F485820
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 923 | 323 | 1846 | 129 |
Family's Representative Sequence
| Representative Sequence | 3300005354|Ga0070675_100970754|Ga0070675_1009707541 |
| Length | 151 |
| Sequence | VRSGSEPGRAARIAAFEAVEAQVANQFVVQLKNEPGSMAVLAETLAARGVDLRAIGGGGLGGVGHVIMTTADDAATKAVLDEGGYTYYEGESILAEVDDRPGGMARVARELADAGVNIYGHLFLGRWGDRAMFAFVVDDTERARPILERKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 171 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 172 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 173 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 174 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 175 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 176 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 179 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 181 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 182 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 183 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 184 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 185 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 187 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 188 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 189 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 191 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 192 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 194 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 195 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 196 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 197 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 198 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 199 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 200 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 201 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 202 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 203 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 209 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 212 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 213 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 214 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 215 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 216 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 217 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 220 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 221 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 222 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 223 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 224 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 225 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 226 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 227 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 228 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 229 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 230 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 231 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 232 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 233 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 234 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 235 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 236 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 237 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 238 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 264 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 265 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 266 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 267 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 268 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 269 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 272 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 273 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 274 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 275 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 276 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 308 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 320 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 321 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 322 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.89 |
| Metatranscriptomes | 0.11 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.22 |
| Nodule | 0 |
| Rhizoplane | 7.69 |
| Rhizosphere | 91.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 19.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070675_100970754 | 3300005354 | Bacteria | 780 |
| 2 | JGI25406J46586_10006705 | 3300003203 | Bacteria | 5292 |
| 3 | Ga0070676_10167750 | 3300005328 | Bacteria | 1418 |
| 4 | Ga0070683_100496332 | 3300005329 | Bacteria | 1166 |
| 5 | Ga0070683_100915679 | 3300005329 | Unclassified | 841 |
| 6 | Ga0070683_101536871 | 3300005329 | Unclassified | 640 |
| 7 | Ga0070690_100071315 | 3300005330 | Unclassified | 2257 |
| 8 | Ga0070690_100462493 | 3300005330 | Bacteria | 943 |
| 9 | Ga0070670_100138938 | 3300005331 | Unclassified | 2101 |
| 10 | Ga0070670_100343930 | 3300005331 | Bacteria | 1310 |
| 11 | Ga0068869_100161285 | 3300005334 | Bacteria | 1746 |
| 12 | Ga0068869_100162104 | 3300005334 | Unclassified | 1741 |
| 13 | Ga0068869_100826735 | 3300005334 | Bacteria | 798 |
| 14 | Ga0070666_10384866 | 3300005335 | Unclassified | 1007 |
| 15 | Ga0070666_10436981 | 3300005335 | Unclassified | 944 |
| 16 | Ga0070666_11103817 | 3300005335 | Bacteria | 590 |
| 17 | Ga0070680_100425633 | 3300005336 | Unclassified | 1133 |
| 18 | Ga0070682_100108106 | 3300005337 | Unclassified | 1848 |
| 19 | Ga0068868_101270969 | 3300005338 | Bacteria | 683 |
| 20 | Ga0070660_100055189 | 3300005339 | Unclassified | 3070 |
| 21 | Ga0070660_100510967 | 3300005339 | Bacteria | 1000 |
| 22 | Ga0070689_100031880 | 3300005340 | Bacteria | 4006 |
| 23 | Ga0070689_100363092 | 3300005340 | Bacteria | 1217 |
| 24 | Ga0070689_101786040 | 3300005340 | Bacteria | 560 |
| 25 | Ga0070691_10224861 | 3300005341 | Bacteria | 996 |
| 26 | Ga0070687_100007332 | 3300005343 | Bacteria | 4590 |
| 27 | Ga0070687_100109659 | 3300005343 | Bacteria | 1560 |
| 28 | Ga0070687_100659609 | 3300005343 | Unclassified | 726 |
| 29 | Ga0070661_101630558 | 3300005344 | Unclassified | 546 |
| 30 | Ga0070692_10109443 | 3300005345 | Bacteria | 1526 |
| 31 | Ga0070668_100158200 | 3300005347 | Unclassified | 1837 |
| 32 | Ga0070669_100870917 | 3300005353 | Bacteria | 768 |
| 33 | Ga0070669_101808553 | 3300005353 | Unclassified | 533 |
| 34 | Ga0070675_100032866 | 3300005354 | Unclassified | 4201 |
| 35 | Ga0070675_101788525 | 3300005354 | Bacteria | 567 |
| 36 | Ga0070674_100066617 | 3300005356 | Bacteria | 2531 |
| 37 | Ga0070674_100132943 | 3300005356 | Bacteria | 1857 |
| 38 | Ga0070674_100540615 | 3300005356 | Unclassified | 976 |
| 39 | Ga0070674_101451992 | 3300005356 | Bacteria | 615 |
| 40 | Ga0070674_101490194 | 3300005356 | Unclassified | 608 |
| 41 | Ga0070688_100112929 | 3300005365 | Bacteria | 1809 |
| 42 | Ga0070688_100312472 | 3300005365 | Unclassified | 1139 |
| 43 | Ga0070659_100030959 | 3300005366 | Bacteria | 4142 |
| 44 | Ga0070667_100151424 | 3300005367 | Bacteria | 2038 |
| 45 | Ga0070667_100487831 | 3300005367 | Bacteria | 1128 |
| 46 | Ga0070703_10057485 | 3300005406 | Bacteria | 1263 |
| 47 | Ga0070713_102001649 | 3300005436 | Bacteria | 562 |
| 48 | Ga0070701_10027060 | 3300005438 | Unclassified | 2804 |
| 49 | Ga0070701_10735738 | 3300005438 | Bacteria | 667 |
| 50 | Ga0070705_100148353 | 3300005440 | Unclassified | 1553 |
| 51 | Ga0070705_100297694 | 3300005440 | Bacteria | 1155 |
| 52 | Ga0070705_100333404 | 3300005440 | Unclassified | 1100 |
| 53 | Ga0070705_100722061 | 3300005440 | Bacteria | 785 |
| 54 | Ga0070700_100025879 | 3300005441 | Unclassified | 3459 |
| 55 | Ga0070700_100042626 | 3300005441 | Bacteria | 2788 |
| 56 | Ga0070694_100141942 | 3300005444 | Bacteria | 1745 |
| 57 | Ga0070694_100148524 | 3300005444 | Bacteria | 1709 |
| 58 | Ga0070694_100179035 | 3300005444 | Bacteria | 1567 |
| 59 | Ga0070708_100148013 | 3300005445 | Unclassified | 2182 |
| 60 | Ga0070663_100103463 | 3300005455 | Unclassified | 2128 |
| 61 | Ga0070663_100213766 | 3300005455 | Bacteria | 1511 |
| 62 | Ga0070663_100330983 | 3300005455 | Bacteria | 1228 |
| 63 | Ga0070678_100014359 | 3300005456 | Bacteria | 4996 |
| 64 | Ga0070678_100112285 | 3300005456 | Unclassified | 2134 |
| 65 | Ga0070678_100984120 | 3300005456 | Bacteria | 775 |
| 66 | Ga0070662_100058497 | 3300005457 | Bacteria | 2805 |
| 67 | Ga0070662_100081063 | 3300005457 | Unclassified | 2417 |
| 68 | Ga0070662_100504081 | 3300005457 | Bacteria | 1010 |
| 69 | Ga0070662_100990960 | 3300005457 | Unclassified | 719 |
| 70 | Ga0070681_10883534 | 3300005458 | Unclassified | 812 |
| 71 | Ga0070681_11026173 | 3300005458 | Bacteria | 745 |
| 72 | Ga0068867_100058718 | 3300005459 | Unclassified | 2851 |
| 73 | Ga0068867_100604307 | 3300005459 | Bacteria | 957 |
| 74 | Ga0070685_10043436 | 3300005466 | Bacteria | 2570 |
| 75 | Ga0070706_100171176 | 3300005467 | Bacteria | 2028 |
| 76 | Ga0070706_100364916 | 3300005467 | Unclassified | 1345 |
| 77 | Ga0070706_100723445 | 3300005467 | Bacteria | 923 |
| 78 | Ga0070706_101748691 | 3300005467 | Bacteria | 566 |
| 79 | Ga0070707_100000290 | 3300005468 | Bacteria | 49402 |
| 80 | Ga0070707_100050303 | 3300005468 | Bacteria | 3994 |
| 81 | Ga0070707_100126906 | 3300005468 | Bacteria | 2479 |
| 82 | Ga0070707_100247588 | 3300005468 | Bacteria | 1734 |
| 83 | Ga0070707_100865760 | 3300005468 | Bacteria | 868 |
| 84 | Ga0070707_101246921 | 3300005468 | Bacteria | 710 |
| 85 | Ga0070698_100023786 | 3300005471 | Bacteria | 6398 |
| 86 | Ga0070698_100113470 | 3300005471 | Bacteria | 2675 |
| 87 | Ga0070698_100185440 | 3300005471 | Unclassified | 2018 |
| 88 | Ga0070698_100207726 | 3300005471 | Unclassified | 1893 |
| 89 | Ga0070699_100003264 | 3300005518 | Bacteria | 14354 |
| 90 | Ga0070699_100004917 | 3300005518 | Bacteria | 11786 |
| 91 | Ga0070699_100038716 | 3300005518 | Bacteria | 4128 |
| 92 | Ga0070699_100260427 | 3300005518 | Bacteria | 1551 |
| 93 | Ga0070699_100327481 | 3300005518 | Bacteria | 1377 |
| 94 | Ga0070699_100336099 | 3300005518 | Bacteria | 1359 |
| 95 | Ga0070699_100596691 | 3300005518 | Bacteria | 1007 |
| 96 | Ga0070679_100155762 | 3300005530 | Unclassified | 2259 |
| 97 | Ga0070684_100171217 | 3300005535 | Bacteria | 1972 |
| 98 | Ga0070684_100910705 | 3300005535 | Bacteria | 824 |
| 99 | Ga0070684_101811715 | 3300005535 | Bacteria | 576 |
| 100 | Ga0070697_100096715 | 3300005536 | Bacteria | 2450 |
| 101 | Ga0070697_100226245 | 3300005536 | Bacteria | 1595 |
| 102 | Ga0070697_101022989 | 3300005536 | Bacteria | 735 |
| 103 | Ga0068853_100190340 | 3300005539 | Unclassified | 1864 |
| 104 | Ga0068853_101945261 | 3300005539 | Bacteria | 570 |
| 105 | Ga0070672_100440459 | 3300005543 | Bacteria | 1121 |
| 106 | Ga0070672_100451772 | 3300005543 | Unclassified | 1107 |
| 107 | Ga0070672_100692917 | 3300005543 | Unclassified | 892 |
| 108 | Ga0070672_101301012 | 3300005543 | Bacteria | 649 |
| 109 | Ga0070672_101784294 | 3300005543 | Bacteria | 553 |
| 110 | Ga0070686_100107022 | 3300005544 | Bacteria | 1899 |
| 111 | Ga0070686_100234421 | 3300005544 | Unclassified | 1333 |
| 112 | Ga0070686_100566145 | 3300005544 | Unclassified | 891 |
| 113 | Ga0070686_101253098 | 3300005544 | Bacteria | 618 |
| 114 | Ga0070695_100202414 | 3300005545 | Bacteria | 1420 |
| 115 | Ga0070695_100377780 | 3300005545 | Unclassified | 1068 |
| 116 | Ga0070695_101287472 | 3300005545 | Bacteria | 603 |
| 117 | Ga0070696_100004989 | 3300005546 | Bacteria | 8865 |
| 118 | Ga0070696_100008069 | 3300005546 | Bacteria | 7036 |
| 119 | Ga0070696_100104512 | 3300005546 | Unclassified | 2034 |
| 120 | Ga0070696_100576526 | 3300005546 | Unclassified | 904 |
| 121 | Ga0070696_101381285 | 3300005546 | Bacteria | 600 |
| 122 | Ga0070693_100029114 | 3300005547 | Bacteria | 3010 |
| 123 | Ga0070693_100068903 | 3300005547 | Bacteria | 2078 |
| 124 | Ga0070693_100772561 | 3300005547 | Bacteria | 710 |
| 125 | Ga0070665_101667713 | 3300005548 | Bacteria | 645 |
| 126 | Ga0070704_100011823 | 3300005549 | Bacteria | 5370 |
| 127 | Ga0070704_100129592 | 3300005549 | Bacteria | 1952 |
| 128 | Ga0070704_101015391 | 3300005549 | Unclassified | 751 |
| 129 | Ga0068855_100168076 | 3300005563 | Bacteria | 2485 |
| 130 | Ga0070664_100151506 | 3300005564 | Unclassified | 2047 |
| 131 | Ga0070664_102174500 | 3300005564 | Bacteria | 526 |
| 132 | Ga0068857_100213230 | 3300005577 | Unclassified | 1762 |
| 133 | Ga0068857_102400241 | 3300005577 | Bacteria | 518 |
| 134 | Ga0068854_101381893 | 3300005578 | Bacteria | 636 |
| 135 | Ga0068856_100591065 | 3300005614 | Bacteria | 1131 |
| 136 | Ga0070702_100006998 | 3300005615 | Bacteria | 5375 |
| 137 | Ga0070702_100038515 | 3300005615 | Unclassified | 2663 |
| 138 | Ga0068852_100451202 | 3300005616 | Bacteria | 1273 |
| 139 | Ga0068852_100668787 | 3300005616 | Bacteria | 1047 |
| 140 | Ga0068852_100797764 | 3300005616 | Unclassified | 958 |
| 141 | Ga0068859_100094096 | 3300005617 | Unclassified | 3048 |
| 142 | Ga0068859_100094423 | 3300005617 | Bacteria | 3043 |
| 143 | Ga0068859_100310675 | 3300005617 | Bacteria | 1670 |
| 144 | Ga0068859_100837903 | 3300005617 | Bacteria | 1006 |
| 145 | Ga0068859_102273174 | 3300005617 | Bacteria | 598 |
| 146 | Ga0068864_100004996 | 3300005618 | Bacteria | 10867 |
| 147 | Ga0068864_100034906 | 3300005618 | Bacteria | 4280 |
| 148 | Ga0068864_100107285 | 3300005618 | Bacteria | 2484 |
| 149 | Ga0068864_100213727 | 3300005618 | Bacteria | 1777 |
| 150 | Ga0068864_100850234 | 3300005618 | Bacteria | 899 |
| 151 | Ga0068864_102611675 | 3300005618 | Unclassified | 511 |
| 152 | Ga0068866_10019474 | 3300005718 | Bacteria | 3091 |
| 153 | Ga0068861_100051588 | 3300005719 | Bacteria | 3123 |
| 154 | Ga0068861_100090076 | 3300005719 | Unclassified | 2419 |
| 155 | Ga0068861_100762428 | 3300005719 | Unclassified | 905 |
| 156 | Ga0068861_102627856 | 3300005719 | Bacteria | 507 |
| 157 | Ga0068851_10532820 | 3300005834 | Bacteria | 708 |
| 158 | Ga0068870_10041847 | 3300005840 | Unclassified | 2383 |
| 159 | Ga0068870_10303364 | 3300005840 | Bacteria | 1009 |
| 160 | Ga0068863_100216636 | 3300005841 | Unclassified | 1844 |
| 161 | Ga0068863_100270172 | 3300005841 | Unclassified | 1646 |
| 162 | Ga0068863_100593521 | 3300005841 | Bacteria | 1096 |
| 163 | Ga0068863_100607659 | 3300005841 | Unclassified | 1083 |
| 164 | Ga0068863_100798886 | 3300005841 | Bacteria | 941 |
| 165 | Ga0068858_100101759 | 3300005842 | Unclassified | 2680 |
| 166 | Ga0068858_100202107 | 3300005842 | Bacteria | 1879 |
| 167 | Ga0068858_100376301 | 3300005842 | Bacteria | 1362 |
| 168 | Ga0068858_101320740 | 3300005842 | Unclassified | 710 |
| 169 | Ga0068858_102367207 | 3300005842 | Bacteria | 525 |
| 170 | Ga0068860_100059116 | 3300005843 | Bacteria | 3645 |
| 171 | Ga0068860_100466882 | 3300005843 | Unclassified | 1256 |
| 172 | Ga0068860_100516977 | 3300005843 | Bacteria | 1193 |
| 173 | Ga0068860_101763442 | 3300005843 | Bacteria | 641 |
| 174 | Ga0068862_100093155 | 3300005844 | Bacteria | 2627 |
| 175 | Ga0081455_10131408 | 3300005937 | Bacteria | 1957 |
| 176 | Ga0081455_10264080 | 3300005937 | Unclassified | 1252 |
| 177 | Ga0081539_10002120 | 3300005985 | Bacteria | 29394 |
| 178 | Ga0081539_10011336 | 3300005985 | Bacteria | 7069 |
| 179 | Ga0075365_10047055 | 3300006038 | Bacteria | 2834 |
| 180 | Ga0075432_10220670 | 3300006058 | Bacteria | 758 |
| 181 | Ga0097621_101454724 | 3300006237 | Bacteria | 650 |
| 182 | Ga0097621_101836562 | 3300006237 | Bacteria | 578 |
| 183 | Ga0097621_102033747 | 3300006237 | Bacteria | 549 |
| 184 | Ga0097621_102194003 | 3300006237 | Bacteria | 528 |
| 185 | Ga0068871_100161835 | 3300006358 | Unclassified | 1915 |
| 186 | Ga0075428_100112611 | 3300006844 | Bacteria | 2964 |
| 187 | Ga0075428_100662795 | 3300006844 | Bacteria | 1112 |
| 188 | Ga0075431_100066179 | 3300006847 | Bacteria | 3731 |
| 189 | Ga0075431_100662289 | 3300006847 | Bacteria | 1024 |
| 190 | Ga0075433_10170009 | 3300006852 | Bacteria | 1940 |
| 191 | Ga0075433_10233822 | 3300006852 | Bacteria | 1632 |
| 192 | Ga0075433_10287407 | 3300006852 | Bacteria | 1456 |
| 193 | Ga0075433_10546251 | 3300006852 | Bacteria | 1019 |
| 194 | Ga0075433_10720776 | 3300006852 | Bacteria | 873 |
| 195 | Ga0075434_100012357 | 3300006871 | Bacteria | 8091 |
| 196 | Ga0075434_100261181 | 3300006871 | Bacteria | 1751 |
| 197 | Ga0075434_100843894 | 3300006871 | Bacteria | 932 |
| 198 | Ga0075434_102063625 | 3300006871 | Bacteria | 575 |
| 199 | Ga0068865_100028312 | 3300006881 | Unclassified | 3708 |
| 200 | Ga0068865_100664647 | 3300006881 | Bacteria | 887 |
| 201 | Ga0068865_100739487 | 3300006881 | Bacteria | 844 |
| 202 | Ga0075436_100238882 | 3300006914 | Bacteria | 1292 |
| 203 | Ga0075436_100758998 | 3300006914 | Bacteria | 721 |
| 204 | Ga0097620_100094098 | 3300006931 | Unclassified | 3048 |
| 205 | Ga0097620_100094420 | 3300006931 | Bacteria | 3043 |
| 206 | Ga0097620_100310656 | 3300006931 | Bacteria | 1670 |
| 207 | Ga0097620_100837849 | 3300006931 | Bacteria | 1006 |
| 208 | Ga0097620_102272465 | 3300006931 | Bacteria | 598 |
| 209 | Ga0075435_100180516 | 3300007076 | Bacteria | 1784 |
| 210 | Ga0075435_100537263 | 3300007076 | Unclassified | 1012 |
| 211 | Ga0075435_101006407 | 3300007076 | Bacteria | 728 |
| 212 | Ga0075435_101231499 | 3300007076 | Bacteria | 655 |
| 213 | Ga0075435_101625471 | 3300007076 | Bacteria | 567 |
| 214 | Ga0075435_101855758 | 3300007076 | Bacteria | 529 |
| 215 | Ga0105251_10623624 | 3300009011 | Bacteria | 513 |
| 216 | Ga0111539_10016640 | 3300009094 | Bacteria | 9113 |
| 217 | Ga0111539_10065131 | 3300009094 | Bacteria | 4308 |
| 218 | Ga0111539_10284069 | 3300009094 | Bacteria | 1926 |
| 219 | Ga0111539_10521086 | 3300009094 | Bacteria | 1385 |
| 220 | Ga0111539_10904528 | 3300009094 | Bacteria | 1026 |
| 221 | Ga0105245_10023336 | 3300009098 | Bacteria | 5430 |
| 222 | Ga0105245_10035268 | 3300009098 | Bacteria | 4439 |
| 223 | Ga0105245_10162988 | 3300009098 | Bacteria | 2117 |
| 224 | Ga0105245_10387818 | 3300009098 | Bacteria | 1393 |
| 225 | Ga0105245_10415424 | 3300009098 | Bacteria | 1347 |
| 226 | Ga0105245_10439351 | 3300009098 | Bacteria | 1311 |
| 227 | Ga0105247_10225906 | 3300009101 | Unclassified | 1269 |
| 228 | Ga0105247_10483044 | 3300009101 | Bacteria | 899 |
| 229 | Ga0105247_10736800 | 3300009101 | Unclassified | 746 |
| 230 | Ga0105247_10739176 | 3300009101 | Unclassified | 744 |
| 231 | Ga0114129_10019533 | 3300009147 | Bacteria | 9648 |
| 232 | Ga0114129_10024867 | 3300009147 | Bacteria | 8491 |
| 233 | Ga0114129_10035818 | 3300009147 | Bacteria | 7008 |
| 234 | Ga0114129_10061561 | 3300009147 | Bacteria | 5245 |
| 235 | Ga0114129_10129699 | 3300009147 | Bacteria | 3465 |
| 236 | Ga0114129_10771101 | 3300009147 | Bacteria | 1229 |
| 237 | Ga0114129_10885808 | 3300009147 | Archaea | 1132 |
| 238 | Ga0105243_10015358 | 3300009148 | Bacteria | 5793 |
| 239 | Ga0105243_10252071 | 3300009148 | Bacteria | 1576 |
| 240 | Ga0105243_10419907 | 3300009148 | Unclassified | 1247 |
| 241 | Ga0105243_10506050 | 3300009148 | Bacteria | 1145 |
| 242 | Ga0105243_10762785 | 3300009148 | Bacteria | 950 |
| 243 | Ga0105243_10842978 | 3300009148 | Bacteria | 907 |
| 244 | Ga0105243_10877418 | 3300009148 | Bacteria | 891 |
| 245 | Ga0105243_11223962 | 3300009148 | Bacteria | 765 |
| 246 | Ga0105243_12336836 | 3300009148 | Unclassified | 572 |
| 247 | Ga0105241_10885955 | 3300009174 | Bacteria | 828 |
| 248 | Ga0105241_11573706 | 3300009174 | Bacteria | 635 |
| 249 | Ga0105242_10054799 | 3300009176 | Unclassified | 3260 |
| 250 | Ga0105242_10164210 | 3300009176 | Bacteria | 1946 |
| 251 | Ga0105242_10546810 | 3300009176 | Bacteria | 1109 |
| 252 | Ga0105242_10752042 | 3300009176 | Bacteria | 960 |
| 253 | Ga0105242_10829920 | 3300009176 | Bacteria | 918 |
| 254 | Ga0105242_11188505 | 3300009176 | Bacteria | 781 |
| 255 | Ga0105242_11350038 | 3300009176 | Bacteria | 738 |
| 256 | Ga0105248_10310159 | 3300009177 | Bacteria | 1777 |
| 257 | Ga0105248_10319689 | 3300009177 | Unclassified | 1748 |
| 258 | Ga0105248_10954248 | 3300009177 | Unclassified | 969 |
| 259 | Ga0105248_10959458 | 3300009177 | Bacteria | 966 |
| 260 | Ga0105248_11078150 | 3300009177 | Bacteria | 908 |
| 261 | Ga0105238_10207815 | 3300009551 | Bacteria | 1933 |
| 262 | Ga0105238_11015535 | 3300009551 | Bacteria | 850 |
| 263 | Ga0105249_10083825 | 3300009553 | Unclassified | 2968 |
| 264 | Ga0105249_10207078 | 3300009553 | Bacteria | 1922 |
| 265 | Ga0105249_11971011 | 3300009553 | Bacteria | 657 |
| 266 | Ga0099796_10055830 | 3300010159 | Bacteria | 1384 |
| 267 | Ga0105239_10130732 | 3300010375 | Unclassified | 2792 |
| 268 | Ga0105239_10317356 | 3300010375 | Bacteria | 1757 |
| 269 | Ga0105246_10170767 | 3300011119 | Bacteria | 1665 |
| 270 | Ga0105246_10209569 | 3300011119 | Bacteria | 1520 |
| 271 | Ga0105246_10300157 | 3300011119 | Bacteria | 1296 |
| 272 | Ga0105246_10447527 | 3300011119 | Bacteria | 1085 |
| 273 | Ga0105246_10906838 | 3300011119 | Unclassified | 791 |
| 274 | Ga0105246_11460839 | 3300011119 | Bacteria | 640 |
| 275 | Ga0157322_1036831 | 3300012490 | Bacteria | 546 |
| 276 | Ga0157374_10488864 | 3300013296 | Unclassified | 1234 |
| 277 | Ga0157374_11416213 | 3300013296 | Bacteria | 718 |
| 278 | Ga0157378_10019427 | 3300013297 | Bacteria | 5974 |
| 279 | Ga0157378_10252216 | 3300013297 | Bacteria | 1690 |
| 280 | Ga0157378_10760061 | 3300013297 | Bacteria | 993 |
| 281 | Ga0157378_10917872 | 3300013297 | Bacteria | 907 |
| 282 | Ga0163162_10072927 | 3300013306 | Bacteria | 3488 |
| 283 | Ga0163162_10178988 | 3300013306 | Bacteria | 2246 |
| 284 | Ga0163162_10464913 | 3300013306 | Bacteria | 1397 |
| 285 | Ga0163162_10869728 | 3300013306 | Bacteria | 1016 |
| 286 | Ga0163162_10906489 | 3300013306 | Bacteria | 994 |
| 287 | Ga0163162_11332534 | 3300013306 | Bacteria | 816 |
| 288 | Ga0157372_11470786 | 3300013307 | Bacteria | 785 |
| 289 | Ga0157372_11549917 | 3300013307 | Bacteria | 763 |
| 290 | Ga0157375_10038549 | 3300013308 | Bacteria | 4588 |
| 291 | Ga0157375_10057569 | 3300013308 | Bacteria | 3843 |
| 292 | Ga0157375_10060608 | 3300013308 | Bacteria | 3753 |
| 293 | Ga0157375_10153995 | 3300013308 | Unclassified | 2436 |
| 294 | Ga0157375_11420511 | 3300013308 | Bacteria | 818 |
| 295 | Ga0163163_10015603 | 3300014325 | Bacteria | 7027 |
| 296 | Ga0163163_10068161 | 3300014325 | Bacteria | 3539 |
| 297 | Ga0163163_10096558 | 3300014325 | Bacteria | 2976 |
| 298 | Ga0163163_10126104 | 3300014325 | Bacteria | 2598 |
| 299 | Ga0163163_10202400 | 3300014325 | Bacteria | 2034 |
| 300 | Ga0163163_10211400 | 3300014325 | Unclassified | 1989 |
| 301 | Ga0163163_10235951 | 3300014325 | Bacteria | 1878 |
| 302 | Ga0163163_10278177 | 3300014325 | Unclassified | 1725 |
| 303 | Ga0163163_10373953 | 3300014325 | Bacteria | 1482 |
| 304 | Ga0163163_10950737 | 3300014325 | Bacteria | 923 |
| 305 | Ga0163163_11196216 | 3300014325 | Bacteria | 823 |
| 306 | Ga0163163_12716288 | 3300014325 | Bacteria | 552 |
| 307 | Ga0157380_10122506 | 3300014326 | Unclassified | 2205 |
| 308 | Ga0157380_10308433 | 3300014326 | Bacteria | 1461 |
| 309 | Ga0157380_10489663 | 3300014326 | Bacteria | 1191 |
| 310 | Ga0157380_11341649 | 3300014326 | Bacteria | 764 |
| 311 | Ga0182008_10312101 | 3300014497 | Bacteria | 825 |
| 312 | Ga0182008_10524122 | 3300014497 | Unclassified | 655 |
| 313 | Ga0157377_10007586 | 3300014745 | Bacteria | 5248 |
| 314 | Ga0157377_10061950 | 3300014745 | Bacteria | 2139 |
| 315 | Ga0157377_10333474 | 3300014745 | Bacteria | 1012 |
| 316 | Ga0157377_10348904 | 3300014745 | Bacteria | 992 |
| 317 | Ga0157379_10125840 | 3300014968 | Unclassified | 2306 |
| 318 | Ga0157379_10514826 | 3300014968 | Bacteria | 1110 |
| 319 | Ga0157379_11815678 | 3300014968 | Unclassified | 599 |
| 320 | Ga0157376_10193191 | 3300014969 | Bacteria | 1868 |
| 321 | Ga0157376_10328228 | 3300014969 | Bacteria | 1457 |
| 322 | Ga0157376_10511314 | 3300014969 | Bacteria | 1182 |
| 323 | Ga0157376_10582944 | 3300014969 | Unclassified | 1111 |
| 324 | Ga0157376_10767604 | 3300014969 | Bacteria | 974 |
| 325 | Ga0163161_10055076 | 3300017792 | Bacteria | 2887 |
| 326 | Ga0206356_10938136 | 3300020070 | Bacteria | 616 |
| 327 | Ga0207653_10025473 | 3300025885 | Bacteria | 1892 |
| 328 | Ga0207653_10056496 | 3300025885 | Bacteria | 1316 |
| 329 | Ga0207642_10171829 | 3300025899 | Bacteria | 1173 |
| 330 | Ga0207710_10355295 | 3300025900 | Unclassified | 747 |
| 331 | Ga0207710_10704018 | 3300025900 | Bacteria | 530 |
| 332 | Ga0207688_10014514 | 3300025901 | Bacteria | 4282 |
| 333 | Ga0207688_10299259 | 3300025901 | Bacteria | 983 |
| 334 | Ga0207680_10223958 | 3300025903 | Unclassified | 1290 |
| 335 | Ga0207645_10036877 | 3300025907 | Bacteria | 3140 |
| 336 | Ga0207643_10033540 | 3300025908 | Unclassified | 2873 |
| 337 | Ga0207643_10044623 | 3300025908 | Bacteria | 2503 |
| 338 | Ga0207643_10843786 | 3300025908 | Bacteria | 594 |
| 339 | Ga0207684_10044888 | 3300025910 | Bacteria | 3748 |
| 340 | Ga0207684_10311975 | 3300025910 | Bacteria | 1356 |
| 341 | Ga0207684_10865351 | 3300025910 | Bacteria | 761 |
| 342 | Ga0207684_11006304 | 3300025910 | Unclassified | 697 |
| 343 | Ga0207654_10906769 | 3300025911 | Bacteria | 639 |
| 344 | Ga0207707_11002593 | 3300025912 | Bacteria | 685 |
| 345 | Ga0207707_11195507 | 3300025912 | Bacteria | 615 |
| 346 | Ga0207671_10912487 | 3300025914 | Bacteria | 694 |
| 347 | Ga0207660_10627747 | 3300025917 | Bacteria | 876 |
| 348 | Ga0207660_10643898 | 3300025917 | Bacteria | 864 |
| 349 | Ga0207662_10009714 | 3300025918 | Bacteria | 5304 |
| 350 | Ga0207662_10018956 | 3300025918 | Bacteria | 3909 |
| 351 | Ga0207662_10937698 | 3300025918 | Unclassified | 614 |
| 352 | Ga0207657_10062832 | 3300025919 | Unclassified | 3177 |
| 353 | Ga0207657_10730918 | 3300025919 | Bacteria | 768 |
| 354 | Ga0207649_10316240 | 3300025920 | Bacteria | 1146 |
| 355 | Ga0207652_11101306 | 3300025921 | Bacteria | 695 |
| 356 | Ga0207652_11386872 | 3300025921 | Unclassified | 606 |
| 357 | Ga0207646_10032308 | 3300025922 | Bacteria | 4737 |
| 358 | Ga0207646_10170024 | 3300025922 | Bacteria | 1968 |
| 359 | Ga0207646_10548873 | 3300025922 | Bacteria | 1039 |
| 360 | Ga0207681_10634516 | 3300025923 | Bacteria | 885 |
| 361 | Ga0207681_10979750 | 3300025923 | Unclassified | 709 |
| 362 | Ga0207694_10843567 | 3300025924 | Bacteria | 774 |
| 363 | Ga0207650_10171547 | 3300025925 | Unclassified | 1724 |
| 364 | Ga0207650_10582906 | 3300025925 | Unclassified | 939 |
| 365 | Ga0207650_10865016 | 3300025925 | Bacteria | 767 |
| 366 | Ga0207659_10124995 | 3300025926 | Unclassified | 1977 |
| 367 | Ga0207659_10368442 | 3300025926 | Bacteria | 1195 |
| 368 | Ga0207659_10816438 | 3300025926 | Bacteria | 801 |
| 369 | Ga0207687_10066658 | 3300025927 | Bacteria | 2559 |
| 370 | Ga0207687_10088588 | 3300025927 | Unclassified | 2252 |
| 371 | Ga0207687_10207748 | 3300025927 | Bacteria | 1534 |
| 372 | Ga0207687_10364518 | 3300025927 | Unclassified | 1180 |
| 373 | Ga0207687_10891493 | 3300025927 | Bacteria | 761 |
| 374 | Ga0207687_11214581 | 3300025927 | Unclassified | 648 |
| 375 | Ga0207644_11270249 | 3300025931 | Bacteria | 619 |
| 376 | Ga0207690_10127573 | 3300025932 | Unclassified | 1857 |
| 377 | Ga0207690_10179514 | 3300025932 | Bacteria | 1593 |
| 378 | Ga0207690_10562393 | 3300025932 | Bacteria | 928 |
| 379 | Ga0207706_10089337 | 3300025933 | Unclassified | 2709 |
| 380 | Ga0207706_10141883 | 3300025933 | Bacteria | 2113 |
| 381 | Ga0207706_10172787 | 3300025933 | Bacteria | 1899 |
| 382 | Ga0207706_10197244 | 3300025933 | Bacteria | 1766 |
| 383 | Ga0207706_11015748 | 3300025933 | Bacteria | 696 |
| 384 | Ga0207686_10154402 | 3300025934 | Bacteria | 1602 |
| 385 | Ga0207686_10213058 | 3300025934 | Bacteria | 1390 |
| 386 | Ga0207686_10260915 | 3300025934 | Bacteria | 1270 |
| 387 | Ga0207686_11280999 | 3300025934 | Bacteria | 601 |
| 388 | Ga0207709_10171622 | 3300025935 | Bacteria | 1523 |
| 389 | Ga0207709_10188695 | 3300025935 | Bacteria | 1462 |
| 390 | Ga0207709_10270124 | 3300025935 | Bacteria | 1251 |
| 391 | Ga0207709_10565281 | 3300025935 | Bacteria | 896 |
| 392 | Ga0207670_10739210 | 3300025936 | Bacteria | 816 |
| 393 | Ga0207670_10766510 | 3300025936 | Unclassified | 802 |
| 394 | Ga0207669_10078563 | 3300025937 | Unclassified | 2103 |
| 395 | Ga0207669_10993217 | 3300025937 | Bacteria | 705 |
| 396 | Ga0207669_11370424 | 3300025937 | Unclassified | 602 |
| 397 | Ga0207704_10026812 | 3300025938 | Bacteria | 3167 |
| 398 | Ga0207704_10547638 | 3300025938 | Bacteria | 940 |
| 399 | Ga0207691_10056139 | 3300025940 | Bacteria | 3588 |
| 400 | Ga0207691_10170160 | 3300025940 | Unclassified | 1908 |
| 401 | Ga0207691_10977785 | 3300025940 | Bacteria | 707 |
| 402 | Ga0207711_10093758 | 3300025941 | Bacteria | 2645 |
| 403 | Ga0207711_10548995 | 3300025941 | Bacteria | 1078 |
| 404 | Ga0207711_11056964 | 3300025941 | Bacteria | 752 |
| 405 | Ga0207689_10152690 | 3300025942 | Bacteria | 1903 |
| 406 | Ga0207689_10337410 | 3300025942 | Unclassified | 1252 |
| 407 | Ga0207689_10418396 | 3300025942 | Unclassified | 1118 |
| 408 | Ga0207661_10188627 | 3300025944 | Bacteria | 1806 |
| 409 | Ga0207661_10961868 | 3300025944 | Unclassified | 787 |
| 410 | Ga0207679_10283103 | 3300025945 | Unclassified | 1422 |
| 411 | Ga0207679_10656039 | 3300025945 | Unclassified | 949 |
| 412 | Ga0207667_10134895 | 3300025949 | Bacteria | 2542 |
| 413 | Ga0207651_10414205 | 3300025960 | Bacteria | 1149 |
| 414 | Ga0207712_10069073 | 3300025961 | Unclassified | 2534 |
| 415 | Ga0207712_10563461 | 3300025961 | Bacteria | 981 |
| 416 | Ga0207668_10142022 | 3300025972 | Unclassified | 1848 |
| 417 | Ga0207640_11702824 | 3300025981 | Bacteria | 569 |
| 418 | Ga0207658_10077911 | 3300025986 | Bacteria | 2531 |
| 419 | Ga0207658_10121208 | 3300025986 | Bacteria | 2086 |
| 420 | Ga0207658_11806762 | 3300025986 | Bacteria | 558 |
| 421 | Ga0207677_10947915 | 3300026023 | Bacteria | 778 |
| 422 | Ga0207703_10086327 | 3300026035 | Unclassified | 2628 |
| 423 | Ga0207639_10275528 | 3300026041 | Unclassified | 1477 |
| 424 | Ga0207639_11161987 | 3300026041 | Unclassified | 724 |
| 425 | Ga0207639_11594463 | 3300026041 | Bacteria | 612 |
| 426 | Ga0207678_10047590 | 3300026067 | Bacteria | 3708 |
| 427 | Ga0207678_10226717 | 3300026067 | Bacteria | 1600 |
| 428 | Ga0207678_10377108 | 3300026067 | Bacteria | 1226 |
| 429 | Ga0207708_10032182 | 3300026075 | Unclassified | 3984 |
| 430 | Ga0207708_10069193 | 3300026075 | Bacteria | 2702 |
| 431 | Ga0207708_10089332 | 3300026075 | Bacteria | 2374 |
| 432 | Ga0207708_10134392 | 3300026075 | Bacteria | 1936 |
| 433 | Ga0207708_10426865 | 3300026075 | Unclassified | 1100 |
| 434 | Ga0207708_10470189 | 3300026075 | Bacteria | 1050 |
| 435 | Ga0207708_10901095 | 3300026075 | Unclassified | 765 |
| 436 | Ga0207708_11664087 | 3300026075 | Bacteria | 561 |
| 437 | Ga0207702_11872164 | 3300026078 | Bacteria | 591 |
| 438 | Ga0207641_10094515 | 3300026088 | Bacteria | 2622 |
| 439 | Ga0207641_10695311 | 3300026088 | Bacteria | 1001 |
| 440 | Ga0207641_10993168 | 3300026088 | Bacteria | 836 |
| 441 | Ga0207641_10994922 | 3300026088 | Unclassified | 835 |
| 442 | Ga0207648_10003439 | 3300026089 | Bacteria | 16610 |
| 443 | Ga0207648_10330515 | 3300026089 | Bacteria | 1371 |
| 444 | Ga0207648_10468591 | 3300026089 | Bacteria | 1149 |
| 445 | Ga0207648_10493336 | 3300026089 | Bacteria | 1120 |
| 446 | Ga0207648_11381038 | 3300026089 | Unclassified | 662 |
| 447 | Ga0207676_10100042 | 3300026095 | Unclassified | 2401 |
| 448 | Ga0207676_10219216 | 3300026095 | Bacteria | 1693 |
| 449 | Ga0207676_10314967 | 3300026095 | Bacteria | 1434 |
| 450 | Ga0207676_10622732 | 3300026095 | Bacteria | 1039 |
| 451 | Ga0207676_11204432 | 3300026095 | Bacteria | 751 |
| 452 | Ga0207674_10008530 | 3300026116 | Bacteria | 11825 |
| 453 | Ga0207674_11332408 | 3300026116 | Bacteria | 687 |
| 454 | Ga0207675_100028736 | 3300026118 | Bacteria | 5180 |
| 455 | Ga0207675_100086911 | 3300026118 | Unclassified | 2936 |
| 456 | Ga0207675_100219474 | 3300026118 | Bacteria | 1831 |
| 457 | Ga0207675_100480534 | 3300026118 | Unclassified | 1235 |
| 458 | Ga0207675_100483334 | 3300026118 | Bacteria | 1231 |
| 459 | Ga0207675_101109805 | 3300026118 | Unclassified | 811 |
| 460 | Ga0207675_101194003 | 3300026118 | Unclassified | 781 |
| 461 | Ga0207675_101842238 | 3300026118 | Bacteria | 624 |
| 462 | Ga0207683_10022163 | 3300026121 | Bacteria | 5451 |
| 463 | Ga0207683_10079796 | 3300026121 | Unclassified | 2902 |
| 464 | Ga0207683_10249488 | 3300026121 | Bacteria | 1620 |
| 465 | Ga0207698_10404634 | 3300026142 | Unclassified | 1305 |
| 466 | Ga0207698_10560013 | 3300026142 | Bacteria | 1122 |
| 467 | Ga0207698_11369169 | 3300026142 | Bacteria | 722 |
| 468 | Ga0209974_10007045 | 3300027876 | Bacteria | 3889 |
| 469 | Ga0209974_10173392 | 3300027876 | Unclassified | 787 |
| 470 | Ga0207428_10148558 | 3300027907 | Unclassified | 1785 |
| 471 | Ga0268266_10865214 | 3300028379 | Unclassified | 874 |
| 472 | Ga0268265_10144367 | 3300028380 | Bacteria | 1997 |
| 473 | Ga0268265_10575597 | 3300028380 | Bacteria | 1073 |
| 474 | Ga0268265_12099725 | 3300028380 | Bacteria | 572 |
| 475 | Ga0268264_10115256 | 3300028381 | Bacteria | 2360 |
| 476 | Ga0268264_10301864 | 3300028381 | Bacteria | 1508 |
| 477 | Ga0268264_10445795 | 3300028381 | Unclassified | 1253 |
| 478 | Ga0265326_10058855 | 3300028558 | Bacteria | 1087 |
| 479 | Ga0265319_1017347 | 3300028563 | Bacteria | 2738 |
| 480 | Ga0265319_1082400 | 3300028563 | Bacteria | 1021 |
| 481 | Ga0265334_10001943 | 3300028573 | Bacteria | 9805 |
| 482 | Ga0265334_10004633 | 3300028573 | Bacteria | 6074 |
| 483 | Ga0265318_10010345 | 3300028577 | Bacteria | 4067 |
| 484 | Ga0265318_10014342 | 3300028577 | Bacteria | 3330 |
| 485 | Ga0265318_10016388 | 3300028577 | Bacteria | 3062 |
| 486 | Ga0265318_10070895 | 3300028577 | Bacteria | 1291 |
| 487 | Ga0265322_10024040 | 3300028654 | Bacteria | 1742 |
| 488 | Ga0265322_10142344 | 3300028654 | Bacteria | 685 |
| 489 | Ga0265336_10008491 | 3300028666 | Bacteria | 3601 |
| 490 | Ga0265338_10034931 | 3300028800 | Bacteria | 4845 |
| 491 | Ga0265338_10101284 | 3300028800 | Bacteria | 2346 |
| 492 | Ga0265324_10008176 | 3300029957 | Bacteria | 4177 |
| 493 | Ga0265324_10068147 | 3300029957 | Bacteria | 1213 |
| 494 | Ga0265324_10101583 | 3300029957 | Bacteria | 977 |
| 495 | Ga0265330_10303642 | 3300031235 | Bacteria | 673 |
| 496 | Ga0265332_10006365 | 3300031238 | Bacteria | 5357 |
| 497 | Ga0265328_10075045 | 3300031239 | Bacteria | 1244 |
| 498 | Ga0265320_10001498 | 3300031240 | Bacteria | 17012 |
| 499 | Ga0265320_10007410 | 3300031240 | Bacteria | 6814 |
| 500 | Ga0265325_10008089 | 3300031241 | Bacteria | 6232 |
| 501 | Ga0265325_10397012 | 3300031241 | Bacteria | 604 |
| 502 | Ga0265329_10003806 | 3300031242 | Bacteria | 6482 |
| 503 | Ga0265329_10005635 | 3300031242 | Bacteria | 5040 |
| 504 | Ga0265340_10001877 | 3300031247 | Bacteria | 11969 |
| 505 | Ga0265340_10404503 | 3300031247 | Bacteria | 602 |
| 506 | Ga0265339_10009152 | 3300031249 | Bacteria | 6250 |
| 507 | Ga0265339_10012944 | 3300031249 | Bacteria | 5071 |
| 508 | Ga0265339_10058102 | 3300031249 | Bacteria | 2090 |
| 509 | Ga0265339_10088770 | 3300031249 | Bacteria | 1623 |
| 510 | Ga0265331_10016671 | 3300031250 | Bacteria | 3851 |
| 511 | Ga0265331_10412040 | 3300031250 | Bacteria | 606 |
| 512 | Ga0265316_10110871 | 3300031344 | Bacteria | 2078 |
| 513 | Ga0265316_10119118 | 3300031344 | Bacteria | 1994 |
| 514 | Ga0265316_10898187 | 3300031344 | Unclassified | 619 |
| 515 | Ga0265313_10042081 | 3300031595 | Bacteria | 2246 |
| 516 | Ga0265314_10001127 | 3300031711 | Bacteria | 30914 |
| 517 | Ga0265314_10021038 | 3300031711 | Bacteria | 5027 |
| 518 | Ga0265314_10276533 | 3300031711 | Bacteria | 952 |
| 519 | Ga0265342_10015149 | 3300031712 | Bacteria | 5085 |
| 520 | Ga0316576_10160731 | 3300031727 | Bacteria | 1694 |
| 521 | Ga0307405_10258566 | 3300031731 | Bacteria | 1299 |
| 522 | Ga0307413_10553978 | 3300031824 | Unclassified | 933 |
| 523 | Ga0307413_11422991 | 3300031824 | Bacteria | 610 |
| 524 | Ga0307410_10130314 | 3300031852 | Bacteria | 1847 |
| 525 | Ga0307410_10231424 | 3300031852 | Bacteria | 1427 |
| 526 | Ga0307406_10261548 | 3300031901 | Bacteria | 1309 |
| 527 | Ga0307407_10565025 | 3300031903 | Bacteria | 843 |
| 528 | Ga0307412_10191706 | 3300031911 | Bacteria | 1546 |
| 529 | Ga0307412_10603499 | 3300031911 | Bacteria | 930 |
| 530 | Ga0307409_100131540 | 3300031995 | Bacteria | 2139 |
| 531 | Ga0307409_100359397 | 3300031995 | Bacteria | 1377 |
| 532 | Ga0307416_100405208 | 3300032002 | Bacteria | 1403 |
| 533 | Ga0307416_100543089 | 3300032002 | Unclassified | 1234 |
| 534 | Ga0307416_101251509 | 3300032002 | Bacteria | 848 |
| 535 | Ga0307416_101328505 | 3300032002 | Unclassified | 825 |
| 536 | Ga0307416_101448618 | 3300032002 | Bacteria | 792 |
| 537 | Ga0307415_100049288 | 3300032126 | Bacteria | 2847 |
| 538 | Ga0307415_100136765 | 3300032126 | Bacteria | 1865 |
| 539 | Ga0307415_100187912 | 3300032126 | Bacteria | 1627 |
| 540 | Ga0307415_101979620 | 3300032126 | Bacteria | 567 |
| 541 | Ga0373938_0076967 | 3300034957 | Bacteria | 807 |
| 542 | Ga0373952_0162070 | 3300035092 | Bacteria | 634 |
| 543 | Ga0373932_0422924 | 3300035112 | Bacteria | 519 |
| 544 | Ga0373941_0026029 | 3300035115 | Bacteria | 1696 |
| 545 | Ga0373941_0459806 | 3300035115 | Bacteria | 535 |
| 546 | Ga0373960_0284178 | 3300035121 | Bacteria | 611 |
| 547 | Ga0373943_0962522 | 3300035170 | Bacteria | 511 |
| 548 | Ga0373961_0178401 | 3300035241 | Bacteria | 739 |
| 549 | Ga0316574_0097936 | 3300035398 | Bacteria | 1875 |
| 550 | Ga0373931_0078894 | 3300035691 | Bacteria | 1812 |
| 551 | Ga0373937_0448142 | 3300036401 | Unclassified | 1226 |
| 552 | Ga0373937_0590370 | 3300036401 | Unclassified | 1055 |
| 553 | Ga0373937_0746085 | 3300036401 | Bacteria | 926 |
| 554 | Ga0395900_0679730 | 3300037418 | Bacteria | 964 |
| 555 | Ga0395905_0290479 | 3300037471 | Bacteria | 1522 |
| 556 | Ga0395905_0953909 | 3300037471 | Unclassified | 761 |
| 557 | Ga0395905_1567147 | 3300037471 | Bacteria | 563 |
| 558 | Ga0395901_0973059 | 3300038443 | Bacteria | 826 |
| 559 | Ga0242420_065388 | 3300038996 | Bacteria | 732 |
| 560 | Ga0439439_0185965 | 3300041406 | Bacteria | 600 |
| 561 | Ga0439453_0042708 | 3300041408 | Bacteria | 894 |
| 562 | Ga0451800_0784458 | 3300041459 | Bacteria | 532 |
| 563 | Ga0451802_2022771 | 3300041460 | Bacteria | 780 |
| 564 | Ga0451839_0535126 | 3300041496 | Bacteria | 640 |
| 565 | Ga0451843_0977027 | 3300041509 | Bacteria | 517 |
| 566 | Ga0451853_1580022 | 3300041512 | Bacteria | 675 |
| 567 | Ga0451853_2430070 | 3300041512 | Bacteria | 934 |
| 568 | Ga0451853_2653829 | 3300041512 | Bacteria | 543 |
| 569 | Ga0451853_3475761 | 3300041512 | Bacteria | 763 |
| 570 | Ga0439431_0182800 | 3300041997 | Bacteria | 606 |
| 571 | Ga0439445_0149398 | 3300042004 | Bacteria | 680 |
| 572 | Ga0439452_059949 | 3300042010 | Bacteria | 854 |
| 573 | Ga0439456_133750 | 3300042013 | Unclassified | 573 |
| 574 | Ga0450920_093293 | 3300042122 | Unclassified | 622 |
| 575 | Ga0450920_093712 | 3300042122 | Bacteria | 620 |
| 576 | Ga0450920_130043 | 3300042122 | Bacteria | 530 |
| 577 | Ga0450906_058475 | 3300042145 | Bacteria | 684 |
| 578 | Ga0439446_0022435 | 3300042156 | Bacteria | 1790 |
| 579 | Ga0439446_0068544 | 3300042156 | Bacteria | 1082 |
| 580 | Ga0450909_053996 | 3300042185 | Bacteria | 630 |
| 581 | Ga0439434_0081229 | 3300042435 | Bacteria | 1029 |
| 582 | Ga0439434_0216041 | 3300042435 | Bacteria | 650 |
| 583 | Ga0439435_0105595 | 3300042436 | Unclassified | 870 |
| 584 | Ga0439459_0140241 | 3300042438 | Bacteria | 624 |
| 585 | Ga0439460_0115721 | 3300042461 | Bacteria | 874 |
| 586 | Ga0451577_2002995 | 3300042876 | Bacteria | 506 |
| 587 | Ga0453683_0360827 | 3300044673 | Bacteria | 934 |
| 588 | Ga0466960_1042946 | 3300044901 | Bacteria | 504 |
| 589 | Ga0451576_0208745 | 3300045051 | Bacteria | 2040 |
| 590 | Ga0451576_0703505 | 3300045051 | Bacteria | 1062 |
| 591 | Ga0495603_0093249 | 3300046455 | Bacteria | 1760 |
| 592 | Ga0495629_0105254 | 3300046459 | Bacteria | 1968 |
| 593 | Ga0495629_0946338 | 3300046459 | Bacteria | 563 |
| 594 | Ga0495641_0126666 | 3300046461 | Bacteria | 1140 |
| 595 | Ga0495641_0436007 | 3300046461 | Bacteria | 596 |
| 596 | Ga0495651_0248432 | 3300046462 | Unclassified | 1216 |
| 597 | Ga0495582_0696652 | 3300046473 | Bacteria | 588 |
| 598 | Ga0495664_0631171 | 3300046477 | Unclassified | 636 |
| 599 | Ga0495584_0499085 | 3300046491 | Bacteria | 620 |
| 600 | Ga0495608_0461830 | 3300046511 | Unclassified | 772 |
| 601 | Ga0495618_0250690 | 3300046514 | Unclassified | 1111 |
| 602 | Ga0495628_0561832 | 3300046516 | Bacteria | 818 |
| 603 | Ga0495631_0373482 | 3300046518 | Bacteria | 607 |
| 604 | Ga0495644_0194542 | 3300046523 | Bacteria | 781 |
| 605 | Ga0495644_0353498 | 3300046523 | Unclassified | 579 |
| 606 | Ga0495587_0370491 | 3300046536 | Bacteria | 797 |
| 607 | Ga0495656_0302452 | 3300046615 | Bacteria | 820 |
| 608 | Ga0495656_0308081 | 3300046615 | Bacteria | 813 |
| 609 | Ga0495656_0341489 | 3300046615 | Bacteria | 774 |
| 610 | Ga0495656_0606877 | 3300046615 | Unclassified | 586 |
| 611 | Ga0495668_0342198 | 3300046616 | Bacteria | 821 |
| 612 | Ga0495659_0143446 | 3300046664 | Bacteria | 955 |
| 613 | Ga0495647_0317400 | 3300046681 | Bacteria | 705 |
| 614 | Ga0495624_0265811 | 3300046690 | Bacteria | 1036 |
| 615 | Ga0495624_0407720 | 3300046690 | Unclassified | 816 |
| 616 | Ga0495581_0695796 | 3300047315 | Bacteria | 586 |
| 617 | Ga0495604_0081845 | 3300047317 | Bacteria | 2416 |
| 618 | Ga0495674_0152941 | 3300047319 | Bacteria | 1934 |
| 619 | Ga0495672_0542443 | 3300047320 | Unclassified | 511 |
| 620 | Ga0495676_0682754 | 3300047321 | Bacteria | 665 |
| 621 | Ga0496100_0011594 | 3300048903 | Bacteria | 5022 |
| 622 | Ga0496100_0709892 | 3300048903 | Bacteria | 785 |
| 623 | Ga0496100_0790157 | 3300048903 | Bacteria | 743 |
| 624 | Ga0496100_1085552 | 3300048903 | Bacteria | 631 |
| 625 | Ga0496101_0000872 | 3300048904 | Bacteria | 17776 |
| 626 | Ga0496101_0363591 | 3300048904 | Unclassified | 1138 |
| 627 | Ga0496101_0419367 | 3300048904 | Bacteria | 1055 |
| 628 | Ga0496101_0427795 | 3300048904 | Bacteria | 1044 |
| 629 | Ga0496102_0079132 | 3300048905 | Bacteria | 3027 |
| 630 | Ga0496102_0294692 | 3300048905 | Bacteria | 1529 |
| 631 | Ga0496102_0334738 | 3300048905 | Bacteria | 1426 |
| 632 | Ga0496102_0390483 | 3300048905 | Bacteria | 1309 |
| 633 | Ga0496102_0519986 | 3300048905 | Bacteria | 1113 |
| 634 | Ga0496102_0772648 | 3300048905 | Bacteria | 883 |
| 635 | Ga0496102_1605578 | 3300048905 | Unclassified | 569 |
| 636 | Ga0496103_0286918 | 3300048906 | Bacteria | 1059 |
| 637 | Ga0496103_0440201 | 3300048906 | Bacteria | 836 |
| 638 | Ga0496103_0632553 | 3300048906 | Bacteria | 681 |
| 639 | Ga0496103_0929009 | 3300048906 | Unclassified | 544 |
| 640 | Ga0496103_0946468 | 3300048906 | Bacteria | 538 |
| 641 | Ga0496104_0014647 | 3300048907 | Bacteria | 7084 |
| 642 | Ga0496104_0015340 | 3300048907 | Bacteria | 6937 |
| 643 | Ga0496105_0000581 | 3300048908 | Bacteria | 24264 |
| 644 | Ga0496105_0154928 | 3300048908 | Unclassified | 1882 |
| 645 | Ga0496105_0197698 | 3300048908 | Bacteria | 1642 |
| 646 | Ga0496105_0845929 | 3300048908 | Bacteria | 693 |
| 647 | Ga0496105_0987240 | 3300048908 | Bacteria | 630 |
| 648 | Ga0496106_0046452 | 3300048909 | Bacteria | 3265 |
| 649 | Ga0496106_0224204 | 3300048909 | Bacteria | 1500 |
| 650 | Ga0496106_0415049 | 3300048909 | Bacteria | 1082 |
| 651 | Ga0496107_0096589 | 3300048910 | Bacteria | 2163 |
| 652 | Ga0496107_0178428 | 3300048910 | Bacteria | 1577 |
| 653 | Ga0496107_0343189 | 3300048910 | Unclassified | 1111 |
| 654 | Ga0496107_1032142 | 3300048910 | Bacteria | 596 |
| 655 | Ga0496108_0001990 | 3300048911 | Bacteria | 16355 |
| 656 | Ga0496108_0010666 | 3300048911 | Bacteria | 7454 |
| 657 | Ga0496108_0030442 | 3300048911 | Bacteria | 4473 |
| 658 | Ga0496108_0095399 | 3300048911 | Bacteria | 2532 |
| 659 | Ga0496108_0237950 | 3300048911 | Bacteria | 1584 |
| 660 | Ga0496108_0508207 | 3300048911 | Bacteria | 1052 |
| 661 | Ga0496108_1426591 | 3300048911 | Unclassified | 578 |
| 662 | Ga0496109_0007477 | 3300048912 | Bacteria | 9255 |
| 663 | Ga0496109_0049499 | 3300048912 | Bacteria | 3825 |
| 664 | Ga0496109_0059207 | 3300048912 | Bacteria | 3499 |
| 665 | Ga0496109_0070365 | 3300048912 | Bacteria | 3211 |
| 666 | Ga0496109_0242534 | 3300048912 | Bacteria | 1696 |
| 667 | Ga0496109_0477587 | 3300048912 | Bacteria | 1177 |
| 668 | Ga0496109_1082804 | 3300048912 | Bacteria | 739 |
| 669 | Ga0496109_1308119 | 3300048912 | Bacteria | 661 |
| 670 | Ga0496110_0007113 | 3300048913 | Bacteria | 8911 |
| 671 | Ga0496110_0009071 | 3300048913 | Bacteria | 8029 |
| 672 | Ga0496110_0081321 | 3300048913 | Bacteria | 2888 |
| 673 | Ga0496110_0463856 | 3300048913 | Bacteria | 1154 |
| 674 | Ga0496111_0000720 | 3300048914 | Bacteria | 17632 |
| 675 | Ga0496111_0240530 | 3300048914 | Unclassified | 1344 |
| 676 | Ga0496111_1080654 | 3300048914 | Bacteria | 572 |
| 677 | Ga0496112_0000012 | 3300048915 | Bacteria | 243643 |
| 678 | Ga0496112_0038602 | 3300048915 | Bacteria | 4663 |
| 679 | Ga0496112_0336035 | 3300048915 | Bacteria | 1454 |
| 680 | Ga0496112_0414141 | 3300048915 | Bacteria | 1287 |
| 681 | Ga0496112_0446070 | 3300048915 | Bacteria | 1232 |
| 682 | Ga0496113_0028780 | 3300048916 | Bacteria | 4000 |
| 683 | Ga0496113_0118455 | 3300048916 | Unclassified | 2068 |
| 684 | Ga0496113_0310000 | 3300048916 | Bacteria | 1264 |
| 685 | Ga0496113_0499992 | 3300048916 | Unclassified | 976 |
| 686 | Ga0496114_0003028 | 3300048917 | Bacteria | 12889 |
| 687 | Ga0496114_0154624 | 3300048917 | Bacteria | 1991 |
| 688 | Ga0496114_0314323 | 3300048917 | Bacteria | 1384 |
| 689 | Ga0496114_1052915 | 3300048917 | Bacteria | 698 |
| 690 | Ga0501031_0031443 | 3300049568 | Bacteria | 3463 |
| 691 | Ga0501031_0063979 | 3300049568 | Bacteria | 2396 |
| 692 | Ga0501031_0119000 | 3300049568 | Bacteria | 1726 |
| 693 | Ga0501031_0124284 | 3300049568 | Bacteria | 1685 |
| 694 | Ga0501031_0559156 | 3300049568 | Bacteria | 737 |
| 695 | Ga0501032_0016466 | 3300049569 | Bacteria | 5200 |
| 696 | Ga0501033_0227705 | 3300049570 | Bacteria | 1325 |
| 697 | Ga0501033_0250712 | 3300049570 | Bacteria | 1255 |
| 698 | Ga0501033_0512474 | 3300049570 | Bacteria | 829 |
| 699 | Ga0501033_0653815 | 3300049570 | Bacteria | 718 |
| 700 | Ga0501033_0712866 | 3300049570 | Unclassified | 682 |
| 701 | Ga0501033_1210930 | 3300049570 | Archaea | 500 |
| 702 | Ga0501034_1613367 | 3300049571 | Bacteria | 522 |
| 703 | Ga0501036_0036858 | 3300049572 | Bacteria | 4137 |
| 704 | Ga0501036_0078740 | 3300049572 | Bacteria | 2788 |
| 705 | Ga0501036_0087432 | 3300049572 | Bacteria | 2634 |
| 706 | Ga0501036_0116002 | 3300049572 | Bacteria | 2262 |
| 707 | Ga0501036_0299380 | 3300049572 | Bacteria | 1345 |
| 708 | Ga0501036_0354919 | 3300049572 | Bacteria | 1224 |
| 709 | Ga0501036_0567165 | 3300049572 | Unclassified | 943 |
| 710 | Ga0501036_0692906 | 3300049572 | Bacteria | 842 |
| 711 | Ga0501037_0253001 | 3300049573 | Bacteria | 1232 |
| 712 | Ga0501037_0587714 | 3300049573 | Bacteria | 749 |
| 713 | Ga0501038_0041215 | 3300049574 | Bacteria | 4027 |
| 714 | Ga0501038_0085048 | 3300049574 | Bacteria | 2661 |
| 715 | Ga0501038_0115236 | 3300049574 | Bacteria | 2222 |
| 716 | Ga0501038_0467885 | 3300049574 | Bacteria | 968 |
| 717 | Ga0501038_0509168 | 3300049574 | Bacteria | 920 |
| 718 | Ga0501039_0031605 | 3300049575 | Bacteria | 4082 |
| 719 | Ga0501039_0095223 | 3300049575 | Bacteria | 2321 |
| 720 | Ga0501039_0152389 | 3300049575 | Bacteria | 1816 |
| 721 | Ga0501039_0224022 | 3300049575 | Bacteria | 1478 |
| 722 | Ga0501039_0252823 | 3300049575 | Bacteria | 1385 |
| 723 | Ga0501039_0607759 | 3300049575 | Bacteria | 857 |
| 724 | Ga0501040_0011147 | 3300049576 | Bacteria | 5877 |
| 725 | Ga0501040_0017541 | 3300049576 | Bacteria | 4752 |
| 726 | Ga0501040_0027921 | 3300049576 | Bacteria | 3801 |
| 727 | Ga0501040_0076212 | 3300049576 | Bacteria | 2319 |
| 728 | Ga0501040_0111224 | 3300049576 | Bacteria | 1915 |
| 729 | Ga0501040_0115325 | 3300049576 | Bacteria | 1881 |
| 730 | Ga0501041_0038493 | 3300049577 | Bacteria | 2900 |
| 731 | Ga0501041_0094020 | 3300049577 | Bacteria | 1851 |
| 732 | Ga0501041_0130930 | 3300049577 | Bacteria | 1562 |
| 733 | Ga0501041_0137218 | 3300049577 | Bacteria | 1524 |
| 734 | Ga0501041_0340352 | 3300049577 | Bacteria | 947 |
| 735 | Ga0501042_0040671 | 3300049578 | Bacteria | 3305 |
| 736 | Ga0501042_0059941 | 3300049578 | Bacteria | 2718 |
| 737 | Ga0501042_0111362 | 3300049578 | Bacteria | 1971 |
| 738 | Ga0501042_0390114 | 3300049578 | Bacteria | 1008 |
| 739 | Ga0501042_0836785 | 3300049578 | Bacteria | 670 |
| 740 | Ga0501043_0023491 | 3300049579 | Bacteria | 4836 |
| 741 | Ga0501043_0946528 | 3300049579 | Bacteria | 615 |
| 742 | Ga0501043_1005794 | 3300049579 | Bacteria | 593 |
| 743 | Ga0501043_1225344 | 3300049579 | Bacteria | 526 |
| 744 | Ga0501046_0060612 | 3300049580 | Bacteria | 2960 |
| 745 | Ga0501046_0177205 | 3300049580 | Bacteria | 1596 |
| 746 | Ga0501046_0254362 | 3300049580 | Bacteria | 1292 |
| 747 | Ga0501046_0663518 | 3300049580 | Bacteria | 737 |
| 748 | Ga0501048_0018491 | 3300049582 | Bacteria | 5123 |
| 749 | Ga0501048_0045084 | 3300049582 | Bacteria | 3151 |
| 750 | Ga0501048_0109088 | 3300049582 | Bacteria | 1954 |
| 751 | Ga0501048_0178839 | 3300049582 | Bacteria | 1503 |
| 752 | Ga0501048_0273395 | 3300049582 | Bacteria | 1201 |
| 753 | Ga0501048_0687160 | 3300049582 | Bacteria | 735 |
| 754 | Ga0501048_0979574 | 3300049582 | Bacteria | 608 |
| 755 | Ga0501067_0005924 | 3300049583 | Bacteria | 6777 |
| 756 | Ga0501067_0037466 | 3300049583 | Bacteria | 2694 |
| 757 | Ga0501067_0115880 | 3300049583 | Bacteria | 1490 |
| 758 | Ga0501068_0040609 | 3300049584 | Bacteria | 2794 |
| 759 | Ga0501068_0084716 | 3300049584 | Bacteria | 1950 |
| 760 | Ga0501069_0089169 | 3300049585 | Bacteria | 1743 |
| 761 | Ga0501069_0302571 | 3300049585 | Bacteria | 938 |
| 762 | Ga0501070_0131886 | 3300049586 | Bacteria | 2064 |
| 763 | Ga0501070_0390552 | 3300049586 | Bacteria | 1126 |
| 764 | Ga0501070_0445479 | 3300049586 | Bacteria | 1044 |
| 765 | Ga0501070_0550379 | 3300049586 | Bacteria | 924 |
| 766 | Ga0501070_0927922 | 3300049586 | Bacteria | 678 |
| 767 | Ga0501071_0001369 | 3300049587 | Bacteria | 13973 |
| 768 | Ga0501071_0041141 | 3300049587 | Bacteria | 3309 |
| 769 | Ga0501071_0054587 | 3300049587 | Bacteria | 2882 |
| 770 | Ga0501071_0056100 | 3300049587 | Bacteria | 2845 |
| 771 | Ga0501071_0108713 | 3300049587 | Bacteria | 2048 |
| 772 | Ga0501071_0171577 | 3300049587 | Bacteria | 1624 |
| 773 | Ga0501071_0382881 | 3300049587 | Bacteria | 1073 |
| 774 | Ga0501071_0435038 | 3300049587 | Bacteria | 1003 |
| 775 | Ga0501071_0535138 | 3300049587 | Bacteria | 899 |
| 776 | Ga0501071_0565348 | 3300049587 | Bacteria | 874 |
| 777 | Ga0501072_0014411 | 3300049588 | Bacteria | 6059 |
| 778 | Ga0501072_0051845 | 3300049588 | Bacteria | 3230 |
| 779 | Ga0501072_0071663 | 3300049588 | Bacteria | 2738 |
| 780 | Ga0501072_0129498 | 3300049588 | Unclassified | 2011 |
| 781 | Ga0501072_0331857 | 3300049588 | Bacteria | 1208 |
| 782 | Ga0501072_0395075 | 3300049588 | Bacteria | 1097 |
| 783 | Ga0501072_0852025 | 3300049588 | Bacteria | 713 |
| 784 | Ga0501072_1414334 | 3300049588 | Bacteria | 538 |
| 785 | Ga0501073_0168114 | 3300049589 | Bacteria | 1518 |
| 786 | Ga0501073_0236452 | 3300049589 | Bacteria | 1262 |
| 787 | Ga0501073_1068531 | 3300049589 | Unclassified | 555 |
| 788 | Ga0501073_1146739 | 3300049589 | Bacteria | 534 |
| 789 | Ga0501074_0088615 | 3300049590 | Bacteria | 2216 |
| 790 | Ga0501074_0104553 | 3300049590 | Bacteria | 2027 |
| 791 | Ga0501074_0132195 | 3300049590 | Bacteria | 1785 |
| 792 | Ga0501074_0178026 | 3300049590 | Bacteria | 1517 |
| 793 | Ga0501074_0339889 | 3300049590 | Unclassified | 1066 |
| 794 | Ga0501074_0409887 | 3300049590 | Unclassified | 961 |
| 795 | Ga0501075_0023128 | 3300049591 | Bacteria | 4548 |
| 796 | Ga0501075_0035448 | 3300049591 | Bacteria | 3721 |
| 797 | Ga0501075_0038094 | 3300049591 | Bacteria | 3594 |
| 798 | Ga0501075_0049934 | 3300049591 | Bacteria | 3144 |
| 799 | Ga0501075_0130379 | 3300049591 | Bacteria | 1915 |
| 800 | Ga0501075_0174183 | 3300049591 | Bacteria | 1642 |
| 801 | Ga0501075_0229469 | 3300049591 | Unclassified | 1416 |
| 802 | Ga0501075_0283781 | 3300049591 | Bacteria | 1261 |
| 803 | Ga0501075_1042886 | 3300049591 | Bacteria | 621 |
| 804 | Ga0501075_1069260 | 3300049591 | Bacteria | 613 |
| 805 | Ga0501075_1418908 | 3300049591 | Bacteria | 526 |
| 806 | Ga0501076_0006950 | 3300049592 | Bacteria | 8226 |
| 807 | Ga0501076_0082619 | 3300049592 | Bacteria | 2579 |
| 808 | Ga0501076_0088872 | 3300049592 | Bacteria | 2483 |
| 809 | Ga0501076_0142568 | 3300049592 | Bacteria | 1947 |
| 810 | Ga0501076_0228435 | 3300049592 | Bacteria | 1521 |
| 811 | Ga0501076_0363807 | 3300049592 | Bacteria | 1188 |
| 812 | Ga0501076_0400004 | 3300049592 | Unclassified | 1129 |
| 813 | Ga0501076_0428552 | 3300049592 | Bacteria | 1088 |
| 814 | Ga0501076_0773849 | 3300049592 | Bacteria | 792 |
| 815 | Ga0501076_0964125 | 3300049592 | Unclassified | 703 |
| 816 | Ga0501076_1624810 | 3300049592 | Bacteria | 530 |
| 817 | Ga0501077_0020076 | 3300049593 | Bacteria | 4228 |
| 818 | Ga0501077_0064216 | 3300049593 | Bacteria | 2329 |
| 819 | Ga0501077_0105771 | 3300049593 | Bacteria | 1783 |
| 820 | Ga0501077_0113587 | 3300049593 | Bacteria | 1717 |
| 821 | Ga0501077_0228051 | 3300049593 | Bacteria | 1184 |
| 822 | Ga0501077_0251209 | 3300049593 | Bacteria | 1124 |
| 823 | Ga0501077_0454737 | 3300049593 | Unclassified | 820 |
| 824 | Ga0501079_0004307 | 3300049741 | Bacteria | 10564 |
| 825 | Ga0501079_0014517 | 3300049741 | Bacteria | 6008 |
| 826 | Ga0501079_0036479 | 3300049741 | Bacteria | 3787 |
| 827 | Ga0501079_0187088 | 3300049741 | Bacteria | 1616 |
| 828 | Ga0501079_0234507 | 3300049741 | Bacteria | 1434 |
| 829 | Ga0501079_0260452 | 3300049741 | Bacteria | 1355 |
| 830 | Ga0501079_0650852 | 3300049741 | Bacteria | 829 |
| 831 | Ga0501079_0702175 | 3300049741 | Archaea | 796 |
| 832 | Ga0501080_0031946 | 3300049742 | Bacteria | 4907 |
| 833 | Ga0501080_0043089 | 3300049742 | Bacteria | 4201 |
| 834 | Ga0501080_0134411 | 3300049742 | Bacteria | 2289 |
| 835 | Ga0501080_0320325 | 3300049742 | Bacteria | 1404 |
| 836 | Ga0501080_0352465 | 3300049742 | Bacteria | 1329 |
| 837 | Ga0501080_1014516 | 3300049742 | Bacteria | 719 |
| 838 | Ga0501080_1546728 | 3300049742 | Bacteria | 563 |
| 839 | Ga0501081_0030851 | 3300049743 | Bacteria | 3631 |
| 840 | Ga0501081_0043456 | 3300049743 | Bacteria | 3083 |
| 841 | Ga0501081_0044693 | 3300049743 | Bacteria | 3041 |
| 842 | Ga0501081_0052480 | 3300049743 | Bacteria | 2814 |
| 843 | Ga0501081_0772841 | 3300049743 | Bacteria | 722 |
| 844 | Ga0501081_1298052 | 3300049743 | Bacteria | 552 |
| 845 | Ga0501083_0161735 | 3300049744 | Bacteria | 1465 |
| 846 | Ga0501083_0226042 | 3300049744 | Bacteria | 1219 |
| 847 | Ga0501083_0274239 | 3300049744 | Unclassified | 1097 |
| 848 | Ga0501035_0141277 | 3300049822 | Bacteria | 2093 |
| 849 | Ga0501035_0158292 | 3300049822 | Bacteria | 1962 |
| 850 | Ga0501035_0211535 | 3300049822 | Bacteria | 1659 |
| 851 | Ga0501045_0006628 | 3300049824 | Bacteria | 8025 |
| 852 | Ga0501045_0170368 | 3300049824 | Bacteria | 1622 |
| 853 | Ga0501045_0175018 | 3300049824 | Bacteria | 1599 |
| 854 | Ga0501045_0284327 | 3300049824 | Bacteria | 1231 |
| 855 | Ga0501045_0502336 | 3300049824 | Bacteria | 901 |
| 856 | Ga0501045_0559532 | 3300049824 | Bacteria | 848 |
| 857 | nmdc:mga0yw44_372291_c1 | 3300050492 | Bacteria | 964 |
| 858 | nmdc:mga05p37_1088114_c1 | 3300050507 | Bacteria | 839 |
| 859 | nmdc:mga05p37_13160_c1 | 3300050507 | Bacteria | 9903 |
| 860 | nmdc:mga05p37_29045_c1 | 3300050507 | Bacteria | 6748 |
| 861 | nmdc:mga05p37_309457_c1 | 3300050507 | Bacteria | 1873 |
| 862 | nmdc:mga05p37_431007_c1 | 3300050507 | Bacteria | 1532 |
| 863 | nmdc:mga05p37_687055_c1 | 3300050507 | Bacteria | 1139 |
| 864 | nmdc:mga05p37_764891_c1 | 3300050507 | Archaea | 1062 |
| 865 | nmdc:mga05p37_89551_c1 | 3300050507 | Bacteria | 3792 |
| 866 | nmdc:mga06r32_604729_c1 | 3300050510 | Bacteria | 1067 |
| 867 | nmdc:mga06r32_99639_c1 | 3300050510 | Bacteria | 2850 |
| 868 | nmdc:mga08y16_148953_c1 | 3300050511 | Bacteria | 2433 |
| 869 | nmdc:mga08y16_31535_c1 | 3300050511 | Bacteria | 5574 |
| 870 | nmdc:mga08y16_91638_c1 | 3300050511 | Unclassified | 3167 |
| 871 | nmdc:mga0n895_1126745_c1 | 3300050512 | Bacteria | 761 |
| 872 | nmdc:mga0n895_14388_c1 | 3300050512 | Bacteria | 7182 |
| 873 | nmdc:mga0n895_1750667_c1 | 3300050512 | Unclassified | 583 |
| 874 | nmdc:mga0n895_1875070_c1 | 3300050512 | Bacteria | 559 |
| 875 | nmdc:mga0n895_422661_c1 | 3300050512 | Bacteria | 1347 |
| 876 | nmdc:mga0n895_784852_c1 | 3300050512 | Bacteria | 944 |
| 877 | nmdc:mga0rr50_1320002_c1 | 3300050513 | Bacteria | 612 |
| 878 | nmdc:mga0rr50_259671_c1 | 3300050513 | Bacteria | 1445 |
| 879 | nmdc:mga0rr50_528011_c1 | 3300050513 | Unclassified | 1004 |
| 880 | nmdc:mga0rr50_558199_c1 | 3300050513 | Unclassified | 975 |
| 881 | nmdc:mga08x19_279074_c1 | 3300050514 | Unclassified | 1157 |
| 882 | nmdc:mga08x19_313180_c1 | 3300050514 | Unclassified | 1091 |
| 883 | nmdc:mga08x19_767452_c1 | 3300050514 | Bacteria | 685 |
| 884 | nmdc:mga08x19_825310_c1 | 3300050514 | Unclassified | 658 |
| 885 | nmdc:mga0a205_160448_c1 | 3300050515 | Unclassified | 2145 |
| 886 | nmdc:mga0a205_20976_c1 | 3300050515 | Bacteria | 6175 |
| 887 | nmdc:mga0a205_216027_c1 | 3300050515 | Bacteria | 1804 |
| 888 | nmdc:mga0a205_24744_c1 | 3300050515 | Bacteria | 5712 |
| 889 | nmdc:mga0a205_402133_c1 | 3300050515 | Bacteria | 1233 |
| 890 | nmdc:mga0a205_528432_c1 | 3300050515 | Bacteria | 1036 |
| 891 | nmdc:mga0a205_668583_c1 | 3300050515 | Bacteria | 889 |
| 892 | Ga0495612_0000106 | 3300053078 | Bacteria | 35725 |
| 893 | Ga0495595_0444154 | 3300053084 | Unclassified | 659 |
| 894 | Ga0495619_0150521 | 3300053085 | Bacteria | 1605 |
| 895 | Ga0501084_0086236 | 3300054114 | Bacteria | 2636 |
| 896 | Ga0501084_0143408 | 3300054114 | Bacteria | 2012 |
| 897 | Ga0501084_0147979 | 3300054114 | Bacteria | 1978 |
| 898 | Ga0501084_0172720 | 3300054114 | Bacteria | 1824 |
| 899 | Ga0501084_0242704 | 3300054114 | Bacteria | 1520 |
| 900 | Ga0501084_0728531 | 3300054114 | Bacteria | 836 |
| 901 | Ga0501084_1513425 | 3300054114 | Bacteria | 561 |
| 902 | Ga0590071_001827 | 3300059421 | Bacteria | 5495 |
| 903 | Ga0590075_002708 | 3300059424 | Bacteria | 4237 |
| 904 | Ga0590075_063403 | 3300059424 | Unclassified | 953 |
| 905 | Ga0590077_019669 | 3300059426 | Unclassified | 1431 |
| 906 | Ga0590077_170748 | 3300059426 | Unclassified | 523 |
| 907 | Ga0501082_0021804 | 3300060353 | Bacteria | 5522 |
| 908 | Ga0501082_0051125 | 3300060353 | Bacteria | 3562 |
| 909 | Ga0501082_0051373 | 3300060353 | Bacteria | 3553 |
| 910 | Ga0501082_0121670 | 3300060353 | Bacteria | 2262 |
| 911 | Ga0501082_0220412 | 3300060353 | Bacteria | 1650 |
| 912 | Ga0501082_0736116 | 3300060353 | Archaea | 863 |
| 913 | Ga0501082_1114942 | 3300060353 | Bacteria | 690 |
| 914 | Ga0501082_1158402 | 3300060353 | Bacteria | 676 |
| 915 | Ga0501082_1212601 | 3300060353 | Bacteria | 659 |
| 916 | Ga0501082_1933932 | 3300060353 | Bacteria | 514 |
| 917 | Ga0530510_0001133 | 3300061734 | Bacteria | 17731 |
| 918 | Ga0530510_0028432 | 3300061734 | Bacteria | 4009 |
| 919 | Ga0530510_0168605 | 3300061734 | Bacteria | 1621 |
| 920 | Ga0530510_0259688 | 3300061734 | Bacteria | 1295 |
| 921 | Ga0530510_0479945 | 3300061734 | Bacteria | 942 |
| 922 | Ga0530510_0646765 | 3300061734 | Bacteria | 805 |
| 923 | Ga0530510_0679532 | 3300061734 | Bacteria | 784 |
| 924 | Ga0070675_100970754 | |||
| 925 | JGI25406J46586_10006705 | |||
| 926 | Ga0070676_10167750 | |||
| 927 | Ga0070683_100496332 | |||
| 928 | Ga0070683_100915679 | |||
| 929 | Ga0070683_101536871 | |||
| 930 | Ga0070690_100071315 | |||
| 931 | Ga0070690_100462493 | |||
| 932 | Ga0070670_100138938 | |||
| 933 | Ga0070670_100343930 | |||
| 934 | Ga0068869_100161285 | |||
| 935 | Ga0068869_100162104 | |||
| 936 | Ga0068869_100826735 | |||
| 937 | Ga0070666_10384866 | |||
| 938 | Ga0070666_10436981 | |||
| 939 | Ga0070666_11103817 | |||
| 940 | Ga0070680_100425633 | |||
| 941 | Ga0070682_100108106 | |||
| 942 | Ga0068868_101270969 | |||
| 943 | Ga0070660_100055189 | |||
| 944 | Ga0070660_100510967 | |||
| 945 | Ga0070689_100031880 | |||
| 946 | Ga0070689_100363092 | |||
| 947 | Ga0070689_101786040 | |||
| 948 | Ga0070691_10224861 | |||
| 949 | Ga0070687_100007332 | |||
| 950 | Ga0070687_100109659 | |||
| 951 | Ga0070687_100659609 | |||
| 952 | Ga0070661_101630558 | |||
| 953 | Ga0070692_10109443 | |||
| 954 | Ga0070668_100158200 | |||
| 955 | Ga0070669_100870917 | |||
| 956 | Ga0070669_101808553 | |||
| 957 | Ga0070675_100032866 | |||
| 958 | Ga0070675_101788525 | |||
| 959 | Ga0070674_100066617 | |||
| 960 | Ga0070674_100132943 | |||
| 961 | Ga0070674_100540615 | |||
| 962 | Ga0070674_101451992 | |||
| 963 | Ga0070674_101490194 | |||
| 964 | Ga0070688_100112929 | |||
| 965 | Ga0070688_100312472 | |||
| 966 | Ga0070659_100030959 | |||
| 967 | Ga0070667_100151424 | |||
| 968 | Ga0070667_100487831 | |||
| 969 | Ga0070703_10057485 | |||
| 970 | Ga0070713_102001649 | |||
| 971 | Ga0070701_10027060 | |||
| 972 | Ga0070701_10735738 | |||
| 973 | Ga0070705_100148353 | |||
| 974 | Ga0070705_100297694 | |||
| 975 | Ga0070705_100333404 | |||
| 976 | Ga0070705_100722061 | |||
| 977 | Ga0070700_100025879 | |||
| 978 | Ga0070700_100042626 | |||
| 979 | Ga0070694_100141942 | |||
| 980 | Ga0070694_100148524 | |||
| 981 | Ga0070694_100179035 | |||
| 982 | Ga0070708_100148013 | |||
| 983 | Ga0070663_100103463 | |||
| 984 | Ga0070663_100213766 | |||
| 985 | Ga0070663_100330983 | |||
| 986 | Ga0070678_100014359 | |||
| 987 | Ga0070678_100112285 | |||
| 988 | Ga0070678_100984120 | |||
| 989 | Ga0070662_100058497 | |||
| 990 | Ga0070662_100081063 | |||
| 991 | Ga0070662_100504081 | |||
| 992 | Ga0070662_100990960 | |||
| 993 | Ga0070681_10883534 | |||
| 994 | Ga0070681_11026173 | |||
| 995 | Ga0068867_100058718 | |||
| 996 | Ga0068867_100604307 | |||
| 997 | Ga0070685_10043436 | |||
| 998 | Ga0070706_100171176 | |||
| 999 | Ga0070706_100364916 | |||
| 1000 | Ga0070706_100723445 | |||
| 1001 | Ga0070706_101748691 | |||
| 1002 | Ga0070707_100000290 | |||
| 1003 | Ga0070707_100050303 | |||
| 1004 | Ga0070707_100126906 | |||
| 1005 | Ga0070707_100247588 | |||
| 1006 | Ga0070707_100865760 | |||
| 1007 | Ga0070707_101246921 | |||
| 1008 | Ga0070698_100023786 | |||
| 1009 | Ga0070698_100113470 | |||
| 1010 | Ga0070698_100185440 | |||
| 1011 | Ga0070698_100207726 | |||
| 1012 | Ga0070699_100003264 | |||
| 1013 | Ga0070699_100004917 | |||
| 1014 | Ga0070699_100038716 | |||
| 1015 | Ga0070699_100260427 | |||
| 1016 | Ga0070699_100327481 | |||
| 1017 | Ga0070699_100336099 | |||
| 1018 | Ga0070699_100596691 | |||
| 1019 | Ga0070679_100155762 | |||
| 1020 | Ga0070684_100171217 | |||
| 1021 | Ga0070684_100910705 | |||
| 1022 | Ga0070684_101811715 | |||
| 1023 | Ga0070697_100096715 | |||
| 1024 | Ga0070697_100226245 | |||
| 1025 | Ga0070697_101022989 | |||
| 1026 | Ga0068853_100190340 | |||
| 1027 | Ga0068853_101945261 | |||
| 1028 | Ga0070672_100440459 | |||
| 1029 | Ga0070672_100451772 | |||
| 1030 | Ga0070672_100692917 | |||
| 1031 | Ga0070672_101301012 | |||
| 1032 | Ga0070672_101784294 | |||
| 1033 | Ga0070686_100107022 | |||
| 1034 | Ga0070686_100234421 | |||
| 1035 | Ga0070686_100566145 | |||
| 1036 | Ga0070686_101253098 | |||
| 1037 | Ga0070695_100202414 | |||
| 1038 | Ga0070695_100377780 | |||
| 1039 | Ga0070695_101287472 | |||
| 1040 | Ga0070696_100004989 | |||
| 1041 | Ga0070696_100008069 | |||
| 1042 | Ga0070696_100104512 | |||
| 1043 | Ga0070696_100576526 | |||
| 1044 | Ga0070696_101381285 | |||
| 1045 | Ga0070693_100029114 | |||
| 1046 | Ga0070693_100068903 | |||
| 1047 | Ga0070693_100772561 | |||
| 1048 | Ga0070665_101667713 | |||
| 1049 | Ga0070704_100011823 | |||
| 1050 | Ga0070704_100129592 | |||
| 1051 | Ga0070704_101015391 | |||
| 1052 | Ga0068855_100168076 | |||
| 1053 | Ga0070664_100151506 | |||
| 1054 | Ga0070664_102174500 | |||
| 1055 | Ga0068857_100213230 | |||
| 1056 | Ga0068857_102400241 | |||
| 1057 | Ga0068854_101381893 | |||
| 1058 | Ga0068856_100591065 | |||
| 1059 | Ga0070702_100006998 | |||
| 1060 | Ga0070702_100038515 | |||
| 1061 | Ga0068852_100451202 | |||
| 1062 | Ga0068852_100668787 | |||
| 1063 | Ga0068852_100797764 | |||
| 1064 | Ga0068859_100094096 | |||
| 1065 | Ga0068859_100094423 | |||
| 1066 | Ga0068859_100310675 | |||
| 1067 | Ga0068859_100837903 | |||
| 1068 | Ga0068859_102273174 | |||
| 1069 | Ga0068864_100004996 | |||
| 1070 | Ga0068864_100034906 | |||
| 1071 | Ga0068864_100107285 | |||
| 1072 | Ga0068864_100213727 | |||
| 1073 | Ga0068864_100850234 | |||
| 1074 | Ga0068864_102611675 | |||
| 1075 | Ga0068866_10019474 | |||
| 1076 | Ga0068861_100051588 | |||
| 1077 | Ga0068861_100090076 | |||
| 1078 | Ga0068861_100762428 | |||
| 1079 | Ga0068861_102627856 | |||
| 1080 | Ga0068851_10532820 | |||
| 1081 | Ga0068870_10041847 | |||
| 1082 | Ga0068870_10303364 | |||
| 1083 | Ga0068863_100216636 | |||
| 1084 | Ga0068863_100270172 | |||
| 1085 | Ga0068863_100593521 | |||
| 1086 | Ga0068863_100607659 | |||
| 1087 | Ga0068863_100798886 | |||
| 1088 | Ga0068858_100101759 | |||
| 1089 | Ga0068858_100202107 | |||
| 1090 | Ga0068858_100376301 | |||
| 1091 | Ga0068858_101320740 | |||
| 1092 | Ga0068858_102367207 | |||
| 1093 | Ga0068860_100059116 | |||
| 1094 | Ga0068860_100466882 | |||
| 1095 | Ga0068860_100516977 | |||
| 1096 | Ga0068860_101763442 | |||
| 1097 | Ga0068862_100093155 | |||
| 1098 | Ga0081455_10131408 | |||
| 1099 | Ga0081455_10264080 | |||
| 1100 | Ga0081539_10002120 | |||
| 1101 | Ga0081539_10011336 | |||
| 1102 | Ga0075365_10047055 | |||
| 1103 | Ga0075432_10220670 | |||
| 1104 | Ga0097621_101454724 | |||
| 1105 | Ga0097621_101836562 | |||
| 1106 | Ga0097621_102033747 | |||
| 1107 | Ga0097621_102194003 | |||
| 1108 | Ga0068871_100161835 | |||
| 1109 | Ga0075428_100112611 | |||
| 1110 | Ga0075428_100662795 | |||
| 1111 | Ga0075431_100066179 | |||
| 1112 | Ga0075431_100662289 | |||
| 1113 | Ga0075433_10170009 | |||
| 1114 | Ga0075433_10233822 | |||
| 1115 | Ga0075433_10287407 | |||
| 1116 | Ga0075433_10546251 | |||
| 1117 | Ga0075433_10720776 | |||
| 1118 | Ga0075434_100012357 | |||
| 1119 | Ga0075434_100261181 | |||
| 1120 | Ga0075434_100843894 | |||
| 1121 | Ga0075434_102063625 | |||
| 1122 | Ga0068865_100028312 | |||
| 1123 | Ga0068865_100664647 | |||
| 1124 | Ga0068865_100739487 | |||
| 1125 | Ga0075436_100238882 | |||
| 1126 | Ga0075436_100758998 | |||
| 1127 | Ga0097620_100094098 | |||
| 1128 | Ga0097620_100094420 | |||
| 1129 | Ga0097620_100310656 | |||
| 1130 | Ga0097620_100837849 | |||
| 1131 | Ga0097620_102272465 | |||
| 1132 | Ga0075435_100180516 | |||
| 1133 | Ga0075435_100537263 | |||
| 1134 | Ga0075435_101006407 | |||
| 1135 | Ga0075435_101231499 | |||
| 1136 | Ga0075435_101625471 | |||
| 1137 | Ga0075435_101855758 | |||
| 1138 | Ga0105251_10623624 | |||
| 1139 | Ga0111539_10016640 | |||
| 1140 | Ga0111539_10065131 | |||
| 1141 | Ga0111539_10284069 | |||
| 1142 | Ga0111539_10521086 | |||
| 1143 | Ga0111539_10904528 | |||
| 1144 | Ga0105245_10023336 | |||
| 1145 | Ga0105245_10035268 | |||
| 1146 | Ga0105245_10162988 | |||
| 1147 | Ga0105245_10387818 | |||
| 1148 | Ga0105245_10415424 | |||
| 1149 | Ga0105245_10439351 | |||
| 1150 | Ga0105247_10225906 | |||
| 1151 | Ga0105247_10483044 | |||
| 1152 | Ga0105247_10736800 | |||
| 1153 | Ga0105247_10739176 | |||
| 1154 | Ga0114129_10019533 | |||
| 1155 | Ga0114129_10024867 | |||
| 1156 | Ga0114129_10035818 | |||
| 1157 | Ga0114129_10061561 | |||
| 1158 | Ga0114129_10129699 | |||
| 1159 | Ga0114129_10771101 | |||
| 1160 | Ga0114129_10885808 | |||
| 1161 | Ga0105243_10015358 | |||
| 1162 | Ga0105243_10252071 | |||
| 1163 | Ga0105243_10419907 | |||
| 1164 | Ga0105243_10506050 | |||
| 1165 | Ga0105243_10762785 | |||
| 1166 | Ga0105243_10842978 | |||
| 1167 | Ga0105243_10877418 | |||
| 1168 | Ga0105243_11223962 | |||
| 1169 | Ga0105243_12336836 | |||
| 1170 | Ga0105241_10885955 | |||
| 1171 | Ga0105241_11573706 | |||
| 1172 | Ga0105242_10054799 | |||
| 1173 | Ga0105242_10164210 | |||
| 1174 | Ga0105242_10546810 | |||
| 1175 | Ga0105242_10752042 | |||
| 1176 | Ga0105242_10829920 | |||
| 1177 | Ga0105242_11188505 | |||
| 1178 | Ga0105242_11350038 | |||
| 1179 | Ga0105248_10310159 | |||
| 1180 | Ga0105248_10319689 | |||
| 1181 | Ga0105248_10954248 | |||
| 1182 | Ga0105248_10959458 | |||
| 1183 | Ga0105248_11078150 | |||
| 1184 | Ga0105238_10207815 | |||
| 1185 | Ga0105238_11015535 | |||
| 1186 | Ga0105249_10083825 | |||
| 1187 | Ga0105249_10207078 | |||
| 1188 | Ga0105249_11971011 | |||
| 1189 | Ga0099796_10055830 | |||
| 1190 | Ga0105239_10130732 | |||
| 1191 | Ga0105239_10317356 | |||
| 1192 | Ga0105246_10170767 | |||
| 1193 | Ga0105246_10209569 | |||
| 1194 | Ga0105246_10300157 | |||
| 1195 | Ga0105246_10447527 | |||
| 1196 | Ga0105246_10906838 | |||
| 1197 | Ga0105246_11460839 | |||
| 1198 | Ga0157322_1036831 | |||
| 1199 | Ga0157374_10488864 | |||
| 1200 | Ga0157374_11416213 | |||
| 1201 | Ga0157378_10019427 | |||
| 1202 | Ga0157378_10252216 | |||
| 1203 | Ga0157378_10760061 | |||
| 1204 | Ga0157378_10917872 | |||
| 1205 | Ga0163162_10072927 | |||
| 1206 | Ga0163162_10178988 | |||
| 1207 | Ga0163162_10464913 | |||
| 1208 | Ga0163162_10869728 | |||
| 1209 | Ga0163162_10906489 | |||
| 1210 | Ga0163162_11332534 | |||
| 1211 | Ga0157372_11470786 | |||
| 1212 | Ga0157372_11549917 | |||
| 1213 | Ga0157375_10038549 | |||
| 1214 | Ga0157375_10057569 | |||
| 1215 | Ga0157375_10060608 | |||
| 1216 | Ga0157375_10153995 | |||
| 1217 | Ga0157375_11420511 | |||
| 1218 | Ga0163163_10015603 | |||
| 1219 | Ga0163163_10068161 | |||
| 1220 | Ga0163163_10096558 | |||
| 1221 | Ga0163163_10126104 | |||
| 1222 | Ga0163163_10202400 | |||
| 1223 | Ga0163163_10211400 | |||
| 1224 | Ga0163163_10235951 | |||
| 1225 | Ga0163163_10278177 | |||
| 1226 | Ga0163163_10373953 | |||
| 1227 | Ga0163163_10950737 | |||
| 1228 | Ga0163163_11196216 | |||
| 1229 | Ga0163163_12716288 | |||
| 1230 | Ga0157380_10122506 | |||
| 1231 | Ga0157380_10308433 | |||
| 1232 | Ga0157380_10489663 | |||
| 1233 | Ga0157380_11341649 | |||
| 1234 | Ga0182008_10312101 | |||
| 1235 | Ga0182008_10524122 | |||
| 1236 | Ga0157377_10007586 | |||
| 1237 | Ga0157377_10061950 | |||
| 1238 | Ga0157377_10333474 | |||
| 1239 | Ga0157377_10348904 | |||
| 1240 | Ga0157379_10125840 | |||
| 1241 | Ga0157379_10514826 | |||
| 1242 | Ga0157379_11815678 | |||
| 1243 | Ga0157376_10193191 | |||
| 1244 | Ga0157376_10328228 | |||
| 1245 | Ga0157376_10511314 | |||
| 1246 | Ga0157376_10582944 | |||
| 1247 | Ga0157376_10767604 | |||
| 1248 | Ga0163161_10055076 | |||
| 1249 | Ga0206356_10938136 | |||
| 1250 | Ga0207653_10025473 | |||
| 1251 | Ga0207653_10056496 | |||
| 1252 | Ga0207642_10171829 | |||
| 1253 | Ga0207710_10355295 | |||
| 1254 | Ga0207710_10704018 | |||
| 1255 | Ga0207688_10014514 | |||
| 1256 | Ga0207688_10299259 | |||
| 1257 | Ga0207680_10223958 | |||
| 1258 | Ga0207645_10036877 | |||
| 1259 | Ga0207643_10033540 | |||
| 1260 | Ga0207643_10044623 | |||
| 1261 | Ga0207643_10843786 | |||
| 1262 | Ga0207684_10044888 | |||
| 1263 | Ga0207684_10311975 | |||
| 1264 | Ga0207684_10865351 | |||
| 1265 | Ga0207684_11006304 | |||
| 1266 | Ga0207654_10906769 | |||
| 1267 | Ga0207707_11002593 | |||
| 1268 | Ga0207707_11195507 | |||
| 1269 | Ga0207671_10912487 | |||
| 1270 | Ga0207660_10627747 | |||
| 1271 | Ga0207660_10643898 | |||
| 1272 | Ga0207662_10009714 | |||
| 1273 | Ga0207662_10018956 | |||
| 1274 | Ga0207662_10937698 | |||
| 1275 | Ga0207657_10062832 | |||
| 1276 | Ga0207657_10730918 | |||
| 1277 | Ga0207649_10316240 | |||
| 1278 | Ga0207652_11101306 | |||
| 1279 | Ga0207652_11386872 | |||
| 1280 | Ga0207646_10032308 | |||
| 1281 | Ga0207646_10170024 | |||
| 1282 | Ga0207646_10548873 | |||
| 1283 | Ga0207681_10634516 | |||
| 1284 | Ga0207681_10979750 | |||
| 1285 | Ga0207694_10843567 | |||
| 1286 | Ga0207650_10171547 | |||
| 1287 | Ga0207650_10582906 | |||
| 1288 | Ga0207650_10865016 | |||
| 1289 | Ga0207659_10124995 | |||
| 1290 | Ga0207659_10368442 | |||
| 1291 | Ga0207659_10816438 | |||
| 1292 | Ga0207687_10066658 | |||
| 1293 | Ga0207687_10088588 | |||
| 1294 | Ga0207687_10207748 | |||
| 1295 | Ga0207687_10364518 | |||
| 1296 | Ga0207687_10891493 | |||
| 1297 | Ga0207687_11214581 | |||
| 1298 | Ga0207644_11270249 | |||
| 1299 | Ga0207690_10127573 | |||
| 1300 | Ga0207690_10179514 | |||
| 1301 | Ga0207690_10562393 | |||
| 1302 | Ga0207706_10089337 | |||
| 1303 | Ga0207706_10141883 | |||
| 1304 | Ga0207706_10172787 | |||
| 1305 | Ga0207706_10197244 | |||
| 1306 | Ga0207706_11015748 | |||
| 1307 | Ga0207686_10154402 | |||
| 1308 | Ga0207686_10213058 | |||
| 1309 | Ga0207686_10260915 | |||
| 1310 | Ga0207686_11280999 | |||
| 1311 | Ga0207709_10171622 | |||
| 1312 | Ga0207709_10188695 | |||
| 1313 | Ga0207709_10270124 | |||
| 1314 | Ga0207709_10565281 | |||
| 1315 | Ga0207670_10739210 | |||
| 1316 | Ga0207670_10766510 | |||
| 1317 | Ga0207669_10078563 | |||
| 1318 | Ga0207669_10993217 | |||
| 1319 | Ga0207669_11370424 | |||
| 1320 | Ga0207704_10026812 | |||
| 1321 | Ga0207704_10547638 | |||
| 1322 | Ga0207691_10056139 | |||
| 1323 | Ga0207691_10170160 | |||
| 1324 | Ga0207691_10977785 | |||
| 1325 | Ga0207711_10093758 | |||
| 1326 | Ga0207711_10548995 | |||
| 1327 | Ga0207711_11056964 | |||
| 1328 | Ga0207689_10152690 | |||
| 1329 | Ga0207689_10337410 | |||
| 1330 | Ga0207689_10418396 | |||
| 1331 | Ga0207661_10188627 | |||
| 1332 | Ga0207661_10961868 | |||
| 1333 | Ga0207679_10283103 | |||
| 1334 | Ga0207679_10656039 | |||
| 1335 | Ga0207667_10134895 | |||
| 1336 | Ga0207651_10414205 | |||
| 1337 | Ga0207712_10069073 | |||
| 1338 | Ga0207712_10563461 | |||
| 1339 | Ga0207668_10142022 | |||
| 1340 | Ga0207640_11702824 | |||
| 1341 | Ga0207658_10077911 | |||
| 1342 | Ga0207658_10121208 | |||
| 1343 | Ga0207658_11806762 | |||
| 1344 | Ga0207677_10947915 | |||
| 1345 | Ga0207703_10086327 | |||
| 1346 | Ga0207639_10275528 | |||
| 1347 | Ga0207639_11161987 | |||
| 1348 | Ga0207639_11594463 | |||
| 1349 | Ga0207678_10047590 | |||
| 1350 | Ga0207678_10226717 | |||
| 1351 | Ga0207678_10377108 | |||
| 1352 | Ga0207708_10032182 | |||
| 1353 | Ga0207708_10069193 | |||
| 1354 | Ga0207708_10089332 | |||
| 1355 | Ga0207708_10134392 | |||
| 1356 | Ga0207708_10426865 | |||
| 1357 | Ga0207708_10470189 | |||
| 1358 | Ga0207708_10901095 | |||
| 1359 | Ga0207708_11664087 | |||
| 1360 | Ga0207702_11872164 | |||
| 1361 | Ga0207641_10094515 | |||
| 1362 | Ga0207641_10695311 | |||
| 1363 | Ga0207641_10993168 | |||
| 1364 | Ga0207641_10994922 | |||
| 1365 | Ga0207648_10003439 | |||
| 1366 | Ga0207648_10330515 | |||
| 1367 | Ga0207648_10468591 | |||
| 1368 | Ga0207648_10493336 | |||
| 1369 | Ga0207648_11381038 | |||
| 1370 | Ga0207676_10100042 | |||
| 1371 | Ga0207676_10219216 | |||
| 1372 | Ga0207676_10314967 | |||
| 1373 | Ga0207676_10622732 | |||
| 1374 | Ga0207676_11204432 | |||
| 1375 | Ga0207674_10008530 | |||
| 1376 | Ga0207674_11332408 | |||
| 1377 | Ga0207675_100028736 | |||
| 1378 | Ga0207675_100086911 | |||
| 1379 | Ga0207675_100219474 | |||
| 1380 | Ga0207675_100480534 | |||
| 1381 | Ga0207675_100483334 | |||
| 1382 | Ga0207675_101109805 | |||
| 1383 | Ga0207675_101194003 | |||
| 1384 | Ga0207675_101842238 | |||
| 1385 | Ga0207683_10022163 | |||
| 1386 | Ga0207683_10079796 | |||
| 1387 | Ga0207683_10249488 | |||
| 1388 | Ga0207698_10404634 | |||
| 1389 | Ga0207698_10560013 | |||
| 1390 | Ga0207698_11369169 | |||
| 1391 | Ga0209974_10007045 | |||
| 1392 | Ga0209974_10173392 | |||
| 1393 | Ga0207428_10148558 | |||
| 1394 | Ga0268266_10865214 | |||
| 1395 | Ga0268265_10144367 | |||
| 1396 | Ga0268265_10575597 | |||
| 1397 | Ga0268265_12099725 | |||
| 1398 | Ga0268264_10115256 | |||
| 1399 | Ga0268264_10301864 | |||
| 1400 | Ga0268264_10445795 | |||
| 1401 | Ga0265326_10058855 | |||
| 1402 | Ga0265319_1017347 | |||
| 1403 | Ga0265319_1082400 | |||
| 1404 | Ga0265334_10001943 | |||
| 1405 | Ga0265334_10004633 | |||
| 1406 | Ga0265318_10010345 | |||
| 1407 | Ga0265318_10014342 | |||
| 1408 | Ga0265318_10016388 | |||
| 1409 | Ga0265318_10070895 | |||
| 1410 | Ga0265322_10024040 | |||
| 1411 | Ga0265322_10142344 | |||
| 1412 | Ga0265336_10008491 | |||
| 1413 | Ga0265338_10034931 | |||
| 1414 | Ga0265338_10101284 | |||
| 1415 | Ga0265324_10008176 | |||
| 1416 | Ga0265324_10068147 | |||
| 1417 | Ga0265324_10101583 | |||
| 1418 | Ga0265330_10303642 | |||
| 1419 | Ga0265332_10006365 | |||
| 1420 | Ga0265328_10075045 | |||
| 1421 | Ga0265320_10001498 | |||
| 1422 | Ga0265320_10007410 | |||
| 1423 | Ga0265325_10008089 | |||
| 1424 | Ga0265325_10397012 | |||
| 1425 | Ga0265329_10003806 | |||
| 1426 | Ga0265329_10005635 | |||
| 1427 | Ga0265340_10001877 | |||
| 1428 | Ga0265340_10404503 | |||
| 1429 | Ga0265339_10009152 | |||
| 1430 | Ga0265339_10012944 | |||
| 1431 | Ga0265339_10058102 | |||
| 1432 | Ga0265339_10088770 | |||
| 1433 | Ga0265331_10016671 | |||
| 1434 | Ga0265331_10412040 | |||
| 1435 | Ga0265316_10110871 | |||
| 1436 | Ga0265316_10119118 | |||
| 1437 | Ga0265316_10898187 | |||
| 1438 | Ga0265313_10042081 | |||
| 1439 | Ga0265314_10001127 | |||
| 1440 | Ga0265314_10021038 | |||
| 1441 | Ga0265314_10276533 | |||
| 1442 | Ga0265342_10015149 | |||
| 1443 | Ga0316576_10160731 | |||
| 1444 | Ga0307405_10258566 | |||
| 1445 | Ga0307413_10553978 | |||
| 1446 | Ga0307413_11422991 | |||
| 1447 | Ga0307410_10130314 | |||
| 1448 | Ga0307410_10231424 | |||
| 1449 | Ga0307406_10261548 | |||
| 1450 | Ga0307407_10565025 | |||
| 1451 | Ga0307412_10191706 | |||
| 1452 | Ga0307412_10603499 | |||
| 1453 | Ga0307409_100131540 | |||
| 1454 | Ga0307409_100359397 | |||
| 1455 | Ga0307416_100405208 | |||
| 1456 | Ga0307416_100543089 | |||
| 1457 | Ga0307416_101251509 | |||
| 1458 | Ga0307416_101328505 | |||
| 1459 | Ga0307416_101448618 | |||
| 1460 | Ga0307415_100049288 | |||
| 1461 | Ga0307415_100136765 | |||
| 1462 | Ga0307415_100187912 | |||
| 1463 | Ga0307415_101979620 | |||
| 1464 | Ga0373938_0076967 | |||
| 1465 | Ga0373952_0162070 | |||
| 1466 | Ga0373932_0422924 | |||
| 1467 | Ga0373941_0026029 | |||
| 1468 | Ga0373941_0459806 | |||
| 1469 | Ga0373960_0284178 | |||
| 1470 | Ga0373943_0962522 | |||
| 1471 | Ga0373961_0178401 | |||
| 1472 | Ga0316574_0097936 | |||
| 1473 | Ga0373931_0078894 | |||
| 1474 | Ga0373937_0448142 | |||
| 1475 | Ga0373937_0590370 | |||
| 1476 | Ga0373937_0746085 | |||
| 1477 | Ga0395900_0679730 | |||
| 1478 | Ga0395905_0290479 | |||
| 1479 | Ga0395905_0953909 | |||
| 1480 | Ga0395905_1567147 | |||
| 1481 | Ga0395901_0973059 | |||
| 1482 | Ga0242420_065388 | |||
| 1483 | Ga0439439_0185965 | |||
| 1484 | Ga0439453_0042708 | |||
| 1485 | Ga0451800_0784458 | |||
| 1486 | Ga0451802_2022771 | |||
| 1487 | Ga0451839_0535126 | |||
| 1488 | Ga0451843_0977027 | |||
| 1489 | Ga0451853_1580022 | |||
| 1490 | Ga0451853_2430070 | |||
| 1491 | Ga0451853_2653829 | |||
| 1492 | Ga0451853_3475761 | |||
| 1493 | Ga0439431_0182800 | |||
| 1494 | Ga0439445_0149398 | |||
| 1495 | Ga0439452_059949 | |||
| 1496 | Ga0439456_133750 | |||
| 1497 | Ga0450920_093293 | |||
| 1498 | Ga0450920_093712 | |||
| 1499 | Ga0450920_130043 | |||
| 1500 | Ga0450906_058475 | |||
| 1501 | Ga0439446_0022435 | |||
| 1502 | Ga0439446_0068544 | |||
| 1503 | Ga0450909_053996 | |||
| 1504 | Ga0439434_0081229 | |||
| 1505 | Ga0439434_0216041 | |||
| 1506 | Ga0439435_0105595 | |||
| 1507 | Ga0439459_0140241 | |||
| 1508 | Ga0439460_0115721 | |||
| 1509 | Ga0451577_2002995 | |||
| 1510 | Ga0453683_0360827 | |||
| 1511 | Ga0466960_1042946 | |||
| 1512 | Ga0451576_0208745 | |||
| 1513 | Ga0451576_0703505 | |||
| 1514 | Ga0495603_0093249 | |||
| 1515 | Ga0495629_0105254 | |||
| 1516 | Ga0495629_0946338 | |||
| 1517 | Ga0495641_0126666 | |||
| 1518 | Ga0495641_0436007 | |||
| 1519 | Ga0495651_0248432 | |||
| 1520 | Ga0495582_0696652 | |||
| 1521 | Ga0495664_0631171 | |||
| 1522 | Ga0495584_0499085 | |||
| 1523 | Ga0495608_0461830 | |||
| 1524 | Ga0495618_0250690 | |||
| 1525 | Ga0495628_0561832 | |||
| 1526 | Ga0495631_0373482 | |||
| 1527 | Ga0495644_0194542 | |||
| 1528 | Ga0495644_0353498 | |||
| 1529 | Ga0495587_0370491 | |||
| 1530 | Ga0495656_0302452 | |||
| 1531 | Ga0495656_0308081 | |||
| 1532 | Ga0495656_0341489 | |||
| 1533 | Ga0495656_0606877 | |||
| 1534 | Ga0495668_0342198 | |||
| 1535 | Ga0495659_0143446 | |||
| 1536 | Ga0495647_0317400 | |||
| 1537 | Ga0495624_0265811 | |||
| 1538 | Ga0495624_0407720 | |||
| 1539 | Ga0495581_0695796 | |||
| 1540 | Ga0495604_0081845 | |||
| 1541 | Ga0495674_0152941 | |||
| 1542 | Ga0495672_0542443 | |||
| 1543 | Ga0495676_0682754 | |||
| 1544 | Ga0496100_0011594 | |||
| 1545 | Ga0496100_0709892 | |||
| 1546 | Ga0496100_0790157 | |||
| 1547 | Ga0496100_1085552 | |||
| 1548 | Ga0496101_0000872 | |||
| 1549 | Ga0496101_0363591 | |||
| 1550 | Ga0496101_0419367 | |||
| 1551 | Ga0496101_0427795 | |||
| 1552 | Ga0496102_0079132 | |||
| 1553 | Ga0496102_0294692 | |||
| 1554 | Ga0496102_0334738 | |||
| 1555 | Ga0496102_0390483 | |||
| 1556 | Ga0496102_0519986 | |||
| 1557 | Ga0496102_0772648 | |||
| 1558 | Ga0496102_1605578 | |||
| 1559 | Ga0496103_0286918 | |||
| 1560 | Ga0496103_0440201 | |||
| 1561 | Ga0496103_0632553 | |||
| 1562 | Ga0496103_0929009 | |||
| 1563 | Ga0496103_0946468 | |||
| 1564 | Ga0496104_0014647 | |||
| 1565 | Ga0496104_0015340 | |||
| 1566 | Ga0496105_0000581 | |||
| 1567 | Ga0496105_0154928 | |||
| 1568 | Ga0496105_0197698 | |||
| 1569 | Ga0496105_0845929 | |||
| 1570 | Ga0496105_0987240 | |||
| 1571 | Ga0496106_0046452 | |||
| 1572 | Ga0496106_0224204 | |||
| 1573 | Ga0496106_0415049 | |||
| 1574 | Ga0496107_0096589 | |||
| 1575 | Ga0496107_0178428 | |||
| 1576 | Ga0496107_0343189 | |||
| 1577 | Ga0496107_1032142 | |||
| 1578 | Ga0496108_0001990 | |||
| 1579 | Ga0496108_0010666 | |||
| 1580 | Ga0496108_0030442 | |||
| 1581 | Ga0496108_0095399 | |||
| 1582 | Ga0496108_0237950 | |||
| 1583 | Ga0496108_0508207 | |||
| 1584 | Ga0496108_1426591 | |||
| 1585 | Ga0496109_0007477 | |||
| 1586 | Ga0496109_0049499 | |||
| 1587 | Ga0496109_0059207 | |||
| 1588 | Ga0496109_0070365 | |||
| 1589 | Ga0496109_0242534 | |||
| 1590 | Ga0496109_0477587 | |||
| 1591 | Ga0496109_1082804 | |||
| 1592 | Ga0496109_1308119 | |||
| 1593 | Ga0496110_0007113 | |||
| 1594 | Ga0496110_0009071 | |||
| 1595 | Ga0496110_0081321 | |||
| 1596 | Ga0496110_0463856 | |||
| 1597 | Ga0496111_0000720 | |||
| 1598 | Ga0496111_0240530 | |||
| 1599 | Ga0496111_1080654 | |||
| 1600 | Ga0496112_0000012 | |||
| 1601 | Ga0496112_0038602 | |||
| 1602 | Ga0496112_0336035 | |||
| 1603 | Ga0496112_0414141 | |||
| 1604 | Ga0496112_0446070 | |||
| 1605 | Ga0496113_0028780 | |||
| 1606 | Ga0496113_0118455 | |||
| 1607 | Ga0496113_0310000 | |||
| 1608 | Ga0496113_0499992 | |||
| 1609 | Ga0496114_0003028 | |||
| 1610 | Ga0496114_0154624 | |||
| 1611 | Ga0496114_0314323 | |||
| 1612 | Ga0496114_1052915 | |||
| 1613 | Ga0501031_0031443 | |||
| 1614 | Ga0501031_0063979 | |||
| 1615 | Ga0501031_0119000 | |||
| 1616 | Ga0501031_0124284 | |||
| 1617 | Ga0501031_0559156 | |||
| 1618 | Ga0501032_0016466 | |||
| 1619 | Ga0501033_0227705 | |||
| 1620 | Ga0501033_0250712 | |||
| 1621 | Ga0501033_0512474 | |||
| 1622 | Ga0501033_0653815 | |||
| 1623 | Ga0501033_0712866 | |||
| 1624 | Ga0501033_1210930 | |||
| 1625 | Ga0501034_1613367 | |||
| 1626 | Ga0501036_0036858 | |||
| 1627 | Ga0501036_0078740 | |||
| 1628 | Ga0501036_0087432 | |||
| 1629 | Ga0501036_0116002 | |||
| 1630 | Ga0501036_0299380 | |||
| 1631 | Ga0501036_0354919 | |||
| 1632 | Ga0501036_0567165 | |||
| 1633 | Ga0501036_0692906 | |||
| 1634 | Ga0501037_0253001 | |||
| 1635 | Ga0501037_0587714 | |||
| 1636 | Ga0501038_0041215 | |||
| 1637 | Ga0501038_0085048 | |||
| 1638 | Ga0501038_0115236 | |||
| 1639 | Ga0501038_0467885 | |||
| 1640 | Ga0501038_0509168 | |||
| 1641 | Ga0501039_0031605 | |||
| 1642 | Ga0501039_0095223 | |||
| 1643 | Ga0501039_0152389 | |||
| 1644 | Ga0501039_0224022 | |||
| 1645 | Ga0501039_0252823 | |||
| 1646 | Ga0501039_0607759 | |||
| 1647 | Ga0501040_0011147 | |||
| 1648 | Ga0501040_0017541 | |||
| 1649 | Ga0501040_0027921 | |||
| 1650 | Ga0501040_0076212 | |||
| 1651 | Ga0501040_0111224 | |||
| 1652 | Ga0501040_0115325 | |||
| 1653 | Ga0501041_0038493 | |||
| 1654 | Ga0501041_0094020 | |||
| 1655 | Ga0501041_0130930 | |||
| 1656 | Ga0501041_0137218 | |||
| 1657 | Ga0501041_0340352 | |||
| 1658 | Ga0501042_0040671 | |||
| 1659 | Ga0501042_0059941 | |||
| 1660 | Ga0501042_0111362 | |||
| 1661 | Ga0501042_0390114 | |||
| 1662 | Ga0501042_0836785 | |||
| 1663 | Ga0501043_0023491 | |||
| 1664 | Ga0501043_0946528 | |||
| 1665 | Ga0501043_1005794 | |||
| 1666 | Ga0501043_1225344 | |||
| 1667 | Ga0501046_0060612 | |||
| 1668 | Ga0501046_0177205 | |||
| 1669 | Ga0501046_0254362 | |||
| 1670 | Ga0501046_0663518 | |||
| 1671 | Ga0501048_0018491 | |||
| 1672 | Ga0501048_0045084 | |||
| 1673 | Ga0501048_0109088 | |||
| 1674 | Ga0501048_0178839 | |||
| 1675 | Ga0501048_0273395 | |||
| 1676 | Ga0501048_0687160 | |||
| 1677 | Ga0501048_0979574 | |||
| 1678 | Ga0501067_0005924 | |||
| 1679 | Ga0501067_0037466 | |||
| 1680 | Ga0501067_0115880 | |||
| 1681 | Ga0501068_0040609 | |||
| 1682 | Ga0501068_0084716 | |||
| 1683 | Ga0501069_0089169 | |||
| 1684 | Ga0501069_0302571 | |||
| 1685 | Ga0501070_0131886 | |||
| 1686 | Ga0501070_0390552 | |||
| 1687 | Ga0501070_0445479 | |||
| 1688 | Ga0501070_0550379 | |||
| 1689 | Ga0501070_0927922 | |||
| 1690 | Ga0501071_0001369 | |||
| 1691 | Ga0501071_0041141 | |||
| 1692 | Ga0501071_0054587 | |||
| 1693 | Ga0501071_0056100 | |||
| 1694 | Ga0501071_0108713 | |||
| 1695 | Ga0501071_0171577 | |||
| 1696 | Ga0501071_0382881 | |||
| 1697 | Ga0501071_0435038 | |||
| 1698 | Ga0501071_0535138 | |||
| 1699 | Ga0501071_0565348 | |||
| 1700 | Ga0501072_0014411 | |||
| 1701 | Ga0501072_0051845 | |||
| 1702 | Ga0501072_0071663 | |||
| 1703 | Ga0501072_0129498 | |||
| 1704 | Ga0501072_0331857 | |||
| 1705 | Ga0501072_0395075 | |||
| 1706 | Ga0501072_0852025 | |||
| 1707 | Ga0501072_1414334 | |||
| 1708 | Ga0501073_0168114 | |||
| 1709 | Ga0501073_0236452 | |||
| 1710 | Ga0501073_1068531 | |||
| 1711 | Ga0501073_1146739 | |||
| 1712 | Ga0501074_0088615 | |||
| 1713 | Ga0501074_0104553 | |||
| 1714 | Ga0501074_0132195 | |||
| 1715 | Ga0501074_0178026 | |||
| 1716 | Ga0501074_0339889 | |||
| 1717 | Ga0501074_0409887 | |||
| 1718 | Ga0501075_0023128 | |||
| 1719 | Ga0501075_0035448 | |||
| 1720 | Ga0501075_0038094 | |||
| 1721 | Ga0501075_0049934 | |||
| 1722 | Ga0501075_0130379 | |||
| 1723 | Ga0501075_0174183 | |||
| 1724 | Ga0501075_0229469 | |||
| 1725 | Ga0501075_0283781 | |||
| 1726 | Ga0501075_1042886 | |||
| 1727 | Ga0501075_1069260 | |||
| 1728 | Ga0501075_1418908 | |||
| 1729 | Ga0501076_0006950 | |||
| 1730 | Ga0501076_0082619 | |||
| 1731 | Ga0501076_0088872 | |||
| 1732 | Ga0501076_0142568 | |||
| 1733 | Ga0501076_0228435 | |||
| 1734 | Ga0501076_0363807 | |||
| 1735 | Ga0501076_0400004 | |||
| 1736 | Ga0501076_0428552 | |||
| 1737 | Ga0501076_0773849 | |||
| 1738 | Ga0501076_0964125 | |||
| 1739 | Ga0501076_1624810 | |||
| 1740 | Ga0501077_0020076 | |||
| 1741 | Ga0501077_0064216 | |||
| 1742 | Ga0501077_0105771 | |||
| 1743 | Ga0501077_0113587 | |||
| 1744 | Ga0501077_0228051 | |||
| 1745 | Ga0501077_0251209 | |||
| 1746 | Ga0501077_0454737 | |||
| 1747 | Ga0501079_0004307 | |||
| 1748 | Ga0501079_0014517 | |||
| 1749 | Ga0501079_0036479 | |||
| 1750 | Ga0501079_0187088 | |||
| 1751 | Ga0501079_0234507 | |||
| 1752 | Ga0501079_0260452 | |||
| 1753 | Ga0501079_0650852 | |||
| 1754 | Ga0501079_0702175 | |||
| 1755 | Ga0501080_0031946 | |||
| 1756 | Ga0501080_0043089 | |||
| 1757 | Ga0501080_0134411 | |||
| 1758 | Ga0501080_0320325 | |||
| 1759 | Ga0501080_0352465 | |||
| 1760 | Ga0501080_1014516 | |||
| 1761 | Ga0501080_1546728 | |||
| 1762 | Ga0501081_0030851 | |||
| 1763 | Ga0501081_0043456 | |||
| 1764 | Ga0501081_0044693 | |||
| 1765 | Ga0501081_0052480 | |||
| 1766 | Ga0501081_0772841 | |||
| 1767 | Ga0501081_1298052 | |||
| 1768 | Ga0501083_0161735 | |||
| 1769 | Ga0501083_0226042 | |||
| 1770 | Ga0501083_0274239 | |||
| 1771 | Ga0501035_0141277 | |||
| 1772 | Ga0501035_0158292 | |||
| 1773 | Ga0501035_0211535 | |||
| 1774 | Ga0501045_0006628 | |||
| 1775 | Ga0501045_0170368 | |||
| 1776 | Ga0501045_0175018 | |||
| 1777 | Ga0501045_0284327 | |||
| 1778 | Ga0501045_0502336 | |||
| 1779 | Ga0501045_0559532 | |||
| 1780 | nmdc:mga0yw44_372291_c1 | |||
| 1781 | nmdc:mga05p37_1088114_c1 | |||
| 1782 | nmdc:mga05p37_13160_c1 | |||
| 1783 | nmdc:mga05p37_29045_c1 | |||
| 1784 | nmdc:mga05p37_309457_c1 | |||
| 1785 | nmdc:mga05p37_431007_c1 | |||
| 1786 | nmdc:mga05p37_687055_c1 | |||
| 1787 | nmdc:mga05p37_764891_c1 | |||
| 1788 | nmdc:mga05p37_89551_c1 | |||
| 1789 | nmdc:mga06r32_604729_c1 | |||
| 1790 | nmdc:mga06r32_99639_c1 | |||
| 1791 | nmdc:mga08y16_148953_c1 | |||
| 1792 | nmdc:mga08y16_31535_c1 | |||
| 1793 | nmdc:mga08y16_91638_c1 | |||
| 1794 | nmdc:mga0n895_1126745_c1 | |||
| 1795 | nmdc:mga0n895_14388_c1 | |||
| 1796 | nmdc:mga0n895_1750667_c1 | |||
| 1797 | nmdc:mga0n895_1875070_c1 | |||
| 1798 | nmdc:mga0n895_422661_c1 | |||
| 1799 | nmdc:mga0n895_784852_c1 | |||
| 1800 | nmdc:mga0rr50_1320002_c1 | |||
| 1801 | nmdc:mga0rr50_259671_c1 | |||
| 1802 | nmdc:mga0rr50_528011_c1 | |||
| 1803 | nmdc:mga0rr50_558199_c1 | |||
| 1804 | nmdc:mga08x19_279074_c1 | |||
| 1805 | nmdc:mga08x19_313180_c1 | |||
| 1806 | nmdc:mga08x19_767452_c1 | |||
| 1807 | nmdc:mga08x19_825310_c1 | |||
| 1808 | nmdc:mga0a205_160448_c1 | |||
| 1809 | nmdc:mga0a205_20976_c1 | |||
| 1810 | nmdc:mga0a205_216027_c1 | |||
| 1811 | nmdc:mga0a205_24744_c1 | |||
| 1812 | nmdc:mga0a205_402133_c1 | |||
| 1813 | nmdc:mga0a205_528432_c1 | |||
| 1814 | nmdc:mga0a205_668583_c1 | |||
| 1815 | Ga0495612_0000106 | |||
| 1816 | Ga0495595_0444154 | |||
| 1817 | Ga0495619_0150521 | |||
| 1818 | Ga0501084_0086236 | |||
| 1819 | Ga0501084_0143408 | |||
| 1820 | Ga0501084_0147979 | |||
| 1821 | Ga0501084_0172720 | |||
| 1822 | Ga0501084_0242704 | |||
| 1823 | Ga0501084_0728531 | |||
| 1824 | Ga0501084_1513425 | |||
| 1825 | Ga0590071_001827 | |||
| 1826 | Ga0590075_002708 | |||
| 1827 | Ga0590075_063403 | |||
| 1828 | Ga0590077_019669 | |||
| 1829 | Ga0590077_170748 | |||
| 1830 | Ga0501082_0021804 | |||
| 1831 | Ga0501082_0051125 | |||
| 1832 | Ga0501082_0051373 | |||
| 1833 | Ga0501082_0121670 | |||
| 1834 | Ga0501082_0220412 | |||
| 1835 | Ga0501082_0736116 | |||
| 1836 | Ga0501082_1114942 | |||
| 1837 | Ga0501082_1158402 | |||
| 1838 | Ga0501082_1212601 | |||
| 1839 | Ga0501082_1933932 | |||
| 1840 | Ga0530510_0001133 | |||
| 1841 | Ga0530510_0028432 | |||
| 1842 | Ga0530510_0168605 | |||
| 1843 | Ga0530510_0259688 | |||
| 1844 | Ga0530510_0479945 | |||
| 1845 | Ga0530510_0646765 | |||
| 1846 | Ga0530510_0679532 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2p9g-assembly1.cif.gz_A | crystal structure of serine bound g336v,g337v double mutant of e.coli phosphoglycerate dehydrogenase | 0.85 | 3 | 60 |
| 1sc6-assembly1.cif.gz_A | crystal structure of w139g d-3-phosphoglycerate dehydrogenase complexed with nad+ | 0.8479 | 1 | 59 |
| 1psd-assembly1.cif.gz_A | the allosteric ligand site in the vmax-type cooperative enzyme phosphoglycerate dehydrogenase | 0.8457 | 3 | 60 |
| 5v0s-assembly1.cif.gz_B | crystal structure of the act domain of prephenate dehydrogenase tyra from bacillus anthracis | 0.8419 | 4 | 66 |
| 3k5p-assembly1.cif.gz_A | crystal structure of amino acid-binding act: d-isomer specific 2-hydroxyacid dehydrogenase catalytic domain from brucella melitensis | 0.8415 | 1 | 60 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9FFF4_74_151_3.30.70.260 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.8419 | 1 | 67 | 3.30.70.260 |
| af_I1M2G3_44_149_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8402 | 2 | 48 | 3.40.50.2000 |
| af_I1M9H5_373_429_3.30.70.260 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.8363 | 69 | 117 | 3.30.70.260 |
| af_E9AG23_325_406_3.30.70.260 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.8302 | 2 | 67 | 3.30.70.260 |
| af_Q75IY1_131_216_3.30.70.260 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.83 | 4 | 59 | 3.30.70.260 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522MYR4-F1-model_v4 | ACT domain-containing protein | 0.994 | 1 | 127 |
|
| AF-A0A2V9GAR7-F1-model_v4 | ACT domain-containing protein | 0.9913 | 3 | 67 |
|
| AF-A0A1F8RWU0-F1-model_v4 | ACT domain-containing protein | 0.9865 | 1 | 129 |
|
| AF-A0A522MYR4-F1-model_v4 | ACT domain-containing protein | 0.9863 | 1 | 127 |
|
| AF-A0A1F8RWU0-F1-model_v4 | ACT domain-containing protein | 0.979 | 1 | 129 |
|