F485736
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 920 | 326 | 919 | 141 |
Family's Representative Sequence
| Representative Sequence | 3300045049|Ga0466959_0096623|Ga0466959_0096623_1274_1762 |
| Length | 162 |
| Sequence | MHDQRHGGAARWQAEYLGGLMIWAQRRISLSSRPRGFHLVTREVVDAMPELGCVRVGMLHLLIQHTSASLALNENASPDVRRDFETWANQAVPEDTPYWTHTTEGPDDMPAHIKSALFGPSLTLPVADGSLALGTWQGIYLCEHRDRGGDRQVMATLWGEEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2687453341 | Pirellula sp. SH-Sr6A | Isolate | Unclassified |
| 3 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 119 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 120 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 121 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 122 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 183 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 185 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 186 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 187 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 188 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 189 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 190 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 191 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 193 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 196 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 197 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 201 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 202 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 203 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 204 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 205 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 206 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 207 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 208 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 209 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 210 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 214 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 215 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 216 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 217 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 218 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 219 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 220 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 221 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 222 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 223 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 224 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 225 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 226 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 227 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 228 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 229 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 230 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 273 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 274 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 275 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 276 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 277 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 278 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 281 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 282 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 283 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 284 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 285 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 286 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 287 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 309 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 310 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 311 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 312 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 325 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.89 |
| Metatranscriptomes | 0 |
| Isolates | 0.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.17 |
| Nodule | 0 |
| Rhizoplane | 10.43 |
| Rhizosphere | 81.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3932664 | 2162886007 | Bacteria | 962 |
| 2 | LJQas_1011064 | 3300000549 | Bacteria | 1074 |
| 3 | JGI24743J22301_10057169 | 3300001991 | Bacteria | 800 |
| 4 | JGI24743J22301_10097128 | 3300001991 | Bacteria | 632 |
| 5 | JGI24735J21928_10131152 | 3300002067 | Bacteria | 722 |
| 6 | JGI24738J21930_10051752 | 3300002075 | Bacteria | 838 |
| 7 | JGI24738J21930_10089376 | 3300002075 | Bacteria | 650 |
| 8 | JGI25406J46586_10014524 | 3300003203 | Bacteria | 3345 |
| 9 | Ga0065704_10107272 | 3300005289 | Bacteria | 2060 |
| 10 | Ga0070658_10042605 | 3300005327 | Bacteria | 3667 |
| 11 | Ga0070658_10297396 | 3300005327 | Bacteria | 1376 |
| 12 | Ga0070658_10552800 | 3300005327 | Bacteria | 996 |
| 13 | Ga0070683_100001866 | 3300005329 | Bacteria | 16455 |
| 14 | Ga0070683_100026711 | 3300005329 | Bacteria | 5202 |
| 15 | Ga0070683_100047029 | 3300005329 | Bacteria | 3986 |
| 16 | Ga0070683_100101038 | 3300005329 | Bacteria | 2715 |
| 17 | Ga0070683_100205873 | 3300005329 | Bacteria | 1869 |
| 18 | Ga0070683_100241392 | 3300005329 | Bacteria | 1718 |
| 19 | Ga0070683_100324326 | 3300005329 | Bacteria | 1466 |
| 20 | Ga0070683_101382764 | 3300005329 | Bacteria | 677 |
| 21 | Ga0070670_100021832 | 3300005331 | Bacteria | 5506 |
| 22 | Ga0068869_100338910 | 3300005334 | Bacteria | 1223 |
| 23 | Ga0068869_100351431 | 3300005334 | Bacteria | 1202 |
| 24 | Ga0068869_100356138 | 3300005334 | Bacteria | 1194 |
| 25 | Ga0068869_100681778 | 3300005334 | Bacteria | 875 |
| 26 | Ga0068869_100899801 | 3300005334 | Bacteria | 766 |
| 27 | Ga0070680_100198605 | 3300005336 | Bacteria | 1691 |
| 28 | Ga0070680_100572141 | 3300005336 | Bacteria | 969 |
| 29 | Ga0070682_100000102 | 3300005337 | Bacteria | 76457 |
| 30 | Ga0070682_100028386 | 3300005337 | Bacteria | 3365 |
| 31 | Ga0070682_100032367 | 3300005337 | Bacteria | 3169 |
| 32 | Ga0070682_100055481 | 3300005337 | Bacteria | 2489 |
| 33 | Ga0070682_101389634 | 3300005337 | Bacteria | 600 |
| 34 | Ga0068868_100000978 | 3300005338 | Bacteria | 19469 |
| 35 | Ga0068868_100092207 | 3300005338 | Bacteria | 2441 |
| 36 | Ga0068868_100236685 | 3300005338 | Bacteria | 1533 |
| 37 | Ga0068868_100324923 | 3300005338 | Bacteria | 1311 |
| 38 | Ga0068868_100538467 | 3300005338 | Bacteria | 1028 |
| 39 | Ga0068868_100620307 | 3300005338 | Bacteria | 960 |
| 40 | Ga0070660_100002077 | 3300005339 | Bacteria | 13840 |
| 41 | Ga0070660_100009618 | 3300005339 | Bacteria | 6810 |
| 42 | Ga0070660_100511027 | 3300005339 | Bacteria | 1000 |
| 43 | Ga0070660_100607361 | 3300005339 | Bacteria | 915 |
| 44 | Ga0070691_10212994 | 3300005341 | Bacteria | 1020 |
| 45 | Ga0070661_100000032 | 3300005344 | Bacteria | 112964 |
| 46 | Ga0070661_100016519 | 3300005344 | Bacteria | 5220 |
| 47 | Ga0070661_100054871 | 3300005344 | Bacteria | 2918 |
| 48 | Ga0070661_101249890 | 3300005344 | Bacteria | 622 |
| 49 | Ga0070661_101291559 | 3300005344 | Bacteria | 612 |
| 50 | Ga0070692_10001942 | 3300005345 | Bacteria | 7821 |
| 51 | Ga0070692_10027075 | 3300005345 | Bacteria | 2839 |
| 52 | Ga0070692_10028829 | 3300005345 | Bacteria | 2762 |
| 53 | Ga0070692_11298873 | 3300005345 | Bacteria | 522 |
| 54 | Ga0070668_100112766 | 3300005347 | Bacteria | 2165 |
| 55 | Ga0070668_100149824 | 3300005347 | Bacteria | 1885 |
| 56 | Ga0070669_100314808 | 3300005353 | Bacteria | 1263 |
| 57 | Ga0070669_101064725 | 3300005353 | Bacteria | 695 |
| 58 | Ga0070675_100000015 | 3300005354 | Bacteria | 201080 |
| 59 | Ga0070675_100039559 | 3300005354 | Bacteria | 3849 |
| 60 | Ga0070675_100184136 | 3300005354 | Bacteria | 1807 |
| 61 | Ga0070675_101073403 | 3300005354 | Bacteria | 740 |
| 62 | Ga0070671_100038372 | 3300005355 | Bacteria | 3976 |
| 63 | Ga0070674_100021654 | 3300005356 | Bacteria | 4133 |
| 64 | Ga0070674_100422521 | 3300005356 | Bacteria | 1094 |
| 65 | Ga0070673_100035079 | 3300005364 | Bacteria | 3802 |
| 66 | Ga0070673_100171894 | 3300005364 | Bacteria | 1850 |
| 67 | Ga0070688_100000168 | 3300005365 | Bacteria | 35364 |
| 68 | Ga0070688_100148159 | 3300005365 | Bacteria | 1602 |
| 69 | Ga0070688_100149331 | 3300005365 | Bacteria | 1596 |
| 70 | Ga0070659_100000051 | 3300005366 | Bacteria | 97520 |
| 71 | Ga0070659_100009171 | 3300005366 | Bacteria | 7257 |
| 72 | Ga0070659_100119855 | 3300005366 | Bacteria | 2130 |
| 73 | Ga0070667_100263872 | 3300005367 | Bacteria | 1543 |
| 74 | Ga0070714_100056593 | 3300005435 | Bacteria | 3355 |
| 75 | Ga0070714_100098843 | 3300005435 | Bacteria | 2568 |
| 76 | Ga0070714_100235963 | 3300005435 | Bacteria | 1686 |
| 77 | Ga0070713_100000085 | 3300005436 | Bacteria | 58902 |
| 78 | Ga0070713_100031459 | 3300005436 | Bacteria | 4227 |
| 79 | Ga0070713_100122520 | 3300005436 | Bacteria | 2282 |
| 80 | Ga0070713_100137499 | 3300005436 | Bacteria | 2160 |
| 81 | Ga0070713_100446516 | 3300005436 | Bacteria | 1214 |
| 82 | Ga0070713_101228536 | 3300005436 | Bacteria | 725 |
| 83 | Ga0070710_10429106 | 3300005437 | Bacteria | 891 |
| 84 | Ga0070701_10103993 | 3300005438 | Bacteria | 1577 |
| 85 | Ga0070701_10120835 | 3300005438 | Bacteria | 1476 |
| 86 | Ga0070701_10126534 | 3300005438 | Bacteria | 1447 |
| 87 | Ga0070701_10161515 | 3300005438 | Bacteria | 1298 |
| 88 | Ga0070701_10264338 | 3300005438 | Bacteria | 1044 |
| 89 | Ga0070701_10423234 | 3300005438 | Bacteria | 849 |
| 90 | Ga0070711_101884115 | 3300005439 | Bacteria | 525 |
| 91 | Ga0070700_100001146 | 3300005441 | Bacteria | 13083 |
| 92 | Ga0070700_100030018 | 3300005441 | Bacteria | 3245 |
| 93 | Ga0070700_100063360 | 3300005441 | Bacteria | 2339 |
| 94 | Ga0070700_101932304 | 3300005441 | Bacteria | 511 |
| 95 | Ga0070694_100138373 | 3300005444 | Bacteria | 1766 |
| 96 | Ga0070694_100249074 | 3300005444 | Bacteria | 1343 |
| 97 | Ga0070694_100301892 | 3300005444 | Bacteria | 1227 |
| 98 | Ga0070663_100041109 | 3300005455 | Bacteria | 3240 |
| 99 | Ga0070663_100108647 | 3300005455 | Bacteria | 2081 |
| 100 | Ga0070663_100170054 | 3300005455 | Bacteria | 1684 |
| 101 | Ga0070678_100002153 | 3300005456 | Bacteria | 10685 |
| 102 | Ga0070678_100560205 | 3300005456 | Bacteria | 1016 |
| 103 | Ga0070662_100008536 | 3300005457 | Bacteria | 6680 |
| 104 | Ga0070662_100197330 | 3300005457 | Bacteria | 1595 |
| 105 | Ga0070681_10014223 | 3300005458 | Bacteria | 7920 |
| 106 | Ga0070681_10748227 | 3300005458 | Bacteria | 894 |
| 107 | Ga0068867_100050141 | 3300005459 | Bacteria | 3075 |
| 108 | Ga0068867_100110699 | 3300005459 | Bacteria | 2110 |
| 109 | Ga0068867_100182406 | 3300005459 | Bacteria | 1670 |
| 110 | Ga0070685_10000246 | 3300005466 | Bacteria | 35364 |
| 111 | Ga0070685_10043544 | 3300005466 | Bacteria | 2567 |
| 112 | Ga0070685_10085868 | 3300005466 | Bacteria | 1896 |
| 113 | Ga0070685_10143495 | 3300005466 | Bacteria | 1506 |
| 114 | Ga0070707_100308761 | 3300005468 | Bacteria | 1537 |
| 115 | Ga0070699_100128058 | 3300005518 | Bacteria | 2237 |
| 116 | Ga0070679_100000537 | 3300005530 | Bacteria | 32232 |
| 117 | Ga0070679_100132456 | 3300005530 | Bacteria | 2474 |
| 118 | Ga0070684_100010940 | 3300005535 | Bacteria | 7212 |
| 119 | Ga0070684_100015111 | 3300005535 | Bacteria | 6276 |
| 120 | Ga0070684_100068532 | 3300005535 | Bacteria | 3119 |
| 121 | Ga0070684_100148946 | 3300005535 | Bacteria | 2119 |
| 122 | Ga0070684_100222054 | 3300005535 | Bacteria | 1724 |
| 123 | Ga0070684_101588502 | 3300005535 | Bacteria | 617 |
| 124 | Ga0068853_100769096 | 3300005539 | Bacteria | 921 |
| 125 | Ga0070672_100000007 | 3300005543 | Bacteria | 104699 |
| 126 | Ga0070672_100025741 | 3300005543 | Bacteria | 4369 |
| 127 | Ga0070672_100316098 | 3300005543 | Bacteria | 1327 |
| 128 | Ga0070686_100091723 | 3300005544 | Bacteria | 2033 |
| 129 | Ga0070686_100198158 | 3300005544 | Bacteria | 1438 |
| 130 | Ga0070686_100491311 | 3300005544 | Bacteria | 951 |
| 131 | Ga0070696_100203014 | 3300005546 | Bacteria | 1481 |
| 132 | Ga0070696_100596907 | 3300005546 | Bacteria | 890 |
| 133 | Ga0070696_101073228 | 3300005546 | Bacteria | 676 |
| 134 | Ga0070693_100067701 | 3300005547 | Bacteria | 2094 |
| 135 | Ga0070693_100250045 | 3300005547 | Bacteria | 1175 |
| 136 | Ga0070693_100446279 | 3300005547 | Bacteria | 907 |
| 137 | Ga0070665_100240530 | 3300005548 | Bacteria | 1811 |
| 138 | Ga0070665_100410840 | 3300005548 | Bacteria | 1362 |
| 139 | Ga0070704_100174082 | 3300005549 | Bacteria | 1715 |
| 140 | Ga0070704_100433691 | 3300005549 | Bacteria | 1128 |
| 141 | Ga0070704_100785468 | 3300005549 | Bacteria | 850 |
| 142 | Ga0068855_100085845 | 3300005563 | Bacteria | 3641 |
| 143 | Ga0068855_100499475 | 3300005563 | Bacteria | 1322 |
| 144 | Ga0070664_100011227 | 3300005564 | Bacteria | 7266 |
| 145 | Ga0070664_100089256 | 3300005564 | Bacteria | 2667 |
| 146 | Ga0068857_100221353 | 3300005577 | Bacteria | 1729 |
| 147 | Ga0068854_100000090 | 3300005578 | Bacteria | 64443 |
| 148 | Ga0068854_100016779 | 3300005578 | Bacteria | 4888 |
| 149 | Ga0068854_100129861 | 3300005578 | Bacteria | 1923 |
| 150 | Ga0068854_100137525 | 3300005578 | Bacteria | 1871 |
| 151 | Ga0068854_100208098 | 3300005578 | Bacteria | 1542 |
| 152 | Ga0068854_100339119 | 3300005578 | Bacteria | 1227 |
| 153 | Ga0068856_100103144 | 3300005614 | Bacteria | 2846 |
| 154 | Ga0068856_100249054 | 3300005614 | Bacteria | 1792 |
| 155 | Ga0068856_100340510 | 3300005614 | Bacteria | 1518 |
| 156 | Ga0070702_100006043 | 3300005615 | Bacteria | 5700 |
| 157 | Ga0070702_100008205 | 3300005615 | Bacteria | 5045 |
| 158 | Ga0070702_100074794 | 3300005615 | Bacteria | 2011 |
| 159 | Ga0070702_100614531 | 3300005615 | Bacteria | 817 |
| 160 | Ga0070702_100851200 | 3300005615 | Bacteria | 710 |
| 161 | Ga0068852_100057753 | 3300005616 | Bacteria | 3359 |
| 162 | Ga0068852_101209325 | 3300005616 | Bacteria | 777 |
| 163 | Ga0068859_100039669 | 3300005617 | Bacteria | 4725 |
| 164 | Ga0068859_100421512 | 3300005617 | Bacteria | 1431 |
| 165 | Ga0068864_100043380 | 3300005618 | Bacteria | 3851 |
| 166 | Ga0068864_100063321 | 3300005618 | Bacteria | 3205 |
| 167 | Ga0068864_100181624 | 3300005618 | Bacteria | 1924 |
| 168 | Ga0068864_100673657 | 3300005618 | Bacteria | 1009 |
| 169 | Ga0068864_101016690 | 3300005618 | Bacteria | 823 |
| 170 | Ga0068866_10124895 | 3300005718 | Bacteria | 1455 |
| 171 | Ga0068866_10398397 | 3300005718 | Bacteria | 887 |
| 172 | Ga0068866_10684796 | 3300005718 | Bacteria | 702 |
| 173 | Ga0068861_100082055 | 3300005719 | Bacteria | 2526 |
| 174 | Ga0068861_100252453 | 3300005719 | Bacteria | 1506 |
| 175 | Ga0068861_100344640 | 3300005719 | Bacteria | 1305 |
| 176 | Ga0068861_100724284 | 3300005719 | Bacteria | 927 |
| 177 | Ga0068861_100836486 | 3300005719 | Bacteria | 867 |
| 178 | Ga0068861_100952141 | 3300005719 | Bacteria | 817 |
| 179 | Ga0068851_10000233 | 3300005834 | Bacteria | 26436 |
| 180 | Ga0068851_10498430 | 3300005834 | Bacteria | 730 |
| 181 | Ga0068870_10019487 | 3300005840 | Bacteria | 3290 |
| 182 | Ga0068870_10035752 | 3300005840 | Bacteria | 2551 |
| 183 | Ga0068870_10538826 | 3300005840 | Bacteria | 784 |
| 184 | Ga0068863_100009331 | 3300005841 | Bacteria | 9573 |
| 185 | Ga0068858_100169993 | 3300005842 | Bacteria | 2055 |
| 186 | Ga0068858_100211195 | 3300005842 | Bacteria | 1837 |
| 187 | Ga0068860_100292313 | 3300005843 | Bacteria | 1595 |
| 188 | Ga0068862_100101142 | 3300005844 | Bacteria | 2521 |
| 189 | Ga0068862_100327409 | 3300005844 | Bacteria | 1416 |
| 190 | Ga0081455_10551628 | 3300005937 | Bacteria | 762 |
| 191 | Ga0081538_10131903 | 3300005981 | Bacteria | 1172 |
| 192 | Ga0081540_1126892 | 3300005983 | Bacteria | 1048 |
| 193 | Ga0081539_10003976 | 3300005985 | Bacteria | 17075 |
| 194 | Ga0070717_10014762 | 3300006028 | Bacteria | 6009 |
| 195 | Ga0070717_10024989 | 3300006028 | Bacteria | 4745 |
| 196 | Ga0070717_10047485 | 3300006028 | Bacteria | 3518 |
| 197 | Ga0070717_10053959 | 3300006028 | Bacteria | 3313 |
| 198 | Ga0070717_10371434 | 3300006028 | Bacteria | 1281 |
| 199 | Ga0070717_10506019 | 3300006028 | Bacteria | 1092 |
| 200 | Ga0070717_10783712 | 3300006028 | Bacteria | 867 |
| 201 | Ga0070717_10815858 | 3300006028 | Bacteria | 849 |
| 202 | Ga0075365_10044157 | 3300006038 | Bacteria | 2919 |
| 203 | Ga0075365_10046863 | 3300006038 | Bacteria | 2840 |
| 204 | Ga0075365_10664162 | 3300006038 | Bacteria | 737 |
| 205 | Ga0075363_100020772 | 3300006048 | Bacteria | 3297 |
| 206 | Ga0075364_10016188 | 3300006051 | Bacteria | 4637 |
| 207 | Ga0075364_10118494 | 3300006051 | Bacteria | 1771 |
| 208 | Ga0075364_10175443 | 3300006051 | Bacteria | 1449 |
| 209 | Ga0075364_10200801 | 3300006051 | Bacteria | 1351 |
| 210 | Ga0075364_10445662 | 3300006051 | Bacteria | 884 |
| 211 | Ga0070715_10298335 | 3300006163 | Bacteria | 861 |
| 212 | Ga0070716_100069070 | 3300006173 | Bacteria | 2069 |
| 213 | Ga0070712_100005528 | 3300006175 | Bacteria | 7823 |
| 214 | Ga0070712_100061563 | 3300006175 | Bacteria | 2652 |
| 215 | Ga0070712_100883404 | 3300006175 | Bacteria | 770 |
| 216 | Ga0070712_101429329 | 3300006175 | Bacteria | 604 |
| 217 | Ga0070712_101649628 | 3300006175 | Bacteria | 561 |
| 218 | Ga0075367_10061809 | 3300006178 | Bacteria | 2235 |
| 219 | Ga0075367_10269922 | 3300006178 | Bacteria | 1069 |
| 220 | Ga0075428_100044308 | 3300006844 | Bacteria | 4889 |
| 221 | Ga0075428_100483260 | 3300006844 | Bacteria | 1326 |
| 222 | Ga0075428_101367392 | 3300006844 | Bacteria | 744 |
| 223 | Ga0075428_101490690 | 3300006844 | Bacteria | 709 |
| 224 | Ga0075431_100589448 | 3300006847 | Bacteria | 1096 |
| 225 | Ga0075433_10051223 | 3300006852 | Bacteria | 3595 |
| 226 | Ga0075433_10556818 | 3300006852 | Bacteria | 1008 |
| 227 | Ga0075434_100190087 | 3300006871 | Bacteria | 2073 |
| 228 | Ga0075434_100432270 | 3300006871 | Bacteria | 1338 |
| 229 | Ga0075434_101051440 | 3300006871 | Bacteria | 828 |
| 230 | Ga0075434_102325798 | 3300006871 | Bacteria | 539 |
| 231 | Ga0075429_100069997 | 3300006880 | Bacteria | 3054 |
| 232 | Ga0075429_100585398 | 3300006880 | Bacteria | 978 |
| 233 | Ga0068865_100000023 | 3300006881 | Bacteria | 100785 |
| 234 | Ga0068865_100008559 | 3300006881 | Bacteria | 6325 |
| 235 | Ga0068865_100036684 | 3300006881 | Bacteria | 3306 |
| 236 | Ga0068865_101500352 | 3300006881 | Bacteria | 604 |
| 237 | Ga0075436_100007266 | 3300006914 | Bacteria | 7576 |
| 238 | Ga0097620_100039672 | 3300006931 | Bacteria | 4725 |
| 239 | Ga0097620_100421453 | 3300006931 | Bacteria | 1431 |
| 240 | Ga0075435_100042083 | 3300007076 | Bacteria | 3653 |
| 241 | Ga0105251_10328108 | 3300009011 | Bacteria | 696 |
| 242 | Ga0105240_10750025 | 3300009093 | Bacteria | 1061 |
| 243 | Ga0111539_10050474 | 3300009094 | Bacteria | 4956 |
| 244 | Ga0111539_10081111 | 3300009094 | Bacteria | 3816 |
| 245 | Ga0111539_10099745 | 3300009094 | Bacteria | 3410 |
| 246 | Ga0111539_10205519 | 3300009094 | Bacteria | 2296 |
| 247 | Ga0111539_10220435 | 3300009094 | Bacteria | 2209 |
| 248 | Ga0111539_10223314 | 3300009094 | Bacteria | 2194 |
| 249 | Ga0111539_10228597 | 3300009094 | Bacteria | 2166 |
| 250 | Ga0111539_11609505 | 3300009094 | Bacteria | 753 |
| 251 | Ga0105245_10000254 | 3300009098 | Bacteria | 50918 |
| 252 | Ga0105245_10001037 | 3300009098 | Bacteria | 25245 |
| 253 | Ga0105245_10014323 | 3300009098 | Bacteria | 6909 |
| 254 | Ga0105245_10019669 | 3300009098 | Bacteria | 5917 |
| 255 | Ga0105245_10155160 | 3300009098 | Bacteria | 2168 |
| 256 | Ga0105245_10540187 | 3300009098 | Bacteria | 1187 |
| 257 | Ga0105247_10126407 | 3300009101 | Bacteria | 1662 |
| 258 | Ga0114129_10017653 | 3300009147 | Bacteria | 10157 |
| 259 | Ga0114129_10085083 | 3300009147 | Bacteria | 4388 |
| 260 | Ga0114129_10093825 | 3300009147 | Bacteria | 4157 |
| 261 | Ga0114129_10240888 | 3300009147 | Bacteria | 2431 |
| 262 | Ga0114129_10244692 | 3300009147 | Bacteria | 2410 |
| 263 | Ga0114129_10751474 | 3300009147 | Bacteria | 1248 |
| 264 | Ga0114129_10909179 | 3300009147 | Bacteria | 1115 |
| 265 | Ga0114129_12514213 | 3300009147 | Bacteria | 615 |
| 266 | Ga0114129_13338273 | 3300009147 | Bacteria | 518 |
| 267 | Ga0105243_10006380 | 3300009148 | Bacteria | 9109 |
| 268 | Ga0105243_10027113 | 3300009148 | Bacteria | 4388 |
| 269 | Ga0105243_10027186 | 3300009148 | Bacteria | 4381 |
| 270 | Ga0105243_10280762 | 3300009148 | Bacteria | 1500 |
| 271 | Ga0105243_10414586 | 3300009148 | Bacteria | 1254 |
| 272 | Ga0105243_12182703 | 3300009148 | Bacteria | 590 |
| 273 | Ga0105241_11083928 | 3300009174 | Bacteria | 753 |
| 274 | Ga0105242_10000756 | 3300009176 | Bacteria | 25161 |
| 275 | Ga0105242_10048984 | 3300009176 | Bacteria | 3436 |
| 276 | Ga0105242_10412249 | 3300009176 | Bacteria | 1264 |
| 277 | Ga0105242_10853871 | 3300009176 | Bacteria | 906 |
| 278 | Ga0105242_12552559 | 3300009176 | Bacteria | 560 |
| 279 | Ga0105242_13137574 | 3300009176 | Bacteria | 513 |
| 280 | Ga0105248_12456526 | 3300009177 | Bacteria | 594 |
| 281 | Ga0105237_11692488 | 3300009545 | Bacteria | 640 |
| 282 | Ga0105238_10114853 | 3300009551 | Bacteria | 2671 |
| 283 | Ga0105238_10268058 | 3300009551 | Bacteria | 1688 |
| 284 | Ga0105238_12381915 | 3300009551 | Bacteria | 565 |
| 285 | Ga0105249_10045832 | 3300009553 | Bacteria | 3978 |
| 286 | Ga0105249_10063268 | 3300009553 | Bacteria | 3399 |
| 287 | Ga0105239_10007908 | 3300010375 | Bacteria | 12155 |
| 288 | Ga0105239_10053648 | 3300010375 | Bacteria | 4421 |
| 289 | Ga0105246_10034379 | 3300011119 | Bacteria | 3377 |
| 290 | Ga0105246_10042491 | 3300011119 | Bacteria | 3079 |
| 291 | Ga0105246_10094870 | 3300011119 | Bacteria | 2159 |
| 292 | Ga0105246_10663679 | 3300011119 | Bacteria | 909 |
| 293 | Ga0157369_10000020 | 3300013105 | Bacteria | 241679 |
| 294 | Ga0157369_10242289 | 3300013105 | Bacteria | 1883 |
| 295 | Ga0157374_10056528 | 3300013296 | Bacteria | 3663 |
| 296 | Ga0157374_10335622 | 3300013296 | Bacteria | 1500 |
| 297 | Ga0157374_10351592 | 3300013296 | Bacteria | 1464 |
| 298 | Ga0157378_10000770 | 3300013297 | Bacteria | 29730 |
| 299 | Ga0163162_10224868 | 3300013306 | Bacteria | 2006 |
| 300 | Ga0163162_11739675 | 3300013306 | Bacteria | 712 |
| 301 | Ga0163162_13492383 | 3300013306 | Bacteria | 500 |
| 302 | Ga0157372_10000112 | 3300013307 | Bacteria | 85902 |
| 303 | Ga0157372_10353584 | 3300013307 | Bacteria | 1712 |
| 304 | Ga0157375_10044794 | 3300013308 | Bacteria | 4302 |
| 305 | Ga0157375_10218274 | 3300013308 | Bacteria | 2065 |
| 306 | Ga0157375_10396597 | 3300013308 | Bacteria | 1547 |
| 307 | Ga0157375_11822847 | 3300013308 | Bacteria | 721 |
| 308 | Ga0163163_10113311 | 3300014325 | Bacteria | 2742 |
| 309 | Ga0163163_10300942 | 3300014325 | Bacteria | 1656 |
| 310 | Ga0157380_10166829 | 3300014326 | Bacteria | 1920 |
| 311 | Ga0157380_10530144 | 3300014326 | Bacteria | 1151 |
| 312 | Ga0157380_11636956 | 3300014326 | Bacteria | 700 |
| 313 | Ga0157380_11853547 | 3300014326 | Bacteria | 663 |
| 314 | Ga0157377_10000243 | 3300014745 | Bacteria | 27516 |
| 315 | Ga0157377_10011798 | 3300014745 | Bacteria | 4372 |
| 316 | Ga0157379_10005485 | 3300014968 | Bacteria | 10887 |
| 317 | Ga0157379_10479740 | 3300014968 | Bacteria | 1151 |
| 318 | Ga0157379_10592601 | 3300014968 | Bacteria | 1034 |
| 319 | Ga0157376_11168804 | 3300014969 | Bacteria | 797 |
| 320 | Ga0163161_10251371 | 3300017792 | Bacteria | 1378 |
| 321 | Ga0163161_10515644 | 3300017792 | Bacteria | 976 |
| 322 | Ga0213873_10021329 | 3300021358 | Bacteria | 1523 |
| 323 | Ga0213873_10027021 | 3300021358 | Bacteria | 1397 |
| 324 | Ga0213873_10273733 | 3300021358 | Bacteria | 540 |
| 325 | Ga0213874_10000005 | 3300021377 | Bacteria | 27808 |
| 326 | Ga0213874_10003788 | 3300021377 | Bacteria | 3395 |
| 327 | Ga0213874_10009280 | 3300021377 | Bacteria | 2427 |
| 328 | Ga0213874_10034927 | 3300021377 | Bacteria | 1474 |
| 329 | Ga0213876_10005606 | 3300021384 | Bacteria | 6891 |
| 330 | Ga0213876_10018016 | 3300021384 | Bacteria | 3726 |
| 331 | Ga0213876_10078539 | 3300021384 | Bacteria | 1744 |
| 332 | Ga0213876_10116779 | 3300021384 | Bacteria | 1416 |
| 333 | Ga0213875_10000156 | 3300021388 | Bacteria | 72058 |
| 334 | Ga0213875_10006473 | 3300021388 | Bacteria | 6141 |
| 335 | Ga0213875_10009519 | 3300021388 | Bacteria | 4920 |
| 336 | Ga0213875_10017115 | 3300021388 | Bacteria | 3507 |
| 337 | Ga0213875_10163890 | 3300021388 | Bacteria | 1043 |
| 338 | Ga0213875_10181444 | 3300021388 | Bacteria | 989 |
| 339 | Ga0213875_10188806 | 3300021388 | Bacteria | 968 |
| 340 | Ga0213875_10214336 | 3300021388 | Bacteria | 907 |
| 341 | Ga0213875_10289573 | 3300021388 | Bacteria | 774 |
| 342 | Ga0207656_10000180 | 3300025321 | Bacteria | 22842 |
| 343 | Ga0207656_10009888 | 3300025321 | Bacteria | 3553 |
| 344 | Ga0207656_10129913 | 3300025321 | Bacteria | 1179 |
| 345 | Ga0207692_10332375 | 3300025898 | Bacteria | 933 |
| 346 | Ga0207642_10088053 | 3300025899 | Bacteria | 1526 |
| 347 | Ga0207642_10262985 | 3300025899 | Bacteria | 984 |
| 348 | Ga0207642_10310195 | 3300025899 | Bacteria | 918 |
| 349 | Ga0207710_10024439 | 3300025900 | Bacteria | 2602 |
| 350 | Ga0207688_10001744 | 3300025901 | Bacteria | 11542 |
| 351 | Ga0207688_10097685 | 3300025901 | Bacteria | 1692 |
| 352 | Ga0207680_10004019 | 3300025903 | Bacteria | 6949 |
| 353 | Ga0207699_10679641 | 3300025906 | Bacteria | 753 |
| 354 | Ga0207643_10045359 | 3300025908 | Bacteria | 2483 |
| 355 | Ga0207643_10155169 | 3300025908 | Bacteria | 1375 |
| 356 | Ga0207643_10469698 | 3300025908 | Bacteria | 802 |
| 357 | Ga0207705_10015308 | 3300025909 | Bacteria | 5505 |
| 358 | Ga0207705_10095930 | 3300025909 | Bacteria | 2177 |
| 359 | Ga0207705_10229382 | 3300025909 | Bacteria | 1412 |
| 360 | Ga0207654_10857775 | 3300025911 | Bacteria | 657 |
| 361 | Ga0207707_10030725 | 3300025912 | Bacteria | 4699 |
| 362 | Ga0207707_10906610 | 3300025912 | Bacteria | 728 |
| 363 | Ga0207693_10002345 | 3300025915 | Bacteria | 16445 |
| 364 | Ga0207693_10008714 | 3300025915 | Bacteria | 8292 |
| 365 | Ga0207693_10049782 | 3300025915 | Bacteria | 3290 |
| 366 | Ga0207693_10855562 | 3300025915 | Bacteria | 699 |
| 367 | Ga0207663_10015163 | 3300025916 | Bacteria | 4244 |
| 368 | Ga0207660_10435925 | 3300025917 | Bacteria | 1058 |
| 369 | Ga0207660_10585568 | 3300025917 | Bacteria | 908 |
| 370 | Ga0207662_10037290 | 3300025918 | Bacteria | 2844 |
| 371 | Ga0207657_10006150 | 3300025919 | Bacteria | 12477 |
| 372 | Ga0207657_10013240 | 3300025919 | Bacteria | 8094 |
| 373 | Ga0207657_10411720 | 3300025919 | Bacteria | 1063 |
| 374 | Ga0207657_11166309 | 3300025919 | Bacteria | 587 |
| 375 | Ga0207649_10000166 | 3300025920 | Bacteria | 53758 |
| 376 | Ga0207649_10036301 | 3300025920 | Bacteria | 2968 |
| 377 | Ga0207652_10039125 | 3300025921 | Bacteria | 4024 |
| 378 | Ga0207652_10385053 | 3300025921 | Bacteria | 1266 |
| 379 | Ga0207652_11180695 | 3300025921 | Bacteria | 667 |
| 380 | Ga0207652_11298054 | 3300025921 | Bacteria | 630 |
| 381 | Ga0207646_10000162 | 3300025922 | Bacteria | 90943 |
| 382 | Ga0207646_10397311 | 3300025922 | Bacteria | 1245 |
| 383 | Ga0207681_10063338 | 3300025923 | Bacteria | 2550 |
| 384 | Ga0207681_10165208 | 3300025923 | Bacteria | 1673 |
| 385 | Ga0207694_10072598 | 3300025924 | Bacteria | 2691 |
| 386 | Ga0207694_10314980 | 3300025924 | Bacteria | 1290 |
| 387 | Ga0207659_10000032 | 3300025926 | Bacteria | 119492 |
| 388 | Ga0207659_10135601 | 3300025926 | Bacteria | 1905 |
| 389 | Ga0207659_10549605 | 3300025926 | Bacteria | 981 |
| 390 | Ga0207687_10000007 | 3300025927 | Bacteria | 604185 |
| 391 | Ga0207687_10008027 | 3300025927 | Bacteria | 6909 |
| 392 | Ga0207687_10070881 | 3300025927 | Bacteria | 2489 |
| 393 | Ga0207687_10074228 | 3300025927 | Bacteria | 2437 |
| 394 | Ga0207687_10446632 | 3300025927 | Bacteria | 1072 |
| 395 | Ga0207700_10000027 | 3300025928 | Bacteria | 137708 |
| 396 | Ga0207700_10047064 | 3300025928 | Bacteria | 3195 |
| 397 | Ga0207700_10335382 | 3300025928 | Bacteria | 1313 |
| 398 | Ga0207700_10654257 | 3300025928 | Bacteria | 937 |
| 399 | Ga0207700_10663157 | 3300025928 | Bacteria | 930 |
| 400 | Ga0207664_10001411 | 3300025929 | Bacteria | 15808 |
| 401 | Ga0207664_10028937 | 3300025929 | Bacteria | 4217 |
| 402 | Ga0207664_10035475 | 3300025929 | Bacteria | 3849 |
| 403 | Ga0207664_10258904 | 3300025929 | Bacteria | 1521 |
| 404 | Ga0207664_11531885 | 3300025929 | Bacteria | 588 |
| 405 | Ga0207690_10046474 | 3300025932 | Bacteria | 2876 |
| 406 | Ga0207690_10287309 | 3300025932 | Bacteria | 1283 |
| 407 | Ga0207690_10430343 | 3300025932 | Bacteria | 1057 |
| 408 | Ga0207690_11180371 | 3300025932 | Bacteria | 639 |
| 409 | Ga0207706_10019718 | 3300025933 | Bacteria | 6066 |
| 410 | Ga0207706_10029844 | 3300025933 | Bacteria | 4866 |
| 411 | Ga0207706_10052839 | 3300025933 | Bacteria | 3587 |
| 412 | Ga0207706_10180759 | 3300025933 | Bacteria | 1852 |
| 413 | Ga0207686_10001027 | 3300025934 | Bacteria | 16514 |
| 414 | Ga0207686_10207069 | 3300025934 | Bacteria | 1408 |
| 415 | Ga0207686_10213473 | 3300025934 | Bacteria | 1389 |
| 416 | Ga0207686_10536650 | 3300025934 | Bacteria | 913 |
| 417 | Ga0207709_10015789 | 3300025935 | Bacteria | 4191 |
| 418 | Ga0207709_10074278 | 3300025935 | Bacteria | 2169 |
| 419 | Ga0207709_10104154 | 3300025935 | Bacteria | 1882 |
| 420 | Ga0207709_10533339 | 3300025935 | Bacteria | 921 |
| 421 | Ga0207709_10900847 | 3300025935 | Bacteria | 719 |
| 422 | Ga0207670_10138907 | 3300025936 | Bacteria | 1790 |
| 423 | Ga0207670_10203452 | 3300025936 | Bacteria | 1506 |
| 424 | Ga0207669_10012356 | 3300025937 | Bacteria | 4195 |
| 425 | Ga0207669_10379461 | 3300025937 | Bacteria | 1101 |
| 426 | Ga0207669_10459763 | 3300025937 | Bacteria | 1010 |
| 427 | Ga0207704_10000068 | 3300025938 | Bacteria | 65896 |
| 428 | Ga0207704_10065797 | 3300025938 | Bacteria | 2271 |
| 429 | Ga0207704_10172203 | 3300025938 | Bacteria | 1554 |
| 430 | Ga0207704_11175401 | 3300025938 | Bacteria | 654 |
| 431 | Ga0207691_10000525 | 3300025940 | Bacteria | 38219 |
| 432 | Ga0207691_10013227 | 3300025940 | Bacteria | 7903 |
| 433 | Ga0207691_10255159 | 3300025940 | Bacteria | 1513 |
| 434 | Ga0207691_10286749 | 3300025940 | Bacteria | 1416 |
| 435 | Ga0207691_11605624 | 3300025940 | Bacteria | 529 |
| 436 | Ga0207711_11821502 | 3300025941 | Bacteria | 552 |
| 437 | Ga0207689_10133971 | 3300025942 | Bacteria | 2040 |
| 438 | Ga0207689_10516277 | 3300025942 | Bacteria | 1002 |
| 439 | Ga0207689_11185909 | 3300025942 | Bacteria | 643 |
| 440 | Ga0207689_11595433 | 3300025942 | Bacteria | 543 |
| 441 | Ga0207661_10000398 | 3300025944 | Bacteria | 28097 |
| 442 | Ga0207661_10153276 | 3300025944 | Bacteria | 1994 |
| 443 | Ga0207661_10201853 | 3300025944 | Bacteria | 1748 |
| 444 | Ga0207661_10323914 | 3300025944 | Bacteria | 1386 |
| 445 | Ga0207661_10595514 | 3300025944 | Bacteria | 1014 |
| 446 | Ga0207661_11007417 | 3300025944 | Bacteria | 767 |
| 447 | Ga0207661_11437002 | 3300025944 | Bacteria | 633 |
| 448 | Ga0207661_11687359 | 3300025944 | Bacteria | 579 |
| 449 | Ga0207679_10126312 | 3300025945 | Bacteria | 2044 |
| 450 | Ga0207679_10213296 | 3300025945 | Bacteria | 1620 |
| 451 | Ga0207679_10244736 | 3300025945 | Bacteria | 1521 |
| 452 | Ga0207679_11219163 | 3300025945 | Bacteria | 691 |
| 453 | Ga0207667_10429440 | 3300025949 | Bacteria | 1344 |
| 454 | Ga0207667_10456813 | 3300025949 | Bacteria | 1298 |
| 455 | Ga0207651_10210280 | 3300025960 | Bacteria | 1565 |
| 456 | Ga0207651_10804756 | 3300025960 | Bacteria | 833 |
| 457 | Ga0207712_10067426 | 3300025961 | Bacteria | 2561 |
| 458 | Ga0207668_10584821 | 3300025972 | Bacteria | 971 |
| 459 | Ga0207668_10735982 | 3300025972 | Bacteria | 869 |
| 460 | Ga0207668_11375246 | 3300025972 | Bacteria | 636 |
| 461 | Ga0207640_10000778 | 3300025981 | Bacteria | 18133 |
| 462 | Ga0207640_10152069 | 3300025981 | Bacteria | 1701 |
| 463 | Ga0207640_10192376 | 3300025981 | Bacteria | 1539 |
| 464 | Ga0207640_10479643 | 3300025981 | Bacteria | 1031 |
| 465 | Ga0207640_10860749 | 3300025981 | Bacteria | 789 |
| 466 | Ga0207677_10001122 | 3300026023 | Bacteria | 14593 |
| 467 | Ga0207677_10144987 | 3300026023 | Bacteria | 1823 |
| 468 | Ga0207677_10341196 | 3300026023 | Bacteria | 1252 |
| 469 | Ga0207677_10581092 | 3300026023 | Bacteria | 981 |
| 470 | Ga0207677_10751288 | 3300026023 | Bacteria | 869 |
| 471 | Ga0207677_10803451 | 3300026023 | Bacteria | 842 |
| 472 | Ga0207677_10928959 | 3300026023 | Bacteria | 786 |
| 473 | Ga0207703_10636745 | 3300026035 | Bacteria | 1011 |
| 474 | Ga0207639_10741133 | 3300026041 | Bacteria | 913 |
| 475 | Ga0207678_10001328 | 3300026067 | Bacteria | 22835 |
| 476 | Ga0207678_10047028 | 3300026067 | Bacteria | 3731 |
| 477 | Ga0207678_10094513 | 3300026067 | Bacteria | 2554 |
| 478 | Ga0207678_11634229 | 3300026067 | Bacteria | 567 |
| 479 | Ga0207708_10000157 | 3300026075 | Bacteria | 53448 |
| 480 | Ga0207708_10001758 | 3300026075 | Bacteria | 16002 |
| 481 | Ga0207708_10177943 | 3300026075 | Bacteria | 1688 |
| 482 | Ga0207708_10249088 | 3300026075 | Bacteria | 1431 |
| 483 | Ga0207708_10346396 | 3300026075 | Bacteria | 1218 |
| 484 | Ga0207702_10088418 | 3300026078 | Bacteria | 2706 |
| 485 | Ga0207702_10434701 | 3300026078 | Bacteria | 1271 |
| 486 | Ga0207641_10007103 | 3300026088 | Bacteria | 9352 |
| 487 | Ga0207641_10829429 | 3300026088 | Bacteria | 916 |
| 488 | Ga0207648_10068357 | 3300026089 | Bacteria | 3095 |
| 489 | Ga0207648_10073706 | 3300026089 | Bacteria | 2975 |
| 490 | Ga0207648_10079595 | 3300026089 | Bacteria | 2859 |
| 491 | Ga0207648_10158415 | 3300026089 | Bacteria | 1999 |
| 492 | Ga0207676_10054536 | 3300026095 | Bacteria | 3134 |
| 493 | Ga0207676_10233620 | 3300026095 | Bacteria | 1645 |
| 494 | Ga0207676_11211118 | 3300026095 | Bacteria | 748 |
| 495 | Ga0207674_10044201 | 3300026116 | Bacteria | 4589 |
| 496 | Ga0207674_10287460 | 3300026116 | Bacteria | 1593 |
| 497 | Ga0207675_100062080 | 3300026118 | Bacteria | 3489 |
| 498 | Ga0207675_100090817 | 3300026118 | Bacteria | 2871 |
| 499 | Ga0207675_100122575 | 3300026118 | Bacteria | 2461 |
| 500 | Ga0207675_100323396 | 3300026118 | Bacteria | 1506 |
| 501 | Ga0207675_100432322 | 3300026118 | Bacteria | 1302 |
| 502 | Ga0207675_100874894 | 3300026118 | Bacteria | 914 |
| 503 | Ga0207683_10001623 | 3300026121 | Bacteria | 20159 |
| 504 | Ga0207683_10026990 | 3300026121 | Bacteria | 4962 |
| 505 | Ga0207683_11446571 | 3300026121 | Bacteria | 635 |
| 506 | Ga0207698_10000013 | 3300026142 | Bacteria | 255414 |
| 507 | Ga0207698_10018223 | 3300026142 | Bacteria | 4779 |
| 508 | Ga0207428_10001807 | 3300027907 | Bacteria | 21908 |
| 509 | Ga0207428_10017745 | 3300027907 | Bacteria | 6103 |
| 510 | Ga0207428_10206663 | 3300027907 | Bacteria | 1476 |
| 511 | Ga0207428_10255028 | 3300027907 | Bacteria | 1307 |
| 512 | Ga0207428_10256163 | 3300027907 | Bacteria | 1304 |
| 513 | Ga0268266_10033402 | 3300028379 | Bacteria | 4374 |
| 514 | Ga0268266_10197221 | 3300028379 | Bacteria | 1841 |
| 515 | Ga0268266_10244987 | 3300028379 | Bacteria | 1656 |
| 516 | Ga0268266_11613944 | 3300028379 | Bacteria | 624 |
| 517 | Ga0268265_10292873 | 3300028380 | Bacteria | 1462 |
| 518 | Ga0268264_10133948 | 3300028381 | Bacteria | 2201 |
| 519 | Ga0268264_10232960 | 3300028381 | Bacteria | 1702 |
| 520 | Ga0268264_10780218 | 3300028381 | Bacteria | 954 |
| 521 | Ga0265334_10140996 | 3300028573 | Bacteria | 854 |
| 522 | Ga0307408_101075719 | 3300031548 | Bacteria | 745 |
| 523 | Ga0307405_10557817 | 3300031731 | Bacteria | 928 |
| 524 | Ga0307410_10523411 | 3300031852 | Bacteria | 979 |
| 525 | Ga0307410_10845217 | 3300031852 | Bacteria | 781 |
| 526 | Ga0307407_10191028 | 3300031903 | Bacteria | 1365 |
| 527 | Ga0307407_10395530 | 3300031903 | Bacteria | 990 |
| 528 | Ga0307407_10711896 | 3300031903 | Unclassified | 757 |
| 529 | Ga0307412_10703347 | 3300031911 | Bacteria | 868 |
| 530 | Ga0307409_100039378 | 3300031995 | Bacteria | 3507 |
| 531 | Ga0307416_100038250 | 3300032002 | Bacteria | 3701 |
| 532 | Ga0307416_100424452 | 3300032002 | Bacteria | 1375 |
| 533 | Ga0307416_100797759 | 3300032002 | Bacteria | 1040 |
| 534 | Ga0307411_10234766 | 3300032005 | Bacteria | 1432 |
| 535 | Ga0307415_100002829 | 3300032126 | Bacteria | 8688 |
| 536 | Ga0307415_100205028 | 3300032126 | Bacteria | 1568 |
| 537 | Ga0307415_100244925 | 3300032126 | Bacteria | 1453 |
| 538 | Ga0307415_100636672 | 3300032126 | Bacteria | 954 |
| 539 | Ga0373923_0238991 | 3300035111 | Bacteria | 848 |
| 540 | Ga0373941_0467729 | 3300035115 | Bacteria | 532 |
| 541 | Ga0373953_0052036 | 3300035117 | Bacteria | 1657 |
| 542 | Ga0373955_0052893 | 3300035172 | Bacteria | 2216 |
| 543 | Ga0316574_0073131 | 3300035398 | Bacteria | 2167 |
| 544 | Ga0373924_0304577 | 3300035410 | Bacteria | 708 |
| 545 | Ga0373931_1102134 | 3300035691 | Bacteria | 541 |
| 546 | Ga0373935_0143470 | 3300035692 | Bacteria | 1615 |
| 547 | Ga0373937_0601405 | 3300036401 | Bacteria | 1044 |
| 548 | Ga0373937_0628956 | 3300036401 | Bacteria | 1018 |
| 549 | Ga0316582_0238719 | 3300036647 | Bacteria | 1245 |
| 550 | Ga0395900_0052131 | 3300037418 | Bacteria | 4212 |
| 551 | Ga0395898_0000894 | 3300037466 | Bacteria | 48455 |
| 552 | Ga0395898_0021778 | 3300037466 | Bacteria | 6495 |
| 553 | Ga0395905_0186693 | 3300037471 | Bacteria | 1946 |
| 554 | Ga0316581_0214286 | 3300037588 | Bacteria | 592 |
| 555 | Ga0436364_0115266 | 3300037853 | Bacteria | 1322 |
| 556 | Ga0436364_0118612 | 3300037853 | Bacteria | 3657 |
| 557 | Ga0436364_0159150 | 3300037853 | Bacteria | 9191 |
| 558 | Ga0436364_0159207 | 3300037853 | Bacteria | 28255 |
| 559 | Ga0436364_0286486 | 3300037853 | Bacteria | 824 |
| 560 | Ga0436364_0334646 | 3300037853 | Bacteria | 5280 |
| 561 | Ga0436364_0503224 | 3300037853 | Bacteria | 5084 |
| 562 | Ga0436364_0744537 | 3300037853 | Bacteria | 1077 |
| 563 | Ga0436364_0810387 | 3300037853 | Bacteria | 781 |
| 564 | Ga0436364_1245246 | 3300037853 | Bacteria | 3910 |
| 565 | Ga0436364_1339551 | 3300037853 | Bacteria | 15044 |
| 566 | Ga0436364_1372536 | 3300037853 | Bacteria | 1430 |
| 567 | Ga0436364_1375186 | 3300037853 | Bacteria | 86866 |
| 568 | Ga0436364_1467838 | 3300037853 | Bacteria | 3986 |
| 569 | Ga0395901_0019363 | 3300038443 | Bacteria | 6958 |
| 570 | Ga0395901_0205625 | 3300038443 | Bacteria | 2063 |
| 571 | Ga0395901_1063397 | 3300038443 | Bacteria | 782 |
| 572 | Ga0395901_1758017 | 3300038443 | Bacteria | 570 |
| 573 | Ga0436365_0004038 | 3300039437 | Bacteria | 26265 |
| 574 | Ga0436365_0405628 | 3300039437 | Bacteria | 733 |
| 575 | Ga0436365_0896130 | 3300039437 | Bacteria | 22043 |
| 576 | Ga0436365_1001279 | 3300039437 | Bacteria | 29327 |
| 577 | Ga0436365_1500157 | 3300039437 | Bacteria | 750 |
| 578 | Ga0436365_1510673 | 3300039437 | Bacteria | 7863 |
| 579 | Ga0436365_1758755 | 3300039437 | Bacteria | 3726 |
| 580 | Ga0436365_1811968 | 3300039437 | Bacteria | 1332 |
| 581 | Ga0436363_0134081 | 3300039450 | Bacteria | 1035 |
| 582 | Ga0436363_0294066 | 3300039450 | Bacteria | 957 |
| 583 | Ga0436363_0550340 | 3300039450 | Bacteria | 612 |
| 584 | Ga0436363_0760459 | 3300039450 | Bacteria | 34430 |
| 585 | Ga0436363_0843533 | 3300039450 | Bacteria | 7913 |
| 586 | Ga0436363_1431625 | 3300039450 | Bacteria | 5053 |
| 587 | Ga0436363_1449147 | 3300039450 | Bacteria | 548 |
| 588 | Ga0436363_1608452 | 3300039450 | Bacteria | 1603 |
| 589 | Ga0436363_1691717 | 3300039450 | Bacteria | 5219 |
| 590 | Ga0436362_0339746 | 3300039453 | Bacteria | 4301 |
| 591 | Ga0436362_0344812 | 3300039453 | Bacteria | 591 |
| 592 | Ga0436362_0400860 | 3300039453 | Bacteria | 3040 |
| 593 | Ga0436362_0712899 | 3300039453 | Bacteria | 535 |
| 594 | Ga0436362_0787061 | 3300039453 | Bacteria | 1396 |
| 595 | Ga0451789_0804322 | 3300041443 | Bacteria | 633 |
| 596 | Ga0451800_1619457 | 3300041459 | Bacteria | 512 |
| 597 | Ga0451802_0871605 | 3300041460 | Bacteria | 597 |
| 598 | Ga0451833_0916368 | 3300041491 | Bacteria | 989 |
| 599 | Ga0451853_1043671 | 3300041512 | Bacteria | 595 |
| 600 | Ga0439460_0125632 | 3300042461 | Bacteria | 842 |
| 601 | Ga0439460_0183014 | 3300042461 | Bacteria | 709 |
| 602 | Ga0466969_0221621 | 3300044656 | Bacteria | 860 |
| 603 | Ga0466969_0223196 | 3300044656 | Bacteria | 857 |
| 604 | Ga0466969_0284550 | 3300044656 | Bacteria | 748 |
| 605 | Ga0466969_0502549 | 3300044656 | Bacteria | 553 |
| 606 | Ga0466965_0853340 | 3300044683 | Bacteria | 529 |
| 607 | Ga0466966_0112517 | 3300044684 | Bacteria | 1677 |
| 608 | Ga0466966_0157141 | 3300044684 | Bacteria | 1385 |
| 609 | Ga0466966_0172649 | 3300044684 | Bacteria | 1313 |
| 610 | Ga0466966_0349418 | 3300044684 | Bacteria | 889 |
| 611 | Ga0466966_0655980 | 3300044684 | Bacteria | 632 |
| 612 | Ga0466961_0004704 | 3300044693 | Bacteria | 8585 |
| 613 | Ga0466961_0041318 | 3300044693 | Bacteria | 2957 |
| 614 | Ga0466961_0207612 | 3300044693 | Bacteria | 1210 |
| 615 | Ga0466961_0360147 | 3300044693 | Bacteria | 885 |
| 616 | Ga0466961_0525364 | 3300044693 | Bacteria | 714 |
| 617 | Ga0466961_0794879 | 3300044693 | Bacteria | 565 |
| 618 | Ga0466963_0007807 | 3300044694 | Bacteria | 6400 |
| 619 | Ga0466963_0013255 | 3300044694 | Bacteria | 5060 |
| 620 | Ga0466963_0049400 | 3300044694 | Bacteria | 2782 |
| 621 | Ga0466963_0051798 | 3300044694 | Bacteria | 2722 |
| 622 | Ga0466963_0065596 | 3300044694 | Bacteria | 2434 |
| 623 | Ga0466963_0105953 | 3300044694 | Bacteria | 1927 |
| 624 | Ga0466963_0158205 | 3300044694 | Bacteria | 1576 |
| 625 | Ga0466963_0230379 | 3300044694 | Bacteria | 1298 |
| 626 | Ga0466963_0269254 | 3300044694 | Bacteria | 1197 |
| 627 | Ga0466963_0351371 | 3300044694 | Bacteria | 1038 |
| 628 | Ga0466963_0366966 | 3300044694 | Bacteria | 1014 |
| 629 | Ga0466963_0438048 | 3300044694 | Bacteria | 922 |
| 630 | Ga0466963_0734848 | 3300044694 | Bacteria | 696 |
| 631 | Ga0466963_0985236 | 3300044694 | Bacteria | 594 |
| 632 | Ga0453684_0194694 | 3300044712 | Bacteria | 2368 |
| 633 | Ga0466971_0005233 | 3300044719 | Bacteria | 5617 |
| 634 | Ga0466971_0041424 | 3300044719 | Bacteria | 2068 |
| 635 | Ga0466971_0106899 | 3300044719 | Bacteria | 1289 |
| 636 | Ga0466971_0111028 | 3300044719 | Bacteria | 1265 |
| 637 | Ga0466971_0203027 | 3300044719 | Bacteria | 936 |
| 638 | Ga0466968_0070826 | 3300044735 | Bacteria | 1518 |
| 639 | Ga0466968_0091123 | 3300044735 | Bacteria | 1351 |
| 640 | Ga0466968_0151471 | 3300044735 | Bacteria | 1066 |
| 641 | Ga0466968_0185461 | 3300044735 | Bacteria | 969 |
| 642 | Ga0466970_0410857 | 3300044765 | Bacteria | 773 |
| 643 | Ga0466970_0812029 | 3300044765 | Bacteria | 548 |
| 644 | Ga0466957_0005549 | 3300044842 | Bacteria | 7086 |
| 645 | Ga0466957_0080081 | 3300044842 | Bacteria | 2033 |
| 646 | Ga0466957_0154050 | 3300044842 | Bacteria | 1488 |
| 647 | Ga0466957_0169457 | 3300044842 | Bacteria | 1422 |
| 648 | Ga0466957_0337386 | 3300044842 | Bacteria | 1020 |
| 649 | Ga0466957_0741153 | 3300044842 | Bacteria | 695 |
| 650 | Ga0466960_0000064 | 3300044901 | Bacteria | 35453 |
| 651 | Ga0466960_0229807 | 3300044901 | Bacteria | 1024 |
| 652 | Ga0466960_0297199 | 3300044901 | Bacteria | 909 |
| 653 | Ga0466960_0454690 | 3300044901 | Bacteria | 745 |
| 654 | Ga0466960_0830518 | 3300044901 | Bacteria | 561 |
| 655 | Ga0466959_0018317 | 3300045049 | Bacteria | 5141 |
| 656 | Ga0466959_0054464 | 3300045049 | Bacteria | 2922 |
| 657 | Ga0466959_0096623 | 3300045049 | Bacteria | 2118 |
| 658 | Ga0466959_0098486 | 3300045049 | Bacteria | 2095 |
| 659 | Ga0466959_0102830 | 3300045049 | Bacteria | 2044 |
| 660 | Ga0466959_0118442 | 3300045049 | Bacteria | 1885 |
| 661 | Ga0466959_0125962 | 3300045049 | Bacteria | 1818 |
| 662 | Ga0466959_0147463 | 3300045049 | Bacteria | 1660 |
| 663 | Ga0466959_0244931 | 3300045049 | Bacteria | 1237 |
| 664 | Ga0466959_0691815 | 3300045049 | Bacteria | 684 |
| 665 | Ga0466959_0984842 | 3300045049 | Bacteria | 562 |
| 666 | Ga0466958_0001574 | 3300045836 | Bacteria | 10946 |
| 667 | Ga0466958_0011629 | 3300045836 | Bacteria | 4961 |
| 668 | Ga0466958_0014890 | 3300045836 | Bacteria | 4446 |
| 669 | Ga0466958_0023271 | 3300045836 | Bacteria | 3634 |
| 670 | Ga0466958_0067510 | 3300045836 | Bacteria | 2185 |
| 671 | Ga0466958_0067718 | 3300045836 | Bacteria | 2181 |
| 672 | Ga0466958_0177414 | 3300045836 | Bacteria | 1351 |
| 673 | Ga0466958_0238515 | 3300045836 | Bacteria | 1162 |
| 674 | Ga0466958_0330839 | 3300045836 | Bacteria | 979 |
| 675 | Ga0466958_0740000 | 3300045836 | Bacteria | 641 |
| 676 | Ga0466958_0954554 | 3300045836 | Bacteria | 559 |
| 677 | Ga0466967_0004705 | 3300045976 | Bacteria | 9276 |
| 678 | Ga0466967_0005204 | 3300045976 | Bacteria | 8958 |
| 679 | Ga0466967_0008602 | 3300045976 | Bacteria | 7502 |
| 680 | Ga0466967_0012278 | 3300045976 | Bacteria | 6543 |
| 681 | Ga0466967_0023706 | 3300045976 | Bacteria | 5033 |
| 682 | Ga0466967_0023917 | 3300045976 | Bacteria | 5015 |
| 683 | Ga0466967_0080963 | 3300045976 | Bacteria | 2932 |
| 684 | Ga0466967_0089796 | 3300045976 | Bacteria | 2790 |
| 685 | Ga0466967_0140119 | 3300045976 | Bacteria | 2252 |
| 686 | Ga0466967_0178602 | 3300045976 | Bacteria | 2001 |
| 687 | Ga0466967_0331438 | 3300045976 | Bacteria | 1470 |
| 688 | Ga0466967_0432383 | 3300045976 | Bacteria | 1284 |
| 689 | Ga0466967_0439199 | 3300045976 | Bacteria | 1274 |
| 690 | Ga0466967_0489296 | 3300045976 | Bacteria | 1206 |
| 691 | Ga0466967_0498869 | 3300045976 | Bacteria | 1194 |
| 692 | Ga0466967_0689907 | 3300045976 | Bacteria | 1011 |
| 693 | Ga0466967_0791826 | 3300045976 | Bacteria | 941 |
| 694 | Ga0466967_1787722 | 3300045976 | Bacteria | 612 |
| 695 | Ga0466967_1877793 | 3300045976 | Bacteria | 596 |
| 696 | Ga0466967_2275972 | 3300045976 | Bacteria | 538 |
| 697 | Ga0495592_0466152 | 3300046454 | Bacteria | 789 |
| 698 | Ga0495641_0001080 | 3300046461 | Bacteria | 23509 |
| 699 | Ga0495641_0112982 | 3300046461 | Bacteria | 1212 |
| 700 | Ga0495641_0488691 | 3300046461 | Bacteria | 561 |
| 701 | Ga0495651_0006559 | 3300046462 | Bacteria | 8886 |
| 702 | Ga0495653_0014652 | 3300046463 | Bacteria | 6397 |
| 703 | Ga0495650_0000053 | 3300046471 | Bacteria | 316684 |
| 704 | Ga0495582_0544777 | 3300046473 | Bacteria | 671 |
| 705 | Ga0495585_0343213 | 3300046492 | Bacteria | 727 |
| 706 | Ga0495606_0000072 | 3300046507 | Bacteria | 173678 |
| 707 | Ga0495608_0056557 | 3300046511 | Unclassified | 2590 |
| 708 | Ga0495618_0009790 | 3300046514 | Bacteria | 5794 |
| 709 | Ga0495618_0281270 | 3300046514 | Bacteria | 1038 |
| 710 | Ga0495628_0036020 | 3300046516 | Bacteria | 3974 |
| 711 | Ga0495628_0144247 | 3300046516 | Bacteria | 1816 |
| 712 | Ga0495630_0000020 | 3300046517 | Bacteria | 176389 |
| 713 | Ga0495652_0028874 | 3300046529 | Bacteria | 4876 |
| 714 | Ga0495652_0035637 | 3300046529 | Bacteria | 4330 |
| 715 | Ga0495640_0132726 | 3300046533 | Bacteria | 1610 |
| 716 | Ga0495640_0360231 | 3300046533 | Bacteria | 897 |
| 717 | Ga0495587_0009780 | 3300046536 | Bacteria | 6129 |
| 718 | Ga0495645_0170386 | 3300046543 | Bacteria | 1499 |
| 719 | Ga0495645_0280815 | 3300046543 | Unclassified | 1095 |
| 720 | Ga0495622_0000789 | 3300046557 | Bacteria | 17646 |
| 721 | Ga0495667_0001023 | 3300046559 | Bacteria | 18094 |
| 722 | Ga0495656_0346050 | 3300046615 | Bacteria | 769 |
| 723 | Ga0495634_0066330 | 3300046642 | Bacteria | 2390 |
| 724 | Ga0495635_0222215 | 3300046663 | Bacteria | 1277 |
| 725 | Ga0495588_0343354 | 3300046674 | Bacteria | 785 |
| 726 | Ga0495657_0021964 | 3300046675 | Bacteria | 4575 |
| 727 | Ga0495599_0008369 | 3300046678 | Bacteria | 6286 |
| 728 | Ga0495599_0308155 | 3300046678 | Bacteria | 955 |
| 729 | Ga0495646_0015211 | 3300046680 | Bacteria | 4887 |
| 730 | Ga0495658_0217581 | 3300046683 | Bacteria | 1195 |
| 731 | Ga0495613_0719357 | 3300046689 | Bacteria | 656 |
| 732 | Ga0495649_0005280 | 3300046694 | Bacteria | 8253 |
| 733 | Ga0495600_0047127 | 3300046809 | Bacteria | 2811 |
| 734 | Ga0495600_0130333 | 3300046809 | Bacteria | 1635 |
| 735 | Ga0495660_0200929 | 3300046810 | Bacteria | 952 |
| 736 | Ga0495581_0724179 | 3300047315 | Bacteria | 573 |
| 737 | Ga0495604_0006333 | 3300047317 | Bacteria | 9386 |
| 738 | Ga0495604_0066597 | 3300047317 | Bacteria | 2739 |
| 739 | Ga0495604_0130850 | 3300047317 | Bacteria | 1804 |
| 740 | Ga0495674_0076400 | 3300047319 | Bacteria | 2881 |
| 741 | Ga0495674_0306717 | 3300047319 | Bacteria | 1296 |
| 742 | Ga0495672_0084135 | 3300047320 | Bacteria | 1765 |
| 743 | Ga0495680_0080447 | 3300047322 | Bacteria | 2462 |
| 744 | Ga0495684_0006748 | 3300047471 | Bacteria | 8912 |
| 745 | Ga0495686_0689727 | 3300047472 | Bacteria | 522 |
| 746 | Ga0495593_0246985 | 3300047673 | Bacteria | 894 |
| 747 | Ga0495602_0000070 | 3300048088 | Bacteria | 100656 |
| 748 | Ga0495602_0130794 | 3300048088 | Bacteria | 2002 |
| 749 | Ga0495602_0380243 | 3300048088 | Bacteria | 1012 |
| 750 | Ga0495614_0151794 | 3300048089 | Bacteria | 1034 |
| 751 | Ga0496100_0011865 | 3300048903 | Bacteria | 4974 |
| 752 | Ga0496100_0116816 | 3300048903 | Bacteria | 1862 |
| 753 | Ga0496100_0396129 | 3300048903 | Bacteria | 1051 |
| 754 | Ga0496100_0590180 | 3300048903 | Bacteria | 862 |
| 755 | Ga0496100_0996514 | 3300048903 | Bacteria | 659 |
| 756 | Ga0496100_1263026 | 3300048903 | Bacteria | 583 |
| 757 | Ga0496101_0029261 | 3300048904 | Bacteria | 3853 |
| 758 | Ga0496101_0099390 | 3300048904 | Bacteria | 2175 |
| 759 | Ga0496101_0408568 | 3300048904 | Bacteria | 1070 |
| 760 | Ga0496101_0611504 | 3300048904 | Bacteria | 861 |
| 761 | Ga0496102_0013835 | 3300048905 | Bacteria | 7003 |
| 762 | Ga0496102_0018938 | 3300048905 | Bacteria | 6056 |
| 763 | Ga0496102_0319883 | 3300048905 | Bacteria | 1462 |
| 764 | Ga0496102_0479607 | 3300048905 | Bacteria | 1165 |
| 765 | Ga0496102_0480703 | 3300048905 | Bacteria | 1163 |
| 766 | Ga0496103_0107501 | 3300048906 | Bacteria | 1770 |
| 767 | Ga0496103_0669782 | 3300048906 | Bacteria | 659 |
| 768 | Ga0496104_0006465 | 3300048907 | Bacteria | 10301 |
| 769 | Ga0496104_0012549 | 3300048907 | Bacteria | 7624 |
| 770 | Ga0496104_0031238 | 3300048907 | Bacteria | 4952 |
| 771 | Ga0496104_0496185 | 3300048907 | Bacteria | 1132 |
| 772 | Ga0496104_0944022 | 3300048907 | Bacteria | 767 |
| 773 | Ga0496105_0010069 | 3300048908 | Bacteria | 7420 |
| 774 | Ga0496105_0043554 | 3300048908 | Bacteria | 3702 |
| 775 | Ga0496105_0073928 | 3300048908 | Bacteria | 2816 |
| 776 | Ga0496106_0000013 | 3300048909 | Bacteria | 202263 |
| 777 | Ga0496106_0001792 | 3300048909 | Bacteria | 16049 |
| 778 | Ga0496106_0026312 | 3300048909 | Bacteria | 4331 |
| 779 | Ga0496106_0063292 | 3300048909 | Bacteria | 2811 |
| 780 | Ga0496106_0072232 | 3300048909 | Bacteria | 2639 |
| 781 | Ga0496106_0086508 | 3300048909 | Bacteria | 2414 |
| 782 | Ga0496107_0036827 | 3300048910 | Bacteria | 3510 |
| 783 | Ga0496107_0053073 | 3300048910 | Bacteria | 2924 |
| 784 | Ga0496107_0067100 | 3300048910 | Bacteria | 2602 |
| 785 | Ga0496107_0109180 | 3300048910 | Bacteria | 2032 |
| 786 | Ga0496107_0713766 | 3300048910 | Bacteria | 737 |
| 787 | Ga0496107_0908657 | 3300048910 | Bacteria | 641 |
| 788 | Ga0496108_0000146 | 3300048911 | Bacteria | 67618 |
| 789 | Ga0496108_0000832 | 3300048911 | Bacteria | 24019 |
| 790 | Ga0496108_0026006 | 3300048911 | Bacteria | 4827 |
| 791 | Ga0496108_0058642 | 3300048911 | Bacteria | 3236 |
| 792 | Ga0496108_0098170 | 3300048911 | Bacteria | 2496 |
| 793 | Ga0496108_0494064 | 3300048911 | Bacteria | 1069 |
| 794 | Ga0496108_0847941 | 3300048911 | Bacteria | 786 |
| 795 | Ga0496109_0000146 | 3300048912 | Bacteria | 69777 |
| 796 | Ga0496109_0000226 | 3300048912 | Bacteria | 54895 |
| 797 | Ga0496109_0000297 | 3300048912 | Bacteria | 47127 |
| 798 | Ga0496109_0020937 | 3300048912 | Bacteria | 5780 |
| 799 | Ga0496109_0032131 | 3300048912 | Bacteria | 4715 |
| 800 | Ga0496109_0080083 | 3300048912 | Bacteria | 3009 |
| 801 | Ga0496109_0117167 | 3300048912 | Bacteria | 2479 |
| 802 | Ga0496109_0216489 | 3300048912 | Bacteria | 1801 |
| 803 | Ga0496109_0223882 | 3300048912 | Bacteria | 1769 |
| 804 | Ga0496109_1116073 | 3300048912 | Bacteria | 726 |
| 805 | Ga0496109_1167737 | 3300048912 | Bacteria | 707 |
| 806 | Ga0496110_0034676 | 3300048913 | Bacteria | 4373 |
| 807 | Ga0496110_0070834 | 3300048913 | Bacteria | 3090 |
| 808 | Ga0496110_0268505 | 3300048913 | Bacteria | 1553 |
| 809 | Ga0496110_0299285 | 3300048913 | Bacteria | 1465 |
| 810 | Ga0496110_0365975 | 3300048913 | Bacteria | 1314 |
| 811 | Ga0496110_0845407 | 3300048913 | Bacteria | 820 |
| 812 | Ga0496111_0029976 | 3300048914 | Bacteria | 3867 |
| 813 | Ga0496111_0036409 | 3300048914 | Bacteria | 3518 |
| 814 | Ga0496111_0204695 | 3300048914 | Bacteria | 1467 |
| 815 | Ga0496111_0215665 | 3300048914 | Bacteria | 1426 |
| 816 | Ga0496111_0318860 | 3300048914 | Bacteria | 1151 |
| 817 | Ga0496112_0000153 | 3300048915 | Bacteria | 43240 |
| 818 | Ga0496112_0004480 | 3300048915 | Bacteria | 11847 |
| 819 | Ga0496112_0013821 | 3300048915 | Bacteria | 7468 |
| 820 | Ga0496112_0037880 | 3300048915 | Bacteria | 4709 |
| 821 | Ga0496112_0040461 | 3300048915 | Bacteria | 4557 |
| 822 | Ga0496112_0054181 | 3300048915 | Bacteria | 3940 |
| 823 | Ga0496112_0072498 | 3300048915 | Bacteria | 3405 |
| 824 | Ga0496112_0224619 | 3300048915 | Bacteria | 1833 |
| 825 | Ga0496112_0502535 | 3300048915 | Bacteria | 1148 |
| 826 | Ga0496112_1325304 | 3300048915 | Bacteria | 635 |
| 827 | Ga0496113_0000004 | 3300048916 | Bacteria | 109489 |
| 828 | Ga0496113_0002975 | 3300048916 | Bacteria | 10026 |
| 829 | Ga0496113_0009800 | 3300048916 | Bacteria | 6302 |
| 830 | Ga0496113_0015578 | 3300048916 | Bacteria | 5231 |
| 831 | Ga0496113_0017293 | 3300048916 | Bacteria | 5002 |
| 832 | Ga0496113_0028738 | 3300048916 | Bacteria | 4003 |
| 833 | Ga0496113_0178271 | 3300048916 | Bacteria | 1684 |
| 834 | Ga0496113_0267868 | 3300048916 | Bacteria | 1365 |
| 835 | Ga0496113_0449583 | 3300048916 | Bacteria | 1035 |
| 836 | Ga0496114_0073737 | 3300048917 | Bacteria | 2873 |
| 837 | Ga0496114_0093555 | 3300048917 | Bacteria | 2556 |
| 838 | Ga0496114_0179768 | 3300048917 | Bacteria | 1847 |
| 839 | Ga0496114_0607477 | 3300048917 | Bacteria | 964 |
| 840 | Ga0496115_0000070 | 3300048918 | Bacteria | 91981 |
| 841 | Ga0496115_0000243 | 3300048918 | Bacteria | 49388 |
| 842 | Ga0496115_0003897 | 3300048918 | Bacteria | 10750 |
| 843 | Ga0496115_0019289 | 3300048918 | Bacteria | 5248 |
| 844 | Ga0496121_0079589 | 3300048924 | Bacteria | 2601 |
| 845 | Ga0501032_0006397 | 3300049569 | Bacteria | 8668 |
| 846 | Ga0501033_0116250 | 3300049570 | Bacteria | 1943 |
| 847 | Ga0501034_0093581 | 3300049571 | Bacteria | 3002 |
| 848 | Ga0501034_0589921 | 3300049571 | Bacteria | 1017 |
| 849 | Ga0501036_0189743 | 3300049572 | Bacteria | 1729 |
| 850 | Ga0501038_0015020 | 3300049574 | Bacteria | 7053 |
| 851 | Ga0501042_0030232 | 3300049578 | Bacteria | 3824 |
| 852 | Ga0501043_0320154 | 3300049579 | Bacteria | 1182 |
| 853 | Ga0501043_1016887 | 3300049579 | Bacteria | 589 |
| 854 | Ga0501046_0135884 | 3300049580 | Bacteria | 1862 |
| 855 | Ga0501047_0282569 | 3300049581 | Bacteria | 1504 |
| 856 | Ga0501047_0578950 | 3300049581 | Bacteria | 945 |
| 857 | Ga0501048_0118322 | 3300049582 | Bacteria | 1872 |
| 858 | Ga0501048_0291099 | 3300049582 | Bacteria | 1161 |
| 859 | Ga0501067_0105310 | 3300049583 | Bacteria | 1567 |
| 860 | Ga0501069_0058814 | 3300049585 | Bacteria | 2144 |
| 861 | Ga0501070_0375198 | 3300049586 | Bacteria | 1152 |
| 862 | Ga0501071_0694418 | 3300049587 | Bacteria | 783 |
| 863 | Ga0501072_0481792 | 3300049588 | Bacteria | 982 |
| 864 | Ga0501072_0637491 | 3300049588 | Bacteria | 839 |
| 865 | Ga0501073_0003796 | 3300049589 | Bacteria | 11355 |
| 866 | Ga0501074_0216437 | 3300049590 | Bacteria | 1364 |
| 867 | Ga0501080_1498292 | 3300049742 | Bacteria | 573 |
| 868 | Ga0501083_0121759 | 3300049744 | Bacteria | 1711 |
| 869 | Ga0501044_0067143 | 3300049823 | Bacteria | 3654 |
| 870 | Ga0501044_0159492 | 3300049823 | Bacteria | 2234 |
| 871 | Ga0501045_0487507 | 3300049824 | Bacteria | 916 |
| 872 | nmdc:mga03n38_231540_c1 | 3300050490 | Bacteria | 969 |
| 873 | nmdc:mga00v17_175309_c1 | 3300050491 | Bacteria | 1383 |
| 874 | nmdc:mga00v17_177348_c1 | 3300050491 | Bacteria | 1375 |
| 875 | nmdc:mga00v17_189584_c1 | 3300050491 | Bacteria | 1328 |
| 876 | nmdc:mga0yw44_2043_c2 | 3300050492 | Bacteria | 4356 |
| 877 | nmdc:mga0yw44_95271_c1 | 3300050492 | Bacteria | 1888 |
| 878 | nmdc:mga06z11_44670_c1 | 3300050494 | Bacteria | 2235 |
| 879 | nmdc:mga06z11_551729_c1 | 3300050494 | Bacteria | 700 |
| 880 | nmdc:mga05p37_1099293_c1 | 3300050507 | Bacteria | 833 |
| 881 | nmdc:mga05p37_24410_c1 | 3300050507 | Bacteria | 7347 |
| 882 | nmdc:mga05p37_46413_c1 | 3300050507 | Bacteria | 5342 |
| 883 | nmdc:mga09592_11930_c1 | 3300050508 | Bacteria | 7070 |
| 884 | nmdc:mga09592_318697_c1 | 3300050508 | Bacteria | 1347 |
| 885 | nmdc:mga09592_333385_c1 | 3300050508 | Bacteria | 1313 |
| 886 | nmdc:mga09592_773877_c1 | 3300050508 | Bacteria | 813 |
| 887 | nmdc:mga06r32_30770_c1 | 3300050510 | Bacteria | 5037 |
| 888 | nmdc:mga06r32_499245_c1 | 3300050510 | Unclassified | 1194 |
| 889 | nmdc:mga08y16_1008343_c1 | 3300050511 | Bacteria | 812 |
| 890 | nmdc:mga08y16_33168_c1 | 3300050511 | Bacteria | 5424 |
| 891 | nmdc:mga08y16_37344_c1 | 3300050511 | Bacteria | 5102 |
| 892 | nmdc:mga08y16_4830_c1 | 3300050511 | Bacteria | 14064 |
| 893 | nmdc:mga08y16_69212_c1 | 3300050511 | Bacteria | 3679 |
| 894 | nmdc:mga08y16_868032_c1 | 3300050511 | Bacteria | 890 |
| 895 | nmdc:mga0n895_1085036_c1 | 3300050512 | Bacteria | 778 |
| 896 | nmdc:mga0n895_662377_c1 | 3300050512 | Bacteria | 1042 |
| 897 | nmdc:mga0rr50_42833_c1 | 3300050513 | Bacteria | 3309 |
| 898 | nmdc:mga08x19_268735_c1 | 3300050514 | Bacteria | 1180 |
| 899 | nmdc:mga08x19_978916_c1 | 3300050514 | Bacteria | 601 |
| 900 | nmdc:mga0a205_121071_c1 | 3300050515 | Bacteria | 2516 |
| 901 | nmdc:mga0a205_304390_c1 | 3300050515 | Bacteria | 1466 |
| 902 | Ga0495601_0000032 | 3300053077 | Bacteria | 102174 |
| 903 | Ga0495601_0260804 | 3300053077 | Bacteria | 1131 |
| 904 | Ga0495612_0016370 | 3300053078 | Bacteria | 2972 |
| 905 | Ga0495612_0307795 | 3300053078 | Bacteria | 711 |
| 906 | Ga0495655_0031357 | 3300053083 | Bacteria | 1293 |
| 907 | Ga0495655_0048773 | 3300053083 | Bacteria | 1113 |
| 908 | Ga0495595_0010720 | 3300053084 | Bacteria | 3818 |
| 909 | Ga0495595_0028266 | 3300053084 | Bacteria | 2504 |
| 910 | Ga0495595_0111842 | 3300053084 | Bacteria | 1325 |
| 911 | Ga0500614_001722 | 3300053123 | Bacteria | 5104 |
| 912 | Ga0501082_0007829 | 3300060353 | Bacteria | 9223 |
| 913 | Ga0501082_0642955 | 3300060353 | Bacteria | 928 |
| 914 | Ga0466962_0026617 | 3300061719 | Bacteria | 2776 |
| 915 | Ga0466962_0028941 | 3300061719 | Bacteria | 2653 |
| 916 | Ga0466962_0035984 | 3300061719 | Bacteria | 2369 |
| 917 | Ga0466962_0181769 | 3300061719 | Bacteria | 1025 |
| 918 | Ga0466962_0381449 | 3300061719 | Bacteria | 704 |
| 919 | Ga0466962_0736130 | 3300061719 | Bacteria | 507 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005344 | Ga0070661_101291559 | Ga0070661_1012915592 | 132 |
| 2 | 3300005329 | Ga0070683_100026711 | Ga0070683_1000267115 | 137 |
| 3 | 3300005337 | Ga0070682_100055481 | Ga0070682_1000554812 | 137 |
| 4 | 3300005338 | Ga0068868_100538467 | Ga0068868_1005384673 | 137 |
| 5 | 3300005345 | Ga0070692_10028829 | Ga0070692_100288294 | 137 |
| 6 | 3300005438 | Ga0070701_10120835 | Ga0070701_101208352 | 137 |
| 7 | 3300005444 | Ga0070694_100138373 | Ga0070694_1001383733 | 137 |
| 8 | 3300005455 | Ga0070663_100170054 | Ga0070663_1001700543 | 137 |
| 9 | 3300005456 | Ga0070678_100560205 | Ga0070678_1005602052 | 137 |
| 10 | 3300005459 | Ga0068867_100110699 | Ga0068867_1001106993 | 137 |
| 11 | 3300005535 | Ga0070684_100148946 | Ga0070684_1001489464 | 137 |
| 12 | 3300005547 | Ga0070693_100250045 | Ga0070693_1002500452 | 137 |
| 13 | 3300005548 | Ga0070665_100240530 | Ga0070665_1002405301 | 137 |
| 14 | 3300005549 | Ga0070704_100174082 | Ga0070704_1001740823 | 137 |
| 15 | 3300005578 | Ga0068854_100129861 | Ga0068854_1001298613 | 137 |
| 16 | 3300005614 | Ga0068856_100249054 | Ga0068856_1002490543 | 137 |
| 17 | 3300005615 | Ga0070702_100006043 | Ga0070702_1000060434 | 137 |
| 18 | 3300005615 | Ga0070702_100851200 | Ga0070702_1008512001 | 137 |
| 19 | 3300005618 | Ga0068864_100063321 | Ga0068864_1000633214 | 137 |
| 20 | 3300005618 | Ga0068864_101016690 | Ga0068864_1010166902 | 137 |
| 21 | 3300005718 | Ga0068866_10684796 | Ga0068866_106847961 | 137 |
| 22 | 3300005719 | Ga0068861_100344640 | Ga0068861_1003446402 | 137 |
| 23 | 3300005840 | Ga0068870_10019487 | Ga0068870_100194875 | 137 |
| 24 | 3300005843 | Ga0068860_100292313 | Ga0068860_1002923132 | 137 |
| 25 | 3300005844 | Ga0068862_100101142 | Ga0068862_1001011424 | 137 |
| 26 | 3300006852 | Ga0075433_10556818 | Ga0075433_105568182 | 137 |
| 27 | 3300006871 | Ga0075434_102325798 | Ga0075434_1023257982 | 137 |
| 28 | 3300009011 | Ga0105251_10328108 | Ga0105251_103281082 | 137 |
| 29 | 3300009094 | Ga0111539_10228597 | Ga0111539_102285974 | 137 |
| 30 | 3300009098 | Ga0105245_10019669 | Ga0105245_100196693 | 137 |
| 31 | 3300009147 | Ga0114129_13338273 | Ga0114129_133382731 | 137 |
| 32 | 3300009176 | Ga0105242_12552559 | Ga0105242_125525591 | 137 |
| 33 | 3300009551 | Ga0105238_10268058 | Ga0105238_102680583 | 137 |
| 34 | 3300009553 | Ga0105249_10063268 | Ga0105249_100632684 | 137 |
| 35 | 3300013296 | Ga0157374_10351592 | Ga0157374_103515921 | 137 |
| 36 | 3300013306 | Ga0163162_13492383 | Ga0163162_134923832 | 137 |
| 37 | 3300014325 | Ga0163163_10113311 | Ga0163163_101133113 | 137 |
| 38 | 3300014325 | Ga0163163_10300942 | Ga0163163_103009423 | 137 |
| 39 | 3300014968 | Ga0157379_10005485 | Ga0157379_100054856 | 137 |
| 40 | 3300014969 | Ga0157376_11168804 | Ga0157376_111688041 | 137 |
| 41 | 3300025908 | Ga0207643_10155169 | Ga0207643_101551693 | 137 |
| 42 | 3300025918 | Ga0207662_10037290 | Ga0207662_100372901 | 137 |
| 43 | 3300025921 | Ga0207652_10385053 | Ga0207652_103850532 | 137 |
| 44 | 3300025921 | Ga0207652_11298054 | Ga0207652_112980541 | 137 |
| 45 | 3300025927 | Ga0207687_10074228 | Ga0207687_100742283 | 137 |
| 46 | 3300025932 | Ga0207690_10287309 | Ga0207690_102873093 | 137 |
| 47 | 3300025934 | Ga0207686_10536650 | Ga0207686_105366501 | 137 |
| 48 | 3300025936 | Ga0207670_10138907 | Ga0207670_101389073 | 137 |
| 49 | 3300025940 | Ga0207691_10286749 | Ga0207691_102867491 | 137 |
| 50 | 3300025944 | Ga0207661_11437002 | Ga0207661_114370021 | 137 |
| 51 | 3300025972 | Ga0207668_10735982 | Ga0207668_107359822 | 137 |
| 52 | 3300025981 | Ga0207640_10479643 | Ga0207640_104796432 | 137 |
| 53 | 3300026067 | Ga0207678_10047028 | Ga0207678_100470284 | 137 |
| 54 | 3300026089 | Ga0207648_10073706 | Ga0207648_100737062 | 137 |
| 55 | 3300026095 | Ga0207676_11211118 | Ga0207676_112111182 | 137 |
| 56 | 3300026118 | Ga0207675_100432322 | Ga0207675_1004323222 | 137 |
| 57 | 3300026121 | Ga0207683_10026990 | Ga0207683_100269905 | 137 |
| 58 | 3300028379 | Ga0268266_10197221 | Ga0268266_101972211 | 137 |
| 59 | 3300028381 | Ga0268264_10133948 | Ga0268264_101339484 | 137 |
| 60 | 3300032002 | Ga0307416_100797759 | Ga0307416_1007977592 | 137 |
| 61 | 3300035115 | Ga0373941_0467729 | Ga0373941_0467729_49_465 | 137 |
| 62 | 3300035691 | Ga0373931_1102134 | Ga0373931_1102134_109_525 | 137 |
| 63 | 3300037466 | Ga0395898_0021778 | Ga0395898_0021778_1143_1559 | 137 |
| 64 | 3300037471 | Ga0395905_0186693 | Ga0395905_0186693_605_1021 | 137 |
| 65 | 3300038443 | Ga0395901_0019363 | Ga0395901_0019363_4508_4924 | 137 |
| 66 | 3300038443 | Ga0395901_1758017 | Ga0395901_1758017_75_491 | 137 |
| 67 | 3300046471 | Ga0495650_0000053 | Ga0495650_0000053_280624_281040 | 137 |
| 68 | 3300046674 | Ga0495588_0343354 | Ga0495588_0343354_152_568 | 137 |
| 69 | 3300047472 | Ga0495686_0689727 | Ga0495686_0689727_79_504 | 137 |
| 70 | 3300048903 | Ga0496100_0396129 | Ga0496100_0396129_299_715 | 137 |
| 71 | 3300048904 | Ga0496101_0029261 | Ga0496101_0029261_3322_3738 | 137 |
| 72 | 3300048904 | Ga0496101_0611504 | Ga0496101_0611504_91_507 | 137 |
| 73 | 3300048905 | Ga0496102_0013835 | Ga0496102_0013835_4305_4721 | 137 |
| 74 | 3300048905 | Ga0496102_0480703 | Ga0496102_0480703_711_1127 | 137 |
| 75 | 3300048906 | Ga0496103_0107501 | Ga0496103_0107501_626_1042 | 137 |
| 76 | 3300048909 | Ga0496106_0086508 | Ga0496106_0086508_68_484 | 137 |
| 77 | 3300048910 | Ga0496107_0053073 | Ga0496107_0053073_465_881 | 137 |
| 78 | 3300048911 | Ga0496108_0847941 | Ga0496108_0847941_291_707 | 137 |
| 79 | 3300048912 | Ga0496109_0080083 | Ga0496109_0080083_1203_1619 | 137 |
| 80 | 3300048913 | Ga0496110_0845407 | Ga0496110_0845407_299_715 | 137 |
| 81 | 3300048914 | Ga0496111_0318860 | Ga0496111_0318860_262_678 | 137 |
| 82 | 3300048915 | Ga0496112_0040461 | Ga0496112_0040461_2621_3037 | 137 |
| 83 | 3300048915 | Ga0496112_0224619 | Ga0496112_0224619_241_657 | 137 |
| 84 | 3300048916 | Ga0496113_0028738 | Ga0496113_0028738_65_481 | 137 |
| 85 | 3300048916 | Ga0496113_0449583 | Ga0496113_0449583_499_915 | 137 |
| 86 | 3300048917 | Ga0496114_0607477 | Ga0496114_0607477_458_874 | 137 |
| 87 | 3300050512 | nmdc:mga0n895_1085036_c1 | nmdc:mga0n895_1085036_c1_10_426 | 137 |
| 88 | 3300050514 | nmdc:mga08x19_978916_c1 | nmdc:mga08x19_978916_c1_70_486 | 137 |
| 89 | 3300053083 | Ga0495655_0048773 | Ga0495655_0048773_528_944 | 137 |
| 90 | 3300000549 | LJQas_1011064 | LJQas_10110642 | 138 |
| 91 | 3300001991 | JGI24743J22301_10097128 | JGI24743J22301_100971282 | 138 |
| 92 | 3300002067 | JGI24735J21928_10131152 | JGI24735J21928_101311522 | 138 |
| 93 | 3300002075 | JGI24738J21930_10089376 | JGI24738J21930_100893762 | 138 |
| 94 | 3300005327 | Ga0070658_10042605 | Ga0070658_100426052 | 138 |
| 95 | 3300005327 | Ga0070658_10297396 | Ga0070658_102973962 | 138 |
| 96 | 3300005329 | Ga0070683_100047029 | Ga0070683_1000470293 | 138 |
| 97 | 3300005329 | Ga0070683_100205873 | Ga0070683_1002058732 | 138 |
| 98 | 3300005329 | Ga0070683_100241392 | Ga0070683_1002413922 | 138 |
| 99 | 3300005329 | Ga0070683_101382764 | Ga0070683_1013827642 | 138 |
| 100 | 3300005331 | Ga0070670_100021832 | Ga0070670_1000218326 | 138 |
| 101 | 3300005334 | Ga0068869_100351431 | Ga0068869_1003514311 | 138 |
| 102 | 3300005334 | Ga0068869_100356138 | Ga0068869_1003561382 | 138 |
| 103 | 3300005334 | Ga0068869_100681778 | Ga0068869_1006817781 | 138 |
| 104 | 3300005336 | Ga0070680_100198605 | Ga0070680_1001986053 | 138 |
| 105 | 3300005337 | Ga0070682_100032367 | Ga0070682_1000323672 | 138 |
| 106 | 3300005337 | Ga0070682_101389634 | Ga0070682_1013896341 | 138 |
| 107 | 3300005338 | Ga0068868_100236685 | Ga0068868_1002366852 | 138 |
| 108 | 3300005338 | Ga0068868_100324923 | Ga0068868_1003249233 | 138 |
| 109 | 3300005338 | Ga0068868_100620307 | Ga0068868_1006203072 | 138 |
| 110 | 3300005339 | Ga0070660_100002077 | Ga0070660_1000020773 | 138 |
| 111 | 3300005339 | Ga0070660_100009618 | Ga0070660_1000096188 | 138 |
| 112 | 3300005339 | Ga0070660_100511027 | Ga0070660_1005110272 | 138 |
| 113 | 3300005344 | Ga0070661_100016519 | Ga0070661_1000165191 | 138 |
| 114 | 3300005344 | Ga0070661_101249890 | Ga0070661_1012498901 | 138 |
| 115 | 3300005345 | Ga0070692_10001942 | Ga0070692_100019427 | 138 |
| 116 | 3300005345 | Ga0070692_10027075 | Ga0070692_100270751 | 138 |
| 117 | 3300005347 | Ga0070668_100112766 | Ga0070668_1001127662 | 138 |
| 118 | 3300005347 | Ga0070668_100149824 | Ga0070668_1001498242 | 138 |
| 119 | 3300005353 | Ga0070669_100314808 | Ga0070669_1003148082 | 138 |
| 120 | 3300005354 | Ga0070675_100184136 | Ga0070675_1001841362 | 138 |
| 121 | 3300005354 | Ga0070675_101073403 | Ga0070675_1010734032 | 138 |
| 122 | 3300005356 | Ga0070674_100021654 | Ga0070674_1000216545 | 138 |
| 123 | 3300005364 | Ga0070673_100171894 | Ga0070673_1001718943 | 138 |
| 124 | 3300005365 | Ga0070688_100148159 | Ga0070688_1001481592 | 138 |
| 125 | 3300005366 | Ga0070659_100000051 | Ga0070659_10000005117 | 138 |
| 126 | 3300005366 | Ga0070659_100009171 | Ga0070659_1000091713 | 138 |
| 127 | 3300005435 | Ga0070714_100235963 | Ga0070714_1002359632 | 138 |
| 128 | 3300005436 | Ga0070713_100122520 | Ga0070713_1001225202 | 138 |
| 129 | 3300005438 | Ga0070701_10126534 | Ga0070701_101265343 | 138 |
| 130 | 3300005438 | Ga0070701_10161515 | Ga0070701_101615152 | 138 |
| 131 | 3300005438 | Ga0070701_10423234 | Ga0070701_104232342 | 138 |
| 132 | 3300005441 | Ga0070700_100030018 | Ga0070700_1000300185 | 138 |
| 133 | 3300005441 | Ga0070700_100063360 | Ga0070700_1000633603 | 138 |
| 134 | 3300005441 | Ga0070700_101932304 | Ga0070700_1019323041 | 138 |
| 135 | 3300005455 | Ga0070663_100041109 | Ga0070663_1000411092 | 138 |
| 136 | 3300005457 | Ga0070662_100008536 | Ga0070662_1000085366 | 138 |
| 137 | 3300005458 | Ga0070681_10748227 | Ga0070681_107482272 | 138 |
| 138 | 3300005459 | Ga0068867_100050141 | Ga0068867_1000501412 | 138 |
| 139 | 3300005466 | Ga0070685_10143495 | Ga0070685_101434953 | 138 |
| 140 | 3300005530 | Ga0070679_100132456 | Ga0070679_1001324563 | 138 |
| 141 | 3300005535 | Ga0070684_100015111 | Ga0070684_1000151115 | 138 |
| 142 | 3300005535 | Ga0070684_100222054 | Ga0070684_1002220543 | 138 |
| 143 | 3300005539 | Ga0068853_100769096 | Ga0068853_1007690961 | 138 |
| 144 | 3300005543 | Ga0070672_100025741 | Ga0070672_1000257415 | 138 |
| 145 | 3300005544 | Ga0070686_100198158 | Ga0070686_1001981582 | 138 |
| 146 | 3300005546 | Ga0070696_100203014 | Ga0070696_1002030142 | 138 |
| 147 | 3300005547 | Ga0070693_100067701 | Ga0070693_1000677013 | 138 |
| 148 | 3300005564 | Ga0070664_100011227 | Ga0070664_1000112272 | 138 |
| 149 | 3300005564 | Ga0070664_100089256 | Ga0070664_1000892564 | 138 |
| 150 | 3300005578 | Ga0068854_100208098 | Ga0068854_1002080983 | 138 |
| 151 | 3300005615 | Ga0070702_100614531 | Ga0070702_1006145312 | 138 |
| 152 | 3300005617 | Ga0068859_100039669 | Ga0068859_1000396697 | 138 |
| 153 | 3300005618 | Ga0068864_100673657 | Ga0068864_1006736572 | 138 |
| 154 | 3300005719 | Ga0068861_100252453 | Ga0068861_1002524532 | 138 |
| 155 | 3300005834 | Ga0068851_10498430 | Ga0068851_104984302 | 138 |
| 156 | 3300005840 | Ga0068870_10035752 | Ga0068870_100357523 | 138 |
| 157 | 3300005840 | Ga0068870_10538826 | Ga0068870_105388262 | 138 |
| 158 | 3300005842 | Ga0068858_100211195 | Ga0068858_1002111953 | 138 |
| 159 | 3300005937 | Ga0081455_10551628 | Ga0081455_105516281 | 138 |
| 160 | 3300005983 | Ga0081540_1126892 | Ga0081540_11268921 | 138 |
| 161 | 3300006028 | Ga0070717_10024989 | Ga0070717_100249894 | 138 |
| 162 | 3300006038 | Ga0075365_10044157 | Ga0075365_100441574 | 138 |
| 163 | 3300006038 | Ga0075365_10046863 | Ga0075365_100468632 | 138 |
| 164 | 3300006048 | Ga0075363_100020772 | Ga0075363_1000207725 | 138 |
| 165 | 3300006051 | Ga0075364_10016188 | Ga0075364_100161885 | 138 |
| 166 | 3300006051 | Ga0075364_10175443 | Ga0075364_101754433 | 138 |
| 167 | 3300006051 | Ga0075364_10200801 | Ga0075364_102008012 | 138 |
| 168 | 3300006051 | Ga0075364_10445662 | Ga0075364_104456622 | 138 |
| 169 | 3300006175 | Ga0070712_100883404 | Ga0070712_1008834042 | 138 |
| 170 | 3300006178 | Ga0075367_10061809 | Ga0075367_100618093 | 138 |
| 171 | 3300006178 | Ga0075367_10269922 | Ga0075367_102699222 | 138 |
| 172 | 3300006844 | Ga0075428_101367392 | Ga0075428_1013673922 | 138 |
| 173 | 3300006844 | Ga0075428_101490690 | Ga0075428_1014906902 | 138 |
| 174 | 3300006871 | Ga0075434_100432270 | Ga0075434_1004322703 | 138 |
| 175 | 3300006880 | Ga0075429_100069997 | Ga0075429_1000699972 | 138 |
| 176 | 3300006881 | Ga0068865_100008559 | Ga0068865_1000085592 | 138 |
| 177 | 3300006931 | Ga0097620_100039672 | Ga0097620_1000396727 | 138 |
| 178 | 3300009094 | Ga0111539_10081111 | Ga0111539_100811115 | 138 |
| 179 | 3300009094 | Ga0111539_10223314 | Ga0111539_102233142 | 138 |
| 180 | 3300009094 | Ga0111539_11609505 | Ga0111539_116095051 | 138 |
| 181 | 3300009098 | Ga0105245_10155160 | Ga0105245_101551603 | 138 |
| 182 | 3300009148 | Ga0105243_10006380 | Ga0105243_100063805 | 138 |
| 183 | 3300009174 | Ga0105241_11083928 | Ga0105241_110839282 | 138 |
| 184 | 3300009551 | Ga0105238_10114853 | Ga0105238_101148533 | 138 |
| 185 | 3300009553 | Ga0105249_10045832 | Ga0105249_100458322 | 138 |
| 186 | 3300010375 | Ga0105239_10053648 | Ga0105239_100536483 | 138 |
| 187 | 3300011119 | Ga0105246_10663679 | Ga0105246_106636792 | 138 |
| 188 | 3300013296 | Ga0157374_10335622 | Ga0157374_103356223 | 138 |
| 189 | 3300013306 | Ga0163162_10224868 | Ga0163162_102248683 | 138 |
| 190 | 3300013308 | Ga0157375_10218274 | Ga0157375_102182743 | 138 |
| 191 | 3300013308 | Ga0157375_11822847 | Ga0157375_118228471 | 138 |
| 192 | 3300014326 | Ga0157380_10530144 | Ga0157380_105301442 | 138 |
| 193 | 3300014326 | Ga0157380_11853547 | Ga0157380_118535472 | 138 |
| 194 | 3300014745 | Ga0157377_10011798 | Ga0157377_100117984 | 138 |
| 195 | 3300014968 | Ga0157379_10592601 | Ga0157379_105926012 | 138 |
| 196 | 3300017792 | Ga0163161_10515644 | Ga0163161_105156442 | 138 |
| 197 | 3300021388 | Ga0213875_10181444 | Ga0213875_101814442 | 138 |
| 198 | 3300025321 | Ga0207656_10129913 | Ga0207656_101299132 | 138 |
| 199 | 3300025901 | Ga0207688_10097685 | Ga0207688_100976852 | 138 |
| 200 | 3300025908 | Ga0207643_10045359 | Ga0207643_100453592 | 138 |
| 201 | 3300025909 | Ga0207705_10015308 | Ga0207705_100153086 | 138 |
| 202 | 3300025909 | Ga0207705_10229382 | Ga0207705_102293822 | 138 |
| 203 | 3300025911 | Ga0207654_10857775 | Ga0207654_108577752 | 138 |
| 204 | 3300025912 | Ga0207707_10906610 | Ga0207707_109066102 | 138 |
| 205 | 3300025915 | Ga0207693_10855562 | Ga0207693_108555622 | 138 |
| 206 | 3300025917 | Ga0207660_10585568 | Ga0207660_105855682 | 138 |
| 207 | 3300025919 | Ga0207657_10006150 | Ga0207657_1000615010 | 138 |
| 208 | 3300025919 | Ga0207657_10013240 | Ga0207657_1001324010 | 138 |
| 209 | 3300025919 | Ga0207657_10411720 | Ga0207657_104117202 | 138 |
| 210 | 3300025920 | Ga0207649_10036301 | Ga0207649_100363012 | 138 |
| 211 | 3300025921 | Ga0207652_10039125 | Ga0207652_100391252 | 138 |
| 212 | 3300025923 | Ga0207681_10165208 | Ga0207681_101652082 | 138 |
| 213 | 3300025924 | Ga0207694_10072598 | Ga0207694_100725982 | 138 |
| 214 | 3300025926 | Ga0207659_10135601 | Ga0207659_101356013 | 138 |
| 215 | 3300025928 | Ga0207700_10335382 | Ga0207700_103353822 | 138 |
| 216 | 3300025929 | Ga0207664_10001411 | Ga0207664_1000141111 | 138 |
| 217 | 3300025932 | Ga0207690_10430343 | Ga0207690_104303432 | 138 |
| 218 | 3300025932 | Ga0207690_11180371 | Ga0207690_111803712 | 138 |
| 219 | 3300025933 | Ga0207706_10029844 | Ga0207706_100298442 | 138 |
| 220 | 3300025935 | Ga0207709_10533339 | Ga0207709_105333392 | 138 |
| 221 | 3300025936 | Ga0207670_10203452 | Ga0207670_102034522 | 138 |
| 222 | 3300025937 | Ga0207669_10012356 | Ga0207669_100123566 | 138 |
| 223 | 3300025940 | Ga0207691_10013227 | Ga0207691_100132276 | 138 |
| 224 | 3300025940 | Ga0207691_11605624 | Ga0207691_116056242 | 138 |
| 225 | 3300025942 | Ga0207689_10516277 | Ga0207689_105162772 | 138 |
| 226 | 3300025944 | Ga0207661_10201853 | Ga0207661_102018532 | 138 |
| 227 | 3300025944 | Ga0207661_10323914 | Ga0207661_103239142 | 138 |
| 228 | 3300025944 | Ga0207661_10595514 | Ga0207661_105955142 | 138 |
| 229 | 3300025944 | Ga0207661_11687359 | Ga0207661_116873592 | 138 |
| 230 | 3300025945 | Ga0207679_10213296 | Ga0207679_102132962 | 138 |
| 231 | 3300025945 | Ga0207679_10244736 | Ga0207679_102447362 | 138 |
| 232 | 3300025945 | Ga0207679_11219163 | Ga0207679_112191632 | 138 |
| 233 | 3300025960 | Ga0207651_10210280 | Ga0207651_102102803 | 138 |
| 234 | 3300025981 | Ga0207640_10192376 | Ga0207640_101923763 | 138 |
| 235 | 3300026023 | Ga0207677_10144987 | Ga0207677_101449872 | 138 |
| 236 | 3300026023 | Ga0207677_10341196 | Ga0207677_103411962 | 138 |
| 237 | 3300026023 | Ga0207677_10581092 | Ga0207677_105810922 | 138 |
| 238 | 3300026023 | Ga0207677_10751288 | Ga0207677_107512881 | 138 |
| 239 | 3300026041 | Ga0207639_10741133 | Ga0207639_107411332 | 138 |
| 240 | 3300026067 | Ga0207678_10001328 | Ga0207678_1000132818 | 138 |
| 241 | 3300026067 | Ga0207678_11634229 | Ga0207678_116342292 | 138 |
| 242 | 3300026075 | Ga0207708_10249088 | Ga0207708_102490882 | 138 |
| 243 | 3300026089 | Ga0207648_10068357 | Ga0207648_100683574 | 138 |
| 244 | 3300026118 | Ga0207675_100323396 | Ga0207675_1003233962 | 138 |
| 245 | 3300026118 | Ga0207675_100874894 | Ga0207675_1008748942 | 138 |
| 246 | 3300026121 | Ga0207683_11446571 | Ga0207683_114465711 | 138 |
| 247 | 3300027907 | Ga0207428_10206663 | Ga0207428_102066633 | 138 |
| 248 | 3300028379 | Ga0268266_10033402 | Ga0268266_100334025 | 138 |
| 249 | 3300028379 | Ga0268266_11613944 | Ga0268266_116139442 | 138 |
| 250 | 3300028381 | Ga0268264_10780218 | Ga0268264_107802181 | 138 |
| 251 | 3300031548 | Ga0307408_101075719 | Ga0307408_1010757191 | 138 |
| 252 | 3300031731 | Ga0307405_10557817 | Ga0307405_105578171 | 138 |
| 253 | 3300031903 | Ga0307407_10711896 | Ga0307407_107118961 | 138 |
| 254 | 3300031995 | Ga0307409_100039378 | Ga0307409_1000393783 | 138 |
| 255 | 3300032002 | Ga0307416_100424452 | Ga0307416_1004244522 | 138 |
| 256 | 3300032126 | Ga0307415_100205028 | Ga0307415_1002050282 | 138 |
| 257 | 3300035398 | Ga0316574_0073131 | Ga0316574_0073131_205_624 | 138 |
| 258 | 3300036647 | Ga0316582_0238719 | Ga0316582_0238719_461_880 | 138 |
| 259 | 3300037588 | Ga0316581_0214286 | Ga0316581_0214286_10_429 | 138 |
| 260 | 3300037853 | Ga0436364_1372536 | Ga0436364_1372536_534_953 | 138 |
| 261 | 3300038443 | Ga0395901_1063397 | Ga0395901_1063397_280_699 | 138 |
| 262 | 3300041459 | Ga0451800_1619457 | Ga0451800_1619457_35_454 | 138 |
| 263 | 3300041491 | Ga0451833_0916368 | Ga0451833_0916368_430_849 | 138 |
| 264 | 3300041512 | Ga0451853_1043671 | Ga0451853_1043671_53_472 | 138 |
| 265 | 3300042461 | Ga0439460_0183014 | Ga0439460_0183014_91_510 | 138 |
| 266 | 3300044656 | Ga0466969_0223196 | Ga0466969_0223196_310_729 | 138 |
| 267 | 3300044693 | Ga0466961_0004704 | Ga0466961_0004704_905_1324 | 138 |
| 268 | 3300044693 | Ga0466961_0207612 | Ga0466961_0207612_708_1127 | 138 |
| 269 | 3300044694 | Ga0466963_0013255 | Ga0466963_0013255_4378_4797 | 138 |
| 270 | 3300044694 | Ga0466963_0065596 | Ga0466963_0065596_1791_2210 | 138 |
| 271 | 3300044694 | Ga0466963_0269254 | Ga0466963_0269254_319_738 | 138 |
| 272 | 3300044694 | Ga0466963_0366966 | Ga0466963_0366966_421_840 | 138 |
| 273 | 3300044694 | Ga0466963_0438048 | Ga0466963_0438048_415_834 | 138 |
| 274 | 3300044694 | Ga0466963_0985236 | Ga0466963_0985236_60_479 | 138 |
| 275 | 3300044712 | Ga0453684_0194694 | Ga0453684_0194694_1154_1573 | 138 |
| 276 | 3300044719 | Ga0466971_0005233 | Ga0466971_0005233_2536_2955 | 138 |
| 277 | 3300044719 | Ga0466971_0203027 | Ga0466971_0203027_354_773 | 138 |
| 278 | 3300044842 | Ga0466957_0005549 | Ga0466957_0005549_4779_5198 | 138 |
| 279 | 3300044842 | Ga0466957_0080081 | Ga0466957_0080081_1432_1851 | 138 |
| 280 | 3300044842 | Ga0466957_0169457 | Ga0466957_0169457_881_1300 | 138 |
| 281 | 3300044842 | Ga0466957_0741153 | Ga0466957_0741153_212_631 | 138 |
| 282 | 3300044901 | Ga0466960_0454690 | Ga0466960_0454690_70_489 | 138 |
| 283 | 3300044901 | Ga0466960_0830518 | Ga0466960_0830518_28_450 | 138 |
| 284 | 3300045049 | Ga0466959_0018317 | Ga0466959_0018317_411_830 | 138 |
| 285 | 3300045049 | Ga0466959_0054464 | Ga0466959_0054464_2392_2811 | 138 |
| 286 | 3300045836 | Ga0466958_0011629 | Ga0466958_0011629_4101_4520 | 138 |
| 287 | 3300045836 | Ga0466958_0023271 | Ga0466958_0023271_318_737 | 138 |
| 288 | 3300045836 | Ga0466958_0177414 | Ga0466958_0177414_236_655 | 138 |
| 289 | 3300045836 | Ga0466958_0954554 | Ga0466958_0954554_84_503 | 138 |
| 290 | 3300045976 | Ga0466967_0004705 | Ga0466967_0004705_7630_8049 | 138 |
| 291 | 3300045976 | Ga0466967_0080963 | Ga0466967_0080963_2249_2668 | 138 |
| 292 | 3300045976 | Ga0466967_0331438 | Ga0466967_0331438_753_1172 | 138 |
| 293 | 3300045976 | Ga0466967_0489296 | Ga0466967_0489296_497_916 | 138 |
| 294 | 3300045976 | Ga0466967_0498869 | Ga0466967_0498869_385_804 | 138 |
| 295 | 3300045976 | Ga0466967_0791826 | Ga0466967_0791826_211_630 | 138 |
| 296 | 3300045976 | Ga0466967_1787722 | Ga0466967_1787722_162_581 | 138 |
| 297 | 3300046461 | Ga0495641_0488691 | Ga0495641_0488691_23_442 | 138 |
| 298 | 3300046517 | Ga0495630_0000020 | Ga0495630_0000020_132442_132861 | 138 |
| 299 | 3300048903 | Ga0496100_0590180 | Ga0496100_0590180_327_746 | 138 |
| 300 | 3300048905 | Ga0496102_0319883 | Ga0496102_0319883_116_535 | 138 |
| 301 | 3300048909 | Ga0496106_0063292 | Ga0496106_0063292_51_470 | 138 |
| 302 | 3300048910 | Ga0496107_0908657 | Ga0496107_0908657_52_471 | 138 |
| 303 | 3300048911 | Ga0496108_0026006 | Ga0496108_0026006_3918_4337 | 138 |
| 304 | 3300048912 | Ga0496109_0032131 | Ga0496109_0032131_3868_4287 | 138 |
| 305 | 3300048912 | Ga0496109_0117167 | Ga0496109_0117167_1217_1636 | 138 |
| 306 | 3300048912 | Ga0496109_1167737 | Ga0496109_1167737_89_508 | 138 |
| 307 | 3300048913 | Ga0496110_0070834 | Ga0496110_0070834_2344_2763 | 138 |
| 308 | 3300048914 | Ga0496111_0036409 | Ga0496111_0036409_2806_3225 | 138 |
| 309 | 3300048914 | Ga0496111_0204695 | Ga0496111_0204695_511_930 | 138 |
| 310 | 3300048915 | Ga0496112_0004480 | Ga0496112_0004480_3737_4156 | 138 |
| 311 | 3300048916 | Ga0496113_0017293 | Ga0496113_0017293_2520_2939 | 138 |
| 312 | 3300048924 | Ga0496121_0079589 | Ga0496121_0079589_1608_2027 | 138 |
| 313 | 3300049582 | Ga0501048_0118322 | Ga0501048_0118322_936_1355 | 138 |
| 314 | 3300049588 | Ga0501072_0637491 | Ga0501072_0637491_407_826 | 138 |
| 315 | 3300050490 | nmdc:mga03n38_231540_c1 | nmdc:mga03n38_231540_c1_493_912 | 138 |
| 316 | 3300050491 | nmdc:mga00v17_175309_c1 | nmdc:mga00v17_175309_c1_516_935 | 138 |
| 317 | 3300050491 | nmdc:mga00v17_177348_c1 | nmdc:mga00v17_177348_c1_583_1002 | 138 |
| 318 | 3300050491 | nmdc:mga00v17_189584_c1 | nmdc:mga00v17_189584_c1_897_1316 | 138 |
| 319 | 3300050492 | nmdc:mga0yw44_2043_c2 | nmdc:mga0yw44_2043_c2_2315_2734 | 138 |
| 320 | 3300050492 | nmdc:mga0yw44_95271_c1 | nmdc:mga0yw44_95271_c1_425_844 | 138 |
| 321 | 3300050494 | nmdc:mga06z11_44670_c1 | nmdc:mga06z11_44670_c1_1301_1720 | 138 |
| 322 | 3300050494 | nmdc:mga06z11_551729_c1 | nmdc:mga06z11_551729_c1_97_516 | 138 |
| 323 | 3300050508 | nmdc:mga09592_11930_c1 | nmdc:mga09592_11930_c1_5873_6292 | 138 |
| 324 | 3300050510 | nmdc:mga06r32_30770_c1 | nmdc:mga06r32_30770_c1_2778_3197 | 138 |
| 325 | 3300050511 | nmdc:mga08y16_69212_c1 | nmdc:mga08y16_69212_c1_465_884 | 138 |
| 326 | 3300050511 | nmdc:mga08y16_868032_c1 | nmdc:mga08y16_868032_c1_396_815 | 138 |
| 327 | 3300061719 | Ga0466962_0026617 | Ga0466962_0026617_207_626 | 138 |
| 328 | 3300061719 | Ga0466962_0035984 | Ga0466962_0035984_519_938 | 138 |
| 329 | 3300061719 | Ga0466962_0181769 | Ga0466962_0181769_318_737 | 138 |
| 330 | 3300061719 | Ga0466962_0736130 | Ga0466962_0736130_48_467 | 138 |
| 331 | 3300001991 | JGI24743J22301_10057169 | JGI24743J22301_100571691 | 139 |
| 332 | 3300002075 | JGI24738J21930_10051752 | JGI24738J21930_100517522 | 139 |
| 333 | 3300003203 | JGI25406J46586_10014524 | JGI25406J46586_100145244 | 139 |
| 334 | 3300005329 | Ga0070683_100101038 | Ga0070683_1001010382 | 139 |
| 335 | 3300005334 | Ga0068869_100338910 | Ga0068869_1003389102 | 139 |
| 336 | 3300005336 | Ga0070680_100572141 | Ga0070680_1005721412 | 139 |
| 337 | 3300005337 | Ga0070682_100028386 | Ga0070682_1000283864 | 139 |
| 338 | 3300005338 | Ga0068868_100092207 | Ga0068868_1000922073 | 139 |
| 339 | 3300005341 | Ga0070691_10212994 | Ga0070691_102129943 | 139 |
| 340 | 3300005344 | Ga0070661_100054871 | Ga0070661_1000548713 | 139 |
| 341 | 3300005353 | Ga0070669_101064725 | Ga0070669_1010647251 | 139 |
| 342 | 3300005354 | Ga0070675_100039559 | Ga0070675_1000395593 | 139 |
| 343 | 3300005355 | Ga0070671_100038372 | Ga0070671_1000383722 | 139 |
| 344 | 3300005356 | Ga0070674_100422521 | Ga0070674_1004225212 | 139 |
| 345 | 3300005364 | Ga0070673_100035079 | Ga0070673_1000350794 | 139 |
| 346 | 3300005365 | Ga0070688_100149331 | Ga0070688_1001493312 | 139 |
| 347 | 3300005366 | Ga0070659_100119855 | Ga0070659_1001198552 | 139 |
| 348 | 3300005367 | Ga0070667_100263872 | Ga0070667_1002638722 | 139 |
| 349 | 3300005438 | Ga0070701_10103993 | Ga0070701_101039932 | 139 |
| 350 | 3300005438 | Ga0070701_10264338 | Ga0070701_102643383 | 139 |
| 351 | 3300005441 | Ga0070700_100001146 | Ga0070700_1000011469 | 139 |
| 352 | 3300005444 | Ga0070694_100249074 | Ga0070694_1002490742 | 139 |
| 353 | 3300005455 | Ga0070663_100108647 | Ga0070663_1001086472 | 139 |
| 354 | 3300005457 | Ga0070662_100197330 | Ga0070662_1001973302 | 139 |
| 355 | 3300005459 | Ga0068867_100182406 | Ga0068867_1001824063 | 139 |
| 356 | 3300005466 | Ga0070685_10043544 | Ga0070685_100435444 | 139 |
| 357 | 3300005535 | Ga0070684_100010940 | Ga0070684_10001094010 | 139 |
| 358 | 3300005535 | Ga0070684_101588502 | Ga0070684_1015885021 | 139 |
| 359 | 3300005543 | Ga0070672_100316098 | Ga0070672_1003160982 | 139 |
| 360 | 3300005544 | Ga0070686_100091723 | Ga0070686_1000917234 | 139 |
| 361 | 3300005546 | Ga0070696_100596907 | Ga0070696_1005969072 | 139 |
| 362 | 3300005546 | Ga0070696_101073228 | Ga0070696_1010732282 | 139 |
| 363 | 3300005547 | Ga0070693_100446279 | Ga0070693_1004462792 | 139 |
| 364 | 3300005548 | Ga0070665_100410840 | Ga0070665_1004108402 | 139 |
| 365 | 3300005549 | Ga0070704_100433691 | Ga0070704_1004336912 | 139 |
| 366 | 3300005563 | Ga0068855_100085845 | Ga0068855_1000858456 | 139 |
| 367 | 3300005577 | Ga0068857_100221353 | Ga0068857_1002213533 | 139 |
| 368 | 3300005578 | Ga0068854_100016779 | Ga0068854_1000167796 | 139 |
| 369 | 3300005578 | Ga0068854_100137525 | Ga0068854_1001375251 | 139 |
| 370 | 3300005578 | Ga0068854_100339119 | Ga0068854_1003391192 | 139 |
| 371 | 3300005614 | Ga0068856_100103144 | Ga0068856_1001031443 | 139 |
| 372 | 3300005615 | Ga0070702_100008205 | Ga0070702_1000082057 | 139 |
| 373 | 3300005615 | Ga0070702_100074794 | Ga0070702_1000747941 | 139 |
| 374 | 3300005616 | Ga0068852_100057753 | Ga0068852_1000577533 | 139 |
| 375 | 3300005617 | Ga0068859_100421512 | Ga0068859_1004215122 | 139 |
| 376 | 3300005618 | Ga0068864_100043380 | Ga0068864_1000433803 | 139 |
| 377 | 3300005618 | Ga0068864_100181624 | Ga0068864_1001816242 | 139 |
| 378 | 3300005718 | Ga0068866_10124895 | Ga0068866_101248952 | 139 |
| 379 | 3300005718 | Ga0068866_10398397 | Ga0068866_103983972 | 139 |
| 380 | 3300005719 | Ga0068861_100082055 | Ga0068861_1000820555 | 139 |
| 381 | 3300005719 | Ga0068861_100724284 | Ga0068861_1007242842 | 139 |
| 382 | 3300005719 | Ga0068861_100836486 | Ga0068861_1008364862 | 139 |
| 383 | 3300005719 | Ga0068861_100952141 | Ga0068861_1009521411 | 139 |
| 384 | 3300005842 | Ga0068858_100169993 | Ga0068858_1001699932 | 139 |
| 385 | 3300005844 | Ga0068862_100327409 | Ga0068862_1003274092 | 139 |
| 386 | 3300005981 | Ga0081538_10131903 | Ga0081538_101319032 | 139 |
| 387 | 3300005985 | Ga0081539_10003976 | Ga0081539_1000397620 | 139 |
| 388 | 3300006175 | Ga0070712_100061563 | Ga0070712_1000615633 | 139 |
| 389 | 3300006844 | Ga0075428_100044308 | Ga0075428_1000443081 | 139 |
| 390 | 3300006844 | Ga0075428_100483260 | Ga0075428_1004832602 | 139 |
| 391 | 3300006852 | Ga0075433_10051223 | Ga0075433_100512234 | 139 |
| 392 | 3300006871 | Ga0075434_100190087 | Ga0075434_1001900872 | 139 |
| 393 | 3300006871 | Ga0075434_101051440 | Ga0075434_1010514401 | 139 |
| 394 | 3300006880 | Ga0075429_100585398 | Ga0075429_1005853982 | 139 |
| 395 | 3300006881 | Ga0068865_100036684 | Ga0068865_1000366842 | 139 |
| 396 | 3300006914 | Ga0075436_100007266 | Ga0075436_1000072669 | 139 |
| 397 | 3300006931 | Ga0097620_100421453 | Ga0097620_1004214532 | 139 |
| 398 | 3300007076 | Ga0075435_100042083 | Ga0075435_1000420832 | 139 |
| 399 | 3300009094 | Ga0111539_10050474 | Ga0111539_100504745 | 139 |
| 400 | 3300009094 | Ga0111539_10099745 | Ga0111539_100997455 | 139 |
| 401 | 3300009094 | Ga0111539_10220435 | Ga0111539_102204353 | 139 |
| 402 | 3300009098 | Ga0105245_10001037 | Ga0105245_1000103712 | 139 |
| 403 | 3300009098 | Ga0105245_10540187 | Ga0105245_105401871 | 139 |
| 404 | 3300009101 | Ga0105247_10126407 | Ga0105247_101264073 | 139 |
| 405 | 3300009147 | Ga0114129_10093825 | Ga0114129_100938253 | 139 |
| 406 | 3300009147 | Ga0114129_10240888 | Ga0114129_102408882 | 139 |
| 407 | 3300009147 | Ga0114129_10244692 | Ga0114129_102446922 | 139 |
| 408 | 3300009147 | Ga0114129_10751474 | Ga0114129_107514742 | 139 |
| 409 | 3300009147 | Ga0114129_12514213 | Ga0114129_125142131 | 139 |
| 410 | 3300009148 | Ga0105243_10027186 | Ga0105243_100271864 | 139 |
| 411 | 3300009148 | Ga0105243_10280762 | Ga0105243_102807622 | 139 |
| 412 | 3300009148 | Ga0105243_12182703 | Ga0105243_121827031 | 139 |
| 413 | 3300009176 | Ga0105242_10000756 | Ga0105242_1000075613 | 139 |
| 414 | 3300009176 | Ga0105242_10048984 | Ga0105242_100489842 | 139 |
| 415 | 3300009176 | Ga0105242_10853871 | Ga0105242_108538712 | 139 |
| 416 | 3300009176 | Ga0105242_13137574 | Ga0105242_131375741 | 139 |
| 417 | 3300009545 | Ga0105237_11692488 | Ga0105237_116924882 | 139 |
| 418 | 3300009551 | Ga0105238_12381915 | Ga0105238_123819152 | 139 |
| 419 | 3300010375 | Ga0105239_10007908 | Ga0105239_100079083 | 139 |
| 420 | 3300011119 | Ga0105246_10034379 | Ga0105246_100343794 | 139 |
| 421 | 3300011119 | Ga0105246_10094870 | Ga0105246_100948703 | 139 |
| 422 | 3300013105 | Ga0157369_10242289 | Ga0157369_102422893 | 139 |
| 423 | 3300013296 | Ga0157374_10056528 | Ga0157374_100565284 | 139 |
| 424 | 3300013307 | Ga0157372_10353584 | Ga0157372_103535842 | 139 |
| 425 | 3300013308 | Ga0157375_10044794 | Ga0157375_100447946 | 139 |
| 426 | 3300013308 | Ga0157375_10396597 | Ga0157375_103965973 | 139 |
| 427 | 3300014326 | Ga0157380_11636956 | Ga0157380_116369561 | 139 |
| 428 | 3300014745 | Ga0157377_10000243 | Ga0157377_1000024312 | 139 |
| 429 | 3300014968 | Ga0157379_10479740 | Ga0157379_104797403 | 139 |
| 430 | 3300025899 | Ga0207642_10310195 | Ga0207642_103101952 | 139 |
| 431 | 3300025901 | Ga0207688_10001744 | Ga0207688_100017446 | 139 |
| 432 | 3300025908 | Ga0207643_10469698 | Ga0207643_104696982 | 139 |
| 433 | 3300025917 | Ga0207660_10435925 | Ga0207660_104359252 | 139 |
| 434 | 3300025919 | Ga0207657_11166309 | Ga0207657_111663092 | 139 |
| 435 | 3300025921 | Ga0207652_11180695 | Ga0207652_111806952 | 139 |
| 436 | 3300025923 | Ga0207681_10063338 | Ga0207681_100633382 | 139 |
| 437 | 3300025924 | Ga0207694_10314980 | Ga0207694_103149802 | 139 |
| 438 | 3300025926 | Ga0207659_10549605 | Ga0207659_105496052 | 139 |
| 439 | 3300025927 | Ga0207687_10070881 | Ga0207687_100708814 | 139 |
| 440 | 3300025929 | Ga0207664_11531885 | Ga0207664_115318851 | 139 |
| 441 | 3300025932 | Ga0207690_10046474 | Ga0207690_100464744 | 139 |
| 442 | 3300025933 | Ga0207706_10019718 | Ga0207706_100197187 | 139 |
| 443 | 3300025933 | Ga0207706_10052839 | Ga0207706_100528394 | 139 |
| 444 | 3300025933 | Ga0207706_10180759 | Ga0207706_101807592 | 139 |
| 445 | 3300025934 | Ga0207686_10001027 | Ga0207686_100010272 | 139 |
| 446 | 3300025934 | Ga0207686_10207069 | Ga0207686_102070692 | 139 |
| 447 | 3300025934 | Ga0207686_10213473 | Ga0207686_102134732 | 139 |
| 448 | 3300025935 | Ga0207709_10074278 | Ga0207709_100742784 | 139 |
| 449 | 3300025937 | Ga0207669_10459763 | Ga0207669_104597632 | 139 |
| 450 | 3300025938 | Ga0207704_10172203 | Ga0207704_101722033 | 139 |
| 451 | 3300025940 | Ga0207691_10255159 | Ga0207691_102551592 | 139 |
| 452 | 3300025942 | Ga0207689_10133971 | Ga0207689_101339712 | 139 |
| 453 | 3300025942 | Ga0207689_11185909 | Ga0207689_111859091 | 139 |
| 454 | 3300025942 | Ga0207689_11595433 | Ga0207689_115954331 | 139 |
| 455 | 3300025945 | Ga0207679_10126312 | Ga0207679_101263122 | 139 |
| 456 | 3300025949 | Ga0207667_10456813 | Ga0207667_104568132 | 139 |
| 457 | 3300025961 | Ga0207712_10067426 | Ga0207712_100674264 | 139 |
| 458 | 3300025972 | Ga0207668_10584821 | Ga0207668_105848213 | 139 |
| 459 | 3300025981 | Ga0207640_10152069 | Ga0207640_101520692 | 139 |
| 460 | 3300025981 | Ga0207640_10860749 | Ga0207640_108607492 | 139 |
| 461 | 3300026023 | Ga0207677_10803451 | Ga0207677_108034512 | 139 |
| 462 | 3300026035 | Ga0207703_10636745 | Ga0207703_106367452 | 139 |
| 463 | 3300026067 | Ga0207678_10094513 | Ga0207678_100945133 | 139 |
| 464 | 3300026075 | Ga0207708_10000157 | Ga0207708_1000015716 | 139 |
| 465 | 3300026075 | Ga0207708_10001758 | Ga0207708_1000175818 | 139 |
| 466 | 3300026075 | Ga0207708_10177943 | Ga0207708_101779433 | 139 |
| 467 | 3300026078 | Ga0207702_10088418 | Ga0207702_100884184 | 139 |
| 468 | 3300026088 | Ga0207641_10829429 | Ga0207641_108294292 | 139 |
| 469 | 3300026089 | Ga0207648_10079595 | Ga0207648_100795953 | 139 |
| 470 | 3300026095 | Ga0207676_10054536 | Ga0207676_100545363 | 139 |
| 471 | 3300026095 | Ga0207676_10233620 | Ga0207676_102336203 | 139 |
| 472 | 3300026116 | Ga0207674_10044201 | Ga0207674_100442015 | 139 |
| 473 | 3300026118 | Ga0207675_100062080 | Ga0207675_1000620802 | 139 |
| 474 | 3300026118 | Ga0207675_100090817 | Ga0207675_1000908173 | 139 |
| 475 | 3300026118 | Ga0207675_100122575 | Ga0207675_1001225754 | 139 |
| 476 | 3300026142 | Ga0207698_10018223 | Ga0207698_100182237 | 139 |
| 477 | 3300027907 | Ga0207428_10017745 | Ga0207428_100177456 | 139 |
| 478 | 3300027907 | Ga0207428_10256163 | Ga0207428_102561632 | 139 |
| 479 | 3300028379 | Ga0268266_10244987 | Ga0268266_102449873 | 139 |
| 480 | 3300028380 | Ga0268265_10292873 | Ga0268265_102928732 | 139 |
| 481 | 3300028381 | Ga0268264_10232960 | Ga0268264_102329602 | 139 |
| 482 | 3300028573 | Ga0265334_10140996 | Ga0265334_101409962 | 139 |
| 483 | 3300031852 | Ga0307410_10845217 | Ga0307410_108452172 | 139 |
| 484 | 3300031903 | Ga0307407_10395530 | Ga0307407_103955302 | 139 |
| 485 | 3300031911 | Ga0307412_10703347 | Ga0307412_107033472 | 139 |
| 486 | 3300032002 | Ga0307416_100038250 | Ga0307416_1000382504 | 139 |
| 487 | 3300032005 | Ga0307411_10234766 | Ga0307411_102347663 | 139 |
| 488 | 3300032126 | Ga0307415_100636672 | Ga0307415_1006366722 | 139 |
| 489 | 3300037853 | Ga0436364_0115266 | Ga0436364_0115266_587_1009 | 139 |
| 490 | 3300037853 | Ga0436364_0159150 | Ga0436364_0159150_7314_7772 | 139 |
| 491 | 3300038443 | Ga0395901_0205625 | Ga0395901_0205625_520_942 | 139 |
| 492 | 3300039450 | Ga0436363_1449147 | Ga0436363_1449147_24_455 | 139 |
| 493 | 3300039453 | Ga0436362_0344812 | Ga0436362_0344812_101_523 | 139 |
| 494 | 3300041460 | Ga0451802_0871605 | Ga0451802_0871605_144_566 | 139 |
| 495 | 3300042461 | Ga0439460_0125632 | Ga0439460_0125632_151_573 | 139 |
| 496 | 3300044684 | Ga0466966_0112517 | Ga0466966_0112517_752_1174 | 139 |
| 497 | 3300044684 | Ga0466966_0349418 | Ga0466966_0349418_437_859 | 139 |
| 498 | 3300044693 | Ga0466961_0794879 | Ga0466961_0794879_32_454 | 139 |
| 499 | 3300044694 | Ga0466963_0230379 | Ga0466963_0230379_745_1167 | 139 |
| 500 | 3300044694 | Ga0466963_0351371 | Ga0466963_0351371_441_863 | 139 |
| 501 | 3300044765 | Ga0466970_0812029 | Ga0466970_0812029_58_480 | 139 |
| 502 | 3300044901 | Ga0466960_0000064 | Ga0466960_0000064_25473_25895 | 139 |
| 503 | 3300044901 | Ga0466960_0297199 | Ga0466960_0297199_343_765 | 139 |
| 504 | 3300045049 | Ga0466959_0118442 | Ga0466959_0118442_994_1416 | 139 |
| 505 | 3300045049 | Ga0466959_0984842 | Ga0466959_0984842_13_435 | 139 |
| 506 | 3300045976 | Ga0466967_2275972 | Ga0466967_2275972_27_449 | 139 |
| 507 | 3300046473 | Ga0495582_0544777 | Ga0495582_0544777_137_559 | 139 |
| 508 | 3300046683 | Ga0495658_0217581 | Ga0495658_0217581_650_1072 | 139 |
| 509 | 3300048903 | Ga0496100_0116816 | Ga0496100_0116816_630_1052 | 139 |
| 510 | 3300048903 | Ga0496100_1263026 | Ga0496100_1263026_56_478 | 139 |
| 511 | 3300048904 | Ga0496101_0408568 | Ga0496101_0408568_188_610 | 139 |
| 512 | 3300048905 | Ga0496102_0018938 | Ga0496102_0018938_3657_4079 | 139 |
| 513 | 3300048907 | Ga0496104_0031238 | Ga0496104_0031238_470_892 | 139 |
| 514 | 3300048908 | Ga0496105_0043554 | Ga0496105_0043554_1089_1511 | 139 |
| 515 | 3300048909 | Ga0496106_0026312 | Ga0496106_0026312_35_457 | 139 |
| 516 | 3300048909 | Ga0496106_0072232 | Ga0496106_0072232_880_1302 | 139 |
| 517 | 3300048910 | Ga0496107_0067100 | Ga0496107_0067100_1703_2125 | 139 |
| 518 | 3300048911 | Ga0496108_0000832 | Ga0496108_0000832_10933_11355 | 139 |
| 519 | 3300048911 | Ga0496108_0494064 | Ga0496108_0494064_428_850 | 139 |
| 520 | 3300048912 | Ga0496109_0020937 | Ga0496109_0020937_4643_5065 | 139 |
| 521 | 3300048912 | Ga0496109_1116073 | Ga0496109_1116073_81_503 | 139 |
| 522 | 3300048913 | Ga0496110_0034676 | Ga0496110_0034676_696_1118 | 139 |
| 523 | 3300048914 | Ga0496111_0029976 | Ga0496111_0029976_1013_1435 | 139 |
| 524 | 3300048915 | Ga0496112_0072498 | Ga0496112_0072498_678_1100 | 139 |
| 525 | 3300048916 | Ga0496113_0015578 | Ga0496113_0015578_1055_1477 | 139 |
| 526 | 3300049571 | Ga0501034_0093581 | Ga0501034_0093581_860_1291 | 139 |
| 527 | 3300049579 | Ga0501043_1016887 | Ga0501043_1016887_44_466 | 139 |
| 528 | 3300049581 | Ga0501047_0282569 | Ga0501047_0282569_1060_1482 | 139 |
| 529 | 3300049587 | Ga0501071_0694418 | Ga0501071_0694418_229_648 | 139 |
| 530 | 3300049742 | Ga0501080_1498292 | Ga0501080_1498292_62_484 | 139 |
| 531 | 3300049823 | Ga0501044_0159492 | Ga0501044_0159492_1686_2108 | 139 |
| 532 | 3300050508 | nmdc:mga09592_318697_c1 | nmdc:mga09592_318697_c1_433_855 | 139 |
| 533 | 3300050508 | nmdc:mga09592_773877_c1 | nmdc:mga09592_773877_c1_49_471 | 139 |
| 534 | 3300050511 | nmdc:mga08y16_33168_c1 | nmdc:mga08y16_33168_c1_2754_3176 | 139 |
| 535 | 3300050512 | nmdc:mga0n895_662377_c1 | nmdc:mga0n895_662377_c1_286_708 | 139 |
| 536 | 3300050513 | nmdc:mga0rr50_42833_c1 | nmdc:mga0rr50_42833_c1_529_951 | 139 |
| 537 | 3300050514 | nmdc:mga08x19_268735_c1 | nmdc:mga08x19_268735_c1_296_718 | 139 |
| 538 | 3300050515 | nmdc:mga0a205_121071_c1 | nmdc:mga0a205_121071_c1_242_664 | 139 |
| 539 | 3300005329 | Ga0070683_100324326 | Ga0070683_1003243262 | 140 |
| 540 | 3300005337 | Ga0070682_100000102 | Ga0070682_10000010241 | 140 |
| 541 | 3300005339 | Ga0070660_100607361 | Ga0070660_1006073612 | 140 |
| 542 | 3300005436 | Ga0070713_100446516 | Ga0070713_1004465162 | 140 |
| 543 | 3300005444 | Ga0070694_100301892 | Ga0070694_1003018922 | 140 |
| 544 | 3300005458 | Ga0070681_10014223 | Ga0070681_100142234 | 140 |
| 545 | 3300005530 | Ga0070679_100000537 | Ga0070679_10000053742 | 140 |
| 546 | 3300005544 | Ga0070686_100491311 | Ga0070686_1004913112 | 140 |
| 547 | 3300005549 | Ga0070704_100785468 | Ga0070704_1007854682 | 140 |
| 548 | 3300005563 | Ga0068855_100499475 | Ga0068855_1004994753 | 140 |
| 549 | 3300005616 | Ga0068852_101209325 | Ga0068852_1012093252 | 140 |
| 550 | 3300005841 | Ga0068863_100009331 | Ga0068863_10000933110 | 140 |
| 551 | 3300006028 | Ga0070717_10014762 | Ga0070717_100147625 | 140 |
| 552 | 3300006028 | Ga0070717_10053959 | Ga0070717_100539594 | 140 |
| 553 | 3300006028 | Ga0070717_10783712 | Ga0070717_107837122 | 140 |
| 554 | 3300006038 | Ga0075365_10664162 | Ga0075365_106641622 | 140 |
| 555 | 3300006051 | Ga0075364_10118494 | Ga0075364_101184942 | 140 |
| 556 | 3300009093 | Ga0105240_10750025 | Ga0105240_107500252 | 140 |
| 557 | 3300009147 | Ga0114129_10017653 | Ga0114129_100176538 | 140 |
| 558 | 3300009148 | Ga0105243_10027113 | Ga0105243_100271135 | 140 |
| 559 | 3300009148 | Ga0105243_10414586 | Ga0105243_104145862 | 140 |
| 560 | 3300009176 | Ga0105242_10412249 | Ga0105242_104122492 | 140 |
| 561 | 3300013306 | Ga0163162_11739675 | Ga0163162_117396751 | 140 |
| 562 | 3300014326 | Ga0157380_10166829 | Ga0157380_101668292 | 140 |
| 563 | 3300017792 | Ga0163161_10251371 | Ga0163161_102513712 | 140 |
| 564 | 3300021358 | Ga0213873_10273733 | Ga0213873_102737331 | 140 |
| 565 | 3300021377 | Ga0213874_10003788 | Ga0213874_100037883 | 140 |
| 566 | 3300021384 | Ga0213876_10005606 | Ga0213876_100056066 | 140 |
| 567 | 3300021388 | Ga0213875_10006473 | Ga0213875_100064734 | 140 |
| 568 | 3300021388 | Ga0213875_10009519 | Ga0213875_100095196 | 140 |
| 569 | 3300021388 | Ga0213875_10163890 | Ga0213875_101638902 | 140 |
| 570 | 3300021388 | Ga0213875_10188806 | Ga0213875_101888062 | 140 |
| 571 | 3300021388 | Ga0213875_10214336 | Ga0213875_102143362 | 140 |
| 572 | 3300021388 | Ga0213875_10289573 | Ga0213875_102895732 | 140 |
| 573 | 3300025899 | Ga0207642_10088053 | Ga0207642_100880533 | 140 |
| 574 | 3300025900 | Ga0207710_10024439 | Ga0207710_100244393 | 140 |
| 575 | 3300025912 | Ga0207707_10030725 | Ga0207707_100307255 | 140 |
| 576 | 3300025927 | Ga0207687_10446632 | Ga0207687_104466322 | 140 |
| 577 | 3300025928 | Ga0207700_10654257 | Ga0207700_106542572 | 140 |
| 578 | 3300025929 | Ga0207664_10258904 | Ga0207664_102589042 | 140 |
| 579 | 3300025935 | Ga0207709_10015789 | Ga0207709_100157894 | 140 |
| 580 | 3300025935 | Ga0207709_10104154 | Ga0207709_101041543 | 140 |
| 581 | 3300025937 | Ga0207669_10379461 | Ga0207669_103794611 | 140 |
| 582 | 3300025938 | Ga0207704_10065797 | Ga0207704_100657973 | 140 |
| 583 | 3300025944 | Ga0207661_10153276 | Ga0207661_101532762 | 140 |
| 584 | 3300025949 | Ga0207667_10429440 | Ga0207667_104294402 | 140 |
| 585 | 3300025960 | Ga0207651_10804756 | Ga0207651_108047562 | 140 |
| 586 | 3300025972 | Ga0207668_11375246 | Ga0207668_113752461 | 140 |
| 587 | 3300026023 | Ga0207677_10928959 | Ga0207677_109289592 | 140 |
| 588 | 3300026088 | Ga0207641_10007103 | Ga0207641_100071033 | 140 |
| 589 | 3300026089 | Ga0207648_10158415 | Ga0207648_101584153 | 140 |
| 590 | 3300026142 | Ga0207698_10000013 | Ga0207698_1000001381 | 140 |
| 591 | 3300027907 | Ga0207428_10255028 | Ga0207428_102550282 | 140 |
| 592 | 3300032126 | Ga0307415_100002829 | Ga0307415_1000028297 | 140 |
| 593 | 3300037418 | Ga0395900_0052131 | Ga0395900_0052131_969_1394 | 140 |
| 594 | 3300037466 | Ga0395898_0000894 | Ga0395898_0000894_6656_7081 | 140 |
| 595 | 3300037853 | Ga0436364_0118612 | Ga0436364_0118612_573_998 | 140 |
| 596 | 3300037853 | Ga0436364_0286486 | Ga0436364_0286486_207_632 | 140 |
| 597 | 3300037853 | Ga0436364_0334646 | Ga0436364_0334646_2638_3063 | 140 |
| 598 | 3300037853 | Ga0436364_0503224 | Ga0436364_0503224_329_754 | 140 |
| 599 | 3300037853 | Ga0436364_0810387 | Ga0436364_0810387_235_660 | 140 |
| 600 | 3300037853 | Ga0436364_1245246 | Ga0436364_1245246_3172_3597 | 140 |
| 601 | 3300037853 | Ga0436364_1339551 | Ga0436364_1339551_4398_4823 | 140 |
| 602 | 3300039437 | Ga0436365_0405628 | Ga0436365_0405628_242_667 | 140 |
| 603 | 3300039437 | Ga0436365_1500157 | Ga0436365_1500157_43_468 | 140 |
| 604 | 3300039437 | Ga0436365_1510673 | Ga0436365_1510673_1948_2373 | 140 |
| 605 | 3300039437 | Ga0436365_1811968 | Ga0436365_1811968_14_439 | 140 |
| 606 | 3300039450 | Ga0436363_0294066 | Ga0436363_0294066_439_864 | 140 |
| 607 | 3300039450 | Ga0436363_0550340 | Ga0436363_0550340_111_536 | 140 |
| 608 | 3300039450 | Ga0436363_1608452 | Ga0436363_1608452_552_977 | 140 |
| 609 | 3300039453 | Ga0436362_0400860 | Ga0436362_0400860_1294_1719 | 140 |
| 610 | 3300041443 | Ga0451789_0804322 | Ga0451789_0804322_149_574 | 140 |
| 611 | 3300044693 | Ga0466961_0041318 | Ga0466961_0041318_862_1287 | 140 |
| 612 | 3300044693 | Ga0466961_0525364 | Ga0466961_0525364_154_579 | 140 |
| 613 | 3300044694 | Ga0466963_0051798 | Ga0466963_0051798_1080_1505 | 140 |
| 614 | 3300044694 | Ga0466963_0105953 | Ga0466963_0105953_369_794 | 140 |
| 615 | 3300044694 | Ga0466963_0158205 | Ga0466963_0158205_227_652 | 140 |
| 616 | 3300044719 | Ga0466971_0041424 | Ga0466971_0041424_766_1191 | 140 |
| 617 | 3300044719 | Ga0466971_0106899 | Ga0466971_0106899_88_513 | 140 |
| 618 | 3300044735 | Ga0466968_0070826 | Ga0466968_0070826_780_1205 | 140 |
| 619 | 3300044735 | Ga0466968_0185461 | Ga0466968_0185461_203_628 | 140 |
| 620 | 3300044765 | Ga0466970_0410857 | Ga0466970_0410857_262_687 | 140 |
| 621 | 3300044842 | Ga0466957_0337386 | Ga0466957_0337386_496_921 | 140 |
| 622 | 3300044901 | Ga0466960_0229807 | Ga0466960_0229807_409_834 | 140 |
| 623 | 3300045049 | Ga0466959_0691815 | Ga0466959_0691815_204_629 | 140 |
| 624 | 3300045836 | Ga0466958_0014890 | Ga0466958_0014890_3994_4419 | 140 |
| 625 | 3300045836 | Ga0466958_0067718 | Ga0466958_0067718_1649_2074 | 140 |
| 626 | 3300045976 | Ga0466967_0005204 | Ga0466967_0005204_7102_7527 | 140 |
| 627 | 3300045976 | Ga0466967_0012278 | Ga0466967_0012278_5543_5968 | 140 |
| 628 | 3300045976 | Ga0466967_0023706 | Ga0466967_0023706_492_917 | 140 |
| 629 | 3300045976 | Ga0466967_0023917 | Ga0466967_0023917_4070_4495 | 140 |
| 630 | 3300045976 | Ga0466967_0089796 | Ga0466967_0089796_2291_2716 | 140 |
| 631 | 3300045976 | Ga0466967_0140119 | Ga0466967_0140119_513_938 | 140 |
| 632 | 3300046461 | Ga0495641_0001080 | Ga0495641_0001080_14536_14961 | 140 |
| 633 | 3300046511 | Ga0495608_0056557 | Ga0495608_0056557_678_1103 | 140 |
| 634 | 3300046516 | Ga0495628_0144247 | Ga0495628_0144247_242_667 | 140 |
| 635 | 3300046529 | Ga0495652_0035637 | Ga0495652_0035637_46_471 | 140 |
| 636 | 3300046543 | Ga0495645_0170386 | Ga0495645_0170386_366_791 | 140 |
| 637 | 3300046543 | Ga0495645_0280815 | Ga0495645_0280815_36_461 | 140 |
| 638 | 3300046694 | Ga0495649_0005280 | Ga0495649_0005280_1023_1448 | 140 |
| 639 | 3300047317 | Ga0495604_0006333 | Ga0495604_0006333_5246_5671 | 140 |
| 640 | 3300047317 | Ga0495604_0066597 | Ga0495604_0066597_1959_2384 | 140 |
| 641 | 3300047317 | Ga0495604_0130850 | Ga0495604_0130850_380_805 | 140 |
| 642 | 3300047319 | Ga0495674_0306717 | Ga0495674_0306717_34_459 | 140 |
| 643 | 3300048088 | Ga0495602_0000070 | Ga0495602_0000070_27276_27701 | 140 |
| 644 | 3300048088 | Ga0495602_0380243 | Ga0495602_0380243_121_546 | 140 |
| 645 | 3300048907 | Ga0496104_0006465 | Ga0496104_0006465_8138_8563 | 140 |
| 646 | 3300048908 | Ga0496105_0010069 | Ga0496105_0010069_4136_4561 | 140 |
| 647 | 3300048910 | Ga0496107_0713766 | Ga0496107_0713766_120_545 | 140 |
| 648 | 3300048911 | Ga0496108_0058642 | Ga0496108_0058642_1925_2350 | 140 |
| 649 | 3300048912 | Ga0496109_0000146 | Ga0496109_0000146_310_735 | 140 |
| 650 | 3300048912 | Ga0496109_0216489 | Ga0496109_0216489_649_1074 | 140 |
| 651 | 3300048914 | Ga0496111_0215665 | Ga0496111_0215665_247_687 | 140 |
| 652 | 3300048915 | Ga0496112_0000153 | Ga0496112_0000153_24776_25201 | 140 |
| 653 | 3300048915 | Ga0496112_0037880 | Ga0496112_0037880_2572_2997 | 140 |
| 654 | 3300048915 | Ga0496112_0502535 | Ga0496112_0502535_134_559 | 140 |
| 655 | 3300048916 | Ga0496113_0000004 | Ga0496113_0000004_91012_91437 | 140 |
| 656 | 3300048916 | Ga0496113_0178271 | Ga0496113_0178271_610_1035 | 140 |
| 657 | 3300049569 | Ga0501032_0006397 | Ga0501032_0006397_5825_6250 | 140 |
| 658 | 3300049570 | Ga0501033_0116250 | Ga0501033_0116250_1047_1472 | 140 |
| 659 | 3300049571 | Ga0501034_0589921 | Ga0501034_0589921_45_470 | 140 |
| 660 | 3300049572 | Ga0501036_0189743 | Ga0501036_0189743_978_1403 | 140 |
| 661 | 3300049574 | Ga0501038_0015020 | Ga0501038_0015020_978_1403 | 140 |
| 662 | 3300049578 | Ga0501042_0030232 | Ga0501042_0030232_2596_3021 | 140 |
| 663 | 3300049579 | Ga0501043_0320154 | Ga0501043_0320154_174_599 | 140 |
| 664 | 3300049580 | Ga0501046_0135884 | Ga0501046_0135884_487_912 | 140 |
| 665 | 3300049581 | Ga0501047_0578950 | Ga0501047_0578950_468_893 | 140 |
| 666 | 3300049582 | Ga0501048_0291099 | Ga0501048_0291099_664_1089 | 140 |
| 667 | 3300049583 | Ga0501067_0105310 | Ga0501067_0105310_648_1073 | 140 |
| 668 | 3300049585 | Ga0501069_0058814 | Ga0501069_0058814_1396_1821 | 140 |
| 669 | 3300049586 | Ga0501070_0375198 | Ga0501070_0375198_691_1116 | 140 |
| 670 | 3300049588 | Ga0501072_0481792 | Ga0501072_0481792_243_668 | 140 |
| 671 | 3300049589 | Ga0501073_0003796 | Ga0501073_0003796_2764_3189 | 140 |
| 672 | 3300049590 | Ga0501074_0216437 | Ga0501074_0216437_324_749 | 140 |
| 673 | 3300049744 | Ga0501083_0121759 | Ga0501083_0121759_1089_1514 | 140 |
| 674 | 3300049823 | Ga0501044_0067143 | Ga0501044_0067143_515_940 | 140 |
| 675 | 3300049824 | Ga0501045_0487507 | Ga0501045_0487507_115_540 | 140 |
| 676 | 3300050507 | nmdc:mga05p37_46413_c1 | nmdc:mga05p37_46413_c1_1528_1953 | 140 |
| 677 | 3300050511 | nmdc:mga08y16_1008343_c1 | nmdc:mga08y16_1008343_c1_181_606 | 140 |
| 678 | 3300050511 | nmdc:mga08y16_37344_c1 | nmdc:mga08y16_37344_c1_1685_2110 | 140 |
| 679 | 3300053083 | Ga0495655_0031357 | Ga0495655_0031357_21_446 | 140 |
| 680 | 3300053084 | Ga0495595_0028266 | Ga0495595_0028266_1956_2381 | 140 |
| 681 | 3300053084 | Ga0495595_0111842 | Ga0495595_0111842_251_676 | 140 |
| 682 | 3300053123 | Ga0500614_001722 | Ga0500614_001722_4208_4633 | 140 |
| 683 | 3300060353 | Ga0501082_0007829 | Ga0501082_0007829_4904_5329 | 140 |
| 684 | 3300061719 | Ga0466962_0028941 | Ga0466962_0028941_1382_1807 | 140 |
| 685 | 3300005327 | Ga0070658_10552800 | Ga0070658_105528002 | 141 |
| 686 | 3300005329 | Ga0070683_100001866 | Ga0070683_10000186615 | 141 |
| 687 | 3300005345 | Ga0070692_11298873 | Ga0070692_112988731 | 141 |
| 688 | 3300005435 | Ga0070714_100056593 | Ga0070714_1000565932 | 141 |
| 689 | 3300005436 | Ga0070713_100000085 | Ga0070713_10000008549 | 141 |
| 690 | 3300005436 | Ga0070713_100031459 | Ga0070713_1000314596 | 141 |
| 691 | 3300005439 | Ga0070711_101884115 | Ga0070711_1018841151 | 141 |
| 692 | 3300005466 | Ga0070685_10085868 | Ga0070685_100858683 | 141 |
| 693 | 3300005535 | Ga0070684_100068532 | Ga0070684_1000685322 | 141 |
| 694 | 3300005578 | Ga0068854_100000090 | Ga0068854_1000000903 | 141 |
| 695 | 3300005614 | Ga0068856_100340510 | Ga0068856_1003405102 | 141 |
| 696 | 3300006028 | Ga0070717_10047485 | Ga0070717_100474853 | 141 |
| 697 | 3300006028 | Ga0070717_10506019 | Ga0070717_105060192 | 141 |
| 698 | 3300006175 | Ga0070712_100005528 | Ga0070712_1000055289 | 141 |
| 699 | 3300006175 | Ga0070712_101649628 | Ga0070712_1016496281 | 141 |
| 700 | 3300006881 | Ga0068865_101500352 | Ga0068865_1015003522 | 141 |
| 701 | 3300009098 | Ga0105245_10014323 | Ga0105245_100143239 | 141 |
| 702 | 3300009177 | Ga0105248_12456526 | Ga0105248_124565261 | 141 |
| 703 | 3300011119 | Ga0105246_10042491 | Ga0105246_100424912 | 141 |
| 704 | 3300013297 | Ga0157378_10000770 | Ga0157378_1000077023 | 141 |
| 705 | 3300013307 | Ga0157372_10000112 | Ga0157372_100001129 | 141 |
| 706 | 3300021358 | Ga0213873_10021329 | Ga0213873_100213292 | 141 |
| 707 | 3300021377 | Ga0213874_10009280 | Ga0213874_100092803 | 141 |
| 708 | 3300021377 | Ga0213874_10034927 | Ga0213874_100349272 | 141 |
| 709 | 3300021384 | Ga0213876_10018016 | Ga0213876_100180163 | 141 |
| 710 | 3300021388 | Ga0213875_10000156 | Ga0213875_1000015630 | 141 |
| 711 | 3300021388 | Ga0213875_10017115 | Ga0213875_100171153 | 141 |
| 712 | 3300025899 | Ga0207642_10262985 | Ga0207642_102629852 | 141 |
| 713 | 3300025909 | Ga0207705_10095930 | Ga0207705_100959302 | 141 |
| 714 | 3300025915 | Ga0207693_10008714 | Ga0207693_100087142 | 141 |
| 715 | 3300025927 | Ga0207687_10008027 | Ga0207687_100080279 | 141 |
| 716 | 3300025928 | Ga0207700_10000027 | Ga0207700_1000002717 | 141 |
| 717 | 3300025929 | Ga0207664_10028937 | Ga0207664_100289376 | 141 |
| 718 | 3300025938 | Ga0207704_11175401 | Ga0207704_111754012 | 141 |
| 719 | 3300025941 | Ga0207711_11821502 | Ga0207711_118215021 | 141 |
| 720 | 3300025944 | Ga0207661_10000398 | Ga0207661_1000039818 | 141 |
| 721 | 3300025981 | Ga0207640_10000778 | Ga0207640_100007783 | 141 |
| 722 | 3300026075 | Ga0207708_10346396 | Ga0207708_103463962 | 141 |
| 723 | 3300026078 | Ga0207702_10434701 | Ga0207702_104347012 | 141 |
| 724 | 3300026116 | Ga0207674_10287460 | Ga0207674_102874603 | 141 |
| 725 | 3300037853 | Ga0436364_0159207 | Ga0436364_0159207_13570_13998 | 141 |
| 726 | 3300037853 | Ga0436364_0744537 | Ga0436364_0744537_466_894 | 141 |
| 727 | 3300037853 | Ga0436364_1375186 | Ga0436364_1375186_27282_27710 | 141 |
| 728 | 3300037853 | Ga0436364_1467838 | Ga0436364_1467838_2335_2763 | 141 |
| 729 | 3300039437 | Ga0436365_0004038 | Ga0436365_0004038_5573_6001 | 141 |
| 730 | 3300039437 | Ga0436365_1001279 | Ga0436365_1001279_22095_22523 | 141 |
| 731 | 3300039450 | Ga0436363_0134081 | Ga0436363_0134081_62_490 | 141 |
| 732 | 3300039450 | Ga0436363_0843533 | Ga0436363_0843533_2215_2643 | 141 |
| 733 | 3300039450 | Ga0436363_1431625 | Ga0436363_1431625_784_1212 | 141 |
| 734 | 3300039450 | Ga0436363_1691717 | Ga0436363_1691717_2623_3051 | 141 |
| 735 | 3300039453 | Ga0436362_0339746 | Ga0436362_0339746_2516_2944 | 141 |
| 736 | 3300044656 | Ga0466969_0284550 | Ga0466969_0284550_158_586 | 141 |
| 737 | 3300044656 | Ga0466969_0502549 | Ga0466969_0502549_113_541 | 141 |
| 738 | 3300044683 | Ga0466965_0853340 | Ga0466965_0853340_72_500 | 141 |
| 739 | 3300044719 | Ga0466971_0111028 | Ga0466971_0111028_823_1251 | 141 |
| 740 | 3300044735 | Ga0466968_0091123 | Ga0466968_0091123_104_532 | 141 |
| 741 | 3300044842 | Ga0466957_0154050 | Ga0466957_0154050_601_1029 | 141 |
| 742 | 3300045049 | Ga0466959_0098486 | Ga0466959_0098486_1108_1536 | 141 |
| 743 | 3300045049 | Ga0466959_0125962 | Ga0466959_0125962_817_1245 | 141 |
| 744 | 3300045836 | Ga0466958_0330839 | Ga0466958_0330839_336_764 | 141 |
| 745 | 3300045836 | Ga0466958_0740000 | Ga0466958_0740000_134_562 | 141 |
| 746 | 3300045976 | Ga0466967_0432383 | Ga0466967_0432383_232_660 | 141 |
| 747 | 3300045976 | Ga0466967_0689907 | Ga0466967_0689907_300_728 | 141 |
| 748 | 3300045976 | Ga0466967_1877793 | Ga0466967_1877793_133_561 | 141 |
| 749 | 3300046492 | Ga0495585_0343213 | Ga0495585_0343213_108_536 | 141 |
| 750 | 3300046514 | Ga0495618_0281270 | Ga0495618_0281270_416_847 | 141 |
| 751 | 3300048904 | Ga0496101_0099390 | Ga0496101_0099390_1704_2132 | 141 |
| 752 | 3300048907 | Ga0496104_0944022 | Ga0496104_0944022_299_727 | 141 |
| 753 | 3300048908 | Ga0496105_0073928 | Ga0496105_0073928_1018_1446 | 141 |
| 754 | 3300048909 | Ga0496106_0000013 | Ga0496106_0000013_141594_142022 | 141 |
| 755 | 3300048910 | Ga0496107_0036827 | Ga0496107_0036827_606_1034 | 141 |
| 756 | 3300048910 | Ga0496107_0109180 | Ga0496107_0109180_118_546 | 141 |
| 757 | 3300048911 | Ga0496108_0098170 | Ga0496108_0098170_171_599 | 141 |
| 758 | 3300048912 | Ga0496109_0223882 | Ga0496109_0223882_496_924 | 141 |
| 759 | 3300048913 | Ga0496110_0365975 | Ga0496110_0365975_103_531 | 141 |
| 760 | 3300048915 | Ga0496112_0013821 | Ga0496112_0013821_5113_5541 | 141 |
| 761 | 3300048916 | Ga0496113_0002975 | Ga0496113_0002975_9142_9570 | 141 |
| 762 | 3300048917 | Ga0496114_0073737 | Ga0496114_0073737_1680_2108 | 141 |
| 763 | 3300053077 | Ga0495601_0260804 | Ga0495601_0260804_241_669 | 141 |
| 764 | 3300053078 | Ga0495612_0307795 | Ga0495612_0307795_99_527 | 141 |
| 765 | 3300005334 | Ga0068869_100899801 | Ga0068869_1008998011 | 142 |
| 766 | 3300005338 | Ga0068868_100000978 | Ga0068868_1000009789 | 142 |
| 767 | 3300005344 | Ga0070661_100000032 | Ga0070661_1000000324 | 142 |
| 768 | 3300005365 | Ga0070688_100000168 | Ga0070688_10000016825 | 142 |
| 769 | 3300005435 | Ga0070714_100098843 | Ga0070714_1000988432 | 142 |
| 770 | 3300005436 | Ga0070713_100137499 | Ga0070713_1001374992 | 142 |
| 771 | 3300005436 | Ga0070713_101228536 | Ga0070713_1012285361 | 142 |
| 772 | 3300005437 | Ga0070710_10429106 | Ga0070710_104291062 | 142 |
| 773 | 3300005456 | Ga0070678_100002153 | Ga0070678_10000215311 | 142 |
| 774 | 3300005466 | Ga0070685_10000246 | Ga0070685_1000024625 | 142 |
| 775 | 3300005468 | Ga0070707_100308761 | Ga0070707_1003087613 | 142 |
| 776 | 3300006028 | Ga0070717_10371434 | Ga0070717_103714342 | 142 |
| 777 | 3300006028 | Ga0070717_10815858 | Ga0070717_108158582 | 142 |
| 778 | 3300006163 | Ga0070715_10298335 | Ga0070715_102983351 | 142 |
| 779 | 3300006173 | Ga0070716_100069070 | Ga0070716_1000690703 | 142 |
| 780 | 3300006175 | Ga0070712_101429329 | Ga0070712_1014293291 | 142 |
| 781 | 3300006881 | Ga0068865_100000023 | Ga0068865_10000002351 | 142 |
| 782 | 3300009147 | Ga0114129_10909179 | Ga0114129_109091792 | 142 |
| 783 | 3300021384 | Ga0213876_10078539 | Ga0213876_100785392 | 142 |
| 784 | 3300025898 | Ga0207692_10332375 | Ga0207692_103323751 | 142 |
| 785 | 3300025906 | Ga0207699_10679641 | Ga0207699_106796412 | 142 |
| 786 | 3300025915 | Ga0207693_10002345 | Ga0207693_1000234513 | 142 |
| 787 | 3300025915 | Ga0207693_10049782 | Ga0207693_100497821 | 142 |
| 788 | 3300025916 | Ga0207663_10015163 | Ga0207663_100151635 | 142 |
| 789 | 3300025920 | Ga0207649_10000166 | Ga0207649_1000016632 | 142 |
| 790 | 3300025922 | Ga0207646_10397311 | Ga0207646_103973111 | 142 |
| 791 | 3300025928 | Ga0207700_10047064 | Ga0207700_100470642 | 142 |
| 792 | 3300025928 | Ga0207700_10663157 | Ga0207700_106631571 | 142 |
| 793 | 3300025935 | Ga0207709_10900847 | Ga0207709_109008472 | 142 |
| 794 | 3300025938 | Ga0207704_10000068 | Ga0207704_1000006825 | 142 |
| 795 | 3300025944 | Ga0207661_11007417 | Ga0207661_110074171 | 142 |
| 796 | 3300026023 | Ga0207677_10001122 | Ga0207677_1000112215 | 142 |
| 797 | 3300026121 | Ga0207683_10001623 | Ga0207683_1000162322 | 142 |
| 798 | 3300035111 | Ga0373923_0238991 | Ga0373923_0238991_183_614 | 142 |
| 799 | 3300035117 | Ga0373953_0052036 | Ga0373953_0052036_392_823 | 142 |
| 800 | 3300035172 | Ga0373955_0052893 | Ga0373955_0052893_1148_1579 | 142 |
| 801 | 3300035410 | Ga0373924_0304577 | Ga0373924_0304577_223_654 | 142 |
| 802 | 3300036401 | Ga0373937_0628956 | Ga0373937_0628956_573_1004 | 142 |
| 803 | 3300039437 | Ga0436365_0896130 | Ga0436365_0896130_5412_5843 | 142 |
| 804 | 3300039453 | Ga0436362_0712899 | Ga0436362_0712899_13_444 | 142 |
| 805 | 3300044656 | Ga0466969_0221621 | Ga0466969_0221621_326_757 | 142 |
| 806 | 3300044684 | Ga0466966_0172649 | Ga0466966_0172649_47_478 | 142 |
| 807 | 3300044684 | Ga0466966_0655980 | Ga0466966_0655980_178_609 | 142 |
| 808 | 3300044693 | Ga0466961_0360147 | Ga0466961_0360147_313_744 | 142 |
| 809 | 3300044694 | Ga0466963_0007807 | Ga0466963_0007807_1151_1582 | 142 |
| 810 | 3300045049 | Ga0466959_0102830 | Ga0466959_0102830_1316_1747 | 142 |
| 811 | 3300045049 | Ga0466959_0147463 | Ga0466959_0147463_493_924 | 142 |
| 812 | 3300045836 | Ga0466958_0001574 | Ga0466958_0001574_10219_10650 | 142 |
| 813 | 3300045836 | Ga0466958_0067510 | Ga0466958_0067510_739_1170 | 142 |
| 814 | 3300045836 | Ga0466958_0238515 | Ga0466958_0238515_571_1002 | 142 |
| 815 | 3300045976 | Ga0466967_0008602 | Ga0466967_0008602_3331_3762 | 142 |
| 816 | 3300045976 | Ga0466967_0178602 | Ga0466967_0178602_731_1162 | 142 |
| 817 | 3300046454 | Ga0495592_0466152 | Ga0495592_0466152_251_682 | 142 |
| 818 | 3300046461 | Ga0495641_0112982 | Ga0495641_0112982_320_751 | 142 |
| 819 | 3300046462 | Ga0495651_0006559 | Ga0495651_0006559_5413_5844 | 142 |
| 820 | 3300046463 | Ga0495653_0014652 | Ga0495653_0014652_4910_5341 | 142 |
| 821 | 3300046514 | Ga0495618_0009790 | Ga0495618_0009790_1279_1710 | 142 |
| 822 | 3300046516 | Ga0495628_0036020 | Ga0495628_0036020_1149_1580 | 142 |
| 823 | 3300046529 | Ga0495652_0028874 | Ga0495652_0028874_892_1323 | 142 |
| 824 | 3300046533 | Ga0495640_0132726 | Ga0495640_0132726_134_565 | 142 |
| 825 | 3300046533 | Ga0495640_0360231 | Ga0495640_0360231_453_884 | 142 |
| 826 | 3300046536 | Ga0495587_0009780 | Ga0495587_0009780_5651_6082 | 142 |
| 827 | 3300046557 | Ga0495622_0000789 | Ga0495622_0000789_123_554 | 142 |
| 828 | 3300046559 | Ga0495667_0001023 | Ga0495667_0001023_10016_10447 | 142 |
| 829 | 3300046642 | Ga0495634_0066330 | Ga0495634_0066330_920_1351 | 142 |
| 830 | 3300046663 | Ga0495635_0222215 | Ga0495635_0222215_811_1242 | 142 |
| 831 | 3300046675 | Ga0495657_0021964 | Ga0495657_0021964_1247_1678 | 142 |
| 832 | 3300046678 | Ga0495599_0308155 | Ga0495599_0308155_393_824 | 142 |
| 833 | 3300046680 | Ga0495646_0015211 | Ga0495646_0015211_3755_4186 | 142 |
| 834 | 3300046689 | Ga0495613_0719357 | Ga0495613_0719357_40_471 | 142 |
| 835 | 3300046809 | Ga0495600_0047127 | Ga0495600_0047127_873_1304 | 142 |
| 836 | 3300046809 | Ga0495600_0130333 | Ga0495600_0130333_735_1166 | 142 |
| 837 | 3300047315 | Ga0495581_0724179 | Ga0495581_0724179_31_462 | 142 |
| 838 | 3300047319 | Ga0495674_0076400 | Ga0495674_0076400_1925_2356 | 142 |
| 839 | 3300047320 | Ga0495672_0084135 | Ga0495672_0084135_701_1132 | 142 |
| 840 | 3300047322 | Ga0495680_0080447 | Ga0495680_0080447_118_549 | 142 |
| 841 | 3300047673 | Ga0495593_0246985 | Ga0495593_0246985_442_873 | 142 |
| 842 | 3300048088 | Ga0495602_0130794 | Ga0495602_0130794_1186_1617 | 142 |
| 843 | 3300048089 | Ga0495614_0151794 | Ga0495614_0151794_480_911 | 142 |
| 844 | 3300048903 | Ga0496100_0011865 | Ga0496100_0011865_985_1416 | 142 |
| 845 | 3300048903 | Ga0496100_0996514 | Ga0496100_0996514_39_470 | 142 |
| 846 | 3300048905 | Ga0496102_0479607 | Ga0496102_0479607_258_689 | 142 |
| 847 | 3300048906 | Ga0496103_0669782 | Ga0496103_0669782_88_519 | 142 |
| 848 | 3300048907 | Ga0496104_0012549 | Ga0496104_0012549_1175_1606 | 142 |
| 849 | 3300048907 | Ga0496104_0496185 | Ga0496104_0496185_308_739 | 142 |
| 850 | 3300048909 | Ga0496106_0001792 | Ga0496106_0001792_6459_6890 | 142 |
| 851 | 3300048913 | Ga0496110_0299285 | Ga0496110_0299285_811_1242 | 142 |
| 852 | 3300048915 | Ga0496112_0054181 | Ga0496112_0054181_3221_3652 | 142 |
| 853 | 3300048915 | Ga0496112_1325304 | Ga0496112_1325304_29_460 | 142 |
| 854 | 3300048916 | Ga0496113_0009800 | Ga0496113_0009800_1455_1886 | 142 |
| 855 | 3300048916 | Ga0496113_0267868 | Ga0496113_0267868_259_690 | 142 |
| 856 | 3300048917 | Ga0496114_0093555 | Ga0496114_0093555_1873_2304 | 142 |
| 857 | 3300048917 | Ga0496114_0179768 | Ga0496114_0179768_1293_1724 | 142 |
| 858 | 3300048918 | Ga0496115_0000070 | Ga0496115_0000070_49704_50135 | 142 |
| 859 | 3300048918 | Ga0496115_0000243 | Ga0496115_0000243_7395_7826 | 142 |
| 860 | 3300048918 | Ga0496115_0003897 | Ga0496115_0003897_1243_1674 | 142 |
| 861 | 3300048918 | Ga0496115_0019289 | Ga0496115_0019289_1529_1960 | 142 |
| 862 | 3300050507 | nmdc:mga05p37_1099293_c1 | nmdc:mga05p37_1099293_c1_240_680 | 142 |
| 863 | 3300050515 | nmdc:mga0a205_304390_c1 | nmdc:mga0a205_304390_c1_766_1197 | 142 |
| 864 | 3300053077 | Ga0495601_0000032 | Ga0495601_0000032_4997_5428 | 142 |
| 865 | 3300053078 | Ga0495612_0016370 | Ga0495612_0016370_83_514 | 142 |
| 866 | 3300053084 | Ga0495595_0010720 | Ga0495595_0010720_3020_3451 | 142 |
| 867 | 3300005354 | Ga0070675_100000015 | Ga0070675_100000015123 | 143 |
| 868 | 3300025926 | Ga0207659_10000032 | Ga0207659_10000032102 | 143 |
| 869 | 3300035692 | Ga0373935_0143470 | Ga0373935_0143470_1038_1472 | 143 |
| 870 | 3300036401 | Ga0373937_0601405 | Ga0373937_0601405_222_656 | 143 |
| 871 | 3300046507 | Ga0495606_0000072 | Ga0495606_0000072_48285_48719 | 143 |
| 872 | 3300046615 | Ga0495656_0346050 | Ga0495656_0346050_108_542 | 143 |
| 873 | 3300046810 | Ga0495660_0200929 | Ga0495660_0200929_313_747 | 143 |
| 874 | 3300048912 | Ga0496109_0000226 | Ga0496109_0000226_37213_37656 | 143 |
| 875 | 3300048913 | Ga0496110_0268505 | Ga0496110_0268505_160_594 | 143 |
| 876 | 3300061719 | Ga0466962_0381449 | Ga0466962_0381449_25_459 | 143 |
| 877 | 3300009098 | Ga0105245_10000254 | Ga0105245_1000025449 | 144 |
| 878 | 3300013105 | Ga0157369_10000020 | Ga0157369_10000020145 | 144 |
| 879 | 3300021358 | Ga0213873_10027021 | Ga0213873_100270212 | 144 |
| 880 | 3300021377 | Ga0213874_10000005 | Ga0213874_1000000513 | 144 |
| 881 | 3300021384 | Ga0213876_10116779 | Ga0213876_101167792 | 144 |
| 882 | 3300025321 | Ga0207656_10009888 | Ga0207656_100098882 | 144 |
| 883 | 3300025927 | Ga0207687_10000007 | Ga0207687_10000007475 | 144 |
| 884 | 3300025929 | Ga0207664_10035475 | Ga0207664_100354753 | 144 |
| 885 | 3300031852 | Ga0307410_10523411 | Ga0307410_105234112 | 144 |
| 886 | 3300031903 | Ga0307407_10191028 | Ga0307407_101910282 | 144 |
| 887 | 3300032126 | Ga0307415_100244925 | Ga0307415_1002449252 | 144 |
| 888 | 3300039437 | Ga0436365_1758755 | Ga0436365_1758755_762_1202 | 144 |
| 889 | 3300039450 | Ga0436363_0760459 | Ga0436363_0760459_13804_14244 | 144 |
| 890 | 3300039453 | Ga0436362_0787061 | Ga0436362_0787061_346_786 | 144 |
| 891 | 3300044694 | Ga0466963_0049400 | Ga0466963_0049400_1870_2310 | 144 |
| 892 | 3300044735 | Ga0466968_0151471 | Ga0466968_0151471_185_622 | 144 |
| 893 | 3300045976 | Ga0466967_0439199 | Ga0466967_0439199_122_559 | 144 |
| 894 | 3300046678 | Ga0495599_0008369 | Ga0495599_0008369_2422_2859 | 144 |
| 895 | 3300047471 | Ga0495684_0006748 | Ga0495684_0006748_1724_2161 | 144 |
| 896 | 3300048911 | Ga0496108_0000146 | Ga0496108_0000146_42009_42455 | 144 |
| 897 | 3300048912 | Ga0496109_0000297 | Ga0496109_0000297_24766_25212 | 144 |
| 898 | 3300005289 | Ga0065704_10107272 | Ga0065704_101072724 | 145 |
| 899 | 3300005834 | Ga0068851_10000233 | Ga0068851_100002337 | 145 |
| 900 | 3300006847 | Ga0075431_100589448 | Ga0075431_1005894482 | 145 |
| 901 | 3300009094 | Ga0111539_10205519 | Ga0111539_102055191 | 145 |
| 902 | 3300009147 | Ga0114129_10085083 | Ga0114129_100850834 | 145 |
| 903 | 3300025321 | Ga0207656_10000180 | Ga0207656_1000018018 | 145 |
| 904 | 3300027907 | Ga0207428_10001807 | Ga0207428_1000180713 | 145 |
| 905 | 3300050507 | nmdc:mga05p37_24410_c1 | nmdc:mga05p37_24410_c1_6523_6975 | 145 |
| 906 | 3300050508 | nmdc:mga09592_333385_c1 | nmdc:mga09592_333385_c1_816_1268 | 145 |
| 907 | 3300050510 | nmdc:mga06r32_499245_c1 | nmdc:mga06r32_499245_c1_234_686 | 145 |
| 908 | 3300050511 | nmdc:mga08y16_4830_c1 | nmdc:mga08y16_4830_c1_4095_4547 | 145 |
| 909 | 3300060353 | Ga0501082_0642955 | Ga0501082_0642955_397_846 | 145 |
| 910 | 3300044684 | Ga0466966_0157141 | Ga0466966_0157141_330_773 | 146 |
| 911 | 3300045049 | Ga0466959_0244931 | Ga0466959_0244931_686_1129 | 146 |
| 912 | 3300005543 | Ga0070672_100000007 | Ga0070672_10000000777 | 147 |
| 913 | 3300025940 | Ga0207691_10000525 | Ga0207691_1000052545 | 147 |
| 914 | 3300005518 | Ga0070699_100128058 | Ga0070699_1001280581 | 148 |
| 915 | 3300025922 | Ga0207646_10000162 | Ga0207646_1000016254 | 148 |
| 916 | 3300044694 | Ga0466963_0734848 | Ga0466963_0734848_204_656 | 148 |
| 917 | 3300045049 | Ga0466959_0096623 | Ga0466959_0096623_1274_1762 | 148 |
| 918 | iso_pu_bacteria | 2687453341 | 2688394974 | 148 |
| 919 | 3300025903 | Ga0207680_10004019 | Ga0207680_100040192 | 149 |
| 920 | 2162886007 | SwRhRL2b_contig_3932664 | SwRhRL2b_0969.00010440 | 152 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vph-assembly2.cif.gz_E | crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution | 0.8863 | 7 | 146 |
| 1ve0-assembly1.cif.gz_A | crystal structure of uncharacterized protein st2072 from sulfolobus tokodaii | 0.8848 | 9 | 143 |
| 1vph-assembly2.cif.gz_E | crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution | 0.8804 | 7 | 146 |
| 2cu5-assembly1.cif.gz_C | crystal structure of the conserved hypothetical protein tt1486 from thermus thermophilus hb8 | 0.8743 | 11 | 142 |
| 1vmf-assembly1.cif.gz_C | crystal structure of a ybjq-like fold protein of unknown function (bh3498) from bacillus halodurans at 1.46 a resolution | 0.8726 | 12 | 140 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O14155_1_138_2.60.120.460 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.9903 | 9 | 143 | 2.60.120.460 |
| af_P0AF48_1_138_2.60.120.460 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.9777 | 9 | 146 | 2.60.120.460 |
| af_P0AF48_1_138_2.60.120.460 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.9707 | 9 | 146 | 2.60.120.460 |
| af_O14155_1_138_2.60.120.460 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.962 | 9 | 143 | 2.60.120.460 |
| af_P9WFP9_1_132_2.60.120.460 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.887 | 11 | 143 | 2.60.120.460 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A350QL25-F1-model_v4 | YjbQ family protein | 0.9974 | 9 | 146 |
|
| AF-A0A0H0Y7M9-F1-model_v4 | deleted | 0.9973 | 9 | 146 |
|
| AF-A0A7C6ZTY1-F1-model_v4 | YjbQ family protein | 0.9971 | 7 | 148 |
|
| AF-A0A7X1FCT8-F1-model_v4 | YjbQ family protein | 0.9971 | 9 | 148 |
|
| AF-A0A1A8TK41-F1-model_v4 | Secondary thiamine-phosphate synthase enzyme | 0.9968 | 9 | 146 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar