F485820

General Info

Members Datasets Scaffolds Average Seq Length
923 323 1846 129

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100970754|Ga0070675_1009707541
Length 151
Sequence VRSGSEPGRAARIAAFEAVEAQVANQFVVQLKNEPGSMAVLAETLAARGVDLRAIGGGGLGGVGHVIMTTADDAATKAVLDEGGYTYYEGESILAEVDDRPGGMARVARELADAGVNIYGHLFLGRWGDRAMFAFVVDDTERARPILERKG

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
171 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
172 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
173 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
174 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
175 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
176 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
177 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
178 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
179 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
180 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
181 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
182 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
183 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
184 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
185 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
186 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
189 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
190 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
191 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
201 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
202 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
203 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
204 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
205 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
206 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
207 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
208 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
209 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
215 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
216 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
217 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
218 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
219 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
220 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
221 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
222 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
223 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
224 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
225 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
226 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
227 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
228 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
229 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
230 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
231 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
232 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
233 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
234 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
235 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
236 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
237 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
238 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
241 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
242 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
243 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
244 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
245 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
246 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
247 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
248 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
249 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
250 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
251 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
252 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
253 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
254 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
255 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
256 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
257 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
258 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
259 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
260 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
273 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
274 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
291 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
292 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
293 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
294 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
295 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
296 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
297 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
298 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
299 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
300 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
301 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
302 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
303 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
304 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
305 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
307 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
308 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
309 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
310 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
311 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
312 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
313 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
314 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
315 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
316 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
317 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
318 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
319 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
320 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
321 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
322 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
323 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.89
Metatranscriptomes 0.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 7.69
Rhizosphere 91.44
Stem 0
Stem Tuber 0
Unclassified 19.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_100970754 3300005354 Bacteria 780
2 JGI25406J46586_10006705 3300003203 Bacteria 5292
3 Ga0070676_10167750 3300005328 Bacteria 1418
4 Ga0070683_100496332 3300005329 Bacteria 1166
5 Ga0070683_100915679 3300005329 Unclassified 841
6 Ga0070683_101536871 3300005329 Unclassified 640
7 Ga0070690_100071315 3300005330 Unclassified 2257
8 Ga0070690_100462493 3300005330 Bacteria 943
9 Ga0070670_100138938 3300005331 Unclassified 2101
10 Ga0070670_100343930 3300005331 Bacteria 1310
11 Ga0068869_100161285 3300005334 Bacteria 1746
12 Ga0068869_100162104 3300005334 Unclassified 1741
13 Ga0068869_100826735 3300005334 Bacteria 798
14 Ga0070666_10384866 3300005335 Unclassified 1007
15 Ga0070666_10436981 3300005335 Unclassified 944
16 Ga0070666_11103817 3300005335 Bacteria 590
17 Ga0070680_100425633 3300005336 Unclassified 1133
18 Ga0070682_100108106 3300005337 Unclassified 1848
19 Ga0068868_101270969 3300005338 Bacteria 683
20 Ga0070660_100055189 3300005339 Unclassified 3070
21 Ga0070660_100510967 3300005339 Bacteria 1000
22 Ga0070689_100031880 3300005340 Bacteria 4006
23 Ga0070689_100363092 3300005340 Bacteria 1217
24 Ga0070689_101786040 3300005340 Bacteria 560
25 Ga0070691_10224861 3300005341 Bacteria 996
26 Ga0070687_100007332 3300005343 Bacteria 4590
27 Ga0070687_100109659 3300005343 Bacteria 1560
28 Ga0070687_100659609 3300005343 Unclassified 726
29 Ga0070661_101630558 3300005344 Unclassified 546
30 Ga0070692_10109443 3300005345 Bacteria 1526
31 Ga0070668_100158200 3300005347 Unclassified 1837
32 Ga0070669_100870917 3300005353 Bacteria 768
33 Ga0070669_101808553 3300005353 Unclassified 533
34 Ga0070675_100032866 3300005354 Unclassified 4201
35 Ga0070675_101788525 3300005354 Bacteria 567
36 Ga0070674_100066617 3300005356 Bacteria 2531
37 Ga0070674_100132943 3300005356 Bacteria 1857
38 Ga0070674_100540615 3300005356 Unclassified 976
39 Ga0070674_101451992 3300005356 Bacteria 615
40 Ga0070674_101490194 3300005356 Unclassified 608
41 Ga0070688_100112929 3300005365 Bacteria 1809
42 Ga0070688_100312472 3300005365 Unclassified 1139
43 Ga0070659_100030959 3300005366 Bacteria 4142
44 Ga0070667_100151424 3300005367 Bacteria 2038
45 Ga0070667_100487831 3300005367 Bacteria 1128
46 Ga0070703_10057485 3300005406 Bacteria 1263
47 Ga0070713_102001649 3300005436 Bacteria 562
48 Ga0070701_10027060 3300005438 Unclassified 2804
49 Ga0070701_10735738 3300005438 Bacteria 667
50 Ga0070705_100148353 3300005440 Unclassified 1553
51 Ga0070705_100297694 3300005440 Bacteria 1155
52 Ga0070705_100333404 3300005440 Unclassified 1100
53 Ga0070705_100722061 3300005440 Bacteria 785
54 Ga0070700_100025879 3300005441 Unclassified 3459
55 Ga0070700_100042626 3300005441 Bacteria 2788
56 Ga0070694_100141942 3300005444 Bacteria 1745
57 Ga0070694_100148524 3300005444 Bacteria 1709
58 Ga0070694_100179035 3300005444 Bacteria 1567
59 Ga0070708_100148013 3300005445 Unclassified 2182
60 Ga0070663_100103463 3300005455 Unclassified 2128
61 Ga0070663_100213766 3300005455 Bacteria 1511
62 Ga0070663_100330983 3300005455 Bacteria 1228
63 Ga0070678_100014359 3300005456 Bacteria 4996
64 Ga0070678_100112285 3300005456 Unclassified 2134
65 Ga0070678_100984120 3300005456 Bacteria 775
66 Ga0070662_100058497 3300005457 Bacteria 2805
67 Ga0070662_100081063 3300005457 Unclassified 2417
68 Ga0070662_100504081 3300005457 Bacteria 1010
69 Ga0070662_100990960 3300005457 Unclassified 719
70 Ga0070681_10883534 3300005458 Unclassified 812
71 Ga0070681_11026173 3300005458 Bacteria 745
72 Ga0068867_100058718 3300005459 Unclassified 2851
73 Ga0068867_100604307 3300005459 Bacteria 957
74 Ga0070685_10043436 3300005466 Bacteria 2570
75 Ga0070706_100171176 3300005467 Bacteria 2028
76 Ga0070706_100364916 3300005467 Unclassified 1345
77 Ga0070706_100723445 3300005467 Bacteria 923
78 Ga0070706_101748691 3300005467 Bacteria 566
79 Ga0070707_100000290 3300005468 Bacteria 49402
80 Ga0070707_100050303 3300005468 Bacteria 3994
81 Ga0070707_100126906 3300005468 Bacteria 2479
82 Ga0070707_100247588 3300005468 Bacteria 1734
83 Ga0070707_100865760 3300005468 Bacteria 868
84 Ga0070707_101246921 3300005468 Bacteria 710
85 Ga0070698_100023786 3300005471 Bacteria 6398
86 Ga0070698_100113470 3300005471 Bacteria 2675
87 Ga0070698_100185440 3300005471 Unclassified 2018
88 Ga0070698_100207726 3300005471 Unclassified 1893
89 Ga0070699_100003264 3300005518 Bacteria 14354
90 Ga0070699_100004917 3300005518 Bacteria 11786
91 Ga0070699_100038716 3300005518 Bacteria 4128
92 Ga0070699_100260427 3300005518 Bacteria 1551
93 Ga0070699_100327481 3300005518 Bacteria 1377
94 Ga0070699_100336099 3300005518 Bacteria 1359
95 Ga0070699_100596691 3300005518 Bacteria 1007
96 Ga0070679_100155762 3300005530 Unclassified 2259
97 Ga0070684_100171217 3300005535 Bacteria 1972
98 Ga0070684_100910705 3300005535 Bacteria 824
99 Ga0070684_101811715 3300005535 Bacteria 576
100 Ga0070697_100096715 3300005536 Bacteria 2450
101 Ga0070697_100226245 3300005536 Bacteria 1595
102 Ga0070697_101022989 3300005536 Bacteria 735
103 Ga0068853_100190340 3300005539 Unclassified 1864
104 Ga0068853_101945261 3300005539 Bacteria 570
105 Ga0070672_100440459 3300005543 Bacteria 1121
106 Ga0070672_100451772 3300005543 Unclassified 1107
107 Ga0070672_100692917 3300005543 Unclassified 892
108 Ga0070672_101301012 3300005543 Bacteria 649
109 Ga0070672_101784294 3300005543 Bacteria 553
110 Ga0070686_100107022 3300005544 Bacteria 1899
111 Ga0070686_100234421 3300005544 Unclassified 1333
112 Ga0070686_100566145 3300005544 Unclassified 891
113 Ga0070686_101253098 3300005544 Bacteria 618
114 Ga0070695_100202414 3300005545 Bacteria 1420
115 Ga0070695_100377780 3300005545 Unclassified 1068
116 Ga0070695_101287472 3300005545 Bacteria 603
117 Ga0070696_100004989 3300005546 Bacteria 8865
118 Ga0070696_100008069 3300005546 Bacteria 7036
119 Ga0070696_100104512 3300005546 Unclassified 2034
120 Ga0070696_100576526 3300005546 Unclassified 904
121 Ga0070696_101381285 3300005546 Bacteria 600
122 Ga0070693_100029114 3300005547 Bacteria 3010
123 Ga0070693_100068903 3300005547 Bacteria 2078
124 Ga0070693_100772561 3300005547 Bacteria 710
125 Ga0070665_101667713 3300005548 Bacteria 645
126 Ga0070704_100011823 3300005549 Bacteria 5370
127 Ga0070704_100129592 3300005549 Bacteria 1952
128 Ga0070704_101015391 3300005549 Unclassified 751
129 Ga0068855_100168076 3300005563 Bacteria 2485
130 Ga0070664_100151506 3300005564 Unclassified 2047
131 Ga0070664_102174500 3300005564 Bacteria 526
132 Ga0068857_100213230 3300005577 Unclassified 1762
133 Ga0068857_102400241 3300005577 Bacteria 518
134 Ga0068854_101381893 3300005578 Bacteria 636
135 Ga0068856_100591065 3300005614 Bacteria 1131
136 Ga0070702_100006998 3300005615 Bacteria 5375
137 Ga0070702_100038515 3300005615 Unclassified 2663
138 Ga0068852_100451202 3300005616 Bacteria 1273
139 Ga0068852_100668787 3300005616 Bacteria 1047
140 Ga0068852_100797764 3300005616 Unclassified 958
141 Ga0068859_100094096 3300005617 Unclassified 3048
142 Ga0068859_100094423 3300005617 Bacteria 3043
143 Ga0068859_100310675 3300005617 Bacteria 1670
144 Ga0068859_100837903 3300005617 Bacteria 1006
145 Ga0068859_102273174 3300005617 Bacteria 598
146 Ga0068864_100004996 3300005618 Bacteria 10867
147 Ga0068864_100034906 3300005618 Bacteria 4280
148 Ga0068864_100107285 3300005618 Bacteria 2484
149 Ga0068864_100213727 3300005618 Bacteria 1777
150 Ga0068864_100850234 3300005618 Bacteria 899
151 Ga0068864_102611675 3300005618 Unclassified 511
152 Ga0068866_10019474 3300005718 Bacteria 3091
153 Ga0068861_100051588 3300005719 Bacteria 3123
154 Ga0068861_100090076 3300005719 Unclassified 2419
155 Ga0068861_100762428 3300005719 Unclassified 905
156 Ga0068861_102627856 3300005719 Bacteria 507
157 Ga0068851_10532820 3300005834 Bacteria 708
158 Ga0068870_10041847 3300005840 Unclassified 2383
159 Ga0068870_10303364 3300005840 Bacteria 1009
160 Ga0068863_100216636 3300005841 Unclassified 1844
161 Ga0068863_100270172 3300005841 Unclassified 1646
162 Ga0068863_100593521 3300005841 Bacteria 1096
163 Ga0068863_100607659 3300005841 Unclassified 1083
164 Ga0068863_100798886 3300005841 Bacteria 941
165 Ga0068858_100101759 3300005842 Unclassified 2680
166 Ga0068858_100202107 3300005842 Bacteria 1879
167 Ga0068858_100376301 3300005842 Bacteria 1362
168 Ga0068858_101320740 3300005842 Unclassified 710
169 Ga0068858_102367207 3300005842 Bacteria 525
170 Ga0068860_100059116 3300005843 Bacteria 3645
171 Ga0068860_100466882 3300005843 Unclassified 1256
172 Ga0068860_100516977 3300005843 Bacteria 1193
173 Ga0068860_101763442 3300005843 Bacteria 641
174 Ga0068862_100093155 3300005844 Bacteria 2627
175 Ga0081455_10131408 3300005937 Bacteria 1957
176 Ga0081455_10264080 3300005937 Unclassified 1252
177 Ga0081539_10002120 3300005985 Bacteria 29394
178 Ga0081539_10011336 3300005985 Bacteria 7069
179 Ga0075365_10047055 3300006038 Bacteria 2834
180 Ga0075432_10220670 3300006058 Bacteria 758
181 Ga0097621_101454724 3300006237 Bacteria 650
182 Ga0097621_101836562 3300006237 Bacteria 578
183 Ga0097621_102033747 3300006237 Bacteria 549
184 Ga0097621_102194003 3300006237 Bacteria 528
185 Ga0068871_100161835 3300006358 Unclassified 1915
186 Ga0075428_100112611 3300006844 Bacteria 2964
187 Ga0075428_100662795 3300006844 Bacteria 1112
188 Ga0075431_100066179 3300006847 Bacteria 3731
189 Ga0075431_100662289 3300006847 Bacteria 1024
190 Ga0075433_10170009 3300006852 Bacteria 1940
191 Ga0075433_10233822 3300006852 Bacteria 1632
192 Ga0075433_10287407 3300006852 Bacteria 1456
193 Ga0075433_10546251 3300006852 Bacteria 1019
194 Ga0075433_10720776 3300006852 Bacteria 873
195 Ga0075434_100012357 3300006871 Bacteria 8091
196 Ga0075434_100261181 3300006871 Bacteria 1751
197 Ga0075434_100843894 3300006871 Bacteria 932
198 Ga0075434_102063625 3300006871 Bacteria 575
199 Ga0068865_100028312 3300006881 Unclassified 3708
200 Ga0068865_100664647 3300006881 Bacteria 887
201 Ga0068865_100739487 3300006881 Bacteria 844
202 Ga0075436_100238882 3300006914 Bacteria 1292
203 Ga0075436_100758998 3300006914 Bacteria 721
204 Ga0097620_100094098 3300006931 Unclassified 3048
205 Ga0097620_100094420 3300006931 Bacteria 3043
206 Ga0097620_100310656 3300006931 Bacteria 1670
207 Ga0097620_100837849 3300006931 Bacteria 1006
208 Ga0097620_102272465 3300006931 Bacteria 598
209 Ga0075435_100180516 3300007076 Bacteria 1784
210 Ga0075435_100537263 3300007076 Unclassified 1012
211 Ga0075435_101006407 3300007076 Bacteria 728
212 Ga0075435_101231499 3300007076 Bacteria 655
213 Ga0075435_101625471 3300007076 Bacteria 567
214 Ga0075435_101855758 3300007076 Bacteria 529
215 Ga0105251_10623624 3300009011 Bacteria 513
216 Ga0111539_10016640 3300009094 Bacteria 9113
217 Ga0111539_10065131 3300009094 Bacteria 4308
218 Ga0111539_10284069 3300009094 Bacteria 1926
219 Ga0111539_10521086 3300009094 Bacteria 1385
220 Ga0111539_10904528 3300009094 Bacteria 1026
221 Ga0105245_10023336 3300009098 Bacteria 5430
222 Ga0105245_10035268 3300009098 Bacteria 4439
223 Ga0105245_10162988 3300009098 Bacteria 2117
224 Ga0105245_10387818 3300009098 Bacteria 1393
225 Ga0105245_10415424 3300009098 Bacteria 1347
226 Ga0105245_10439351 3300009098 Bacteria 1311
227 Ga0105247_10225906 3300009101 Unclassified 1269
228 Ga0105247_10483044 3300009101 Bacteria 899
229 Ga0105247_10736800 3300009101 Unclassified 746
230 Ga0105247_10739176 3300009101 Unclassified 744
231 Ga0114129_10019533 3300009147 Bacteria 9648
232 Ga0114129_10024867 3300009147 Bacteria 8491
233 Ga0114129_10035818 3300009147 Bacteria 7008
234 Ga0114129_10061561 3300009147 Bacteria 5245
235 Ga0114129_10129699 3300009147 Bacteria 3465
236 Ga0114129_10771101 3300009147 Bacteria 1229
237 Ga0114129_10885808 3300009147 Archaea 1132
238 Ga0105243_10015358 3300009148 Bacteria 5793
239 Ga0105243_10252071 3300009148 Bacteria 1576
240 Ga0105243_10419907 3300009148 Unclassified 1247
241 Ga0105243_10506050 3300009148 Bacteria 1145
242 Ga0105243_10762785 3300009148 Bacteria 950
243 Ga0105243_10842978 3300009148 Bacteria 907
244 Ga0105243_10877418 3300009148 Bacteria 891
245 Ga0105243_11223962 3300009148 Bacteria 765
246 Ga0105243_12336836 3300009148 Unclassified 572
247 Ga0105241_10885955 3300009174 Bacteria 828
248 Ga0105241_11573706 3300009174 Bacteria 635
249 Ga0105242_10054799 3300009176 Unclassified 3260
250 Ga0105242_10164210 3300009176 Bacteria 1946
251 Ga0105242_10546810 3300009176 Bacteria 1109
252 Ga0105242_10752042 3300009176 Bacteria 960
253 Ga0105242_10829920 3300009176 Bacteria 918
254 Ga0105242_11188505 3300009176 Bacteria 781
255 Ga0105242_11350038 3300009176 Bacteria 738
256 Ga0105248_10310159 3300009177 Bacteria 1777
257 Ga0105248_10319689 3300009177 Unclassified 1748
258 Ga0105248_10954248 3300009177 Unclassified 969
259 Ga0105248_10959458 3300009177 Bacteria 966
260 Ga0105248_11078150 3300009177 Bacteria 908
261 Ga0105238_10207815 3300009551 Bacteria 1933
262 Ga0105238_11015535 3300009551 Bacteria 850
263 Ga0105249_10083825 3300009553 Unclassified 2968
264 Ga0105249_10207078 3300009553 Bacteria 1922
265 Ga0105249_11971011 3300009553 Bacteria 657
266 Ga0099796_10055830 3300010159 Bacteria 1384
267 Ga0105239_10130732 3300010375 Unclassified 2792
268 Ga0105239_10317356 3300010375 Bacteria 1757
269 Ga0105246_10170767 3300011119 Bacteria 1665
270 Ga0105246_10209569 3300011119 Bacteria 1520
271 Ga0105246_10300157 3300011119 Bacteria 1296
272 Ga0105246_10447527 3300011119 Bacteria 1085
273 Ga0105246_10906838 3300011119 Unclassified 791
274 Ga0105246_11460839 3300011119 Bacteria 640
275 Ga0157322_1036831 3300012490 Bacteria 546
276 Ga0157374_10488864 3300013296 Unclassified 1234
277 Ga0157374_11416213 3300013296 Bacteria 718
278 Ga0157378_10019427 3300013297 Bacteria 5974
279 Ga0157378_10252216 3300013297 Bacteria 1690
280 Ga0157378_10760061 3300013297 Bacteria 993
281 Ga0157378_10917872 3300013297 Bacteria 907
282 Ga0163162_10072927 3300013306 Bacteria 3488
283 Ga0163162_10178988 3300013306 Bacteria 2246
284 Ga0163162_10464913 3300013306 Bacteria 1397
285 Ga0163162_10869728 3300013306 Bacteria 1016
286 Ga0163162_10906489 3300013306 Bacteria 994
287 Ga0163162_11332534 3300013306 Bacteria 816
288 Ga0157372_11470786 3300013307 Bacteria 785
289 Ga0157372_11549917 3300013307 Bacteria 763
290 Ga0157375_10038549 3300013308 Bacteria 4588
291 Ga0157375_10057569 3300013308 Bacteria 3843
292 Ga0157375_10060608 3300013308 Bacteria 3753
293 Ga0157375_10153995 3300013308 Unclassified 2436
294 Ga0157375_11420511 3300013308 Bacteria 818
295 Ga0163163_10015603 3300014325 Bacteria 7027
296 Ga0163163_10068161 3300014325 Bacteria 3539
297 Ga0163163_10096558 3300014325 Bacteria 2976
298 Ga0163163_10126104 3300014325 Bacteria 2598
299 Ga0163163_10202400 3300014325 Bacteria 2034
300 Ga0163163_10211400 3300014325 Unclassified 1989
301 Ga0163163_10235951 3300014325 Bacteria 1878
302 Ga0163163_10278177 3300014325 Unclassified 1725
303 Ga0163163_10373953 3300014325 Bacteria 1482
304 Ga0163163_10950737 3300014325 Bacteria 923
305 Ga0163163_11196216 3300014325 Bacteria 823
306 Ga0163163_12716288 3300014325 Bacteria 552
307 Ga0157380_10122506 3300014326 Unclassified 2205
308 Ga0157380_10308433 3300014326 Bacteria 1461
309 Ga0157380_10489663 3300014326 Bacteria 1191
310 Ga0157380_11341649 3300014326 Bacteria 764
311 Ga0182008_10312101 3300014497 Bacteria 825
312 Ga0182008_10524122 3300014497 Unclassified 655
313 Ga0157377_10007586 3300014745 Bacteria 5248
314 Ga0157377_10061950 3300014745 Bacteria 2139
315 Ga0157377_10333474 3300014745 Bacteria 1012
316 Ga0157377_10348904 3300014745 Bacteria 992
317 Ga0157379_10125840 3300014968 Unclassified 2306
318 Ga0157379_10514826 3300014968 Bacteria 1110
319 Ga0157379_11815678 3300014968 Unclassified 599
320 Ga0157376_10193191 3300014969 Bacteria 1868
321 Ga0157376_10328228 3300014969 Bacteria 1457
322 Ga0157376_10511314 3300014969 Bacteria 1182
323 Ga0157376_10582944 3300014969 Unclassified 1111
324 Ga0157376_10767604 3300014969 Bacteria 974
325 Ga0163161_10055076 3300017792 Bacteria 2887
326 Ga0206356_10938136 3300020070 Bacteria 616
327 Ga0207653_10025473 3300025885 Bacteria 1892
328 Ga0207653_10056496 3300025885 Bacteria 1316
329 Ga0207642_10171829 3300025899 Bacteria 1173
330 Ga0207710_10355295 3300025900 Unclassified 747
331 Ga0207710_10704018 3300025900 Bacteria 530
332 Ga0207688_10014514 3300025901 Bacteria 4282
333 Ga0207688_10299259 3300025901 Bacteria 983
334 Ga0207680_10223958 3300025903 Unclassified 1290
335 Ga0207645_10036877 3300025907 Bacteria 3140
336 Ga0207643_10033540 3300025908 Unclassified 2873
337 Ga0207643_10044623 3300025908 Bacteria 2503
338 Ga0207643_10843786 3300025908 Bacteria 594
339 Ga0207684_10044888 3300025910 Bacteria 3748
340 Ga0207684_10311975 3300025910 Bacteria 1356
341 Ga0207684_10865351 3300025910 Bacteria 761
342 Ga0207684_11006304 3300025910 Unclassified 697
343 Ga0207654_10906769 3300025911 Bacteria 639
344 Ga0207707_11002593 3300025912 Bacteria 685
345 Ga0207707_11195507 3300025912 Bacteria 615
346 Ga0207671_10912487 3300025914 Bacteria 694
347 Ga0207660_10627747 3300025917 Bacteria 876
348 Ga0207660_10643898 3300025917 Bacteria 864
349 Ga0207662_10009714 3300025918 Bacteria 5304
350 Ga0207662_10018956 3300025918 Bacteria 3909
351 Ga0207662_10937698 3300025918 Unclassified 614
352 Ga0207657_10062832 3300025919 Unclassified 3177
353 Ga0207657_10730918 3300025919 Bacteria 768
354 Ga0207649_10316240 3300025920 Bacteria 1146
355 Ga0207652_11101306 3300025921 Bacteria 695
356 Ga0207652_11386872 3300025921 Unclassified 606
357 Ga0207646_10032308 3300025922 Bacteria 4737
358 Ga0207646_10170024 3300025922 Bacteria 1968
359 Ga0207646_10548873 3300025922 Bacteria 1039
360 Ga0207681_10634516 3300025923 Bacteria 885
361 Ga0207681_10979750 3300025923 Unclassified 709
362 Ga0207694_10843567 3300025924 Bacteria 774
363 Ga0207650_10171547 3300025925 Unclassified 1724
364 Ga0207650_10582906 3300025925 Unclassified 939
365 Ga0207650_10865016 3300025925 Bacteria 767
366 Ga0207659_10124995 3300025926 Unclassified 1977
367 Ga0207659_10368442 3300025926 Bacteria 1195
368 Ga0207659_10816438 3300025926 Bacteria 801
369 Ga0207687_10066658 3300025927 Bacteria 2559
370 Ga0207687_10088588 3300025927 Unclassified 2252
371 Ga0207687_10207748 3300025927 Bacteria 1534
372 Ga0207687_10364518 3300025927 Unclassified 1180
373 Ga0207687_10891493 3300025927 Bacteria 761
374 Ga0207687_11214581 3300025927 Unclassified 648
375 Ga0207644_11270249 3300025931 Bacteria 619
376 Ga0207690_10127573 3300025932 Unclassified 1857
377 Ga0207690_10179514 3300025932 Bacteria 1593
378 Ga0207690_10562393 3300025932 Bacteria 928
379 Ga0207706_10089337 3300025933 Unclassified 2709
380 Ga0207706_10141883 3300025933 Bacteria 2113
381 Ga0207706_10172787 3300025933 Bacteria 1899
382 Ga0207706_10197244 3300025933 Bacteria 1766
383 Ga0207706_11015748 3300025933 Bacteria 696
384 Ga0207686_10154402 3300025934 Bacteria 1602
385 Ga0207686_10213058 3300025934 Bacteria 1390
386 Ga0207686_10260915 3300025934 Bacteria 1270
387 Ga0207686_11280999 3300025934 Bacteria 601
388 Ga0207709_10171622 3300025935 Bacteria 1523
389 Ga0207709_10188695 3300025935 Bacteria 1462
390 Ga0207709_10270124 3300025935 Bacteria 1251
391 Ga0207709_10565281 3300025935 Bacteria 896
392 Ga0207670_10739210 3300025936 Bacteria 816
393 Ga0207670_10766510 3300025936 Unclassified 802
394 Ga0207669_10078563 3300025937 Unclassified 2103
395 Ga0207669_10993217 3300025937 Bacteria 705
396 Ga0207669_11370424 3300025937 Unclassified 602
397 Ga0207704_10026812 3300025938 Bacteria 3167
398 Ga0207704_10547638 3300025938 Bacteria 940
399 Ga0207691_10056139 3300025940 Bacteria 3588
400 Ga0207691_10170160 3300025940 Unclassified 1908
401 Ga0207691_10977785 3300025940 Bacteria 707
402 Ga0207711_10093758 3300025941 Bacteria 2645
403 Ga0207711_10548995 3300025941 Bacteria 1078
404 Ga0207711_11056964 3300025941 Bacteria 752
405 Ga0207689_10152690 3300025942 Bacteria 1903
406 Ga0207689_10337410 3300025942 Unclassified 1252
407 Ga0207689_10418396 3300025942 Unclassified 1118
408 Ga0207661_10188627 3300025944 Bacteria 1806
409 Ga0207661_10961868 3300025944 Unclassified 787
410 Ga0207679_10283103 3300025945 Unclassified 1422
411 Ga0207679_10656039 3300025945 Unclassified 949
412 Ga0207667_10134895 3300025949 Bacteria 2542
413 Ga0207651_10414205 3300025960 Bacteria 1149
414 Ga0207712_10069073 3300025961 Unclassified 2534
415 Ga0207712_10563461 3300025961 Bacteria 981
416 Ga0207668_10142022 3300025972 Unclassified 1848
417 Ga0207640_11702824 3300025981 Bacteria 569
418 Ga0207658_10077911 3300025986 Bacteria 2531
419 Ga0207658_10121208 3300025986 Bacteria 2086
420 Ga0207658_11806762 3300025986 Bacteria 558
421 Ga0207677_10947915 3300026023 Bacteria 778
422 Ga0207703_10086327 3300026035 Unclassified 2628
423 Ga0207639_10275528 3300026041 Unclassified 1477
424 Ga0207639_11161987 3300026041 Unclassified 724
425 Ga0207639_11594463 3300026041 Bacteria 612
426 Ga0207678_10047590 3300026067 Bacteria 3708
427 Ga0207678_10226717 3300026067 Bacteria 1600
428 Ga0207678_10377108 3300026067 Bacteria 1226
429 Ga0207708_10032182 3300026075 Unclassified 3984
430 Ga0207708_10069193 3300026075 Bacteria 2702
431 Ga0207708_10089332 3300026075 Bacteria 2374
432 Ga0207708_10134392 3300026075 Bacteria 1936
433 Ga0207708_10426865 3300026075 Unclassified 1100
434 Ga0207708_10470189 3300026075 Bacteria 1050
435 Ga0207708_10901095 3300026075 Unclassified 765
436 Ga0207708_11664087 3300026075 Bacteria 561
437 Ga0207702_11872164 3300026078 Bacteria 591
438 Ga0207641_10094515 3300026088 Bacteria 2622
439 Ga0207641_10695311 3300026088 Bacteria 1001
440 Ga0207641_10993168 3300026088 Bacteria 836
441 Ga0207641_10994922 3300026088 Unclassified 835
442 Ga0207648_10003439 3300026089 Bacteria 16610
443 Ga0207648_10330515 3300026089 Bacteria 1371
444 Ga0207648_10468591 3300026089 Bacteria 1149
445 Ga0207648_10493336 3300026089 Bacteria 1120
446 Ga0207648_11381038 3300026089 Unclassified 662
447 Ga0207676_10100042 3300026095 Unclassified 2401
448 Ga0207676_10219216 3300026095 Bacteria 1693
449 Ga0207676_10314967 3300026095 Bacteria 1434
450 Ga0207676_10622732 3300026095 Bacteria 1039
451 Ga0207676_11204432 3300026095 Bacteria 751
452 Ga0207674_10008530 3300026116 Bacteria 11825
453 Ga0207674_11332408 3300026116 Bacteria 687
454 Ga0207675_100028736 3300026118 Bacteria 5180
455 Ga0207675_100086911 3300026118 Unclassified 2936
456 Ga0207675_100219474 3300026118 Bacteria 1831
457 Ga0207675_100480534 3300026118 Unclassified 1235
458 Ga0207675_100483334 3300026118 Bacteria 1231
459 Ga0207675_101109805 3300026118 Unclassified 811
460 Ga0207675_101194003 3300026118 Unclassified 781
461 Ga0207675_101842238 3300026118 Bacteria 624
462 Ga0207683_10022163 3300026121 Bacteria 5451
463 Ga0207683_10079796 3300026121 Unclassified 2902
464 Ga0207683_10249488 3300026121 Bacteria 1620
465 Ga0207698_10404634 3300026142 Unclassified 1305
466 Ga0207698_10560013 3300026142 Bacteria 1122
467 Ga0207698_11369169 3300026142 Bacteria 722
468 Ga0209974_10007045 3300027876 Bacteria 3889
469 Ga0209974_10173392 3300027876 Unclassified 787
470 Ga0207428_10148558 3300027907 Unclassified 1785
471 Ga0268266_10865214 3300028379 Unclassified 874
472 Ga0268265_10144367 3300028380 Bacteria 1997
473 Ga0268265_10575597 3300028380 Bacteria 1073
474 Ga0268265_12099725 3300028380 Bacteria 572
475 Ga0268264_10115256 3300028381 Bacteria 2360
476 Ga0268264_10301864 3300028381 Bacteria 1508
477 Ga0268264_10445795 3300028381 Unclassified 1253
478 Ga0265326_10058855 3300028558 Bacteria 1087
479 Ga0265319_1017347 3300028563 Bacteria 2738
480 Ga0265319_1082400 3300028563 Bacteria 1021
481 Ga0265334_10001943 3300028573 Bacteria 9805
482 Ga0265334_10004633 3300028573 Bacteria 6074
483 Ga0265318_10010345 3300028577 Bacteria 4067
484 Ga0265318_10014342 3300028577 Bacteria 3330
485 Ga0265318_10016388 3300028577 Bacteria 3062
486 Ga0265318_10070895 3300028577 Bacteria 1291
487 Ga0265322_10024040 3300028654 Bacteria 1742
488 Ga0265322_10142344 3300028654 Bacteria 685
489 Ga0265336_10008491 3300028666 Bacteria 3601
490 Ga0265338_10034931 3300028800 Bacteria 4845
491 Ga0265338_10101284 3300028800 Bacteria 2346
492 Ga0265324_10008176 3300029957 Bacteria 4177
493 Ga0265324_10068147 3300029957 Bacteria 1213
494 Ga0265324_10101583 3300029957 Bacteria 977
495 Ga0265330_10303642 3300031235 Bacteria 673
496 Ga0265332_10006365 3300031238 Bacteria 5357
497 Ga0265328_10075045 3300031239 Bacteria 1244
498 Ga0265320_10001498 3300031240 Bacteria 17012
499 Ga0265320_10007410 3300031240 Bacteria 6814
500 Ga0265325_10008089 3300031241 Bacteria 6232
501 Ga0265325_10397012 3300031241 Bacteria 604
502 Ga0265329_10003806 3300031242 Bacteria 6482
503 Ga0265329_10005635 3300031242 Bacteria 5040
504 Ga0265340_10001877 3300031247 Bacteria 11969
505 Ga0265340_10404503 3300031247 Bacteria 602
506 Ga0265339_10009152 3300031249 Bacteria 6250
507 Ga0265339_10012944 3300031249 Bacteria 5071
508 Ga0265339_10058102 3300031249 Bacteria 2090
509 Ga0265339_10088770 3300031249 Bacteria 1623
510 Ga0265331_10016671 3300031250 Bacteria 3851
511 Ga0265331_10412040 3300031250 Bacteria 606
512 Ga0265316_10110871 3300031344 Bacteria 2078
513 Ga0265316_10119118 3300031344 Bacteria 1994
514 Ga0265316_10898187 3300031344 Unclassified 619
515 Ga0265313_10042081 3300031595 Bacteria 2246
516 Ga0265314_10001127 3300031711 Bacteria 30914
517 Ga0265314_10021038 3300031711 Bacteria 5027
518 Ga0265314_10276533 3300031711 Bacteria 952
519 Ga0265342_10015149 3300031712 Bacteria 5085
520 Ga0316576_10160731 3300031727 Bacteria 1694
521 Ga0307405_10258566 3300031731 Bacteria 1299
522 Ga0307413_10553978 3300031824 Unclassified 933
523 Ga0307413_11422991 3300031824 Bacteria 610
524 Ga0307410_10130314 3300031852 Bacteria 1847
525 Ga0307410_10231424 3300031852 Bacteria 1427
526 Ga0307406_10261548 3300031901 Bacteria 1309
527 Ga0307407_10565025 3300031903 Bacteria 843
528 Ga0307412_10191706 3300031911 Bacteria 1546
529 Ga0307412_10603499 3300031911 Bacteria 930
530 Ga0307409_100131540 3300031995 Bacteria 2139
531 Ga0307409_100359397 3300031995 Bacteria 1377
532 Ga0307416_100405208 3300032002 Bacteria 1403
533 Ga0307416_100543089 3300032002 Unclassified 1234
534 Ga0307416_101251509 3300032002 Bacteria 848
535 Ga0307416_101328505 3300032002 Unclassified 825
536 Ga0307416_101448618 3300032002 Bacteria 792
537 Ga0307415_100049288 3300032126 Bacteria 2847
538 Ga0307415_100136765 3300032126 Bacteria 1865
539 Ga0307415_100187912 3300032126 Bacteria 1627
540 Ga0307415_101979620 3300032126 Bacteria 567
541 Ga0373938_0076967 3300034957 Bacteria 807
542 Ga0373952_0162070 3300035092 Bacteria 634
543 Ga0373932_0422924 3300035112 Bacteria 519
544 Ga0373941_0026029 3300035115 Bacteria 1696
545 Ga0373941_0459806 3300035115 Bacteria 535
546 Ga0373960_0284178 3300035121 Bacteria 611
547 Ga0373943_0962522 3300035170 Bacteria 511
548 Ga0373961_0178401 3300035241 Bacteria 739
549 Ga0316574_0097936 3300035398 Bacteria 1875
550 Ga0373931_0078894 3300035691 Bacteria 1812
551 Ga0373937_0448142 3300036401 Unclassified 1226
552 Ga0373937_0590370 3300036401 Unclassified 1055
553 Ga0373937_0746085 3300036401 Bacteria 926
554 Ga0395900_0679730 3300037418 Bacteria 964
555 Ga0395905_0290479 3300037471 Bacteria 1522
556 Ga0395905_0953909 3300037471 Unclassified 761
557 Ga0395905_1567147 3300037471 Bacteria 563
558 Ga0395901_0973059 3300038443 Bacteria 826
559 Ga0242420_065388 3300038996 Bacteria 732
560 Ga0439439_0185965 3300041406 Bacteria 600
561 Ga0439453_0042708 3300041408 Bacteria 894
562 Ga0451800_0784458 3300041459 Bacteria 532
563 Ga0451802_2022771 3300041460 Bacteria 780
564 Ga0451839_0535126 3300041496 Bacteria 640
565 Ga0451843_0977027 3300041509 Bacteria 517
566 Ga0451853_1580022 3300041512 Bacteria 675
567 Ga0451853_2430070 3300041512 Bacteria 934
568 Ga0451853_2653829 3300041512 Bacteria 543
569 Ga0451853_3475761 3300041512 Bacteria 763
570 Ga0439431_0182800 3300041997 Bacteria 606
571 Ga0439445_0149398 3300042004 Bacteria 680
572 Ga0439452_059949 3300042010 Bacteria 854
573 Ga0439456_133750 3300042013 Unclassified 573
574 Ga0450920_093293 3300042122 Unclassified 622
575 Ga0450920_093712 3300042122 Bacteria 620
576 Ga0450920_130043 3300042122 Bacteria 530
577 Ga0450906_058475 3300042145 Bacteria 684
578 Ga0439446_0022435 3300042156 Bacteria 1790
579 Ga0439446_0068544 3300042156 Bacteria 1082
580 Ga0450909_053996 3300042185 Bacteria 630
581 Ga0439434_0081229 3300042435 Bacteria 1029
582 Ga0439434_0216041 3300042435 Bacteria 650
583 Ga0439435_0105595 3300042436 Unclassified 870
584 Ga0439459_0140241 3300042438 Bacteria 624
585 Ga0439460_0115721 3300042461 Bacteria 874
586 Ga0451577_2002995 3300042876 Bacteria 506
587 Ga0453683_0360827 3300044673 Bacteria 934
588 Ga0466960_1042946 3300044901 Bacteria 504
589 Ga0451576_0208745 3300045051 Bacteria 2040
590 Ga0451576_0703505 3300045051 Bacteria 1062
591 Ga0495603_0093249 3300046455 Bacteria 1760
592 Ga0495629_0105254 3300046459 Bacteria 1968
593 Ga0495629_0946338 3300046459 Bacteria 563
594 Ga0495641_0126666 3300046461 Bacteria 1140
595 Ga0495641_0436007 3300046461 Bacteria 596
596 Ga0495651_0248432 3300046462 Unclassified 1216
597 Ga0495582_0696652 3300046473 Bacteria 588
598 Ga0495664_0631171 3300046477 Unclassified 636
599 Ga0495584_0499085 3300046491 Bacteria 620
600 Ga0495608_0461830 3300046511 Unclassified 772
601 Ga0495618_0250690 3300046514 Unclassified 1111
602 Ga0495628_0561832 3300046516 Bacteria 818
603 Ga0495631_0373482 3300046518 Bacteria 607
604 Ga0495644_0194542 3300046523 Bacteria 781
605 Ga0495644_0353498 3300046523 Unclassified 579
606 Ga0495587_0370491 3300046536 Bacteria 797
607 Ga0495656_0302452 3300046615 Bacteria 820
608 Ga0495656_0308081 3300046615 Bacteria 813
609 Ga0495656_0341489 3300046615 Bacteria 774
610 Ga0495656_0606877 3300046615 Unclassified 586
611 Ga0495668_0342198 3300046616 Bacteria 821
612 Ga0495659_0143446 3300046664 Bacteria 955
613 Ga0495647_0317400 3300046681 Bacteria 705
614 Ga0495624_0265811 3300046690 Bacteria 1036
615 Ga0495624_0407720 3300046690 Unclassified 816
616 Ga0495581_0695796 3300047315 Bacteria 586
617 Ga0495604_0081845 3300047317 Bacteria 2416
618 Ga0495674_0152941 3300047319 Bacteria 1934
619 Ga0495672_0542443 3300047320 Unclassified 511
620 Ga0495676_0682754 3300047321 Bacteria 665
621 Ga0496100_0011594 3300048903 Bacteria 5022
622 Ga0496100_0709892 3300048903 Bacteria 785
623 Ga0496100_0790157 3300048903 Bacteria 743
624 Ga0496100_1085552 3300048903 Bacteria 631
625 Ga0496101_0000872 3300048904 Bacteria 17776
626 Ga0496101_0363591 3300048904 Unclassified 1138
627 Ga0496101_0419367 3300048904 Bacteria 1055
628 Ga0496101_0427795 3300048904 Bacteria 1044
629 Ga0496102_0079132 3300048905 Bacteria 3027
630 Ga0496102_0294692 3300048905 Bacteria 1529
631 Ga0496102_0334738 3300048905 Bacteria 1426
632 Ga0496102_0390483 3300048905 Bacteria 1309
633 Ga0496102_0519986 3300048905 Bacteria 1113
634 Ga0496102_0772648 3300048905 Bacteria 883
635 Ga0496102_1605578 3300048905 Unclassified 569
636 Ga0496103_0286918 3300048906 Bacteria 1059
637 Ga0496103_0440201 3300048906 Bacteria 836
638 Ga0496103_0632553 3300048906 Bacteria 681
639 Ga0496103_0929009 3300048906 Unclassified 544
640 Ga0496103_0946468 3300048906 Bacteria 538
641 Ga0496104_0014647 3300048907 Bacteria 7084
642 Ga0496104_0015340 3300048907 Bacteria 6937
643 Ga0496105_0000581 3300048908 Bacteria 24264
644 Ga0496105_0154928 3300048908 Unclassified 1882
645 Ga0496105_0197698 3300048908 Bacteria 1642
646 Ga0496105_0845929 3300048908 Bacteria 693
647 Ga0496105_0987240 3300048908 Bacteria 630
648 Ga0496106_0046452 3300048909 Bacteria 3265
649 Ga0496106_0224204 3300048909 Bacteria 1500
650 Ga0496106_0415049 3300048909 Bacteria 1082
651 Ga0496107_0096589 3300048910 Bacteria 2163
652 Ga0496107_0178428 3300048910 Bacteria 1577
653 Ga0496107_0343189 3300048910 Unclassified 1111
654 Ga0496107_1032142 3300048910 Bacteria 596
655 Ga0496108_0001990 3300048911 Bacteria 16355
656 Ga0496108_0010666 3300048911 Bacteria 7454
657 Ga0496108_0030442 3300048911 Bacteria 4473
658 Ga0496108_0095399 3300048911 Bacteria 2532
659 Ga0496108_0237950 3300048911 Bacteria 1584
660 Ga0496108_0508207 3300048911 Bacteria 1052
661 Ga0496108_1426591 3300048911 Unclassified 578
662 Ga0496109_0007477 3300048912 Bacteria 9255
663 Ga0496109_0049499 3300048912 Bacteria 3825
664 Ga0496109_0059207 3300048912 Bacteria 3499
665 Ga0496109_0070365 3300048912 Bacteria 3211
666 Ga0496109_0242534 3300048912 Bacteria 1696
667 Ga0496109_0477587 3300048912 Bacteria 1177
668 Ga0496109_1082804 3300048912 Bacteria 739
669 Ga0496109_1308119 3300048912 Bacteria 661
670 Ga0496110_0007113 3300048913 Bacteria 8911
671 Ga0496110_0009071 3300048913 Bacteria 8029
672 Ga0496110_0081321 3300048913 Bacteria 2888
673 Ga0496110_0463856 3300048913 Bacteria 1154
674 Ga0496111_0000720 3300048914 Bacteria 17632
675 Ga0496111_0240530 3300048914 Unclassified 1344
676 Ga0496111_1080654 3300048914 Bacteria 572
677 Ga0496112_0000012 3300048915 Bacteria 243643
678 Ga0496112_0038602 3300048915 Bacteria 4663
679 Ga0496112_0336035 3300048915 Bacteria 1454
680 Ga0496112_0414141 3300048915 Bacteria 1287
681 Ga0496112_0446070 3300048915 Bacteria 1232
682 Ga0496113_0028780 3300048916 Bacteria 4000
683 Ga0496113_0118455 3300048916 Unclassified 2068
684 Ga0496113_0310000 3300048916 Bacteria 1264
685 Ga0496113_0499992 3300048916 Unclassified 976
686 Ga0496114_0003028 3300048917 Bacteria 12889
687 Ga0496114_0154624 3300048917 Bacteria 1991
688 Ga0496114_0314323 3300048917 Bacteria 1384
689 Ga0496114_1052915 3300048917 Bacteria 698
690 Ga0501031_0031443 3300049568 Bacteria 3463
691 Ga0501031_0063979 3300049568 Bacteria 2396
692 Ga0501031_0119000 3300049568 Bacteria 1726
693 Ga0501031_0124284 3300049568 Bacteria 1685
694 Ga0501031_0559156 3300049568 Bacteria 737
695 Ga0501032_0016466 3300049569 Bacteria 5200
696 Ga0501033_0227705 3300049570 Bacteria 1325
697 Ga0501033_0250712 3300049570 Bacteria 1255
698 Ga0501033_0512474 3300049570 Bacteria 829
699 Ga0501033_0653815 3300049570 Bacteria 718
700 Ga0501033_0712866 3300049570 Unclassified 682
701 Ga0501033_1210930 3300049570 Archaea 500
702 Ga0501034_1613367 3300049571 Bacteria 522
703 Ga0501036_0036858 3300049572 Bacteria 4137
704 Ga0501036_0078740 3300049572 Bacteria 2788
705 Ga0501036_0087432 3300049572 Bacteria 2634
706 Ga0501036_0116002 3300049572 Bacteria 2262
707 Ga0501036_0299380 3300049572 Bacteria 1345
708 Ga0501036_0354919 3300049572 Bacteria 1224
709 Ga0501036_0567165 3300049572 Unclassified 943
710 Ga0501036_0692906 3300049572 Bacteria 842
711 Ga0501037_0253001 3300049573 Bacteria 1232
712 Ga0501037_0587714 3300049573 Bacteria 749
713 Ga0501038_0041215 3300049574 Bacteria 4027
714 Ga0501038_0085048 3300049574 Bacteria 2661
715 Ga0501038_0115236 3300049574 Bacteria 2222
716 Ga0501038_0467885 3300049574 Bacteria 968
717 Ga0501038_0509168 3300049574 Bacteria 920
718 Ga0501039_0031605 3300049575 Bacteria 4082
719 Ga0501039_0095223 3300049575 Bacteria 2321
720 Ga0501039_0152389 3300049575 Bacteria 1816
721 Ga0501039_0224022 3300049575 Bacteria 1478
722 Ga0501039_0252823 3300049575 Bacteria 1385
723 Ga0501039_0607759 3300049575 Bacteria 857
724 Ga0501040_0011147 3300049576 Bacteria 5877
725 Ga0501040_0017541 3300049576 Bacteria 4752
726 Ga0501040_0027921 3300049576 Bacteria 3801
727 Ga0501040_0076212 3300049576 Bacteria 2319
728 Ga0501040_0111224 3300049576 Bacteria 1915
729 Ga0501040_0115325 3300049576 Bacteria 1881
730 Ga0501041_0038493 3300049577 Bacteria 2900
731 Ga0501041_0094020 3300049577 Bacteria 1851
732 Ga0501041_0130930 3300049577 Bacteria 1562
733 Ga0501041_0137218 3300049577 Bacteria 1524
734 Ga0501041_0340352 3300049577 Bacteria 947
735 Ga0501042_0040671 3300049578 Bacteria 3305
736 Ga0501042_0059941 3300049578 Bacteria 2718
737 Ga0501042_0111362 3300049578 Bacteria 1971
738 Ga0501042_0390114 3300049578 Bacteria 1008
739 Ga0501042_0836785 3300049578 Bacteria 670
740 Ga0501043_0023491 3300049579 Bacteria 4836
741 Ga0501043_0946528 3300049579 Bacteria 615
742 Ga0501043_1005794 3300049579 Bacteria 593
743 Ga0501043_1225344 3300049579 Bacteria 526
744 Ga0501046_0060612 3300049580 Bacteria 2960
745 Ga0501046_0177205 3300049580 Bacteria 1596
746 Ga0501046_0254362 3300049580 Bacteria 1292
747 Ga0501046_0663518 3300049580 Bacteria 737
748 Ga0501048_0018491 3300049582 Bacteria 5123
749 Ga0501048_0045084 3300049582 Bacteria 3151
750 Ga0501048_0109088 3300049582 Bacteria 1954
751 Ga0501048_0178839 3300049582 Bacteria 1503
752 Ga0501048_0273395 3300049582 Bacteria 1201
753 Ga0501048_0687160 3300049582 Bacteria 735
754 Ga0501048_0979574 3300049582 Bacteria 608
755 Ga0501067_0005924 3300049583 Bacteria 6777
756 Ga0501067_0037466 3300049583 Bacteria 2694
757 Ga0501067_0115880 3300049583 Bacteria 1490
758 Ga0501068_0040609 3300049584 Bacteria 2794
759 Ga0501068_0084716 3300049584 Bacteria 1950
760 Ga0501069_0089169 3300049585 Bacteria 1743
761 Ga0501069_0302571 3300049585 Bacteria 938
762 Ga0501070_0131886 3300049586 Bacteria 2064
763 Ga0501070_0390552 3300049586 Bacteria 1126
764 Ga0501070_0445479 3300049586 Bacteria 1044
765 Ga0501070_0550379 3300049586 Bacteria 924
766 Ga0501070_0927922 3300049586 Bacteria 678
767 Ga0501071_0001369 3300049587 Bacteria 13973
768 Ga0501071_0041141 3300049587 Bacteria 3309
769 Ga0501071_0054587 3300049587 Bacteria 2882
770 Ga0501071_0056100 3300049587 Bacteria 2845
771 Ga0501071_0108713 3300049587 Bacteria 2048
772 Ga0501071_0171577 3300049587 Bacteria 1624
773 Ga0501071_0382881 3300049587 Bacteria 1073
774 Ga0501071_0435038 3300049587 Bacteria 1003
775 Ga0501071_0535138 3300049587 Bacteria 899
776 Ga0501071_0565348 3300049587 Bacteria 874
777 Ga0501072_0014411 3300049588 Bacteria 6059
778 Ga0501072_0051845 3300049588 Bacteria 3230
779 Ga0501072_0071663 3300049588 Bacteria 2738
780 Ga0501072_0129498 3300049588 Unclassified 2011
781 Ga0501072_0331857 3300049588 Bacteria 1208
782 Ga0501072_0395075 3300049588 Bacteria 1097
783 Ga0501072_0852025 3300049588 Bacteria 713
784 Ga0501072_1414334 3300049588 Bacteria 538
785 Ga0501073_0168114 3300049589 Bacteria 1518
786 Ga0501073_0236452 3300049589 Bacteria 1262
787 Ga0501073_1068531 3300049589 Unclassified 555
788 Ga0501073_1146739 3300049589 Bacteria 534
789 Ga0501074_0088615 3300049590 Bacteria 2216
790 Ga0501074_0104553 3300049590 Bacteria 2027
791 Ga0501074_0132195 3300049590 Bacteria 1785
792 Ga0501074_0178026 3300049590 Bacteria 1517
793 Ga0501074_0339889 3300049590 Unclassified 1066
794 Ga0501074_0409887 3300049590 Unclassified 961
795 Ga0501075_0023128 3300049591 Bacteria 4548
796 Ga0501075_0035448 3300049591 Bacteria 3721
797 Ga0501075_0038094 3300049591 Bacteria 3594
798 Ga0501075_0049934 3300049591 Bacteria 3144
799 Ga0501075_0130379 3300049591 Bacteria 1915
800 Ga0501075_0174183 3300049591 Bacteria 1642
801 Ga0501075_0229469 3300049591 Unclassified 1416
802 Ga0501075_0283781 3300049591 Bacteria 1261
803 Ga0501075_1042886 3300049591 Bacteria 621
804 Ga0501075_1069260 3300049591 Bacteria 613
805 Ga0501075_1418908 3300049591 Bacteria 526
806 Ga0501076_0006950 3300049592 Bacteria 8226
807 Ga0501076_0082619 3300049592 Bacteria 2579
808 Ga0501076_0088872 3300049592 Bacteria 2483
809 Ga0501076_0142568 3300049592 Bacteria 1947
810 Ga0501076_0228435 3300049592 Bacteria 1521
811 Ga0501076_0363807 3300049592 Bacteria 1188
812 Ga0501076_0400004 3300049592 Unclassified 1129
813 Ga0501076_0428552 3300049592 Bacteria 1088
814 Ga0501076_0773849 3300049592 Bacteria 792
815 Ga0501076_0964125 3300049592 Unclassified 703
816 Ga0501076_1624810 3300049592 Bacteria 530
817 Ga0501077_0020076 3300049593 Bacteria 4228
818 Ga0501077_0064216 3300049593 Bacteria 2329
819 Ga0501077_0105771 3300049593 Bacteria 1783
820 Ga0501077_0113587 3300049593 Bacteria 1717
821 Ga0501077_0228051 3300049593 Bacteria 1184
822 Ga0501077_0251209 3300049593 Bacteria 1124
823 Ga0501077_0454737 3300049593 Unclassified 820
824 Ga0501079_0004307 3300049741 Bacteria 10564
825 Ga0501079_0014517 3300049741 Bacteria 6008
826 Ga0501079_0036479 3300049741 Bacteria 3787
827 Ga0501079_0187088 3300049741 Bacteria 1616
828 Ga0501079_0234507 3300049741 Bacteria 1434
829 Ga0501079_0260452 3300049741 Bacteria 1355
830 Ga0501079_0650852 3300049741 Bacteria 829
831 Ga0501079_0702175 3300049741 Archaea 796
832 Ga0501080_0031946 3300049742 Bacteria 4907
833 Ga0501080_0043089 3300049742 Bacteria 4201
834 Ga0501080_0134411 3300049742 Bacteria 2289
835 Ga0501080_0320325 3300049742 Bacteria 1404
836 Ga0501080_0352465 3300049742 Bacteria 1329
837 Ga0501080_1014516 3300049742 Bacteria 719
838 Ga0501080_1546728 3300049742 Bacteria 563
839 Ga0501081_0030851 3300049743 Bacteria 3631
840 Ga0501081_0043456 3300049743 Bacteria 3083
841 Ga0501081_0044693 3300049743 Bacteria 3041
842 Ga0501081_0052480 3300049743 Bacteria 2814
843 Ga0501081_0772841 3300049743 Bacteria 722
844 Ga0501081_1298052 3300049743 Bacteria 552
845 Ga0501083_0161735 3300049744 Bacteria 1465
846 Ga0501083_0226042 3300049744 Bacteria 1219
847 Ga0501083_0274239 3300049744 Unclassified 1097
848 Ga0501035_0141277 3300049822 Bacteria 2093
849 Ga0501035_0158292 3300049822 Bacteria 1962
850 Ga0501035_0211535 3300049822 Bacteria 1659
851 Ga0501045_0006628 3300049824 Bacteria 8025
852 Ga0501045_0170368 3300049824 Bacteria 1622
853 Ga0501045_0175018 3300049824 Bacteria 1599
854 Ga0501045_0284327 3300049824 Bacteria 1231
855 Ga0501045_0502336 3300049824 Bacteria 901
856 Ga0501045_0559532 3300049824 Bacteria 848
857 nmdc:mga0yw44_372291_c1 3300050492 Bacteria 964
858 nmdc:mga05p37_1088114_c1 3300050507 Bacteria 839
859 nmdc:mga05p37_13160_c1 3300050507 Bacteria 9903
860 nmdc:mga05p37_29045_c1 3300050507 Bacteria 6748
861 nmdc:mga05p37_309457_c1 3300050507 Bacteria 1873
862 nmdc:mga05p37_431007_c1 3300050507 Bacteria 1532
863 nmdc:mga05p37_687055_c1 3300050507 Bacteria 1139
864 nmdc:mga05p37_764891_c1 3300050507 Archaea 1062
865 nmdc:mga05p37_89551_c1 3300050507 Bacteria 3792
866 nmdc:mga06r32_604729_c1 3300050510 Bacteria 1067
867 nmdc:mga06r32_99639_c1 3300050510 Bacteria 2850
868 nmdc:mga08y16_148953_c1 3300050511 Bacteria 2433
869 nmdc:mga08y16_31535_c1 3300050511 Bacteria 5574
870 nmdc:mga08y16_91638_c1 3300050511 Unclassified 3167
871 nmdc:mga0n895_1126745_c1 3300050512 Bacteria 761
872 nmdc:mga0n895_14388_c1 3300050512 Bacteria 7182
873 nmdc:mga0n895_1750667_c1 3300050512 Unclassified 583
874 nmdc:mga0n895_1875070_c1 3300050512 Bacteria 559
875 nmdc:mga0n895_422661_c1 3300050512 Bacteria 1347
876 nmdc:mga0n895_784852_c1 3300050512 Bacteria 944
877 nmdc:mga0rr50_1320002_c1 3300050513 Bacteria 612
878 nmdc:mga0rr50_259671_c1 3300050513 Bacteria 1445
879 nmdc:mga0rr50_528011_c1 3300050513 Unclassified 1004
880 nmdc:mga0rr50_558199_c1 3300050513 Unclassified 975
881 nmdc:mga08x19_279074_c1 3300050514 Unclassified 1157
882 nmdc:mga08x19_313180_c1 3300050514 Unclassified 1091
883 nmdc:mga08x19_767452_c1 3300050514 Bacteria 685
884 nmdc:mga08x19_825310_c1 3300050514 Unclassified 658
885 nmdc:mga0a205_160448_c1 3300050515 Unclassified 2145
886 nmdc:mga0a205_20976_c1 3300050515 Bacteria 6175
887 nmdc:mga0a205_216027_c1 3300050515 Bacteria 1804
888 nmdc:mga0a205_24744_c1 3300050515 Bacteria 5712
889 nmdc:mga0a205_402133_c1 3300050515 Bacteria 1233
890 nmdc:mga0a205_528432_c1 3300050515 Bacteria 1036
891 nmdc:mga0a205_668583_c1 3300050515 Bacteria 889
892 Ga0495612_0000106 3300053078 Bacteria 35725
893 Ga0495595_0444154 3300053084 Unclassified 659
894 Ga0495619_0150521 3300053085 Bacteria 1605
895 Ga0501084_0086236 3300054114 Bacteria 2636
896 Ga0501084_0143408 3300054114 Bacteria 2012
897 Ga0501084_0147979 3300054114 Bacteria 1978
898 Ga0501084_0172720 3300054114 Bacteria 1824
899 Ga0501084_0242704 3300054114 Bacteria 1520
900 Ga0501084_0728531 3300054114 Bacteria 836
901 Ga0501084_1513425 3300054114 Bacteria 561
902 Ga0590071_001827 3300059421 Bacteria 5495
903 Ga0590075_002708 3300059424 Bacteria 4237
904 Ga0590075_063403 3300059424 Unclassified 953
905 Ga0590077_019669 3300059426 Unclassified 1431
906 Ga0590077_170748 3300059426 Unclassified 523
907 Ga0501082_0021804 3300060353 Bacteria 5522
908 Ga0501082_0051125 3300060353 Bacteria 3562
909 Ga0501082_0051373 3300060353 Bacteria 3553
910 Ga0501082_0121670 3300060353 Bacteria 2262
911 Ga0501082_0220412 3300060353 Bacteria 1650
912 Ga0501082_0736116 3300060353 Archaea 863
913 Ga0501082_1114942 3300060353 Bacteria 690
914 Ga0501082_1158402 3300060353 Bacteria 676
915 Ga0501082_1212601 3300060353 Bacteria 659
916 Ga0501082_1933932 3300060353 Bacteria 514
917 Ga0530510_0001133 3300061734 Bacteria 17731
918 Ga0530510_0028432 3300061734 Bacteria 4009
919 Ga0530510_0168605 3300061734 Bacteria 1621
920 Ga0530510_0259688 3300061734 Bacteria 1295
921 Ga0530510_0479945 3300061734 Bacteria 942
922 Ga0530510_0646765 3300061734 Bacteria 805
923 Ga0530510_0679532 3300061734 Bacteria 784
924 Ga0070675_100970754
925 JGI25406J46586_10006705
926 Ga0070676_10167750
927 Ga0070683_100496332
928 Ga0070683_100915679
929 Ga0070683_101536871
930 Ga0070690_100071315
931 Ga0070690_100462493
932 Ga0070670_100138938
933 Ga0070670_100343930
934 Ga0068869_100161285
935 Ga0068869_100162104
936 Ga0068869_100826735
937 Ga0070666_10384866
938 Ga0070666_10436981
939 Ga0070666_11103817
940 Ga0070680_100425633
941 Ga0070682_100108106
942 Ga0068868_101270969
943 Ga0070660_100055189
944 Ga0070660_100510967
945 Ga0070689_100031880
946 Ga0070689_100363092
947 Ga0070689_101786040
948 Ga0070691_10224861
949 Ga0070687_100007332
950 Ga0070687_100109659
951 Ga0070687_100659609
952 Ga0070661_101630558
953 Ga0070692_10109443
954 Ga0070668_100158200
955 Ga0070669_100870917
956 Ga0070669_101808553
957 Ga0070675_100032866
958 Ga0070675_101788525
959 Ga0070674_100066617
960 Ga0070674_100132943
961 Ga0070674_100540615
962 Ga0070674_101451992
963 Ga0070674_101490194
964 Ga0070688_100112929
965 Ga0070688_100312472
966 Ga0070659_100030959
967 Ga0070667_100151424
968 Ga0070667_100487831
969 Ga0070703_10057485
970 Ga0070713_102001649
971 Ga0070701_10027060
972 Ga0070701_10735738
973 Ga0070705_100148353
974 Ga0070705_100297694
975 Ga0070705_100333404
976 Ga0070705_100722061
977 Ga0070700_100025879
978 Ga0070700_100042626
979 Ga0070694_100141942
980 Ga0070694_100148524
981 Ga0070694_100179035
982 Ga0070708_100148013
983 Ga0070663_100103463
984 Ga0070663_100213766
985 Ga0070663_100330983
986 Ga0070678_100014359
987 Ga0070678_100112285
988 Ga0070678_100984120
989 Ga0070662_100058497
990 Ga0070662_100081063
991 Ga0070662_100504081
992 Ga0070662_100990960
993 Ga0070681_10883534
994 Ga0070681_11026173
995 Ga0068867_100058718
996 Ga0068867_100604307
997 Ga0070685_10043436
998 Ga0070706_100171176
999 Ga0070706_100364916
1000 Ga0070706_100723445
1001 Ga0070706_101748691
1002 Ga0070707_100000290
1003 Ga0070707_100050303
1004 Ga0070707_100126906
1005 Ga0070707_100247588
1006 Ga0070707_100865760
1007 Ga0070707_101246921
1008 Ga0070698_100023786
1009 Ga0070698_100113470
1010 Ga0070698_100185440
1011 Ga0070698_100207726
1012 Ga0070699_100003264
1013 Ga0070699_100004917
1014 Ga0070699_100038716
1015 Ga0070699_100260427
1016 Ga0070699_100327481
1017 Ga0070699_100336099
1018 Ga0070699_100596691
1019 Ga0070679_100155762
1020 Ga0070684_100171217
1021 Ga0070684_100910705
1022 Ga0070684_101811715
1023 Ga0070697_100096715
1024 Ga0070697_100226245
1025 Ga0070697_101022989
1026 Ga0068853_100190340
1027 Ga0068853_101945261
1028 Ga0070672_100440459
1029 Ga0070672_100451772
1030 Ga0070672_100692917
1031 Ga0070672_101301012
1032 Ga0070672_101784294
1033 Ga0070686_100107022
1034 Ga0070686_100234421
1035 Ga0070686_100566145
1036 Ga0070686_101253098
1037 Ga0070695_100202414
1038 Ga0070695_100377780
1039 Ga0070695_101287472
1040 Ga0070696_100004989
1041 Ga0070696_100008069
1042 Ga0070696_100104512
1043 Ga0070696_100576526
1044 Ga0070696_101381285
1045 Ga0070693_100029114
1046 Ga0070693_100068903
1047 Ga0070693_100772561
1048 Ga0070665_101667713
1049 Ga0070704_100011823
1050 Ga0070704_100129592
1051 Ga0070704_101015391
1052 Ga0068855_100168076
1053 Ga0070664_100151506
1054 Ga0070664_102174500
1055 Ga0068857_100213230
1056 Ga0068857_102400241
1057 Ga0068854_101381893
1058 Ga0068856_100591065
1059 Ga0070702_100006998
1060 Ga0070702_100038515
1061 Ga0068852_100451202
1062 Ga0068852_100668787
1063 Ga0068852_100797764
1064 Ga0068859_100094096
1065 Ga0068859_100094423
1066 Ga0068859_100310675
1067 Ga0068859_100837903
1068 Ga0068859_102273174
1069 Ga0068864_100004996
1070 Ga0068864_100034906
1071 Ga0068864_100107285
1072 Ga0068864_100213727
1073 Ga0068864_100850234
1074 Ga0068864_102611675
1075 Ga0068866_10019474
1076 Ga0068861_100051588
1077 Ga0068861_100090076
1078 Ga0068861_100762428
1079 Ga0068861_102627856
1080 Ga0068851_10532820
1081 Ga0068870_10041847
1082 Ga0068870_10303364
1083 Ga0068863_100216636
1084 Ga0068863_100270172
1085 Ga0068863_100593521
1086 Ga0068863_100607659
1087 Ga0068863_100798886
1088 Ga0068858_100101759
1089 Ga0068858_100202107
1090 Ga0068858_100376301
1091 Ga0068858_101320740
1092 Ga0068858_102367207
1093 Ga0068860_100059116
1094 Ga0068860_100466882
1095 Ga0068860_100516977
1096 Ga0068860_101763442
1097 Ga0068862_100093155
1098 Ga0081455_10131408
1099 Ga0081455_10264080
1100 Ga0081539_10002120
1101 Ga0081539_10011336
1102 Ga0075365_10047055
1103 Ga0075432_10220670
1104 Ga0097621_101454724
1105 Ga0097621_101836562
1106 Ga0097621_102033747
1107 Ga0097621_102194003
1108 Ga0068871_100161835
1109 Ga0075428_100112611
1110 Ga0075428_100662795
1111 Ga0075431_100066179
1112 Ga0075431_100662289
1113 Ga0075433_10170009
1114 Ga0075433_10233822
1115 Ga0075433_10287407
1116 Ga0075433_10546251
1117 Ga0075433_10720776
1118 Ga0075434_100012357
1119 Ga0075434_100261181
1120 Ga0075434_100843894
1121 Ga0075434_102063625
1122 Ga0068865_100028312
1123 Ga0068865_100664647
1124 Ga0068865_100739487
1125 Ga0075436_100238882
1126 Ga0075436_100758998
1127 Ga0097620_100094098
1128 Ga0097620_100094420
1129 Ga0097620_100310656
1130 Ga0097620_100837849
1131 Ga0097620_102272465
1132 Ga0075435_100180516
1133 Ga0075435_100537263
1134 Ga0075435_101006407
1135 Ga0075435_101231499
1136 Ga0075435_101625471
1137 Ga0075435_101855758
1138 Ga0105251_10623624
1139 Ga0111539_10016640
1140 Ga0111539_10065131
1141 Ga0111539_10284069
1142 Ga0111539_10521086
1143 Ga0111539_10904528
1144 Ga0105245_10023336
1145 Ga0105245_10035268
1146 Ga0105245_10162988
1147 Ga0105245_10387818
1148 Ga0105245_10415424
1149 Ga0105245_10439351
1150 Ga0105247_10225906
1151 Ga0105247_10483044
1152 Ga0105247_10736800
1153 Ga0105247_10739176
1154 Ga0114129_10019533
1155 Ga0114129_10024867
1156 Ga0114129_10035818
1157 Ga0114129_10061561
1158 Ga0114129_10129699
1159 Ga0114129_10771101
1160 Ga0114129_10885808
1161 Ga0105243_10015358
1162 Ga0105243_10252071
1163 Ga0105243_10419907
1164 Ga0105243_10506050
1165 Ga0105243_10762785
1166 Ga0105243_10842978
1167 Ga0105243_10877418
1168 Ga0105243_11223962
1169 Ga0105243_12336836
1170 Ga0105241_10885955
1171 Ga0105241_11573706
1172 Ga0105242_10054799
1173 Ga0105242_10164210
1174 Ga0105242_10546810
1175 Ga0105242_10752042
1176 Ga0105242_10829920
1177 Ga0105242_11188505
1178 Ga0105242_11350038
1179 Ga0105248_10310159
1180 Ga0105248_10319689
1181 Ga0105248_10954248
1182 Ga0105248_10959458
1183 Ga0105248_11078150
1184 Ga0105238_10207815
1185 Ga0105238_11015535
1186 Ga0105249_10083825
1187 Ga0105249_10207078
1188 Ga0105249_11971011
1189 Ga0099796_10055830
1190 Ga0105239_10130732
1191 Ga0105239_10317356
1192 Ga0105246_10170767
1193 Ga0105246_10209569
1194 Ga0105246_10300157
1195 Ga0105246_10447527
1196 Ga0105246_10906838
1197 Ga0105246_11460839
1198 Ga0157322_1036831
1199 Ga0157374_10488864
1200 Ga0157374_11416213
1201 Ga0157378_10019427
1202 Ga0157378_10252216
1203 Ga0157378_10760061
1204 Ga0157378_10917872
1205 Ga0163162_10072927
1206 Ga0163162_10178988
1207 Ga0163162_10464913
1208 Ga0163162_10869728
1209 Ga0163162_10906489
1210 Ga0163162_11332534
1211 Ga0157372_11470786
1212 Ga0157372_11549917
1213 Ga0157375_10038549
1214 Ga0157375_10057569
1215 Ga0157375_10060608
1216 Ga0157375_10153995
1217 Ga0157375_11420511
1218 Ga0163163_10015603
1219 Ga0163163_10068161
1220 Ga0163163_10096558
1221 Ga0163163_10126104
1222 Ga0163163_10202400
1223 Ga0163163_10211400
1224 Ga0163163_10235951
1225 Ga0163163_10278177
1226 Ga0163163_10373953
1227 Ga0163163_10950737
1228 Ga0163163_11196216
1229 Ga0163163_12716288
1230 Ga0157380_10122506
1231 Ga0157380_10308433
1232 Ga0157380_10489663
1233 Ga0157380_11341649
1234 Ga0182008_10312101
1235 Ga0182008_10524122
1236 Ga0157377_10007586
1237 Ga0157377_10061950
1238 Ga0157377_10333474
1239 Ga0157377_10348904
1240 Ga0157379_10125840
1241 Ga0157379_10514826
1242 Ga0157379_11815678
1243 Ga0157376_10193191
1244 Ga0157376_10328228
1245 Ga0157376_10511314
1246 Ga0157376_10582944
1247 Ga0157376_10767604
1248 Ga0163161_10055076
1249 Ga0206356_10938136
1250 Ga0207653_10025473
1251 Ga0207653_10056496
1252 Ga0207642_10171829
1253 Ga0207710_10355295
1254 Ga0207710_10704018
1255 Ga0207688_10014514
1256 Ga0207688_10299259
1257 Ga0207680_10223958
1258 Ga0207645_10036877
1259 Ga0207643_10033540
1260 Ga0207643_10044623
1261 Ga0207643_10843786
1262 Ga0207684_10044888
1263 Ga0207684_10311975
1264 Ga0207684_10865351
1265 Ga0207684_11006304
1266 Ga0207654_10906769
1267 Ga0207707_11002593
1268 Ga0207707_11195507
1269 Ga0207671_10912487
1270 Ga0207660_10627747
1271 Ga0207660_10643898
1272 Ga0207662_10009714
1273 Ga0207662_10018956
1274 Ga0207662_10937698
1275 Ga0207657_10062832
1276 Ga0207657_10730918
1277 Ga0207649_10316240
1278 Ga0207652_11101306
1279 Ga0207652_11386872
1280 Ga0207646_10032308
1281 Ga0207646_10170024
1282 Ga0207646_10548873
1283 Ga0207681_10634516
1284 Ga0207681_10979750
1285 Ga0207694_10843567
1286 Ga0207650_10171547
1287 Ga0207650_10582906
1288 Ga0207650_10865016
1289 Ga0207659_10124995
1290 Ga0207659_10368442
1291 Ga0207659_10816438
1292 Ga0207687_10066658
1293 Ga0207687_10088588
1294 Ga0207687_10207748
1295 Ga0207687_10364518
1296 Ga0207687_10891493
1297 Ga0207687_11214581
1298 Ga0207644_11270249
1299 Ga0207690_10127573
1300 Ga0207690_10179514
1301 Ga0207690_10562393
1302 Ga0207706_10089337
1303 Ga0207706_10141883
1304 Ga0207706_10172787
1305 Ga0207706_10197244
1306 Ga0207706_11015748
1307 Ga0207686_10154402
1308 Ga0207686_10213058
1309 Ga0207686_10260915
1310 Ga0207686_11280999
1311 Ga0207709_10171622
1312 Ga0207709_10188695
1313 Ga0207709_10270124
1314 Ga0207709_10565281
1315 Ga0207670_10739210
1316 Ga0207670_10766510
1317 Ga0207669_10078563
1318 Ga0207669_10993217
1319 Ga0207669_11370424
1320 Ga0207704_10026812
1321 Ga0207704_10547638
1322 Ga0207691_10056139
1323 Ga0207691_10170160
1324 Ga0207691_10977785
1325 Ga0207711_10093758
1326 Ga0207711_10548995
1327 Ga0207711_11056964
1328 Ga0207689_10152690
1329 Ga0207689_10337410
1330 Ga0207689_10418396
1331 Ga0207661_10188627
1332 Ga0207661_10961868
1333 Ga0207679_10283103
1334 Ga0207679_10656039
1335 Ga0207667_10134895
1336 Ga0207651_10414205
1337 Ga0207712_10069073
1338 Ga0207712_10563461
1339 Ga0207668_10142022
1340 Ga0207640_11702824
1341 Ga0207658_10077911
1342 Ga0207658_10121208
1343 Ga0207658_11806762
1344 Ga0207677_10947915
1345 Ga0207703_10086327
1346 Ga0207639_10275528
1347 Ga0207639_11161987
1348 Ga0207639_11594463
1349 Ga0207678_10047590
1350 Ga0207678_10226717
1351 Ga0207678_10377108
1352 Ga0207708_10032182
1353 Ga0207708_10069193
1354 Ga0207708_10089332
1355 Ga0207708_10134392
1356 Ga0207708_10426865
1357 Ga0207708_10470189
1358 Ga0207708_10901095
1359 Ga0207708_11664087
1360 Ga0207702_11872164
1361 Ga0207641_10094515
1362 Ga0207641_10695311
1363 Ga0207641_10993168
1364 Ga0207641_10994922
1365 Ga0207648_10003439
1366 Ga0207648_10330515
1367 Ga0207648_10468591
1368 Ga0207648_10493336
1369 Ga0207648_11381038
1370 Ga0207676_10100042
1371 Ga0207676_10219216
1372 Ga0207676_10314967
1373 Ga0207676_10622732
1374 Ga0207676_11204432
1375 Ga0207674_10008530
1376 Ga0207674_11332408
1377 Ga0207675_100028736
1378 Ga0207675_100086911
1379 Ga0207675_100219474
1380 Ga0207675_100480534
1381 Ga0207675_100483334
1382 Ga0207675_101109805
1383 Ga0207675_101194003
1384 Ga0207675_101842238
1385 Ga0207683_10022163
1386 Ga0207683_10079796
1387 Ga0207683_10249488
1388 Ga0207698_10404634
1389 Ga0207698_10560013
1390 Ga0207698_11369169
1391 Ga0209974_10007045
1392 Ga0209974_10173392
1393 Ga0207428_10148558
1394 Ga0268266_10865214
1395 Ga0268265_10144367
1396 Ga0268265_10575597
1397 Ga0268265_12099725
1398 Ga0268264_10115256
1399 Ga0268264_10301864
1400 Ga0268264_10445795
1401 Ga0265326_10058855
1402 Ga0265319_1017347
1403 Ga0265319_1082400
1404 Ga0265334_10001943
1405 Ga0265334_10004633
1406 Ga0265318_10010345
1407 Ga0265318_10014342
1408 Ga0265318_10016388
1409 Ga0265318_10070895
1410 Ga0265322_10024040
1411 Ga0265322_10142344
1412 Ga0265336_10008491
1413 Ga0265338_10034931
1414 Ga0265338_10101284
1415 Ga0265324_10008176
1416 Ga0265324_10068147
1417 Ga0265324_10101583
1418 Ga0265330_10303642
1419 Ga0265332_10006365
1420 Ga0265328_10075045
1421 Ga0265320_10001498
1422 Ga0265320_10007410
1423 Ga0265325_10008089
1424 Ga0265325_10397012
1425 Ga0265329_10003806
1426 Ga0265329_10005635
1427 Ga0265340_10001877
1428 Ga0265340_10404503
1429 Ga0265339_10009152
1430 Ga0265339_10012944
1431 Ga0265339_10058102
1432 Ga0265339_10088770
1433 Ga0265331_10016671
1434 Ga0265331_10412040
1435 Ga0265316_10110871
1436 Ga0265316_10119118
1437 Ga0265316_10898187
1438 Ga0265313_10042081
1439 Ga0265314_10001127
1440 Ga0265314_10021038
1441 Ga0265314_10276533
1442 Ga0265342_10015149
1443 Ga0316576_10160731
1444 Ga0307405_10258566
1445 Ga0307413_10553978
1446 Ga0307413_11422991
1447 Ga0307410_10130314
1448 Ga0307410_10231424
1449 Ga0307406_10261548
1450 Ga0307407_10565025
1451 Ga0307412_10191706
1452 Ga0307412_10603499
1453 Ga0307409_100131540
1454 Ga0307409_100359397
1455 Ga0307416_100405208
1456 Ga0307416_100543089
1457 Ga0307416_101251509
1458 Ga0307416_101328505
1459 Ga0307416_101448618
1460 Ga0307415_100049288
1461 Ga0307415_100136765
1462 Ga0307415_100187912
1463 Ga0307415_101979620
1464 Ga0373938_0076967
1465 Ga0373952_0162070
1466 Ga0373932_0422924
1467 Ga0373941_0026029
1468 Ga0373941_0459806
1469 Ga0373960_0284178
1470 Ga0373943_0962522
1471 Ga0373961_0178401
1472 Ga0316574_0097936
1473 Ga0373931_0078894
1474 Ga0373937_0448142
1475 Ga0373937_0590370
1476 Ga0373937_0746085
1477 Ga0395900_0679730
1478 Ga0395905_0290479
1479 Ga0395905_0953909
1480 Ga0395905_1567147
1481 Ga0395901_0973059
1482 Ga0242420_065388
1483 Ga0439439_0185965
1484 Ga0439453_0042708
1485 Ga0451800_0784458
1486 Ga0451802_2022771
1487 Ga0451839_0535126
1488 Ga0451843_0977027
1489 Ga0451853_1580022
1490 Ga0451853_2430070
1491 Ga0451853_2653829
1492 Ga0451853_3475761
1493 Ga0439431_0182800
1494 Ga0439445_0149398
1495 Ga0439452_059949
1496 Ga0439456_133750
1497 Ga0450920_093293
1498 Ga0450920_093712
1499 Ga0450920_130043
1500 Ga0450906_058475
1501 Ga0439446_0022435
1502 Ga0439446_0068544
1503 Ga0450909_053996
1504 Ga0439434_0081229
1505 Ga0439434_0216041
1506 Ga0439435_0105595
1507 Ga0439459_0140241
1508 Ga0439460_0115721
1509 Ga0451577_2002995
1510 Ga0453683_0360827
1511 Ga0466960_1042946
1512 Ga0451576_0208745
1513 Ga0451576_0703505
1514 Ga0495603_0093249
1515 Ga0495629_0105254
1516 Ga0495629_0946338
1517 Ga0495641_0126666
1518 Ga0495641_0436007
1519 Ga0495651_0248432
1520 Ga0495582_0696652
1521 Ga0495664_0631171
1522 Ga0495584_0499085
1523 Ga0495608_0461830
1524 Ga0495618_0250690
1525 Ga0495628_0561832
1526 Ga0495631_0373482
1527 Ga0495644_0194542
1528 Ga0495644_0353498
1529 Ga0495587_0370491
1530 Ga0495656_0302452
1531 Ga0495656_0308081
1532 Ga0495656_0341489
1533 Ga0495656_0606877
1534 Ga0495668_0342198
1535 Ga0495659_0143446
1536 Ga0495647_0317400
1537 Ga0495624_0265811
1538 Ga0495624_0407720
1539 Ga0495581_0695796
1540 Ga0495604_0081845
1541 Ga0495674_0152941
1542 Ga0495672_0542443
1543 Ga0495676_0682754
1544 Ga0496100_0011594
1545 Ga0496100_0709892
1546 Ga0496100_0790157
1547 Ga0496100_1085552
1548 Ga0496101_0000872
1549 Ga0496101_0363591
1550 Ga0496101_0419367
1551 Ga0496101_0427795
1552 Ga0496102_0079132
1553 Ga0496102_0294692
1554 Ga0496102_0334738
1555 Ga0496102_0390483
1556 Ga0496102_0519986
1557 Ga0496102_0772648
1558 Ga0496102_1605578
1559 Ga0496103_0286918
1560 Ga0496103_0440201
1561 Ga0496103_0632553
1562 Ga0496103_0929009
1563 Ga0496103_0946468
1564 Ga0496104_0014647
1565 Ga0496104_0015340
1566 Ga0496105_0000581
1567 Ga0496105_0154928
1568 Ga0496105_0197698
1569 Ga0496105_0845929
1570 Ga0496105_0987240
1571 Ga0496106_0046452
1572 Ga0496106_0224204
1573 Ga0496106_0415049
1574 Ga0496107_0096589
1575 Ga0496107_0178428
1576 Ga0496107_0343189
1577 Ga0496107_1032142
1578 Ga0496108_0001990
1579 Ga0496108_0010666
1580 Ga0496108_0030442
1581 Ga0496108_0095399
1582 Ga0496108_0237950
1583 Ga0496108_0508207
1584 Ga0496108_1426591
1585 Ga0496109_0007477
1586 Ga0496109_0049499
1587 Ga0496109_0059207
1588 Ga0496109_0070365
1589 Ga0496109_0242534
1590 Ga0496109_0477587
1591 Ga0496109_1082804
1592 Ga0496109_1308119
1593 Ga0496110_0007113
1594 Ga0496110_0009071
1595 Ga0496110_0081321
1596 Ga0496110_0463856
1597 Ga0496111_0000720
1598 Ga0496111_0240530
1599 Ga0496111_1080654
1600 Ga0496112_0000012
1601 Ga0496112_0038602
1602 Ga0496112_0336035
1603 Ga0496112_0414141
1604 Ga0496112_0446070
1605 Ga0496113_0028780
1606 Ga0496113_0118455
1607 Ga0496113_0310000
1608 Ga0496113_0499992
1609 Ga0496114_0003028
1610 Ga0496114_0154624
1611 Ga0496114_0314323
1612 Ga0496114_1052915
1613 Ga0501031_0031443
1614 Ga0501031_0063979
1615 Ga0501031_0119000
1616 Ga0501031_0124284
1617 Ga0501031_0559156
1618 Ga0501032_0016466
1619 Ga0501033_0227705
1620 Ga0501033_0250712
1621 Ga0501033_0512474
1622 Ga0501033_0653815
1623 Ga0501033_0712866
1624 Ga0501033_1210930
1625 Ga0501034_1613367
1626 Ga0501036_0036858
1627 Ga0501036_0078740
1628 Ga0501036_0087432
1629 Ga0501036_0116002
1630 Ga0501036_0299380
1631 Ga0501036_0354919
1632 Ga0501036_0567165
1633 Ga0501036_0692906
1634 Ga0501037_0253001
1635 Ga0501037_0587714
1636 Ga0501038_0041215
1637 Ga0501038_0085048
1638 Ga0501038_0115236
1639 Ga0501038_0467885
1640 Ga0501038_0509168
1641 Ga0501039_0031605
1642 Ga0501039_0095223
1643 Ga0501039_0152389
1644 Ga0501039_0224022
1645 Ga0501039_0252823
1646 Ga0501039_0607759
1647 Ga0501040_0011147
1648 Ga0501040_0017541
1649 Ga0501040_0027921
1650 Ga0501040_0076212
1651 Ga0501040_0111224
1652 Ga0501040_0115325
1653 Ga0501041_0038493
1654 Ga0501041_0094020
1655 Ga0501041_0130930
1656 Ga0501041_0137218
1657 Ga0501041_0340352
1658 Ga0501042_0040671
1659 Ga0501042_0059941
1660 Ga0501042_0111362
1661 Ga0501042_0390114
1662 Ga0501042_0836785
1663 Ga0501043_0023491
1664 Ga0501043_0946528
1665 Ga0501043_1005794
1666 Ga0501043_1225344
1667 Ga0501046_0060612
1668 Ga0501046_0177205
1669 Ga0501046_0254362
1670 Ga0501046_0663518
1671 Ga0501048_0018491
1672 Ga0501048_0045084
1673 Ga0501048_0109088
1674 Ga0501048_0178839
1675 Ga0501048_0273395
1676 Ga0501048_0687160
1677 Ga0501048_0979574
1678 Ga0501067_0005924
1679 Ga0501067_0037466
1680 Ga0501067_0115880
1681 Ga0501068_0040609
1682 Ga0501068_0084716
1683 Ga0501069_0089169
1684 Ga0501069_0302571
1685 Ga0501070_0131886
1686 Ga0501070_0390552
1687 Ga0501070_0445479
1688 Ga0501070_0550379
1689 Ga0501070_0927922
1690 Ga0501071_0001369
1691 Ga0501071_0041141
1692 Ga0501071_0054587
1693 Ga0501071_0056100
1694 Ga0501071_0108713
1695 Ga0501071_0171577
1696 Ga0501071_0382881
1697 Ga0501071_0435038
1698 Ga0501071_0535138
1699 Ga0501071_0565348
1700 Ga0501072_0014411
1701 Ga0501072_0051845
1702 Ga0501072_0071663
1703 Ga0501072_0129498
1704 Ga0501072_0331857
1705 Ga0501072_0395075
1706 Ga0501072_0852025
1707 Ga0501072_1414334
1708 Ga0501073_0168114
1709 Ga0501073_0236452
1710 Ga0501073_1068531
1711 Ga0501073_1146739
1712 Ga0501074_0088615
1713 Ga0501074_0104553
1714 Ga0501074_0132195
1715 Ga0501074_0178026
1716 Ga0501074_0339889
1717 Ga0501074_0409887
1718 Ga0501075_0023128
1719 Ga0501075_0035448
1720 Ga0501075_0038094
1721 Ga0501075_0049934
1722 Ga0501075_0130379
1723 Ga0501075_0174183
1724 Ga0501075_0229469
1725 Ga0501075_0283781
1726 Ga0501075_1042886
1727 Ga0501075_1069260
1728 Ga0501075_1418908
1729 Ga0501076_0006950
1730 Ga0501076_0082619
1731 Ga0501076_0088872
1732 Ga0501076_0142568
1733 Ga0501076_0228435
1734 Ga0501076_0363807
1735 Ga0501076_0400004
1736 Ga0501076_0428552
1737 Ga0501076_0773849
1738 Ga0501076_0964125
1739 Ga0501076_1624810
1740 Ga0501077_0020076
1741 Ga0501077_0064216
1742 Ga0501077_0105771
1743 Ga0501077_0113587
1744 Ga0501077_0228051
1745 Ga0501077_0251209
1746 Ga0501077_0454737
1747 Ga0501079_0004307
1748 Ga0501079_0014517
1749 Ga0501079_0036479
1750 Ga0501079_0187088
1751 Ga0501079_0234507
1752 Ga0501079_0260452
1753 Ga0501079_0650852
1754 Ga0501079_0702175
1755 Ga0501080_0031946
1756 Ga0501080_0043089
1757 Ga0501080_0134411
1758 Ga0501080_0320325
1759 Ga0501080_0352465
1760 Ga0501080_1014516
1761 Ga0501080_1546728
1762 Ga0501081_0030851
1763 Ga0501081_0043456
1764 Ga0501081_0044693
1765 Ga0501081_0052480
1766 Ga0501081_0772841
1767 Ga0501081_1298052
1768 Ga0501083_0161735
1769 Ga0501083_0226042
1770 Ga0501083_0274239
1771 Ga0501035_0141277
1772 Ga0501035_0158292
1773 Ga0501035_0211535
1774 Ga0501045_0006628
1775 Ga0501045_0170368
1776 Ga0501045_0175018
1777 Ga0501045_0284327
1778 Ga0501045_0502336
1779 Ga0501045_0559532
1780 nmdc:mga0yw44_372291_c1
1781 nmdc:mga05p37_1088114_c1
1782 nmdc:mga05p37_13160_c1
1783 nmdc:mga05p37_29045_c1
1784 nmdc:mga05p37_309457_c1
1785 nmdc:mga05p37_431007_c1
1786 nmdc:mga05p37_687055_c1
1787 nmdc:mga05p37_764891_c1
1788 nmdc:mga05p37_89551_c1
1789 nmdc:mga06r32_604729_c1
1790 nmdc:mga06r32_99639_c1
1791 nmdc:mga08y16_148953_c1
1792 nmdc:mga08y16_31535_c1
1793 nmdc:mga08y16_91638_c1
1794 nmdc:mga0n895_1126745_c1
1795 nmdc:mga0n895_14388_c1
1796 nmdc:mga0n895_1750667_c1
1797 nmdc:mga0n895_1875070_c1
1798 nmdc:mga0n895_422661_c1
1799 nmdc:mga0n895_784852_c1
1800 nmdc:mga0rr50_1320002_c1
1801 nmdc:mga0rr50_259671_c1
1802 nmdc:mga0rr50_528011_c1
1803 nmdc:mga0rr50_558199_c1
1804 nmdc:mga08x19_279074_c1
1805 nmdc:mga08x19_313180_c1
1806 nmdc:mga08x19_767452_c1
1807 nmdc:mga08x19_825310_c1
1808 nmdc:mga0a205_160448_c1
1809 nmdc:mga0a205_20976_c1
1810 nmdc:mga0a205_216027_c1
1811 nmdc:mga0a205_24744_c1
1812 nmdc:mga0a205_402133_c1
1813 nmdc:mga0a205_528432_c1
1814 nmdc:mga0a205_668583_c1
1815 Ga0495612_0000106
1816 Ga0495595_0444154
1817 Ga0495619_0150521
1818 Ga0501084_0086236
1819 Ga0501084_0143408
1820 Ga0501084_0147979
1821 Ga0501084_0172720
1822 Ga0501084_0242704
1823 Ga0501084_0728531
1824 Ga0501084_1513425
1825 Ga0590071_001827
1826 Ga0590075_002708
1827 Ga0590075_063403
1828 Ga0590077_019669
1829 Ga0590077_170748
1830 Ga0501082_0021804
1831 Ga0501082_0051125
1832 Ga0501082_0051373
1833 Ga0501082_0121670
1834 Ga0501082_0220412
1835 Ga0501082_0736116
1836 Ga0501082_1114942
1837 Ga0501082_1158402
1838 Ga0501082_1212601
1839 Ga0501082_1933932
1840 Ga0530510_0001133
1841 Ga0530510_0028432
1842 Ga0530510_0168605
1843 Ga0530510_0259688
1844 Ga0530510_0479945
1845 Ga0530510_0646765
1846 Ga0530510_0679532

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p9g-assembly1.cif.gz_A crystal structure of serine bound g336v,g337v double mutant of e.coli phosphoglycerate dehydrogenase 0.85 3 60
1sc6-assembly1.cif.gz_A crystal structure of w139g d-3-phosphoglycerate dehydrogenase complexed with nad+ 0.8479 1 59
1psd-assembly1.cif.gz_A the allosteric ligand site in the vmax-type cooperative enzyme phosphoglycerate dehydrogenase 0.8457 3 60
5v0s-assembly1.cif.gz_B crystal structure of the act domain of prephenate dehydrogenase tyra from bacillus anthracis 0.8419 4 66
3k5p-assembly1.cif.gz_A crystal structure of amino acid-binding act: d-isomer specific 2-hydroxyacid dehydrogenase catalytic domain from brucella melitensis 0.8415 1 60
ID Description Score Start End Superfamily
af_Q9FFF4_74_151_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8419 1 67 3.30.70.260
af_I1M2G3_44_149_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8402 2 48 3.40.50.2000
af_I1M9H5_373_429_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8363 69 117 3.30.70.260
af_E9AG23_325_406_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8302 2 67 3.30.70.260
af_Q75IY1_131_216_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.83 4 59 3.30.70.260
ID Description Score Start End GO Terms
AF-A0A522MYR4-F1-model_v4 ACT domain-containing protein 0.994 1 127
AF-A0A2V9GAR7-F1-model_v4 ACT domain-containing protein 0.9913 3 67
AF-A0A1F8RWU0-F1-model_v4 ACT domain-containing protein 0.9865 1 129
AF-A0A522MYR4-F1-model_v4 ACT domain-containing protein 0.9863 1 127
AF-A0A1F8RWU0-F1-model_v4 ACT domain-containing protein 0.979 1 129

Map