_0015024 3300046518 Bacteria 3721
452 Ga0495631_0015692 3300046518 Bacteria 3624
453 Ga0495631_0032249 3300046518 Bacteria 2363
454 Ga0495631_0051375 3300046518 Bacteria 1801
455 Ga0495631_0073157 3300046518 Bacteria 1480
456 Ga0495631_0130349 3300046518 Bacteria 1080
457 Ga0495632_0000077 3300046519 Bacteria 100834
458 Ga0495632_0001081 3300046519 Bacteria 23373
459 Ga0495632_0004490 3300046519 Bacteria 9462
460 Ga0495632_0222471 3300046519 Bacteria 853
461 Ga0495637_0000126 3300046520 Bacteria 57018
462 Ga0495637_0000327 3300046520 Bacteria 36965
463 Ga0495637_0006099 3300046520 Bacteria 6069
464 Ga0495637_0013723 3300046520 Bacteria 3841
465 Ga0495637_0027938 3300046520 Bacteria 2521
466 Ga0495637_0031293 3300046520 Bacteria 2355
467 Ga0495643_0000415 3300046522 Bacteria 55824
468 Ga0495643_0000747 3300046522 Bacteria 36826
469 Ga0495643_0001870 3300046522 Bacteria 17847
470 Ga0495643_0002987 3300046522 Bacteria 12778
471 Ga0495643_0041150 3300046522 Bacteria 2520
472 Ga0495643_0224312 3300046522 Bacteria 889
473 Ga0495644_0003414 3300046523 Bacteria 6285
474 Ga0495644_0006881 3300046523 Bacteria 4401
475 Ga0495644_0010124 3300046523 Bacteria 3633
476 Ga0495644_0017512 3300046523 Bacteria 2738
477 Ga0495644_0019139 3300046523 Bacteria 2614
478 Ga0495644_0052584 3300046523 Bacteria 1529
479 Ga0495648_0000007 3300046524 Bacteria 347305
480 Ga0495648_0000045 3300046524 Bacteria 172587
481 Ga0495648_0000534 3300046524 Bacteria 40983
482 Ga0495648_0000708 3300046524 Bacteria 35539
483 Ga0495648_0002581 3300046524 Bacteria 16591
484 Ga0495648_0008428 3300046524 Bacteria 8112
485 Ga0495648_0024977 3300046524 Bacteria 4055
486 Ga0495648_0054248 3300046524 Bacteria 2422
487 Ga0495663_0011742 3300046525 Bacteria 2439
488 Ga0495666_0000738 3300046526 Bacteria 15006
489 Ga0495666_0003203 3300046526 Bacteria 8238
490 Ga0495666_0043989 3300046526 Bacteria 2156
491 Ga0495642_0000422 3300046528 Bacteria 22466
492 Ga0495642_0000749 3300046528 Bacteria 16028
493 Ga0495642_0006403 3300046528 Bacteria 4515
494 Ga0495642_0017514 3300046528 Bacteria 2799
495 Ga0495642_0020988 3300046528 Bacteria 2567
496 Ga0495642_0033497 3300046528 Bacteria 2065
497 Ga0495642_0044315 3300046528 Bacteria 1815
498 Ga0495652_0020998 3300046529 Bacteria 5804
499 Ga0495654_0000004 3300046530 Bacteria 515304
500 Ga0495654_0005449 3300046530 Bacteria 7387
501 Ga0495654_0058694 3300046530 Bacteria 1855
502 Ga0495654_0103500 3300046530 Bacteria 1307
503 Ga0495665_0006321 3300046531 Bacteria 6391
504 Ga0495665_0028275 3300046531 Bacteria 3006
505 Ga0495665_0174738 3300046531 Bacteria 1117
506 Ga0495586_0010284 3300046535 Bacteria 4976
507 Ga0495586_0038439 3300046535 Bacteria 2570
508 Ga0495586_0075084 3300046535 Bacteria 1850
509 Ga0495586_0108725 3300046535 Bacteria 1542
510 Ga0495586_0170259 3300046535 Bacteria 1231
511 Ga0495587_0020480 3300046536 Bacteria 4082
512 Ga0495587_0065793 3300046536 Bacteria 2115
513 Ga0495609_0000002 3300046538 Bacteria 739816
514 Ga0495609_0000433 3300046538 Bacteria 34767
515 Ga0495609_0010208 3300046538 Bacteria 4512
516 Ga0495609_0013379 3300046538 Bacteria 3876
517 Ga0495609_0015171 3300046538 Bacteria 3610
518 Ga0495609_0020581 3300046538 Bacteria 3047
519 Ga0495609_0022531 3300046538 Bacteria 2900
520 Ga0495609_0029689 3300046538 Bacteria 2488
521 Ga0495609_0072718 3300046538 Bacteria 1509
522 Ga0495609_0126132 3300046538 Bacteria 1098
523 Ga0495597_0000523 3300046542 Bacteria 31819
524 Ga0495597_0001053 3300046542 Bacteria 21085
525 Ga0495597_0001374 3300046542 Bacteria 17598
526 Ga0495597_0002627 3300046542 Bacteria 11180
527 Ga0495597_0010108 3300046542 Bacteria 4626
528 Ga0495597_0016981 3300046542 Bacteria 3430
529 Ga0495597_0066102 3300046542 Bacteria 1567
530 Ga0495622_0002130 3300046557 Bacteria 9647
531 Ga0495622_0026612 3300046557 Bacteria 2699
532 Ga0495622_0036812 3300046557 Bacteria 2280
533 Ga0495622_0040208 3300046557 Bacteria 2176
534 Ga0495622_0147821 3300046557 Bacteria 1064
535 Ga0495633_0000504 3300046558 Bacteria 39318
536 Ga0495633_0001016 3300046558 Bacteria 22969
537 Ga0495633_0004300 3300046558 Bacteria 9097
538 Ga0495633_0005658 3300046558 Bacteria 7567
539 Ga0495633_0007382 3300046558 Bacteria 6330
540 Ga0495633_0012242 3300046558 Bacteria 4574
541 Ga0495633_0013436 3300046558 Bacteria 4315
542 Ga0495633_0015734 3300046558 Bacteria 3920
543 Ga0495633_0019270 3300046558 Bacteria 3451
544 Ga0495656_0017227 3300046615 Bacteria 2754
545 Ga0495656_0023163 3300046615 Bacteria 2441
546 Ga0495656_0025883 3300046615 Bacteria 2330
547 Ga0495656_0229934 3300046615 Bacteria 930
548 Ga0495668_0000025 3300046616 Bacteria 304546
549 Ga0495668_0000126 3300046616 Bacteria 114185
550 Ga0495668_0000810 3300046616 Bacteria 35815
551 Ga0495668_0001707 3300046616 Bacteria 20270
552 Ga0495668_0002549 3300046616 Bacteria 14816
553 Ga0495668_0004065 3300046616 Bacteria 10620
554 Ga0495668_0005188 3300046616 Bacteria 8946
555 Ga0495668_0007538 3300046616 Bacteria 6943
556 Ga0495668_0009246 3300046616 Bacteria 6062
557 Ga0495668_0018131 3300046616 Bacteria 4071
558 Ga0495668_0020835 3300046616 Bacteria 3765
559 Ga0495668_0025258 3300046616 Bacteria 3376
560 Ga0495668_0072635 3300046616 Bacteria 1890
561 Ga0495668_0086465 3300046616 Bacteria 1719
562 Ga0495668_0105530 3300046616 Bacteria 1541
563 Ga0495634_0168123 3300046642 Bacteria 1379
564 Ga0495611_0000551 3300046648 Bacteria 21888
565 Ga0495611_0008248 3300046648 Bacteria 4419
566 Ga0495611_0014670 3300046648 Bacteria 3349
567 Ga0495611_0015059 3300046648 Bacteria 3305
568 Ga0495611_0015669 3300046648 Bacteria 3240
569 Ga0495611_0056131 3300046648 Bacteria 1782
570 Ga0495611_0056343 3300046648 Bacteria 1779
571 Ga0495611_0084660 3300046648 Bacteria 1462
572 Ga0495625_0002773 3300046660 Bacteria 18494
573 Ga0495625_0002810 3300046660 Bacteria 18329
574 Ga0495625_0009260 3300046660 Bacteria 8262
575 Ga0495625_0012218 3300046660 Bacteria 6964
576 Ga0495625_0019633 3300046660 Bacteria 5234
577 Ga0495625_0037296 3300046660 Bacteria 3567
578 Ga0495625_0047348 3300046660 Bacteria 3100
579 Ga0495625_0054637 3300046660 Bacteria 2851
580 Ga0495625_0055425 3300046660 Bacteria 2827
581 Ga0495625_0093667 3300046660 Bacteria 2073
582 Ga0495659_0000445 3300046664 Bacteria 15457
583 Ga0495659_0090261 3300046664 Bacteria 1175
584 Ga0495659_0115358 3300046664 Bacteria 1053
585 Ga0495661_0000859 3300046665 Bacteria 28295
586 Ga0495661_0001479 3300046665 Bacteria 19638
587 Ga0495661_0002355 3300046665 Bacteria 14587
588 Ga0495661_0004983 3300046665 Bacteria 9482
589 Ga0495661_0008804 3300046665 Bacteria 6961
590 Ga0495661_0009671 3300046665 Bacteria 6604
591 Ga0495661_0016891 3300046665 Bacteria 4823
592 Ga0495661_0022952 3300046665 Bacteria 4055
593 Ga0495661_0042189 3300046665 Bacteria 2814
594 Ga0495661_0048547 3300046665 Bacteria 2578
595 Ga0495661_0049026 3300046665 Bacteria 2563
596 Ga0495661_0052103 3300046665 Bacteria 2467
597 Ga0495661_0054316 3300046665 Bacteria 2405
598 Ga0495661_0059265 3300046665 Bacteria 2279
599 Ga0495661_0087706 3300046665 Bacteria 1778
600 Ga0495661_0097057 3300046665 Bacteria 1665
601 Ga0495661_0121558 3300046665 Bacteria 1442
602 Ga0495661_0187558 3300046665 Bacteria 1091
603 Ga0495661_0243383 3300046665 Bacteria 921
604 Ga0495661_0335104 3300046665 Bacteria 748
605 Ga0495588_0000067 3300046674 Bacteria 238958
606 Ga0495588_0020049 3300046674 Bacteria 3280
607 Ga0495588_0087213 3300046674 Bacteria 1632
608 Ga0495657_0338102 3300046675 Bacteria 893
609 Ga0495599_0297355 3300046678 Bacteria 975
610 Ga0495623_0021263 3300046679 Bacteria 4190
611 Ga0495623_0097997 3300046679 Bacteria 1790
612 Ga0495623_0160321 3300046679 Bacteria 1323
613 Ga0495646_0085121 3300046680 Bacteria 1835
614 Ga0495646_0159490 3300046680 Bacteria 1250
615 Ga0495646_0224371 3300046680 Bacteria 1015
616 Ga0495669_0000401 3300046684 Bacteria 21231
617 Ga0495669_0000712 3300046684 Bacteria 14461
618 Ga0495669_0003709 3300046684 Bacteria 6282
619 Ga0495669_0020327 3300046684 Bacteria 2872
620 Ga0495669_0026832 3300046684 Bacteria 2517
621 Ga0495613_0150896 3300046689 Bacteria 1657
622 Ga0495624_0005808 3300046690 Bacteria 8836
623 Ga0495624_0145508 3300046690 Bacteria 1450
624 Ga0495670_0001953 3300046691 Bacteria 10152
625 Ga0495670_0006207 3300046691 Bacteria 5868
626 Ga0495670_0011529 3300046691 Bacteria 4348
627 Ga0495670_0012966 3300046691 Bacteria 4097
628 Ga0495670_0208416 3300046691 Bacteria 1036
629 Ga0495670_0287688 3300046691 Bacteria 879
630 Ga0495671_0000001 3300046692 Bacteria 1169494
631 Ga0495671_0007128 3300046692 Bacteria 6404
632 Ga0495671_0014118 3300046692 Bacteria 4306
633 Ga0495671_0017617 3300046692 Bacteria 3800
634 Ga0495671_0029571 3300046692 Bacteria 2812
635 Ga0495671_0069513 3300046692 Bacteria 1731
636 Ga0495671_0080435 3300046692 Bacteria 1596
637 Ga0495671_0084987 3300046692 Bacteria 1550
638 Ga0495649_0001061 3300046694 Bacteria 21490
639 Ga0495649_0004351 3300046694 Bacteria 9283
640 Ga0495649_0013688 3300046694 Bacteria 4675
641 Ga0495649_0021684 3300046694 Bacteria 3598
642 Ga0495649_0103004 3300046694 Bacteria 1516
643 Ga0495589_0000324 3300046794 Bacteria 37487
644 Ga0495589_0000701 3300046794 Bacteria 21813
645 Ga0495589_0008247 3300046794 Bacteria 5442
646 Ga0495589_0013146 3300046794 Bacteria 4272
647 Ga0495589_0273682 3300046794 Bacteria 786
648 Ga0495589_0275315 3300046794 Bacteria 783
649 Ga0495660_0000026 3300046810 Bacteria 256223
650 Ga0495660_0007088 3300046810 Bacteria 6603
651 Ga0495660_0010717 3300046810 Bacteria 5327
652 Ga0495660_0020096 3300046810 Bacteria 3830
653 Ga0495660_0021269 3300046810 Bacteria 3715
654 Ga0495660_0031785 3300046810 Bacteria 2966
655 Ga0495660_0058419 3300046810 Bacteria 2078
656 Ga0495581_0005532 3300047315 Bacteria 7318
657 Ga0495581_0133366 3300047315 Bacteria 1447
658 Ga0495604_0004090 3300047317 Bacteria 11589
659 Ga0495636_0004150 3300047318 Bacteria 5679
660 Ga0495636_0029856 3300047318 Bacteria 2226
661 Ga0495674_0004640 3300047319 Bacteria 13210
662 Ga0495672_0000041 3300047320 Bacteria 267545
663 Ga0495672_0000050 3300047320 Bacteria 240336
664 Ga0495672_0000454 3300047320 Bacteria 48596
665 Ga0495672_0000505 3300047320 Bacteria 45047
666 Ga0495672_0001726 3300047320 Bacteria 21137
667 Ga0495672_0001789 3300047320 Bacteria 20634
668 Ga0495672_0036121 3300047320 Bacteria 3036
669 Ga0495672_0041549 3300047320 Bacteria 2780
670 Ga0495672_0052171 3300047320 Bacteria 2403
671 Ga0495672_0123916 3300047320 Bacteria 1369
672 Ga0495676_0000235 3300047321 Bacteria 44374
673 Ga0495676_0013662 3300047321 Bacteria 7287
674 Ga0495676_0041757 3300047321 Bacteria 3772
675 Ga0495680_0009334 3300047322 Bacteria 8833
676 Ga0495683_0000203 3300047323 Bacteria 56418
677 Ga0495683_0000434 3300047323 Bacteria 33166
678 Ga0495683_0007966 3300047323 Bacteria 5687
679 Ga0495683_0086209 3300047323 Bacteria 1526
680 Ga0495683_0123035 3300047323 Bacteria 1229
681 Ga0495687_000013 3300047443 Bacteria 371058
682 Ga0495687_000127 3300047443 Bacteria 117520
683 Ga0495687_000143 3300047443 Bacteria 108306
684 Ga0495687_000871 3300047443 Bacteria 32002
685 Ga0495687_005119 3300047443 Bacteria 8489
686 Ga0495687_008376 3300047443 Bacteria 5924
687 Ga0495687_008545 3300047443 Bacteria 5851
688 Ga0495687_009637 3300047443 Bacteria 5377
689 Ga0495675_0001313 3300047444 Bacteria 15070
690 Ga0495677_0000098 3300047445 Bacteria 44329
691 Ga0495677_0001073 3300047445 Bacteria 10973
692 Ga0495677_0001928 3300047445 Bacteria 8292
693 Ga0495677_0003237 3300047445 Bacteria 6351
694 Ga0495677_0009863 3300047445 Bacteria 3517
695 Ga0495677_0012011 3300047445 Bacteria 3161
696 Ga0495677_0014037 3300047445 Bacteria 2916
697 Ga0495677_0014123 3300047445 Bacteria 2908
698 Ga0495677_0023046 3300047445 Bacteria 2260
699 Ga0495677_0028793 3300047445 Bacteria 2019
700 Ga0495677_0030832 3300047445 Bacteria 1951
701 Ga0495677_0083203 3300047445 Bacteria 1201
702 Ga0495679_002036 3300047446 Bacteria 10688
703 Ga0495679_021491 3300047446 Bacteria 2226
704 Ga0495679_025773 3300047446 Bacteria 1961
705 Ga0495679_042088 3300047446 Bacteria 1410
706 Ga0495685_000942 3300047447 Bacteria 8806
707 Ga0495685_003481 3300047447 Bacteria 5028
708 Ga0495685_016432 3300047447 Bacteria 2527
709 Ga0495673_0000006 3300047469 Bacteria 908691
710 Ga0495673_0000014 3300047469 Bacteria 599202
711 Ga0495673_0000430 3300047469 Bacteria 47639
712 Ga0495673_0058575 3300047469 Bacteria 1659
713 Ga0495681_0000647 3300047470 Bacteria 26531
714 Ga0495681_0005070 3300047470 Bacteria 8881
715 Ga0495681_0006678 3300047470 Bacteria 7534
716 Ga0495681_0008759 3300047470 Bacteria 6307
717 Ga0495681_0021487 3300047470 Bacteria 3475
718 Ga0495681_0031803 3300047470 Bacteria 2664
719 Ga0495681_0041010 3300047470 Bacteria 2250
720 Ga0495681_0041705 3300047470 Bacteria 2227
721 Ga0495686_0000288 3300047472 Bacteria 88523
722 Ga0495686_0001006 3300047472 Bacteria 34250
723 Ga0495686_0001335 3300047472 Bacteria 27633
724 Ga0495686_0001432 3300047472 Bacteria 26052
725 Ga0495686_0023406 3300047472 Bacteria 4074
726 Ga0495686_0045610 3300047472 Bacteria 2772
727 Ga0495686_0125285 3300047472 Bacteria 1528
728 Ga0495593_0005559 3300047673 Bacteria 7446
729 Ga0495593_0015881 3300047673 Bacteria 4254
730 Ga0495602_0030814 3300048088 Bacteria 5082
731 Ga0495602_0032483 3300048088 Bacteria 4913
732 Ga0495614_0010817 3300048089 Bacteria 4017
733 Ga0495614_0021970 3300048089 Bacteria 2755
734 Ga0495614_0025445 3300048089 Bacteria 2552
735 Ga0495615_0004089 3300048090 Bacteria 2512
736 Ga0495626_0000003 3300048091 Bacteria 427774
737 Ga0495626_0000096 3300048091 Bacteria 114087
738 Ga0495626_0001123 3300048091 Bacteria 22492
739 Ga0495626_0002799 3300048091 Bacteria 11701
740 Ga0495626_0003171 3300048091 Bacteria 10711
741 Ga0495626_0010902 3300048091 Bacteria 4826
742 Ga0495626_0010929 3300048091 Bacteria 4822
743 Ga0495626_0010932 3300048091 Bacteria 4821
744 Ga0495626_0013054 3300048091 Bacteria 4331
745 Ga0495626_0018878 3300048091 Bacteria 3453
746 Ga0495626_0020338 3300048091 Bacteria 3309
747 Ga0495626_0028973 3300048091 Bacteria 2681
748 Ga0495626_0049881 3300048091 Bacteria 1936
749 Ga0495626_0102479 3300048091 Bacteria 1246
750 Ga0496100_0027033 3300048903 Bacteria 3524
751 Ga0496100_0275358 3300048903 Bacteria 1253
752 Ga0496101_0073207 3300048904 Bacteria 2516
753 Ga0496102_0000194 3300048905 Bacteria 83095
754 Ga0496102_0072072 3300048905 Bacteria 3173
755 Ga0496102_0717870 3300048905 Bacteria 922
756 Ga0496103_0009176 3300048906 Bacteria 5857
757 Ga0496103_0021055 3300048906 Bacteria 3922
758 Ga0496103_0034059 3300048906 Bacteria 3114
759 Ga0496106_0005315 3300048909 Bacteria 9537
760 Ga0496107_0076728 3300048910 Bacteria 2434
761 Ga0496108_0040462 3300048911 Bacteria 3886
762 Ga0496109_0021209 3300048912 Bacteria 5743
763 Ga0496110_0006349 3300048913 Bacteria 9344
764 Ga0496110_0050784 3300048913 Bacteria 3643
765 Ga0496112_0653524 3300048915 Bacteria 981
766 Ga0496113_0626763 3300048916 Bacteria 861
767 Ga0496114_0001342 3300048917 Bacteria 18646
768 Ga0496114_0029253 3300048917 Bacteria 4526
769 Ga0496114_0115921 3300048917 Bacteria 2299
770 Ga0496114_0118714 3300048917 Bacteria 2272
771 Ga0496115_0062650 3300048918 Bacteria 3000
772 Ga0496115_0227964 3300048918 Bacteria 1537
773 Ga0496116_0149178 3300048919 Bacteria 1302
774 Ga0496118_0144473 3300048921 Bacteria 1501
775 Ga0496120_0130363 3300048923 Bacteria 1288
776 Ga0496121_0003188 3300048924 Bacteria 23647
777 Ga0496121_0060430 3300048924 Bacteria 3117
778 Ga0496121_0088120 3300048924 Bacteria 2434
779 Ga0496122_0000445 3300048925 Bacteria 86566
780 Ga0496122_0000968 3300048925 Bacteria 51537
781 Ga0496122_0024024 3300048925 Bacteria 5347
782 Ga0496122_0092819 3300048925 Bacteria 2050
783 Ga0496123_0004226 3300048926 Bacteria 15322
784 Ga0496123_0004825 3300048926 Bacteria 13907
785 Ga0496123_0061417 3300048926 Bacteria 2414
786 Ga0496123_0087936 3300048926 Bacteria 1857
787 Ga0496124_0009111 3300048927 Bacteria 10260
788 Ga0496124_0041731 3300048927 Bacteria 3956
789 Ga0496124_0085319 3300048927 Bacteria 2588
790 Ga0496124_0118207 3300048927 Bacteria 2122
791 Ga0496124_0278419 3300048927 Bacteria 1221
792 Ga0496125_0004258 3300048928 Bacteria 16661
793 Ga0496125_0017185 3300048928 Bacteria 6913
794 Ga0496126_0015414 3300048929 Bacteria 7690
795 Ga0495678_000408 3300049459 Bacteria 43359
796 Ga0495678_000910 3300049459 Bacteria 25989
797 Ga0495678_001706 3300049459 Bacteria 16499
798 Ga0495678_001938 3300049459 Bacteria 14980
799 Ga0495678_003948 3300049459 Bacteria 8874
800 Ga0495678_005643 3300049459 Bacteria 6836
801 Ga0495678_041648 3300049459 Bacteria 1836
802 Ga0495678_117639 3300049459 Bacteria 897
803 Ga0495682_0000351 3300049460 Bacteria 33719
804 Ga0495682_0001002 3300049460 Bacteria 16842
805 Ga0495682_0010776 3300049460 Bacteria 3528
806 Ga0495682_0014757 3300049460 Bacteria 2961
807 Ga0495682_0018316 3300049460 Bacteria 2638
808 Ga0495682_0099491 3300049460 Bacteria 1043
809 Ga0501031_0004117 3300049568 Bacteria 9389
810 Ga0501031_0015053 3300049568 Bacteria 5023
811 Ga0501032_0002455 3300049569 Bacteria 14482
812 Ga0501032_0013401 3300049569 Bacteria 5832
813 Ga0501033_0002230 3300049570 Bacteria 16664
814 Ga0501033_0004514 3300049570 Bacteria 11142
815 Ga0501033_0004903 3300049570 Bacteria 10648
816 Ga0501036_0009324 3300049572 Bacteria 8072
817 Ga0501036_0306886 3300049572 Bacteria 1327
818 Ga0501037_0063335 3300049573 Bacteria 2695
819 Ga0501037_0269985 3300049573 Bacteria 1187
820 Ga0501038_0015899 3300049574 Bacteria 6837
821 Ga0501038_0040448 3300049574 Bacteria 4071
822 Ga0501038_0041437 3300049574 Bacteria 4015
823 Ga0501039_0106454 3300049575 Bacteria 2190
824 Ga0501039_0172274 3300049575 Bacteria 1701
825 Ga0501040_0002743 3300049576 Bacteria 11343
826 Ga0501042_0009794 3300049578 Bacteria 6402
827 Ga0501043_0005656 3300049579 Bacteria 10072
828 Ga0501043_0007467 3300049579 Bacteria 8682
829 Ga0501043_0085602 3300049579 Bacteria 2477
830 Ga0501043_0321037 3300049579 Bacteria 1181
831 Ga0501046_0006116 3300049580 Bacteria 10698
832 Ga0501046_0046835 3300049580 Bacteria 3430
833 Ga0501046_0509580 3300049580 Bacteria 861
834 Ga0501047_0091996 3300049581 Bacteria 2911
835 Ga0501047_0306976 3300049581 Bacteria 1428
836 Ga0501048_0030133 3300049582 Bacteria 3928
837 Ga0501068_0003678 3300049584 Bacteria 8297
838 Ga0501238_002802 3300049671 Bacteria 2110
839 Ga0501249_005902 3300049679 Bacteria 2508
840 Ga0501269_001331 3300049766 Bacteria 3274
841 Ga0501035_0001124 3300049822 Bacteria 27956
842 Ga0501035_0002256 3300049822 Bacteria 19064
843 Ga0501035_0057071 3300049822 Bacteria 3481
844 Ga0501044_0010900 3300049823 Bacteria 9865
845 Ga0501044_0015152 3300049823 Bacteria 8308
846 Ga0501044_0028349 3300049823 Bacteria 5910
847 Ga0501045_0004780 3300049824 Bacteria 9358
848 nmdc:mga08y16_15265_c1 3300050511 Bacteria 8080
849 nmdc:mga08y16_256392_c1 3300050511 Bacteria 1807
850 Ga0500594_0008642 3300053118 Bacteria 2326
851 Ga0500618_000426 3300053125 Bacteria 28249
852 Ga0500618_001765 3300053125 Bacteria 9153
853 Ga0500618_003076 3300053125 Bacteria 5904
854 Ga0500586_001291 3300053145 Bacteria 5258
855 Ga0500616_0079532 3300053153 Bacteria 1650
856 Ga0587066_017614 3300059490 Bacteria 1140
857 Ga0587070_032462 3300059491 Bacteria 955
858 Ga0587083_0001536 3300059505 Bacteria 2628
859 Ga0587090_015677 3300059510 Bacteria 1124
860 Ga0587090_054793 3300059510 Bacteria 741
861 Ga0587091_018907 3300059511 Bacteria 1178
862 Ga0587092_047516 3300059512 Bacteria 767
863 Ga0587106_043474 3300059605 Bacteria 771
864 Ga0587101_007192 3300059623 Bacteria 1306
865 Ga0587113_004574 3300059625 Bacteria 1106
866 Ga0587067_013242 3300059640 Bacteria 1302
867 Ga0587068_006947 3300059641 Bacteria 1600
868 Ga0587078_018517 3300059646 Bacteria 863
869 Ga0587071_018029 3300060344 Bacteria 1265
870 Ga0587071_045861 3300060344 Bacteria 890
871 Ga0466962_0109336 3300061719 Bacteria 1330

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025937 Ga0207669_10136358 Ga0207669_101363582 201
2 3300013308 Ga0157375_10615177 Ga0157375_106151772 204
3 3300009551 Ga0105238_10053531 Ga0105238_100535312 206
4 iso_pu_bacteria 2952252522 2952256059 207
5 3300005290 Ga0065712_10165081 Ga0065712_101650811 208
6 3300005293 Ga0065715_10228053 Ga0065715_102280532 208
7 3300005331 Ga0070670_100019310 Ga0070670_1000193104 208
8 3300005334 Ga0068869_100100111 Ga0068869_1001001112 208
9 3300005365 Ga0070688_100204107 Ga0070688_1002041072 208
10 3300005438 Ga0070701_10204655 Ga0070701_102046551 208
11 3300005459 Ga0068867_100043831 Ga0068867_1000438312 208
12 3300005466 Ga0070685_10199875 Ga0070685_101998752 208
13 3300005577 Ga0068857_100106766 Ga0068857_1001067662 208
14 3300005617 Ga0068859_100074769 Ga0068859_1000747692 208
15 3300006931 Ga0097620_100074766 Ga0097620_1000747662 208
16 3300014326 Ga0157380_10047811 Ga0157380_100478112 208
17 3300014745 Ga0157377_10256914 Ga0157377_102569141 208
18 3300025925 Ga0207650_10009675 Ga0207650_100096751 208
19 3300025934 Ga0207686_10247933 Ga0207686_102479331 208
20 3300026075 Ga0207708_10081624 Ga0207708_100816242 208
21 3300026089 Ga0207648_10121752 Ga0207648_101217522 208
22 3300026116 Ga0207674_10062454 Ga0207674_100624542 208
23 3300046499 Ga0495594_0013970 Ga0495594_0013970_3166_3792 208
24 3300046506 Ga0495583_0127193 Ga0495583_0127193_187_819 208
25 3300046535 Ga0495586_0170259 Ga0495586_0170259_202_828 208
26 3300046557 Ga0495622_0147821 Ga0495622_0147821_420_1046 208
27 3300047321 Ga0495676_0041757 Ga0495676_0041757_1661_2287 208
28 3300048928 Ga0496125_0017185 Ga0496125_0017185_4113_4739 208
29 iso_pu_bacteria 2511231003 2511247471 208
30 iso_pu_bacteria 2521172590 2521560889 208
31 iso_pu_bacteria 2551306416 2553007600 208
32 iso_pu_bacteria 2643221556 2643798159 208
33 iso_pu_bacteria 2643221603 2644026956 208
34 iso_pu_bacteria 2643221684 2644475156 208
35 iso_pu_bacteria 2738541297 2738825132 208
36 iso_pu_bacteria 2738541357 2739148929 208
37 iso_pu_bacteria 2738543003 2739190848 208
38 iso_pu_bacteria 2738543026 2739317325 208
39 iso_pu_bacteria 2738543029 2739335566 208
40 iso_pu_bacteria 2765235838 2765567326 208
41 iso_pu_bacteria 2808606386 2808984235 208
42 iso_pu_bacteria 2808606415 2809132039 208
43 iso_pu_bacteria 2808606418 2809144607 208
44 iso_pu_bacteria 2808606419 2809151662 208
45 iso_pu_bacteria 2818991445 2819594334 208
46 iso_pu_bacteria 2818991449 2819618761 208
47 iso_pu_bacteria 2821131069 2821133729 208
48 iso_pu_bacteria 2831426010 2831426403 208
49 iso_pu_bacteria 2839094727 2839095410 208
50 iso_pu_bacteria 2842711865 2842717207 208
51 iso_pu_bacteria 2848694841 2848697939 208
52 iso_pu_bacteria 2849660919 2849665533 208
53 iso_pu_bacteria 2852618963 2852622878 208
54 iso_pu_bacteria 2857558681 2857560375 208
55 iso_pu_bacteria 2857564685 2857565522 208
56 iso_pu_bacteria 2884811622 2884814037 208
57 iso_pu_bacteria 2884836552 2884840731 208
58 iso_pu_bacteria 2884852848 2884857673 208
59 iso_pu_bacteria 2886627955 2886634677 208
60 iso_pu_bacteria 2896154374 2896158613 208
61 iso_pu_bacteria 2904424332 2904430578 208
62 iso_pu_bacteria 2904434214 2904438194 208
63 iso_pu_bacteria 2904439833 2904442494 208
64 iso_pu_bacteria 2904530477 2904533752 208
65 iso_pu_bacteria 2904584206 2904589411 208
66 iso_pu_bacteria 2904589729 2904595114 208
67 iso_pu_bacteria 2904601388 2904602384 208
68 iso_pu_bacteria 2913844669 2913847959 208
69 iso_pu_bacteria 2919046199 2919050733 208
70 iso_pu_bacteria 2919079590 2919084927 208
71 iso_pu_bacteria 2923510766 2923514731 208
72 iso_pu_bacteria 2928130867 2928135667 208
73 iso_pu_bacteria 8047673197 8047678168 208
74 3300048916 Ga0496113_0626763 Ga0496113_0626763_23_652 209
75 iso_pu_bacteria 2643221628 2644163225 209
76 iso_pu_bacteria 2842677519 2842679666 209
77 iso_pu_bacteria 2842747753 2842751158 209
78 iso_pu_bacteria 2919462493 2919467243 209
79 iso_pu_bacteria 2929520902 2929522752 209
80 iso_pu_bacteria 2945945610 2945947702 209
81 iso_pu_bacteria 2954767861 2954772458 209
82 3300036401 Ga0373937_0336745 Ga0373937_0336745_47_706 210
83 3300046531 Ga0495665_0174738 Ga0495665_0174738_424_1056 210
84 3300005563 Ga0068855_100008403 Ga0068855_1000084036 211
85 3300009093 Ga0105240_10159307 Ga0105240_101593072 211
86 3300020070 Ga0206356_11570456 Ga0206356_115704561 211
87 3300021361 Ga0213872_10000920 Ga0213872_1000092012 211
88 3300025912 Ga0207707_10607648 Ga0207707_106076481 211
89 3300025913 Ga0207695_10080349 Ga0207695_100803493 211
90 3300025949 Ga0207667_10000543 Ga0207667_1000054330 211
91 3300031995 Ga0307409_100781846 Ga0307409_1007818462 211
92 3300032002 Ga0307416_101069069 Ga0307416_1010690691 211
93 3300032126 Ga0307415_100328697 Ga0307415_1003286972 211
94 3300039062 Ga0400483_114212 Ga0400483_114212_321_956 211
95 3300041509 Ga0451843_1115385 Ga0451843_1115385_54_689 211
96 3300002704 JGI25155J39150_1000170 JGI25155J39150_10001706 212
97 3300002704 JGI25155J39150_1000318 JGI25155J39150_100031815 212
98 3300002705 JGI25156J39149_1000293 JGI25156J39149_100029328 212
99 3300002705 JGI25156J39149_1001177 JGI25156J39149_10011779 212
100 3300002737 JGI25162J39368_1004661 JGI25162J39368_10046613 212
101 3300002738 JGI25154J39366_1000260 JGI25154J39366_100026028 212
102 3300002738 JGI25154J39366_1000267 JGI25154J39366_10002676 212
103 3300002738 JGI25154J39366_1000581 JGI25154J39366_100058112 212
104 3300002741 JGI25157J39369_1000327 JGI25157J39369_100032728 212
105 3300002774 JGI25150J39212_1005529 JGI25150J39212_10055293 212
106 3300002774 JGI25150J39212_1012921 JGI25150J39212_10129212 212
107 3300002987 JGI25159J45721_1003120 JGI25159J45721_10031202 212
108 3300003187 JGI25151J46595_10035960 JGI25151J46595_100359601 212
109 3300003215 JGI25153J46596_10009537 JGI25153J46596_100095375 212
110 3300003544 Ga0007417J51691_1076888 Ga0007417J51691_10768881 212
111 3300003574 Ga0007410J51695_1013512 Ga0007410J51695_10135122 212
112 3300003575 Ga0007409J51694_1005946 Ga0007409J51694_10059464 212
113 3300003575 Ga0007409J51694_1006985 Ga0007409J51694_10069852 212
114 3300003577 Ga0007416J51690_1007671 Ga0007416J51690_10076713 212
115 3300003693 Ga0032354_1018852 Ga0032354_10188522 212
116 3300003751 Ga0055538_1000138 Ga0055538_100013832 212
117 3300003752 Ga0055539_1000187 Ga0055539_100018732 212
118 3300003756 Ga0055533_1000189 Ga0055533_100018932 212
119 3300003758 Ga0055532_1000184 Ga0055532_100018436 212
120 3300003759 Ga0055525_1000133 Ga0055525_100013337 212
121 3300003759 Ga0055525_1000254 Ga0055525_100025432 212
122 3300003761 Ga0055535_1009076 Ga0055535_10090762 212
123 3300003763 Ga0055529_1000154 Ga0055529_100015435 212
124 3300003771 Ga0055526_1000237 Ga0055526_100023734 212
125 3300003771 Ga0055526_1000525 Ga0055526_100052515 212
126 3300003773 Ga0055537_1000111 Ga0055537_100011146 212
127 3300003773 Ga0055537_1014742 Ga0055537_10147421 212
128 3300003775 Ga0055524_1000015 Ga0055524_1000015203 212
129 3300003775 Ga0055524_1004885 Ga0055524_10048856 212
130 3300003775 Ga0055524_1008329 Ga0055524_10083293 212
131 3300003784 Ga0055534_1000509 Ga0055534_10005098 212
132 3300003784 Ga0055534_1001874 Ga0055534_10018749 212
133 3300003790 Ga0055528_1000178 Ga0055528_10001786 212
134 3300003841 Ga0055541_1000122 Ga0055541_100012234 212
135 3300004625 Ga0055543_1002600 Ga0055543_10026007 212
136 3300005262 Ga0065165_1000286 Ga0065165_100028677 212
137 3300005262 Ga0065165_1000465 Ga0065165_100046517 212
138 3300005262 Ga0065165_1092670 Ga0065165_10926701 212
139 3300005327 Ga0070658_10825019 Ga0070658_108250191 212
140 3300005331 Ga0070670_100013536 Ga0070670_1000135365 212
141 3300005337 Ga0070682_100001863 Ga0070682_1000018636 212
142 3300005337 Ga0070682_100143786 Ga0070682_1001437862 212
143 3300005339 Ga0070660_100001978 Ga0070660_10000197822 212
144 3300005339 Ga0070660_100056850 Ga0070660_1000568503 212
145 3300005339 Ga0070660_100102515 Ga0070660_1001025152 212
146 3300005344 Ga0070661_100122751 Ga0070661_1001227512 212
147 3300005344 Ga0070661_100126061 Ga0070661_1001260612 212
148 3300005366 Ga0070659_100001966 Ga0070659_10000196613 212
149 3300005366 Ga0070659_100327545 Ga0070659_1003275451 212
150 3300005436 Ga0070713_100664514 Ga0070713_1006645141 212
151 3300005455 Ga0070663_100508761 Ga0070663_1005087611 212
152 3300005457 Ga0070662_100115694 Ga0070662_1001156941 212
153 3300005457 Ga0070662_100356682 Ga0070662_1003566822 212
154 3300005459 Ga0068867_101096594 Ga0068867_1010965941 212
155 3300005563 Ga0068855_100002390 Ga0068855_1000023904 212
156 3300005563 Ga0068855_100205705 Ga0068855_1002057053 212
157 3300005564 Ga0070664_100031977 Ga0070664_1000319772 212
158 3300005564 Ga0070664_100153990 Ga0070664_1001539902 212
159 3300005577 Ga0068857_100149585 Ga0068857_1001495852 212
160 3300005577 Ga0068857_100843308 Ga0068857_1008433081 212
161 3300005578 Ga0068854_100020109 Ga0068854_1000201093 212
162 3300005615 Ga0070702_100403005 Ga0070702_1004030051 212
163 3300005616 Ga0068852_100014663 Ga0068852_1000146635 212
164 3300005834 Ga0068851_10100841 Ga0068851_101008412 212
165 3300005834 Ga0068851_10160807 Ga0068851_101608071 212
166 3300006358 Ga0068871_100133073 Ga0068871_1001330733 212
167 3300006946 Ga0079104_1005980 Ga0079104_10059804 212
168 3300006948 Ga0099826_10000003 Ga0099826_10000003219 212
169 3300009036 Ga0105244_10002912 Ga0105244_100029129 212
170 3300009036 Ga0105244_10013090 Ga0105244_100130905 212
171 3300009036 Ga0105244_10028026 Ga0105244_100280262 212
172 3300009093 Ga0105240_10018441 Ga0105240_1001844110 212
173 3300009093 Ga0105240_10069027 Ga0105240_100690274 212
174 3300009093 Ga0105240_10763176 Ga0105240_107631762 212
175 3300009093 Ga0105240_11032630 Ga0105240_110326301 212
176 3300009094 Ga0111539_10016114 Ga0111539_100161143 212
177 3300009148 Ga0105243_10020624 Ga0105243_100206242 212
178 3300009174 Ga0105241_10227329 Ga0105241_102273291 212
179 3300009176 Ga0105242_10116936 Ga0105242_101169363 212
180 3300009545 Ga0105237_10006499 Ga0105237_1000649910 212
181 3300009545 Ga0105237_10304152 Ga0105237_103041522 212
182 3300009551 Ga0105238_10000255 Ga0105238_1000025534 212
183 3300010375 Ga0105239_10001561 Ga0105239_1000156113 212
184 3300010375 Ga0105239_10231888 Ga0105239_102318881 212
185 3300010375 Ga0105239_10330143 Ga0105239_103301432 212
186 3300013100 Ga0157373_10092631 Ga0157373_100926312 212
187 3300013100 Ga0157373_10129519 Ga0157373_101295192 212
188 3300013104 Ga0157370_10007558 Ga0157370_100075584 212
189 3300013307 Ga0157372_10416221 Ga0157372_104162212 212
190 3300013307 Ga0157372_10817923 Ga0157372_108179232 212
191 3300013308 Ga0157375_10280728 Ga0157375_102807282 212
192 3300014497 Ga0182008_10013109 Ga0182008_100131093 212
193 3300014497 Ga0182008_10180962 Ga0182008_101809622 212
194 3300014969 Ga0157376_10480967 Ga0157376_104809672 212
195 3300014969 Ga0157376_10661087 Ga0157376_106610872 212
196 3300015261 Ga0182006_1019052 Ga0182006_10190522 212
197 3300021361 Ga0213872_10000002 Ga0213872_10000002217 212
198 3300021361 Ga0213872_10000307 Ga0213872_1000030715 212
199 3300021361 Ga0213872_10000427 Ga0213872_1000042711 212
200 3300021361 Ga0213872_10005167 Ga0213872_100051674 212
201 3300021361 Ga0213872_10011283 Ga0213872_100112835 212
202 3300021361 Ga0213872_10022797 Ga0213872_100227971 212
203 3300025206 Ga0209435_100079 Ga0209435_10007933 212
204 3300025206 Ga0209435_100137 Ga0209435_10013711 212
205 3300025208 Ga0209436_110345 Ga0209436_1103452 212
206 3300025224 Ga0209784_100035 Ga0209784_100035164 212
207 3300025225 Ga0209566_100040 Ga0209566_100040164 212
208 3300025226 Ga0209674_100057 Ga0209674_100057164 212
209 3300025229 Ga0209147_100060 Ga0209147_100060214 212
210 3300025230 Ga0209563_100015 Ga0209563_10001567 212
211 3300025230 Ga0209563_100059 Ga0209563_100059164 212
212 3300025233 Ga0209437_100081 Ga0209437_100081237 212
213 3300025233 Ga0209437_111330 Ga0209437_1113302 212
214 3300025242 Ga0209258_100141 Ga0209258_10014122 212
215 3300025245 Ga0207425_1000551 Ga0207425_100055122 212
216 3300025246 Ga0209646_1000028 Ga0209646_1000028145 212
217 3300025246 Ga0209646_1000265 Ga0209646_100026532 212
218 3300025246 Ga0209646_1000290 Ga0209646_100029031 212
219 3300025250 Ga0209026_1000330 Ga0209026_100033032 212
220 3300025250 Ga0209026_1002521 Ga0209026_10025216 212
221 3300025253 Ga0209677_100036 Ga0209677_100036164 212
222 3300025253 Ga0209677_101095 Ga0209677_1010953 212
223 3300025254 Ga0209148_1000765 Ga0209148_100076518 212
224 3300025256 Ga0209759_1000473 Ga0209759_100047320 212
225 3300025256 Ga0209759_1000485 Ga0209759_100048512 212
226 3300025263 Ga0209565_1000009 Ga0209565_1000009553 212
227 3300025272 Ga0209455_1000049 Ga0209455_1000049188 212
228 3300025273 Ga0209673_1000036 Ga0209673_1000036129 212
229 3300025284 Ga0209130_1000044 Ga0209130_1000044176 212
230 3300025291 Ga0209675_1000013 Ga0209675_1000013129 212
231 3300025291 Ga0209675_1011303 Ga0209675_10113031 212
232 3300025294 Ga0209025_1012300 Ga0209025_10123006 212
233 3300025295 Ga0209564_1000006 Ga0209564_100000653 212
234 3300025295 Ga0209564_1000038 Ga0209564_100003833 212
235 3300025295 Ga0209564_1000122 Ga0209564_1000122129 212
236 3300025295 Ga0209564_1002158 Ga0209564_10021582 212
237 3300025295 Ga0209564_1068754 Ga0209564_10687541 212
238 3300025297 Ga0209758_1000149 Ga0209758_1000149110 212
239 3300025299 Ga0209256_1000005 Ga0209256_1000005204 212
240 3300025299 Ga0209256_1000106 Ga0209256_100010646 212
241 3300025728 Ga0207655_1012507 Ga0207655_10125075 212
242 3300025728 Ga0207655_1059957 Ga0207655_10599572 212
243 3300025735 Ga0207713_1016732 Ga0207713_10167324 212
244 3300025909 Ga0207705_10034934 Ga0207705_100349341 212
245 3300025909 Ga0207705_10331377 Ga0207705_103313771 212
246 3300025909 Ga0207705_10934439 Ga0207705_109344391 212
247 3300025911 Ga0207654_10282684 Ga0207654_102826841 212
248 3300025913 Ga0207695_10001345 Ga0207695_1000134534 212
249 3300025913 Ga0207695_10003241 Ga0207695_100032412 212
250 3300025913 Ga0207695_10052058 Ga0207695_100520584 212
251 3300025914 Ga0207671_10001558 Ga0207671_1000155813 212
252 3300025919 Ga0207657_10001495 Ga0207657_1000149512 212
253 3300025919 Ga0207657_10032958 Ga0207657_100329583 212
254 3300025920 Ga0207649_10005902 Ga0207649_100059026 212
255 3300025920 Ga0207649_10065752 Ga0207649_100657523 212
256 3300025921 Ga0207652_10762404 Ga0207652_107624042 212
257 3300025924 Ga0207694_10000193 Ga0207694_1000019345 212
258 3300025924 Ga0207694_10166653 Ga0207694_101666532 212
259 3300025932 Ga0207690_10009202 Ga0207690_100092022 212
260 3300025932 Ga0207690_10019554 Ga0207690_100195543 212
261 3300025932 Ga0207690_10021347 Ga0207690_100213473 212
262 3300025933 Ga0207706_10043384 Ga0207706_100433843 212
263 3300025933 Ga0207706_10046776 Ga0207706_100467761 212
264 3300025934 Ga0207686_10007659 Ga0207686_100076594 212
265 3300025938 Ga0207704_10072307 Ga0207704_100723071 212
266 3300025945 Ga0207679_10016387 Ga0207679_100163872 212
267 3300025945 Ga0207679_10044089 Ga0207679_100440892 212
268 3300025949 Ga0207667_10000946 Ga0207667_100009464 212
269 3300025949 Ga0207667_10010647 Ga0207667_100106478 212
270 3300025949 Ga0207667_10023494 Ga0207667_100234946 212
271 3300025949 Ga0207667_10908222 Ga0207667_109082221 212
272 3300025981 Ga0207640_10031586 Ga0207640_100315862 212
273 3300026067 Ga0207678_10422718 Ga0207678_104227182 212
274 3300026089 Ga0207648_10364738 Ga0207648_103647382 212
275 3300026116 Ga0207674_10200977 Ga0207674_102009772 212
276 3300026142 Ga0207698_10099486 Ga0207698_100994862 212
277 3300027111 Ga0209281_1005655 Ga0209281_10056552 212
278 3300027666 Ga0209282_1000002 Ga0209282_1000002778 212
279 3300027907 Ga0207428_10145539 Ga0207428_101455392 212
280 3300027907 Ga0207428_10192088 Ga0207428_101920882 212
281 3300030731 Ga0316177_1181113 Ga0316177_11811131 212
282 3300030735 Ga0316178_1151420 Ga0316178_11514202 212
283 3300030736 Ga0316180_1113945 Ga0316180_11139452 212
284 3300030745 Ga0316182_1150052 Ga0316182_11500522 212
285 3300031838 Ga0307518_10008072 Ga0307518_100080725 212
286 3300032002 Ga0307416_100010843 Ga0307416_1000108436 212
287 3300036401 Ga0373937_0100910 Ga0373937_0100910_1997_2635 212
288 3300037312 Ga0395899_0000206 Ga0395899_0000206_49954_50598 212
289 3300037312 Ga0395899_0001430 Ga0395899_0001430_8689_9369 212
290 3300037312 Ga0395899_0002882 Ga0395899_0002882_10442_11080 212
291 3300037312 Ga0395899_0029111 Ga0395899_0029111_1306_1950 212
292 3300037312 Ga0395899_0039029 Ga0395899_0039029_1008_1652 212
293 3300037312 Ga0395899_0046977 Ga0395899_0046977_536_1174 212
294 3300037312 Ga0395899_0201294 Ga0395899_0201294_223_861 212
295 3300037312 Ga0395899_0231229 Ga0395899_0231229_460_1101 212
296 3300037418 Ga0395900_0000298 Ga0395900_0000298_18566_19210 212
297 3300037418 Ga0395900_0001764 Ga0395900_0001764_19343_19984 212
298 3300037418 Ga0395900_0005739 Ga0395900_0005739_4729_5373 212
299 3300037418 Ga0395900_0010058 Ga0395900_0010058_3428_4066 212
300 3300037418 Ga0395900_0022527 Ga0395900_0022527_4229_4867 212
301 3300037418 Ga0395900_0076138 Ga0395900_0076138_2382_3020 212
302 3300037418 Ga0395900_0080048 Ga0395900_0080048_1732_2376 212
303 3300037418 Ga0395900_0217065 Ga0395900_0217065_310_951 212
304 3300037418 Ga0395900_0279577 Ga0395900_0279577_625_1263 212
305 3300037418 Ga0395900_0498390 Ga0395900_0498390_278_922 212
306 3300037418 Ga0395900_0525120 Ga0395900_0525120_483_1121 212
307 3300037418 Ga0395900_0529413 Ga0395900_0529413_240_878 212
308 3300037418 Ga0395900_0572269 Ga0395900_0572269_135_773 212
309 3300037418 Ga0395900_0578093 Ga0395900_0578093_123_764 212
310 3300037418 Ga0395900_0868983 Ga0395900_0868983_128_766 212
311 3300037466 Ga0395898_0006001 Ga0395898_0006001_7314_7952 212
312 3300037466 Ga0395898_0082226 Ga0395898_0082226_1606_2250 212
313 3300037466 Ga0395898_0097732 Ga0395898_0097732_1100_1738 212
314 3300037466 Ga0395898_0358522 Ga0395898_0358522_192_836 212
315 3300037466 Ga0395898_0535902 Ga0395898_0535902_456_1100 212
316 3300037466 Ga0395898_0568060 Ga0395898_0568060_234_875 212
317 3300037471 Ga0395905_0000549 Ga0395905_0000549_12643_13281 212
318 3300037471 Ga0395905_0001839 Ga0395905_0001839_17722_18360 212
319 3300037471 Ga0395905_0006051 Ga0395905_0006051_11274_11912 212
320 3300037471 Ga0395905_0057719 Ga0395905_0057719_1323_1964 212
321 3300037471 Ga0395905_0118515 Ga0395905_0118515_662_1306 212
322 3300037471 Ga0395905_0154863 Ga0395905_0154863_1012_1650 212
323 3300037471 Ga0395905_0304307 Ga0395905_0304307_34_672 212
324 3300037471 Ga0395905_0312296 Ga0395905_0312296_400_1041 212
325 3300037471 Ga0395905_0495067 Ga0395905_0495067_465_1103 212
326 3300038443 Ga0395901_0000508 Ga0395901_0000508_20289_20930 212
327 3300038443 Ga0395901_0001421 Ga0395901_0001421_14122_14760 212
328 3300038443 Ga0395901_0010350 Ga0395901_0010350_1970_2608 212
329 3300038443 Ga0395901_0056215 Ga0395901_0056215_1801_2445 212
330 3300038443 Ga0395901_0078091 Ga0395901_0078091_1483_2121 212
331 3300038443 Ga0395901_0263518 Ga0395901_0263518_743_1387 212
332 3300038443 Ga0395901_0408517 Ga0395901_0408517_275_913 212
333 3300038443 Ga0395901_0436655 Ga0395901_0436655_592_1230 212
334 3300038443 Ga0395901_0914796 Ga0395901_0914796_131_769 212
335 3300039447 Ga0436361_0376382 Ga0436361_0376382_14083_14721 212
336 3300039447 Ga0436361_0391791 Ga0436361_0391791_17306_17944 212
337 3300039447 Ga0436361_0684212 Ga0436361_0684212_4716_5354 212
338 3300039447 Ga0436361_0733741 Ga0436361_0733741_5615_6253 212
339 3300039447 Ga0436361_0868581 Ga0436361_0868581_132_770 212
340 3300039447 Ga0436361_1016700 Ga0436361_1016700_17919_18557 212
341 3300039447 Ga0436361_1196357 Ga0436361_1196357_2399_3037 212
342 3300042005 Ga0439448_0006029 Ga0439448_0006029_2487_3125 212
343 3300042007 Ga0439449_0072104 Ga0439449_0072104_347_991 212
344 3300042012 Ga0439455_0012451 Ga0439455_0012451_562_1200 212
345 3300042012 Ga0439455_0016438 Ga0439455_0016438_427_1071 212
346 3300042015 Ga0439462_0034206 Ga0439462_0034206_631_1272 212
347 3300042139 Ga0450904_001033 Ga0450904_001033_913_1563 212
348 3300042157 Ga0439458_0032026 Ga0439458_0032026_262_906 212
349 3300042876 Ga0451577_0007665 Ga0451577_0007665_8165_8803 212
350 3300044656 Ga0466969_0060342 Ga0466969_0060342_911_1549 212
351 3300044658 Ga0466972_0000140 Ga0466972_0000140_45515_46153 212
352 3300044658 Ga0466972_0017423 Ga0466972_0017423_46_687 212
353 3300044683 Ga0466965_0000818 Ga0466965_0000818_5117_5755 212
354 3300044683 Ga0466965_0003643 Ga0466965_0003643_2360_3001 212
355 3300044683 Ga0466965_0033185 Ga0466965_0033185_78_716 212
356 3300044683 Ga0466965_0040322 Ga0466965_0040322_1088_1726 212
357 3300044684 Ga0466966_0057925 Ga0466966_0057925_861_1505 212
358 3300044684 Ga0466966_0060141 Ga0466966_0060141_1634_2272 212
359 3300044684 Ga0466966_0112953 Ga0466966_0112953_818_1456 212
360 3300044706 Ga0466964_0000639 Ga0466964_0000639_773_1417 212
361 3300044706 Ga0466964_0002253 Ga0466964_0002253_5317_5958 212
362 3300044719 Ga0466971_0052891 Ga0466971_0052891_413_1051 212
363 3300044735 Ga0466968_0018171 Ga0466968_0018171_1885_2526 212
364 3300044735 Ga0466968_0032940 Ga0466968_0032940_893_1531 212
365 3300044765 Ga0466970_0031711 Ga0466970_0031711_603_1241 212
366 3300044842 Ga0466957_0003058 Ga0466957_0003058_1807_2445 212
367 3300044842 Ga0466957_0106118 Ga0466957_0106118_574_1218 212
368 3300044842 Ga0466957_0114944 Ga0466957_0114944_158_802 212
369 3300044842 Ga0466957_0127004 Ga0466957_0127004_628_1272 212
370 3300045049 Ga0466959_0085374 Ga0466959_0085374_407_1051 212
371 3300045049 Ga0466959_0140467 Ga0466959_0140467_101_739 212
372 3300045976 Ga0466967_0059609 Ga0466967_0059609_2475_3119 212
373 3300046452 Ga0495617_000002 Ga0495617_000002_664306_664944 212
374 3300046452 Ga0495617_000574 Ga0495617_000574_6526_7164 212
375 3300046453 Ga0495627_000350 Ga0495627_000350_17533_18171 212
376 3300046455 Ga0495603_0143924 Ga0495603_0143924_395_1033 212
377 3300046457 Ga0495590_0000025 Ga0495590_0000025_45962_46600 212
378 3300046457 Ga0495590_0000052 Ga0495590_0000052_60454_61092 212
379 3300046457 Ga0495590_0003125 Ga0495590_0003125_6060_6698 212
380 3300046457 Ga0495590_0035970 Ga0495590_0035970_667_1305 212
381 3300046458 Ga0495591_000290 Ga0495591_000290_18657_19295 212
382 3300046459 Ga0495629_0018934 Ga0495629_0018934_974_1618 212
383 3300046459 Ga0495629_0022874 Ga0495629_0022874_2726_3364 212
384 3300046460 Ga0495638_0000066 Ga0495638_0000066_64545_65189 212
385 3300046460 Ga0495638_0007197 Ga0495638_0007197_2693_3331 212
386 3300046460 Ga0495638_0034164 Ga0495638_0034164_264_902 212
387 3300046460 Ga0495638_0055994 Ga0495638_0055994_785_1465 212
388 3300046463 Ga0495653_0000011 Ga0495653_0000011_242658_243296 212
389 3300046463 Ga0495653_0005660 Ga0495653_0005660_5999_6637 212
390 3300046463 Ga0495653_0008945 Ga0495653_0008945_1150_1788 212
391 3300046463 Ga0495653_0034471 Ga0495653_0034471_2743_3381 212
392 3300046471 Ga0495650_0000015 Ga0495650_0000015_260925_261566 212
393 3300046471 Ga0495650_0000506 Ga0495650_0000506_13200_13838 212
394 3300046471 Ga0495650_0000567 Ga0495650_0000567_36384_37064 212
395 3300046471 Ga0495650_0000694 Ga0495650_0000694_13248_13886 212
396 3300046471 Ga0495650_0000716 Ga0495650_0000716_17324_17962 212
397 3300046471 Ga0495650_0000721 Ga0495650_0000721_40264_40902 212
398 3300046471 Ga0495650_0012095 Ga0495650_0012095_2862_3500 212
399 3300046471 Ga0495650_0012906 Ga0495650_0012906_2377_3015 212
400 3300046471 Ga0495650_0115113 Ga0495650_0115113_216_854 212
401 3300046472 Ga0495580_0003141 Ga0495580_0003141_10605_11243 212
402 3300046472 Ga0495580_0098195 Ga0495580_0098195_43_681 212
403 3300046473 Ga0495582_0025473 Ga0495582_0025473_545_1183 212
404 3300046473 Ga0495582_0028174 Ga0495582_0028174_886_1530 212
405 3300046473 Ga0495582_0067515 Ga0495582_0067515_272_910 212
406 3300046474 Ga0495605_0000003 Ga0495605_0000003_349382_350020 212
407 3300046474 Ga0495605_0000034 Ga0495605_0000034_118562_119200 212
408 3300046474 Ga0495605_0000474 Ga0495605_0000474_21895_22533 212
409 3300046474 Ga0495605_0030905 Ga0495605_0030905_1457_2095 212
410 3300046474 Ga0495605_0039401 Ga0495605_0039401_690_1328 212
411 3300046474 Ga0495605_0081458 Ga0495605_0081458_425_1063 212
412 3300046474 Ga0495605_0085899 Ga0495605_0085899_217_855 212
413 3300046475 Ga0495639_0011637 Ga0495639_0011637_2119_2763 212
414 3300046475 Ga0495639_0395440 Ga0495639_0395440_13_651 212
415 3300046491 Ga0495584_0000017 Ga0495584_0000017_123536_124174 212
416 3300046491 Ga0495584_0004259 Ga0495584_0004259_480_1118 212
417 3300046491 Ga0495584_0010891 Ga0495584_0010891_1142_1780 212
418 3300046491 Ga0495584_0027048 Ga0495584_0027048_357_995 212
419 3300046491 Ga0495584_0027755 Ga0495584_0027755_1948_2586 212
420 3300046491 Ga0495584_0032084 Ga0495584_0032084_1392_2030 212
421 3300046491 Ga0495584_0051362 Ga0495584_0051362_1389_2033 212
422 3300046491 Ga0495584_0071811 Ga0495584_0071811_991_1629 212
423 3300046491 Ga0495584_0076705 Ga0495584_0076705_467_1111 212
424 3300046491 Ga0495584_0185813 Ga0495584_0185813_87_725 212
425 3300046491 Ga0495584_0242058 Ga0495584_0242058_67_705 212
426 3300046492 Ga0495585_0000006 Ga0495585_0000006_314781_315419 212
427 3300046492 Ga0495585_0000064 Ga0495585_0000064_53437_54075 212
428 3300046492 Ga0495585_0002287 Ga0495585_0002287_12668_13306 212
429 3300046492 Ga0495585_0002576 Ga0495585_0002576_402_1040 212
430 3300046492 Ga0495585_0003985 Ga0495585_0003985_6710_7390 212
431 3300046492 Ga0495585_0004342 Ga0495585_0004342_3778_4416 212
432 3300046492 Ga0495585_0004490 Ga0495585_0004490_5952_6590 212
433 3300046492 Ga0495585_0005798 Ga0495585_0005798_5304_5942 212
434 3300046492 Ga0495585_0014043 Ga0495585_0014043_1180_1818 212
435 3300046492 Ga0495585_0047820 Ga0495585_0047820_175_813 212
436 3300046492 Ga0495585_0048409 Ga0495585_0048409_1056_1700 212
437 3300046492 Ga0495585_0062085 Ga0495585_0062085_182_820 212
438 3300046492 Ga0495585_0079079 Ga0495585_0079079_693_1331 212
439 3300046492 Ga0495585_0278465 Ga0495585_0278465_136_774 212
440 3300046499 Ga0495594_0010545 Ga0495594_0010545_4003_4647 212
441 3300046499 Ga0495594_0032405 Ga0495594_0032405_1308_1946 212
442 3300046499 Ga0495594_0072625 Ga0495594_0072625_30_668 212
443 3300046500 Ga0495596_0000550 Ga0495596_0000550_5516_6154 212
444 3300046500 Ga0495596_0002227 Ga0495596_0002227_7418_8056 212
445 3300046500 Ga0495596_0004778 Ga0495596_0004778_3454_4092 212
446 3300046500 Ga0495596_0008875 Ga0495596_0008875_2961_3605 212
447 3300046500 Ga0495596_0009006 Ga0495596_0009006_2754_3392 212
448 3300046500 Ga0495596_0017447 Ga0495596_0017447_377_1015 212
449 3300046500 Ga0495596_0021491 Ga0495596_0021491_1379_2017 212
450 3300046500 Ga0495596_0025031 Ga0495596_0025031_841_1479 212
451 3300046500 Ga0495596_0096228 Ga0495596_0096228_352_990 212
452 3300046501 Ga0495607_0002172 Ga0495607_0002172_2380_3018 212
453 3300046501 Ga0495607_0003491 Ga0495607_0003491_2935_3573 212
454 3300046501 Ga0495607_0006380 Ga0495607_0006380_810_1448 212
455 3300046501 Ga0495607_0007438 Ga0495607_0007438_3754_4392 212
456 3300046501 Ga0495607_0008285 Ga0495607_0008285_5008_5646 212
457 3300046501 Ga0495607_0018387 Ga0495607_0018387_1390_2028 212
458 3300046501 Ga0495607_0023637 Ga0495607_0023637_3039_3677 212
459 3300046501 Ga0495607_0032412 Ga0495607_0032412_2413_3051 212
460 3300046501 Ga0495607_0043236 Ga0495607_0043236_1863_2513 212
461 3300046501 Ga0495607_0052835 Ga0495607_0052835_1241_1879 212
462 3300046506 Ga0495583_0000056 Ga0495583_0000056_141054_141692 212
463 3300046506 Ga0495583_0000320 Ga0495583_0000320_60498_61136 212
464 3300046506 Ga0495583_0000344 Ga0495583_0000344_67077_67715 212
465 3300046506 Ga0495583_0000808 Ga0495583_0000808_34734_35372 212
466 3300046506 Ga0495583_0000864 Ga0495583_0000864_13355_13993 212
467 3300046506 Ga0495583_0002451 Ga0495583_0002451_12198_12836 212
468 3300046506 Ga0495583_0004193 Ga0495583_0004193_2206_2886 212
469 3300046506 Ga0495583_0004206 Ga0495583_0004206_6705_7343 212
470 3300046506 Ga0495583_0025151 Ga0495583_0025151_1391_2029 212
471 3300046506 Ga0495583_0026117 Ga0495583_0026117_2105_2743 212
472 3300046506 Ga0495583_0028021 Ga0495583_0028021_846_1484 212
473 3300046506 Ga0495583_0061266 Ga0495583_0061266_575_1213 212
474 3300046506 Ga0495583_0087270 Ga0495583_0087270_294_932 212
475 3300046506 Ga0495583_0138663 Ga0495583_0138663_31_669 212
476 3300046507 Ga0495606_0000024 Ga0495606_0000024_53509_54147 212
477 3300046507 Ga0495606_0000043 Ga0495606_0000043_50788_51426 212
478 3300046507 Ga0495606_0000920 Ga0495606_0000920_29470_30108 212
479 3300046507 Ga0495606_0001616 Ga0495606_0001616_20419_21057 212
480 3300046507 Ga0495606_0003205 Ga0495606_0003205_9056_9694 212
481 3300046507 Ga0495606_0003670 Ga0495606_0003670_13116_13754 212
482 3300046507 Ga0495606_0003817 Ga0495606_0003817_1533_2171 212
483 3300046507 Ga0495606_0008549 Ga0495606_0008549_2631_3329 212
484 3300046507 Ga0495606_0014675 Ga0495606_0014675_3084_3722 212
485 3300046507 Ga0495606_0035706 Ga0495606_0035706_2411_3049 212
486 3300046507 Ga0495606_0041147 Ga0495606_0041147_1958_2596 212
487 3300046507 Ga0495606_0139429 Ga0495606_0139429_452_1150 212
488 3300046507 Ga0495606_0251134 Ga0495606_0251134_205_843 212
489 3300046512 Ga0495610_0000004 Ga0495610_0000004_366344_366982 212
490 3300046512 Ga0495610_0000613 Ga0495610_0000613_18664_19302 212
491 3300046512 Ga0495610_0005202 Ga0495610_0005202_1416_2054 212
492 3300046513 Ga0495616_0000057 Ga0495616_0000057_44702_45382 212
493 3300046513 Ga0495616_0000727 Ga0495616_0000727_11678_12316 212
494 3300046513 Ga0495616_0000765 Ga0495616_0000765_22536_23174 212
495 3300046513 Ga0495616_0001904 Ga0495616_0001904_1780_2418 212
496 3300046513 Ga0495616_0003367 Ga0495616_0003367_2480_3118 212
497 3300046513 Ga0495616_0009006 Ga0495616_0009006_2859_3497 212
498 3300046513 Ga0495616_0010979 Ga0495616_0010979_1386_2030 212
499 3300046513 Ga0495616_0013917 Ga0495616_0013917_2957_3595 212
500 3300046513 Ga0495616_0017895 Ga0495616_0017895_1098_1736 212
501 3300046513 Ga0495616_0018263 Ga0495616_0018263_1656_2294 212
502 3300046513 Ga0495616_0036374 Ga0495616_0036374_1020_1658 212
503 3300046513 Ga0495616_0037678 Ga0495616_0037678_635_1273 212
504 3300046513 Ga0495616_0172725 Ga0495616_0172725_271_909 212
505 3300046517 Ga0495630_0495929 Ga0495630_0495929_80_718 212
506 3300046518 Ga0495631_0000703 Ga0495631_0000703_2648_3286 212
507 3300046518 Ga0495631_0001517 Ga0495631_0001517_7811_8449 212
508 3300046518 Ga0495631_0003602 Ga0495631_0003602_7649_8287 212
509 3300046518 Ga0495631_0003814 Ga0495631_0003814_3220_3858 212
510 3300046518 Ga0495631_0015024 Ga0495631_0015024_1336_1980 212
511 3300046518 Ga0495631_0015692 Ga0495631_0015692_2860_3498 212
512 3300046518 Ga0495631_0032249 Ga0495631_0032249_187_825 212
513 3300046518 Ga0495631_0051375 Ga0495631_0051375_654_1292 212
514 3300046518 Ga0495631_0073157 Ga0495631_0073157_547_1245 212
515 3300046518 Ga0495631_0130349 Ga0495631_0130349_381_1025 212
516 3300046519 Ga0495632_0000077 Ga0495632_0000077_14091_14729 212
517 3300046519 Ga0495632_0001081 Ga0495632_0001081_20269_20907 212
518 3300046519 Ga0495632_0004490 Ga0495632_0004490_1786_2424 212
519 3300046519 Ga0495632_0222471 Ga0495632_0222471_68_706 212
520 3300046520 Ga0495637_0000126 Ga0495637_0000126_15723_16361 212
521 3300046520 Ga0495637_0000327 Ga0495637_0000327_13207_13845 212
522 3300046520 Ga0495637_0006099 Ga0495637_0006099_2226_2864 212
523 3300046520 Ga0495637_0013723 Ga0495637_0013723_1757_2401 212
524 3300046520 Ga0495637_0027938 Ga0495637_0027938_820_1458 212
525 3300046520 Ga0495637_0031293 Ga0495637_0031293_263_901 212
526 3300046522 Ga0495643_0000415 Ga0495643_0000415_52396_53076 212
527 3300046522 Ga0495643_0000747 Ga0495643_0000747_21660_22328 212
528 3300046522 Ga0495643_0001870 Ga0495643_0001870_6671_7309 212
529 3300046522 Ga0495643_0002987 Ga0495643_0002987_1086_1724 212
530 3300046522 Ga0495643_0041150 Ga0495643_0041150_1482_2120 212
531 3300046522 Ga0495643_0224312 Ga0495643_0224312_156_800 212
532 3300046523 Ga0495644_0003414 Ga0495644_0003414_3308_3946 212
533 3300046523 Ga0495644_0006881 Ga0495644_0006881_1335_1973 212
534 3300046523 Ga0495644_0010124 Ga0495644_0010124_2403_3041 212
535 3300046523 Ga0495644_0017512 Ga0495644_0017512_976_1614 212
536 3300046523 Ga0495644_0019139 Ga0495644_0019139_743_1387 212
537 3300046523 Ga0495644_0052584 Ga0495644_0052584_275_913 212
538 3300046524 Ga0495648_0000007 Ga0495648_0000007_278302_278940 212
539 3300046524 Ga0495648_0000045 Ga0495648_0000045_120497_121141 212
540 3300046524 Ga0495648_0000534 Ga0495648_0000534_32444_33082 212
541 3300046524 Ga0495648_0000708 Ga0495648_0000708_25300_25938 212
542 3300046524 Ga0495648_0002581 Ga0495648_0002581_10469_11107 212
543 3300046524 Ga0495648_0008428 Ga0495648_0008428_1466_2146 212
544 3300046524 Ga0495648_0024977 Ga0495648_0024977_1965_2603 212
545 3300046524 Ga0495648_0054248 Ga0495648_0054248_1484_2122 212
546 3300046525 Ga0495663_0011742 Ga0495663_0011742_1059_1697 212
547 3300046526 Ga0495666_0000738 Ga0495666_0000738_13360_13998 212
548 3300046526 Ga0495666_0003203 Ga0495666_0003203_4029_4667 212
549 3300046526 Ga0495666_0043989 Ga0495666_0043989_272_916 212
550 3300046528 Ga0495642_0000422 Ga0495642_0000422_12226_12864 212
551 3300046528 Ga0495642_0000749 Ga0495642_0000749_6031_6669 212
552 3300046528 Ga0495642_0006403 Ga0495642_0006403_1195_1833 212
553 3300046528 Ga0495642_0017514 Ga0495642_0017514_510_1148 212
554 3300046528 Ga0495642_0020988 Ga0495642_0020988_1492_2169 212
555 3300046528 Ga0495642_0033497 Ga0495642_0033497_399_1097 212
556 3300046528 Ga0495642_0044315 Ga0495642_0044315_843_1481 212
557 3300046529 Ga0495652_0020998 Ga0495652_0020998_491_1129 212
558 3300046530 Ga0495654_0000004 Ga0495654_0000004_101650_102288 212
559 3300046530 Ga0495654_0005449 Ga0495654_0005449_4899_5537 212
560 3300046530 Ga0495654_0058694 Ga0495654_0058694_257_895 212
561 3300046530 Ga0495654_0103500 Ga0495654_0103500_79_717 212
562 3300046531 Ga0495665_0006321 Ga0495665_0006321_2470_3108 212
563 3300046531 Ga0495665_0028275 Ga0495665_0028275_2090_2734 212
564 3300046535 Ga0495586_0010284 Ga0495586_0010284_28_666 212
565 3300046535 Ga0495586_0038439 Ga0495586_0038439_1559_2203 212
566 3300046535 Ga0495586_0075084 Ga0495586_0075084_713_1351 212
567 3300046535 Ga0495586_0108725 Ga0495586_0108725_101_823 212
568 3300046536 Ga0495587_0020480 Ga0495587_0020480_2817_3455 212
569 3300046536 Ga0495587_0065793 Ga0495587_0065793_157_795 212
570 3300046538 Ga0495609_0000002 Ga0495609_0000002_436919_437557 212
571 3300046538 Ga0495609_0000433 Ga0495609_0000433_13228_13866 212
572 3300046538 Ga0495609_0010208 Ga0495609_0010208_2456_3094 212
573 3300046538 Ga0495609_0013379 Ga0495609_0013379_2737_3375 212
574 3300046538 Ga0495609_0015171 Ga0495609_0015171_2526_3164 212
575 3300046538 Ga0495609_0020581 Ga0495609_0020581_2338_2976 212
576 3300046538 Ga0495609_0022531 Ga0495609_0022531_1956_2600 212
577 3300046538 Ga0495609_0029689 Ga0495609_0029689_1690_2328 212
578 3300046538 Ga0495609_0072718 Ga0495609_0072718_800_1438 212
579 3300046538 Ga0495609_0126132 Ga0495609_0126132_160_798 212
580 3300046542 Ga0495597_0000523 Ga0495597_0000523_15175_15813 212
581 3300046542 Ga0495597_0001053 Ga0495597_0001053_13844_14482 212
582 3300046542 Ga0495597_0001374 Ga0495597_0001374_5964_6602 212
583 3300046542 Ga0495597_0002627 Ga0495597_0002627_3319_3957 212
584 3300046542 Ga0495597_0010108 Ga0495597_0010108_1608_2246 212
585 3300046542 Ga0495597_0016981 Ga0495597_0016981_1696_2334 212
586 3300046542 Ga0495597_0066102 Ga0495597_0066102_897_1535 212
587 3300046557 Ga0495622_0002130 Ga0495622_0002130_2186_2830 212
588 3300046557 Ga0495622_0026612 Ga0495622_0026612_1518_2156 212
589 3300046557 Ga0495622_0036812 Ga0495622_0036812_270_914 212
590 3300046557 Ga0495622_0040208 Ga0495622_0040208_1034_1678 212
591 3300046558 Ga0495633_0000504 Ga0495633_0000504_14025_14693 212
592 3300046558 Ga0495633_0001016 Ga0495633_0001016_7865_8509 212
593 3300046558 Ga0495633_0004300 Ga0495633_0004300_6193_6831 212
594 3300046558 Ga0495633_0005658 Ga0495633_0005658_4377_5015 212
595 3300046558 Ga0495633_0007382 Ga0495633_0007382_2933_3571 212
596 3300046558 Ga0495633_0012242 Ga0495633_0012242_663_1301 212
597 3300046558 Ga0495633_0013436 Ga0495633_0013436_3313_3957 212
598 3300046558 Ga0495633_0015734 Ga0495633_0015734_3162_3800 212
599 3300046558 Ga0495633_0019270 Ga0495633_0019270_1335_1973 212
600 3300046615 Ga0495656_0017227 Ga0495656_0017227_1671_2309 212
601 3300046615 Ga0495656_0023163 Ga0495656_0023163_429_1067 212
602 3300046615 Ga0495656_0025883 Ga0495656_0025883_81_719 212
603 3300046615 Ga0495656_0229934 Ga0495656_0229934_75_713 212
604 3300046616 Ga0495668_0000025 Ga0495668_0000025_242365_243003 212
605 3300046616 Ga0495668_0000126 Ga0495668_0000126_73453_74121 212
606 3300046616 Ga0495668_0000810 Ga0495668_0000810_8106_8744 212
607 3300046616 Ga0495668_0001707 Ga0495668_0001707_14655_15293 212
608 3300046616 Ga0495668_0002549 Ga0495668_0002549_1280_1918 212
609 3300046616 Ga0495668_0004065 Ga0495668_0004065_6653_7333 212
610 3300046616 Ga0495668_0005188 Ga0495668_0005188_5011_5649 212
611 3300046616 Ga0495668_0007538 Ga0495668_0007538_1412_2050 212
612 3300046616 Ga0495668_0009246 Ga0495668_0009246_3080_3718 212
613 3300046616 Ga0495668_0018131 Ga0495668_0018131_3097_3735 212
614 3300046616 Ga0495668_0020835 Ga0495668_0020835_850_1488 212
615 3300046616 Ga0495668_0025258 Ga0495668_0025258_1232_1870 212
616 3300046616 Ga0495668_0072635 Ga0495668_0072635_511_1149 212
617 3300046616 Ga0495668_0086465 Ga0495668_0086465_833_1471 212
618 3300046616 Ga0495668_0105530 Ga0495668_0105530_518_1216 212
619 3300046642 Ga0495634_0168123 Ga0495634_0168123_239_877 212
620 3300046648 Ga0495611_0000551 Ga0495611_0000551_2890_3528 212
621 3300046648 Ga0495611_0008248 Ga0495611_0008248_3749_4387 212
622 3300046648 Ga0495611_0014670 Ga0495611_0014670_1649_2287 212
623 3300046648 Ga0495611_0015059 Ga0495611_0015059_737_1375 212
624 3300046648 Ga0495611_0015669 Ga0495611_0015669_1032_1670 212
625 3300046648 Ga0495611_0056131 Ga0495611_0056131_473_1111 212
626 3300046648 Ga0495611_0056343 Ga0495611_0056343_707_1351 212
627 3300046648 Ga0495611_0084660 Ga0495611_0084660_245_883 212
628 3300046660 Ga0495625_0002773 Ga0495625_0002773_4582_5220 212
629 3300046660 Ga0495625_0002810 Ga0495625_0002810_10890_11534 212
630 3300046660 Ga0495625_0009260 Ga0495625_0009260_5854_6528 212
631 3300046660 Ga0495625_0012218 Ga0495625_0012218_6017_6655 212
632 3300046660 Ga0495625_0019633 Ga0495625_0019633_1317_1955 212
633 3300046660 Ga0495625_0037296 Ga0495625_0037296_2108_2746 212
634 3300046660 Ga0495625_0047348 Ga0495625_0047348_444_1082 212
635 3300046660 Ga0495625_0054637 Ga0495625_0054637_1162_1830 212
636 3300046660 Ga0495625_0055425 Ga0495625_0055425_1000_1683 212
637 3300046660 Ga0495625_0093667 Ga0495625_0093667_100_738 212
638 3300046664 Ga0495659_0000445 Ga0495659_0000445_11550_12188 212
639 3300046664 Ga0495659_0090261 Ga0495659_0090261_320_958 212
640 3300046664 Ga0495659_0115358 Ga0495659_0115358_183_821 212
641 3300046665 Ga0495661_0000859 Ga0495661_0000859_5130_5768 212
642 3300046665 Ga0495661_0001479 Ga0495661_0001479_6962_7636 212
643 3300046665 Ga0495661_0002355 Ga0495661_0002355_6584_7222 212
644 3300046665 Ga0495661_0004983 Ga0495661_0004983_1404_2048 212
645 3300046665 Ga0495661_0008804 Ga0495661_0008804_2719_3357 212
646 3300046665 Ga0495661_0009671 Ga0495661_0009671_182_820 212
647 3300046665 Ga0495661_0016891 Ga0495661_0016891_1792_2430 212
648 3300046665 Ga0495661_0022952 Ga0495661_0022952_1400_2038 212
649 3300046665 Ga0495661_0042189 Ga0495661_0042189_16_654 212
650 3300046665 Ga0495661_0048547 Ga0495661_0048547_142_780 212
651 3300046665 Ga0495661_0049026 Ga0495661_0049026_345_1025 212
652 3300046665 Ga0495661_0052103 Ga0495661_0052103_867_1565 212
653 3300046665 Ga0495661_0054316 Ga0495661_0054316_194_832 212
654 3300046665 Ga0495661_0059265 Ga0495661_0059265_982_1620 212
655 3300046665 Ga0495661_0087706 Ga0495661_0087706_739_1377 212
656 3300046665 Ga0495661_0097057 Ga0495661_0097057_49_747 212
657 3300046665 Ga0495661_0121558 Ga0495661_0121558_747_1421 212
658 3300046665 Ga0495661_0187558 Ga0495661_0187558_160_798 212
659 3300046665 Ga0495661_0243383 Ga0495661_0243383_54_692 212
660 3300046665 Ga0495661_0335104 Ga0495661_0335104_51_689 212
661 3300046674 Ga0495588_0000067 Ga0495588_0000067_219144_219782 212
662 3300046674 Ga0495588_0020049 Ga0495588_0020049_136_774 212
663 3300046674 Ga0495588_0087213 Ga0495588_0087213_65_742 212
664 3300046675 Ga0495657_0338102 Ga0495657_0338102_114_752 212
665 3300046678 Ga0495599_0297355 Ga0495599_0297355_42_680 212
666 3300046679 Ga0495623_0021263 Ga0495623_0021263_493_1131 212
667 3300046679 Ga0495623_0097997 Ga0495623_0097997_29_667 212
668 3300046679 Ga0495623_0160321 Ga0495623_0160321_481_1119 212
669 3300046680 Ga0495646_0085121 Ga0495646_0085121_884_1522 212
670 3300046680 Ga0495646_0159490 Ga0495646_0159490_547_1185 212
671 3300046680 Ga0495646_0224371 Ga0495646_0224371_109_747 212
672 3300046684 Ga0495669_0000401 Ga0495669_0000401_17624_18268 212
673 3300046684 Ga0495669_0000712 Ga0495669_0000712_4470_5108 212
674 3300046684 Ga0495669_0003709 Ga0495669_0003709_3071_3709 212
675 3300046684 Ga0495669_0020327 Ga0495669_0020327_1366_2004 212
676 3300046684 Ga0495669_0026832 Ga0495669_0026832_1141_1779 212
677 3300046689 Ga0495613_0150896 Ga0495613_0150896_46_690 212
678 3300046690 Ga0495624_0005808 Ga0495624_0005808_1220_1858 212
679 3300046690 Ga0495624_0145508 Ga0495624_0145508_751_1389 212
680 3300046691 Ga0495670_0001953 Ga0495670_0001953_1687_2325 212
681 3300046691 Ga0495670_0006207 Ga0495670_0006207_762_1400 212
682 3300046691 Ga0495670_0011529 Ga0495670_0011529_118_756 212
683 3300046691 Ga0495670_0012966 Ga0495670_0012966_268_906 212
684 3300046691 Ga0495670_0208416 Ga0495670_0208416_89_727 212
685 3300046691 Ga0495670_0287688 Ga0495670_0287688_182_820 212
686 3300046692 Ga0495671_0000001 Ga0495671_0000001_1014075_1014713 212
687 3300046692 Ga0495671_0007128 Ga0495671_0007128_4682_5362 212
688 3300046692 Ga0495671_0014118 Ga0495671_0014118_2544_3182 212
689 3300046692 Ga0495671_0017617 Ga0495671_0017617_2363_3001 212
690 3300046692 Ga0495671_0029571 Ga0495671_0029571_304_1002 212
691 3300046692 Ga0495671_0069513 Ga0495671_0069513_65_706 212
692 3300046692 Ga0495671_0080435 Ga0495671_0080435_621_1259 212
693 3300046692 Ga0495671_0084987 Ga0495671_0084987_595_1233 212
694 3300046694 Ga0495649_0001061 Ga0495649_0001061_18377_19015 212
695 3300046694 Ga0495649_0004351 Ga0495649_0004351_7579_8217 212
696 3300046694 Ga0495649_0013688 Ga0495649_0013688_1862_2500 212
697 3300046694 Ga0495649_0021684 Ga0495649_0021684_1380_2018 212
698 3300046694 Ga0495649_0103004 Ga0495649_0103004_102_743 212
699 3300046794 Ga0495589_0000324 Ga0495589_0000324_12306_12944 212
700 3300046794 Ga0495589_0000701 Ga0495589_0000701_4954_5592 212
701 3300046794 Ga0495589_0008247 Ga0495589_0008247_2500_3138 212
702 3300046794 Ga0495589_0013146 Ga0495589_0013146_2516_3154 212
703 3300046794 Ga0495589_0273682 Ga0495589_0273682_92_730 212
704 3300046794 Ga0495589_0275315 Ga0495589_0275315_14_652 212
705 3300046810 Ga0495660_0000026 Ga0495660_0000026_146337_146975 212
706 3300046810 Ga0495660_0007088 Ga0495660_0007088_1369_2007 212
707 3300046810 Ga0495660_0010717 Ga0495660_0010717_3467_4105 212
708 3300046810 Ga0495660_0020096 Ga0495660_0020096_791_1429 212
709 3300046810 Ga0495660_0021269 Ga0495660_0021269_542_1180 212
710 3300046810 Ga0495660_0031785 Ga0495660_0031785_1978_2616 212
711 3300046810 Ga0495660_0058419 Ga0495660_0058419_558_1196 212
712 3300047315 Ga0495581_0005532 Ga0495581_0005532_3352_3990 212
713 3300047315 Ga0495581_0133366 Ga0495581_0133366_290_934 212
714 3300047317 Ga0495604_0004090 Ga0495604_0004090_2874_3512 212
715 3300047318 Ga0495636_0004150 Ga0495636_0004150_2592_3230 212
716 3300047318 Ga0495636_0029856 Ga0495636_0029856_1269_1907 212
717 3300047319 Ga0495674_0004640 Ga0495674_0004640_3520_4164 212
718 3300047320 Ga0495672_0000041 Ga0495672_0000041_230087_230725 212
719 3300047320 Ga0495672_0000050 Ga0495672_0000050_151440_152078 212
720 3300047320 Ga0495672_0000454 Ga0495672_0000454_24205_24843 212
721 3300047320 Ga0495672_0000505 Ga0495672_0000505_2429_3097 212
722 3300047320 Ga0495672_0001726 Ga0495672_0001726_17998_18636 212
723 3300047320 Ga0495672_0001789 Ga0495672_0001789_5307_5945 212
724 3300047320 Ga0495672_0036121 Ga0495672_0036121_1174_1812 212
725 3300047320 Ga0495672_0041549 Ga0495672_0041549_823_1461 212
726 3300047320 Ga0495672_0052171 Ga0495672_0052171_406_1044 212
727 3300047320 Ga0495672_0123916 Ga0495672_0123916_453_1091 212
728 3300047321 Ga0495676_0000235 Ga0495676_0000235_25513_26151 212
729 3300047321 Ga0495676_0013662 Ga0495676_0013662_2197_2841 212
730 3300047322 Ga0495680_0009334 Ga0495680_0009334_8153_8797 212
731 3300047323 Ga0495683_0000203 Ga0495683_0000203_52836_53474 212
732 3300047323 Ga0495683_0000434 Ga0495683_0000434_24955_25593 212
733 3300047323 Ga0495683_0007966 Ga0495683_0007966_4836_5474 212
734 3300047323 Ga0495683_0086209 Ga0495683_0086209_782_1420 212
735 3300047323 Ga0495683_0123035 Ga0495683_0123035_466_1104 212
736 3300047443 Ga0495687_000013 Ga0495687_000013_299299_299937 212
737 3300047443 Ga0495687_000127 Ga0495687_000127_52203_52847 212
738 3300047443 Ga0495687_000143 Ga0495687_000143_55758_56396 212
739 3300047443 Ga0495687_000871 Ga0495687_000871_7902_8540 212
740 3300047443 Ga0495687_005119 Ga0495687_005119_2303_2941 212
741 3300047443 Ga0495687_008376 Ga0495687_008376_5015_5653 212
742 3300047443 Ga0495687_008545 Ga0495687_008545_4896_5534 212
743 3300047443 Ga0495687_009637 Ga0495687_009637_4639_5277 212
744 3300047444 Ga0495675_0001313 Ga0495675_0001313_14014_14652 212
745 3300047445 Ga0495677_0000098 Ga0495677_0000098_30561_31199 212
746 3300047445 Ga0495677_0001073 Ga0495677_0001073_9194_9832 212
747 3300047445 Ga0495677_0001928 Ga0495677_0001928_5130_5768 212
748 3300047445 Ga0495677_0003237 Ga0495677_0003237_5590_6228 212
749 3300047445 Ga0495677_0009863 Ga0495677_0009863_292_930 212
750 3300047445 Ga0495677_0012011 Ga0495677_0012011_325_963 212
751 3300047445 Ga0495677_0014037 Ga0495677_0014037_572_1216 212
752 3300047445 Ga0495677_0014123 Ga0495677_0014123_1035_1673 212
753 3300047445 Ga0495677_0023046 Ga0495677_0023046_770_1408 212
754 3300047445 Ga0495677_0028793 Ga0495677_0028793_165_803 212
755 3300047445 Ga0495677_0030832 Ga0495677_0030832_625_1263 212
756 3300047445 Ga0495677_0083203 Ga0495677_0083203_250_894 212
757 3300047446 Ga0495679_002036 Ga0495679_002036_2529_3167 212
758 3300047446 Ga0495679_021491 Ga0495679_021491_1040_1720 212
759 3300047446 Ga0495679_025773 Ga0495679_025773_1014_1652 212
760 3300047446 Ga0495679_042088 Ga0495679_042088_725_1363 212
761 3300047447 Ga0495685_000942 Ga0495685_000942_4091_4729 212
762 3300047447 Ga0495685_003481 Ga0495685_003481_2444_3082 212
763 3300047447 Ga0495685_016432 Ga0495685_016432_801_1445 212
764 3300047469 Ga0495673_0000006 Ga0495673_0000006_163946_164584 212
765 3300047469 Ga0495673_0000014 Ga0495673_0000014_306396_307034 212
766 3300047469 Ga0495673_0000430 Ga0495673_0000430_33129_33809 212
767 3300047469 Ga0495673_0058575 Ga0495673_0058575_23_661 212
768 3300047470 Ga0495681_0000647 Ga0495681_0000647_11956_12594 212
769 3300047470 Ga0495681_0005070 Ga0495681_0005070_5488_6126 212
770 3300047470 Ga0495681_0006678 Ga0495681_0006678_1567_2211 212
771 3300047470 Ga0495681_0008759 Ga0495681_0008759_1031_1669 212
772 3300047470 Ga0495681_0021487 Ga0495681_0021487_538_1176 212
773 3300047470 Ga0495681_0031803 Ga0495681_0031803_1239_1877 212
774 3300047470 Ga0495681_0041010 Ga0495681_0041010_1528_2166 212
775 3300047470 Ga0495681_0041705 Ga0495681_0041705_1133_1771 212
776 3300047472 Ga0495686_0000288 Ga0495686_0000288_31633_32271 212
777 3300047472 Ga0495686_0001006 Ga0495686_0001006_20295_20933 212
778 3300047472 Ga0495686_0001335 Ga0495686_0001335_19157_19795 212
779 3300047472 Ga0495686_0001432 Ga0495686_0001432_6239_6877 212
780 3300047472 Ga0495686_0023406 Ga0495686_0023406_2755_3393 212
781 3300047472 Ga0495686_0045610 Ga0495686_0045610_1452_2090 212
782 3300047472 Ga0495686_0125285 Ga0495686_0125285_727_1407 212
783 3300047673 Ga0495593_0005559 Ga0495593_0005559_3280_3918 212
784 3300047673 Ga0495593_0015881 Ga0495593_0015881_2237_2875 212
785 3300048088 Ga0495602_0030814 Ga0495602_0030814_171_809 212
786 3300048088 Ga0495602_0032483 Ga0495602_0032483_574_1212 212
787 3300048089 Ga0495614_0010817 Ga0495614_0010817_1375_2013 212
788 3300048089 Ga0495614_0021970 Ga0495614_0021970_1046_1768 212
789 3300048089 Ga0495614_0025445 Ga0495614_0025445_326_964 212
790 3300048090 Ga0495615_0004089 Ga0495615_0004089_1613_2251 212
791 3300048091 Ga0495626_0000003 Ga0495626_0000003_362461_363099 212
792 3300048091 Ga0495626_0000096 Ga0495626_0000096_88337_88975 212
793 3300048091 Ga0495626_0001123 Ga0495626_0001123_13055_13693 212
794 3300048091 Ga0495626_0002799 Ga0495626_0002799_4279_4917 212
795 3300048091 Ga0495626_0003171 Ga0495626_0003171_1253_1891 212
796 3300048091 Ga0495626_0010902 Ga0495626_0010902_2311_2949 212
797 3300048091 Ga0495626_0010929 Ga0495626_0010929_2835_3479 212
798 3300048091 Ga0495626_0010932 Ga0495626_0010932_3072_3710 212
799 3300048091 Ga0495626_0013054 Ga0495626_0013054_1213_1851 212
800 3300048091 Ga0495626_0018878 Ga0495626_0018878_2084_2722 212
801 3300048091 Ga0495626_0020338 Ga0495626_0020338_2516_3154 212
802 3300048091 Ga0495626_0028973 Ga0495626_0028973_1668_2306 212
803 3300048091 Ga0495626_0049881 Ga0495626_0049881_222_860 212
804 3300048091 Ga0495626_0102479 Ga0495626_0102479_45_683 212
805 3300048903 Ga0496100_0027033 Ga0496100_0027033_2689_3327 212
806 3300048903 Ga0496100_0275358 Ga0496100_0275358_486_1130 212
807 3300048904 Ga0496101_0073207 Ga0496101_0073207_58_696 212
808 3300048905 Ga0496102_0000194 Ga0496102_0000194_17528_18166 212
809 3300048905 Ga0496102_0072072 Ga0496102_0072072_379_1056 212
810 3300048905 Ga0496102_0717870 Ga0496102_0717870_137_781 212
811 3300048906 Ga0496103_0009176 Ga0496103_0009176_3886_4563 212
812 3300048906 Ga0496103_0021055 Ga0496103_0021055_1657_2295 212
813 3300048906 Ga0496103_0034059 Ga0496103_0034059_2104_2742 212
814 3300048909 Ga0496106_0005315 Ga0496106_0005315_3476_4117 212
815 3300048910 Ga0496107_0076728 Ga0496107_0076728_102_743 212
816 3300048911 Ga0496108_0040462 Ga0496108_0040462_1827_2465 212
817 3300048912 Ga0496109_0021209 Ga0496109_0021209_1848_2486 212
818 3300048913 Ga0496110_0006349 Ga0496110_0006349_3135_3773 212
819 3300048913 Ga0496110_0050784 Ga0496110_0050784_1377_2015 212
820 3300048915 Ga0496112_0653524 Ga0496112_0653524_43_681 212
821 3300048917 Ga0496114_0001342 Ga0496114_0001342_4925_5563 212
822 3300048917 Ga0496114_0029253 Ga0496114_0029253_1709_2347 212
823 3300048917 Ga0496114_0115921 Ga0496114_0115921_1349_1987 212
824 3300048917 Ga0496114_0118714 Ga0496114_0118714_825_1469 212
825 3300048918 Ga0496115_0062650 Ga0496115_0062650_285_923 212
826 3300048918 Ga0496115_0227964 Ga0496115_0227964_851_1489 212
827 3300048919 Ga0496116_0149178 Ga0496116_0149178_554_1192 212
828 3300048921 Ga0496118_0144473 Ga0496118_0144473_808_1446 212
829 3300048923 Ga0496120_0130363 Ga0496120_0130363_618_1256 212
830 3300048924 Ga0496121_0003188 Ga0496121_0003188_1702_2340 212
831 3300048924 Ga0496121_0060430 Ga0496121_0060430_2324_2962 212
832 3300048924 Ga0496121_0088120 Ga0496121_0088120_1670_2308 212
833 3300048925 Ga0496122_0000445 Ga0496122_0000445_23369_24007 212
834 3300048925 Ga0496122_0000968 Ga0496122_0000968_15159_15797 212
835 3300048925 Ga0496122_0024024 Ga0496122_0024024_3679_4317 212
836 3300048925 Ga0496122_0092819 Ga0496122_0092819_727_1365 212
837 3300048926 Ga0496123_0004226 Ga0496123_0004226_6609_7247 212
838 3300048926 Ga0496123_0004825 Ga0496123_0004825_13036_13674 212
839 3300048926 Ga0496123_0061417 Ga0496123_0061417_821_1459 212
840 3300048926 Ga0496123_0087936 Ga0496123_0087936_73_717 212
841 3300048927 Ga0496124_0009111 Ga0496124_0009111_4909_5547 212
842 3300048927 Ga0496124_0041731 Ga0496124_0041731_2286_2930 212
843 3300048927 Ga0496124_0085319 Ga0496124_0085319_601_1239 212
844 3300048927 Ga0496124_0118207 Ga0496124_0118207_948_1586 212
845 3300048927 Ga0496124_0278419 Ga0496124_0278419_346_984 212
846 3300048928 Ga0496125_0004258 Ga0496125_0004258_14331_14969 212
847 3300048929 Ga0496126_0015414 Ga0496126_0015414_2863_3501 212
848 3300049459 Ga0495678_000408 Ga0495678_000408_24359_24997 212
849 3300049459 Ga0495678_000910 Ga0495678_000910_14490_15158 212
850 3300049459 Ga0495678_001706 Ga0495678_001706_6995_7678 212
851 3300049459 Ga0495678_001938 Ga0495678_001938_253_891 212
852 3300049459 Ga0495678_003948 Ga0495678_003948_5423_6061 212
853 3300049459 Ga0495678_005643 Ga0495678_005643_3081_3719 212
854 3300049459 Ga0495678_041648 Ga0495678_041648_1113_1751 212
855 3300049459 Ga0495678_117639 Ga0495678_117639_112_798 212
856 3300049460 Ga0495682_0000351 Ga0495682_0000351_24223_24861 212
857 3300049460 Ga0495682_0001002 Ga0495682_0001002_4017_4655 212
858 3300049460 Ga0495682_0010776 Ga0495682_0010776_2723_3361 212
859 3300049460 Ga0495682_0014757 Ga0495682_0014757_1122_1760 212
860 3300049460 Ga0495682_0018316 Ga0495682_0018316_148_786 212
861 3300049460 Ga0495682_0099491 Ga0495682_0099491_52_720 212
862 3300049568 Ga0501031_0004117 Ga0501031_0004117_3796_4434 212
863 3300049568 Ga0501031_0015053 Ga0501031_0015053_878_1516 212
864 3300049569 Ga0501032_0002455 Ga0501032_0002455_3505_4143 212
865 3300049569 Ga0501032_0013401 Ga0501032_0013401_1385_2023 212
866 3300049570 Ga0501033_0002230 Ga0501033_0002230_7946_8584 212
867 3300049570 Ga0501033_0004514 Ga0501033_0004514_7807_8445 212
868 3300049570 Ga0501033_0004903 Ga0501033_0004903_7775_8413 212
869 3300049572 Ga0501036_0009324 Ga0501036_0009324_5560_6198 212
870 3300049572 Ga0501036_0306886 Ga0501036_0306886_425_1063 212
871 3300049573 Ga0501037_0063335 Ga0501037_0063335_341_979 212
872 3300049573 Ga0501037_0269985 Ga0501037_0269985_113_751 212
873 3300049574 Ga0501038_0015899 Ga0501038_0015899_3160_3798 212
874 3300049574 Ga0501038_0040448 Ga0501038_0040448_1737_2375 212
875 3300049574 Ga0501038_0041437 Ga0501038_0041437_213_851 212
876 3300049575 Ga0501039_0106454 Ga0501039_0106454_1359_1997 212
877 3300049575 Ga0501039_0172274 Ga0501039_0172274_876_1514 212
878 3300049576 Ga0501040_0002743 Ga0501040_0002743_3182_3820 212
879 3300049578 Ga0501042_0009794 Ga0501042_0009794_1828_2466 212
880 3300049579 Ga0501043_0005656 Ga0501043_0005656_2697_3335 212
881 3300049579 Ga0501043_0007467 Ga0501043_0007467_2376_3014 212
882 3300049579 Ga0501043_0085602 Ga0501043_0085602_327_965 212
883 3300049579 Ga0501043_0321037 Ga0501043_0321037_402_1040 212
884 3300049580 Ga0501046_0006116 Ga0501046_0006116_8043_8681 212
885 3300049580 Ga0501046_0046835 Ga0501046_0046835_1794_2432 212
886 3300049580 Ga0501046_0509580 Ga0501046_0509580_32_670 212
887 3300049581 Ga0501047_0091996 Ga0501047_0091996_341_979 212
888 3300049581 Ga0501047_0306976 Ga0501047_0306976_386_1024 212
889 3300049582 Ga0501048_0030133 Ga0501048_0030133_2952_3590 212
890 3300049584 Ga0501068_0003678 Ga0501068_0003678_1812_2450 212
891 3300049671 Ga0501238_002802 Ga0501238_002802_997_1635 212
892 3300049679 Ga0501249_005902 Ga0501249_005902_1168_1806 212
893 3300049766 Ga0501269_001331 Ga0501269_001331_912_1550 212
894 3300049822 Ga0501035_0001124 Ga0501035_0001124_7971_8609 212
895 3300049822 Ga0501035_0002256 Ga0501035_0002256_18402_19043 212
896 3300049822 Ga0501035_0057071 Ga0501035_0057071_1235_1873 212
897 3300049823 Ga0501044_0010900 Ga0501044_0010900_3810_4448 212
898 3300049823 Ga0501044_0015152 Ga0501044_0015152_6016_6654 212
899 3300049823 Ga0501044_0028349 Ga0501044_0028349_2195_2833 212
900 3300049824 Ga0501045_0004780 Ga0501045_0004780_1845_2483 212
901 3300050511 nmdc:mga08y16_15265_c1 nmdc:mga08y16_15265_c1_826_1464 212
902 3300050511 nmdc:mga08y16_256392_c1 nmdc:mga08y16_256392_c1_495_1133 212
903 3300053118 Ga0500594_0008642 Ga0500594_0008642_854_1531 212
904 3300053125 Ga0500618_000426 Ga0500618_000426_27538_28203 212
905 3300053125 Ga0500618_001765 Ga0500618_001765_4315_4953 212
906 3300053125 Ga0500618_003076 Ga0500618_003076_2569_3399 212
907 3300053145 Ga0500586_001291 Ga0500586_001291_2364_3002 212
908 3300053153 Ga0500616_0079532 Ga0500616_0079532_42_680 212
909 3300059490 Ga0587066_017614 Ga0587066_017614_320_958 212
910 3300059491 Ga0587070_032462 Ga0587070_032462_138_776 212
911 3300059505 Ga0587083_0001536 Ga0587083_0001536_1410_2054 212
912 3300059510 Ga0587090_015677 Ga0587090_015677_445_1083 212
913 3300059510 Ga0587090_054793 Ga0587090_054793_85_723 212
914 3300059511 Ga0587091_018907 Ga0587091_018907_488_1132 212
915 3300059512 Ga0587092_047516 Ga0587092_047516_68_706 212
916 3300059605 Ga0587106_043474 Ga0587106_043474_44_682 212
917 3300059623 Ga0587101_007192 Ga0587101_007192_457_1095 212
918 3300059625 Ga0587113_004574 Ga0587113_004574_263_970 212
919 3300059640 Ga0587067_013242 Ga0587067_013242_157_801 212
920 3300059641 Ga0587068_006947 Ga0587068_006947_535_1176 212
921 3300059646 Ga0587078_018517 Ga0587078_018517_175_813 212
922 3300060344 Ga0587071_018029 Ga0587071_018029_101_739 212
923 3300060344 Ga0587071_045861 Ga0587071_045861_101_739 212
924 3300061719 Ga0466962_0109336 Ga0466962_0109336_45_689 212

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

46

177

0.96

PF08534

Redoxin

Redoxin

45

195

0.86

PF10417

1-cysPrx_C

C-terminal domain of 1-Cys peroxiredoxin

197

237

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9786 3 211
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9738 3 211
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9696 2 211
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9649 2 211
1xcc-assembly2.cif.gz_D 1-cys peroxidoxin from plasmodium yoelli 0.9388 5 208
ID Description Score Start End Superfamily
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9644 146 209 3.30.1020.10
af_A0A0R0K508_6_109_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9542 5 106 3.40.30.10
af_P34227_199_260_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.941 146 208 3.30.1020.10
3a2vB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9403 1 141 3.40.30.10
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9357 146 209 3.30.1020.10
ID Description Score Start End GO Terms
AF-A0A1H2PQ68-F1-model_v4 Alkyl hydroperoxide reductase subunit AhpC (Peroxiredoxin) 0.9873 1 212 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A4Q3TGA5-F1-model_v4 Peroxidase 0.9867 137 212 GO:0051920
AF-A0A7Z1KZL8-F1-model_v4 deleted 0.9834 1 212
AF-A0A0M2WDS2-F1-model_v4 Selenocysteine-containing peroxiredoxin PrxU (EC 1.11.1.15) 0.9829 1 212 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A1H2PQ68-F1-model_v4 Alkyl hydroperoxide reductase subunit AhpC (Peroxiredoxin) 0.9827 1 212 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454

Feature Viewer

pLDDT pTM Quality
92.39 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map