F485736

General Info

Members Datasets Scaffolds Average Seq Length
920 326 919 141

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0096623|Ga0466959_0096623_1274_1762
Length 162
Sequence MHDQRHGGAARWQAEYLGGLMIWAQRRISLSSRPRGFHLVTREVVDAMPELGCVRVGMLHLLIQHTSASLALNENASPDVRRDFETWANQAVPEDTPYWTHTTEGPDDMPAHIKSALFGPSLTLPVADGSLALGTWQGIYLCEHRDRGGDRQVMATLWGEEA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
119 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
193 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
194 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
195 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
196 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
205 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
206 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
209 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
210 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
211 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
212 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
213 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
214 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
215 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
216 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
217 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
218 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
219 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
220 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
221 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
222 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
223 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
224 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
225 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
226 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
227 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
228 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
229 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
230 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
231 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
234 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
235 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
236 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
237 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
238 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
239 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
240 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
241 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
242 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
243 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
244 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
245 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
246 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
247 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
248 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
249 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
250 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
251 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
252 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
253 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
254 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
255 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
256 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
257 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
258 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
259 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
260 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
261 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
262 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
263 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
264 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
265 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
266 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
267 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
268 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
269 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
277 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
278 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
279 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
280 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
281 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
282 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
283 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
284 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
285 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
286 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
287 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
298 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
299 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
300 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
301 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
302 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
303 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
304 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
305 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
306 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
308 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
309 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
310 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
311 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
312 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
313 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
314 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
315 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
316 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
317 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
318 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
319 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
320 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
321 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
322 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
323 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
324 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
325 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
326 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.89
Metatranscriptomes 0
Isolates 0.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.17
Nodule 0
Rhizoplane 10.43
Rhizosphere 81.74
Stem 0
Stem Tuber 0
Unclassified 5.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3932664 2162886007 Bacteria 962
2 LJQas_1011064 3300000549 Bacteria 1074
3 JGI24743J22301_10057169 3300001991 Bacteria 800
4 JGI24743J22301_10097128 3300001991 Bacteria 632
5 JGI24735J21928_10131152 3300002067 Bacteria 722
6 JGI24738J21930_10051752 3300002075 Bacteria 838
7 JGI24738J21930_10089376 3300002075 Bacteria 650
8 JGI25406J46586_10014524 3300003203 Bacteria 3345
9 Ga0065704_10107272 3300005289 Bacteria 2060
10 Ga0070658_10042605 3300005327 Bacteria 3667
11 Ga0070658_10297396 3300005327 Bacteria 1376
12 Ga0070658_10552800 3300005327 Bacteria 996
13 Ga0070683_100001866 3300005329 Bacteria 16455
14 Ga0070683_100026711 3300005329 Bacteria 5202
15 Ga0070683_100047029 3300005329 Bacteria 3986
16 Ga0070683_100101038 3300005329 Bacteria 2715
17 Ga0070683_100205873 3300005329 Bacteria 1869
18 Ga0070683_100241392 3300005329 Bacteria 1718
19 Ga0070683_100324326 3300005329 Bacteria 1466
20 Ga0070683_101382764 3300005329 Bacteria 677
21 Ga0070670_100021832 3300005331 Bacteria 5506
22 Ga0068869_100338910 3300005334 Bacteria 1223
23 Ga0068869_100351431 3300005334 Bacteria 1202
24 Ga0068869_100356138 3300005334 Bacteria 1194
25 Ga0068869_100681778 3300005334 Bacteria 875
26 Ga0068869_100899801 3300005334 Bacteria 766
27 Ga0070680_100198605 3300005336 Bacteria 1691
28 Ga0070680_100572141 3300005336 Bacteria 969
29 Ga0070682_100000102 3300005337 Bacteria 76457
30 Ga0070682_100028386 3300005337 Bacteria 3365
31 Ga0070682_100032367 3300005337 Bacteria 3169
32 Ga0070682_100055481 3300005337 Bacteria 2489
33 Ga0070682_101389634 3300005337 Bacteria 600
34 Ga0068868_100000978 3300005338 Bacteria 19469
35 Ga0068868_100092207 3300005338 Bacteria 2441
36 Ga0068868_100236685 3300005338 Bacteria 1533
37 Ga0068868_100324923 3300005338 Bacteria 1311
38 Ga0068868_100538467 3300005338 Bacteria 1028
39 Ga0068868_100620307 3300005338 Bacteria 960
40 Ga0070660_100002077 3300005339 Bacteria 13840
41 Ga0070660_100009618 3300005339 Bacteria 6810
42 Ga0070660_100511027 3300005339 Bacteria 1000
43 Ga0070660_100607361 3300005339 Bacteria 915
44 Ga0070691_10212994 3300005341 Bacteria 1020
45 Ga0070661_100000032 3300005344 Bacteria 112964
46 Ga0070661_100016519 3300005344 Bacteria 5220
47 Ga0070661_100054871 3300005344 Bacteria 2918
48 Ga0070661_101249890 3300005344 Bacteria 622
49 Ga0070661_101291559 3300005344 Bacteria 612
50 Ga0070692_10001942 3300005345 Bacteria 7821
51 Ga0070692_10027075 3300005345 Bacteria 2839
52 Ga0070692_10028829 3300005345 Bacteria 2762
53 Ga0070692_11298873 3300005345 Bacteria 522
54 Ga0070668_100112766 3300005347 Bacteria 2165
55 Ga0070668_100149824 3300005347 Bacteria 1885
56 Ga0070669_100314808 3300005353 Bacteria 1263
57 Ga0070669_101064725 3300005353 Bacteria 695
58 Ga0070675_100000015 3300005354 Bacteria 201080
59 Ga0070675_100039559 3300005354 Bacteria 3849
60 Ga0070675_100184136 3300005354 Bacteria 1807
61 Ga0070675_101073403 3300005354 Bacteria 740
62 Ga0070671_100038372 3300005355 Bacteria 3976
63 Ga0070674_100021654 3300005356 Bacteria 4133
64 Ga0070674_100422521 3300005356 Bacteria 1094
65 Ga0070673_100035079 3300005364 Bacteria 3802
66 Ga0070673_100171894 3300005364 Bacteria 1850
67 Ga0070688_100000168 3300005365 Bacteria 35364
68 Ga0070688_100148159 3300005365 Bacteria 1602
69 Ga0070688_100149331 3300005365 Bacteria 1596
70 Ga0070659_100000051 3300005366 Bacteria 97520
71 Ga0070659_100009171 3300005366 Bacteria 7257
72 Ga0070659_100119855 3300005366 Bacteria 2130
73 Ga0070667_100263872 3300005367 Bacteria 1543
74 Ga0070714_100056593 3300005435 Bacteria 3355
75 Ga0070714_100098843 3300005435 Bacteria 2568
76 Ga0070714_100235963 3300005435 Bacteria 1686
77 Ga0070713_100000085 3300005436 Bacteria 58902
78 Ga0070713_100031459 3300005436 Bacteria 4227
79 Ga0070713_100122520 3300005436 Bacteria 2282
80 Ga0070713_100137499 3300005436 Bacteria 2160
81 Ga0070713_100446516 3300005436 Bacteria 1214
82 Ga0070713_101228536 3300005436 Bacteria 725
83 Ga0070710_10429106 3300005437 Bacteria 891
84 Ga0070701_10103993 3300005438 Bacteria 1577
85 Ga0070701_10120835 3300005438 Bacteria 1476
86 Ga0070701_10126534 3300005438 Bacteria 1447
87 Ga0070701_10161515 3300005438 Bacteria 1298
88 Ga0070701_10264338 3300005438 Bacteria 1044
89 Ga0070701_10423234 3300005438 Bacteria 849
90 Ga0070711_101884115 3300005439 Bacteria 525
91 Ga0070700_100001146 3300005441 Bacteria 13083
92 Ga0070700_100030018 3300005441 Bacteria 3245
93 Ga0070700_100063360 3300005441 Bacteria 2339
94 Ga0070700_101932304 3300005441 Bacteria 511
95 Ga0070694_100138373 3300005444 Bacteria 1766
96 Ga0070694_100249074 3300005444 Bacteria 1343
97 Ga0070694_100301892 3300005444 Bacteria 1227
98 Ga0070663_100041109 3300005455 Bacteria 3240
99 Ga0070663_100108647 3300005455 Bacteria 2081
100 Ga0070663_100170054 3300005455 Bacteria 1684
101 Ga0070678_100002153 3300005456 Bacteria 10685
102 Ga0070678_100560205 3300005456 Bacteria 1016
103 Ga0070662_100008536 3300005457 Bacteria 6680
104 Ga0070662_100197330 3300005457 Bacteria 1595
105 Ga0070681_10014223 3300005458 Bacteria 7920
106 Ga0070681_10748227 3300005458 Bacteria 894
107 Ga0068867_100050141 3300005459 Bacteria 3075
108 Ga0068867_100110699 3300005459 Bacteria 2110
109 Ga0068867_100182406 3300005459 Bacteria 1670
110 Ga0070685_10000246 3300005466 Bacteria 35364
111 Ga0070685_10043544 3300005466 Bacteria 2567
112 Ga0070685_10085868 3300005466 Bacteria 1896
113 Ga0070685_10143495 3300005466 Bacteria 1506
114 Ga0070707_100308761 3300005468 Bacteria 1537
115 Ga0070699_100128058 3300005518 Bacteria 2237
116 Ga0070679_100000537 3300005530 Bacteria 32232
117 Ga0070679_100132456 3300005530 Bacteria 2474
118 Ga0070684_100010940 3300005535 Bacteria 7212
119 Ga0070684_100015111 3300005535 Bacteria 6276
120 Ga0070684_100068532 3300005535 Bacteria 3119
121 Ga0070684_100148946 3300005535 Bacteria 2119
122 Ga0070684_100222054 3300005535 Bacteria 1724
123 Ga0070684_101588502 3300005535 Bacteria 617
124 Ga0068853_100769096 3300005539 Bacteria 921
125 Ga0070672_100000007 3300005543 Bacteria 104699
126 Ga0070672_100025741 3300005543 Bacteria 4369
127 Ga0070672_100316098 3300005543 Bacteria 1327
128 Ga0070686_100091723 3300005544 Bacteria 2033
129 Ga0070686_100198158 3300005544 Bacteria 1438
130 Ga0070686_100491311 3300005544 Bacteria 951
131 Ga0070696_100203014 3300005546 Bacteria 1481
132 Ga0070696_100596907 3300005546 Bacteria 890
133 Ga0070696_101073228 3300005546 Bacteria 676
134 Ga0070693_100067701 3300005547 Bacteria 2094
135 Ga0070693_100250045 3300005547 Bacteria 1175
136 Ga0070693_100446279 3300005547 Bacteria 907
137 Ga0070665_100240530 3300005548 Bacteria 1811
138 Ga0070665_100410840 3300005548 Bacteria 1362
139 Ga0070704_100174082 3300005549 Bacteria 1715
140 Ga0070704_100433691 3300005549 Bacteria 1128
141 Ga0070704_100785468 3300005549 Bacteria 850
142 Ga0068855_100085845 3300005563 Bacteria 3641
143 Ga0068855_100499475 3300005563 Bacteria 1322
144 Ga0070664_100011227 3300005564 Bacteria 7266
145 Ga0070664_100089256 3300005564 Bacteria 2667
146 Ga0068857_100221353 3300005577 Bacteria 1729
147 Ga0068854_100000090 3300005578 Bacteria 64443
148 Ga0068854_100016779 3300005578 Bacteria 4888
149 Ga0068854_100129861 3300005578 Bacteria 1923
150 Ga0068854_100137525 3300005578 Bacteria 1871
151 Ga0068854_100208098 3300005578 Bacteria 1542
152 Ga0068854_100339119 3300005578 Bacteria 1227
153 Ga0068856_100103144 3300005614 Bacteria 2846
154 Ga0068856_100249054 3300005614 Bacteria 1792
155 Ga0068856_100340510 3300005614 Bacteria 1518
156 Ga0070702_100006043 3300005615 Bacteria 5700
157 Ga0070702_100008205 3300005615 Bacteria 5045
158 Ga0070702_100074794 3300005615 Bacteria 2011
159 Ga0070702_100614531 3300005615 Bacteria 817
160 Ga0070702_100851200 3300005615 Bacteria 710
161 Ga0068852_100057753 3300005616 Bacteria 3359
162 Ga0068852_101209325 3300005616 Bacteria 777
163 Ga0068859_100039669 3300005617 Bacteria 4725
164 Ga0068859_100421512 3300005617 Bacteria 1431
165 Ga0068864_100043380 3300005618 Bacteria 3851
166 Ga0068864_100063321 3300005618 Bacteria 3205
167 Ga0068864_100181624 3300005618 Bacteria 1924
168 Ga0068864_100673657 3300005618 Bacteria 1009
169 Ga0068864_101016690 3300005618 Bacteria 823
170 Ga0068866_10124895 3300005718 Bacteria 1455
171 Ga0068866_10398397 3300005718 Bacteria 887
172 Ga0068866_10684796 3300005718 Bacteria 702
173 Ga0068861_100082055 3300005719 Bacteria 2526
174 Ga0068861_100252453 3300005719 Bacteria 1506
175 Ga0068861_100344640 3300005719 Bacteria 1305
176 Ga0068861_100724284 3300005719 Bacteria 927
177 Ga0068861_100836486 3300005719 Bacteria 867
178 Ga0068861_100952141 3300005719 Bacteria 817
179 Ga0068851_10000233 3300005834 Bacteria 26436
180 Ga0068851_10498430 3300005834 Bacteria 730
181 Ga0068870_10019487 3300005840 Bacteria 3290
182 Ga0068870_10035752 3300005840 Bacteria 2551
183 Ga0068870_10538826 3300005840 Bacteria 784
184 Ga0068863_100009331 3300005841 Bacteria 9573
185 Ga0068858_100169993 3300005842 Bacteria 2055
186 Ga0068858_100211195 3300005842 Bacteria 1837
187 Ga0068860_100292313 3300005843 Bacteria 1595
188 Ga0068862_100101142 3300005844 Bacteria 2521
189 Ga0068862_100327409 3300005844 Bacteria 1416
190 Ga0081455_10551628 3300005937 Bacteria 762
191 Ga0081538_10131903 3300005981 Bacteria 1172
192 Ga0081540_1126892 3300005983 Bacteria 1048
193 Ga0081539_10003976 3300005985 Bacteria 17075
194 Ga0070717_10014762 3300006028 Bacteria 6009
195 Ga0070717_10024989 3300006028 Bacteria 4745
196 Ga0070717_10047485 3300006028 Bacteria 3518
197 Ga0070717_10053959 3300006028 Bacteria 3313
198 Ga0070717_10371434 3300006028 Bacteria 1281
199 Ga0070717_10506019 3300006028 Bacteria 1092
200 Ga0070717_10783712 3300006028 Bacteria 867
201 Ga0070717_10815858 3300006028 Bacteria 849
202 Ga0075365_10044157 3300006038 Bacteria 2919
203 Ga0075365_10046863 3300006038 Bacteria 2840
204 Ga0075365_10664162 3300006038 Bacteria 737
205 Ga0075363_100020772 3300006048 Bacteria 3297
206 Ga0075364_10016188 3300006051 Bacteria 4637
207 Ga0075364_10118494 3300006051 Bacteria 1771
208 Ga0075364_10175443 3300006051 Bacteria 1449
209 Ga0075364_10200801 3300006051 Bacteria 1351
210 Ga0075364_10445662 3300006051 Bacteria 884
211 Ga0070715_10298335 3300006163 Bacteria 861
212 Ga0070716_100069070 3300006173 Bacteria 2069
213 Ga0070712_100005528 3300006175 Bacteria 7823
214 Ga0070712_100061563 3300006175 Bacteria 2652
215 Ga0070712_100883404 3300006175 Bacteria 770
216 Ga0070712_101429329 3300006175 Bacteria 604
217 Ga0070712_101649628 3300006175 Bacteria 561
218 Ga0075367_10061809 3300006178 Bacteria 2235
219 Ga0075367_10269922 3300006178 Bacteria 1069
220 Ga0075428_100044308 3300006844 Bacteria 4889
221 Ga0075428_100483260 3300006844 Bacteria 1326
222 Ga0075428_101367392 3300006844 Bacteria 744
223 Ga0075428_101490690 3300006844 Bacteria 709
224 Ga0075431_100589448 3300006847 Bacteria 1096
225 Ga0075433_10051223 3300006852 Bacteria 3595
226 Ga0075433_10556818 3300006852 Bacteria 1008
227 Ga0075434_100190087 3300006871 Bacteria 2073
228 Ga0075434_100432270 3300006871 Bacteria 1338
229 Ga0075434_101051440 3300006871 Bacteria 828
230 Ga0075434_102325798 3300006871 Bacteria 539
231 Ga0075429_100069997 3300006880 Bacteria 3054
232 Ga0075429_100585398 3300006880 Bacteria 978
233 Ga0068865_100000023 3300006881 Bacteria 100785
234 Ga0068865_100008559 3300006881 Bacteria 6325
235 Ga0068865_100036684 3300006881 Bacteria 3306
236 Ga0068865_101500352 3300006881 Bacteria 604
237 Ga0075436_100007266 3300006914 Bacteria 7576
238 Ga0097620_100039672 3300006931 Bacteria 4725
239 Ga0097620_100421453 3300006931 Bacteria 1431
240 Ga0075435_100042083 3300007076 Bacteria 3653
241 Ga0105251_10328108 3300009011 Bacteria 696
242 Ga0105240_10750025 3300009093 Bacteria 1061
243 Ga0111539_10050474 3300009094 Bacteria 4956
244 Ga0111539_10081111 3300009094 Bacteria 3816
245 Ga0111539_10099745 3300009094 Bacteria 3410
246 Ga0111539_10205519 3300009094 Bacteria 2296
247 Ga0111539_10220435 3300009094 Bacteria 2209
248 Ga0111539_10223314 3300009094 Bacteria 2194
249 Ga0111539_10228597 3300009094 Bacteria 2166
250 Ga0111539_11609505 3300009094 Bacteria 753
251 Ga0105245_10000254 3300009098 Bacteria 50918
252 Ga0105245_10001037 3300009098 Bacteria 25245
253 Ga0105245_10014323 3300009098 Bacteria 6909
254 Ga0105245_10019669 3300009098 Bacteria 5917
255 Ga0105245_10155160 3300009098 Bacteria 2168
256 Ga0105245_10540187 3300009098 Bacteria 1187
257 Ga0105247_10126407 3300009101 Bacteria 1662
258 Ga0114129_10017653 3300009147 Bacteria 10157
259 Ga0114129_10085083 3300009147 Bacteria 4388
260 Ga0114129_10093825 3300009147 Bacteria 4157
261 Ga0114129_10240888 3300009147 Bacteria 2431
262 Ga0114129_10244692 3300009147 Bacteria 2410
263 Ga0114129_10751474 3300009147 Bacteria 1248
264 Ga0114129_10909179 3300009147 Bacteria 1115
265 Ga0114129_12514213 3300009147 Bacteria 615
266 Ga0114129_13338273 3300009147 Bacteria 518
267 Ga0105243_10006380 3300009148 Bacteria 9109
268 Ga0105243_10027113 3300009148 Bacteria 4388
269 Ga0105243_10027186 3300009148 Bacteria 4381
270 Ga0105243_10280762 3300009148 Bacteria 1500
271 Ga0105243_10414586 3300009148 Bacteria 1254
272 Ga0105243_12182703 3300009148 Bacteria 590
273 Ga0105241_11083928 3300009174 Bacteria 753
274 Ga0105242_10000756 3300009176 Bacteria 25161
275 Ga0105242_10048984 3300009176 Bacteria 3436
276 Ga0105242_10412249 3300009176 Bacteria 1264
277 Ga0105242_10853871 3300009176 Bacteria 906
278 Ga0105242_12552559 3300009176 Bacteria 560
279 Ga0105242_13137574 3300009176 Bacteria 513
280 Ga0105248_12456526 3300009177 Bacteria 594
281 Ga0105237_11692488 3300009545 Bacteria 640
282 Ga0105238_10114853 3300009551 Bacteria 2671
283 Ga0105238_10268058 3300009551 Bacteria 1688
284 Ga0105238_12381915 3300009551 Bacteria 565
285 Ga0105249_10045832 3300009553 Bacteria 3978
286 Ga0105249_10063268 3300009553 Bacteria 3399
287 Ga0105239_10007908 3300010375 Bacteria 12155
288 Ga0105239_10053648 3300010375 Bacteria 4421
289 Ga0105246_10034379 3300011119 Bacteria 3377
290 Ga0105246_10042491 3300011119 Bacteria 3079
291 Ga0105246_10094870 3300011119 Bacteria 2159
292 Ga0105246_10663679 3300011119 Bacteria 909
293 Ga0157369_10000020 3300013105 Bacteria 241679
294 Ga0157369_10242289 3300013105 Bacteria 1883
295 Ga0157374_10056528 3300013296 Bacteria 3663
296 Ga0157374_10335622 3300013296 Bacteria 1500
297 Ga0157374_10351592 3300013296 Bacteria 1464
298 Ga0157378_10000770 3300013297 Bacteria 29730
299 Ga0163162_10224868 3300013306 Bacteria 2006
300 Ga0163162_11739675 3300013306 Bacteria 712
301 Ga0163162_13492383 3300013306 Bacteria 500
302 Ga0157372_10000112 3300013307 Bacteria 85902
303 Ga0157372_10353584 3300013307 Bacteria 1712
304 Ga0157375_10044794 3300013308 Bacteria 4302
305 Ga0157375_10218274 3300013308 Bacteria 2065
306 Ga0157375_10396597 3300013308 Bacteria 1547
307 Ga0157375_11822847 3300013308 Bacteria 721
308 Ga0163163_10113311 3300014325 Bacteria 2742
309 Ga0163163_10300942 3300014325 Bacteria 1656
310 Ga0157380_10166829 3300014326 Bacteria 1920
311 Ga0157380_10530144 3300014326 Bacteria 1151
312 Ga0157380_11636956 3300014326 Bacteria 700
313 Ga0157380_11853547 3300014326 Bacteria 663
314 Ga0157377_10000243 3300014745 Bacteria 27516
315 Ga0157377_10011798 3300014745 Bacteria 4372
316 Ga0157379_10005485 3300014968 Bacteria 10887
317 Ga0157379_10479740 3300014968 Bacteria 1151
318 Ga0157379_10592601 3300014968 Bacteria 1034
319 Ga0157376_11168804 3300014969 Bacteria 797
320 Ga0163161_10251371 3300017792 Bacteria 1378
321 Ga0163161_10515644 3300017792 Bacteria 976
322 Ga0213873_10021329 3300021358 Bacteria 1523
323 Ga0213873_10027021 3300021358 Bacteria 1397
324 Ga0213873_10273733 3300021358 Bacteria 540
325 Ga0213874_10000005 3300021377 Bacteria 27808
326 Ga0213874_10003788 3300021377 Bacteria 3395
327 Ga0213874_10009280 3300021377 Bacteria 2427
328 Ga0213874_10034927 3300021377 Bacteria 1474
329 Ga0213876_10005606 3300021384 Bacteria 6891
330 Ga0213876_10018016 3300021384 Bacteria 3726
331 Ga0213876_10078539 3300021384 Bacteria 1744
332 Ga0213876_10116779 3300021384 Bacteria 1416
333 Ga0213875_10000156 3300021388 Bacteria 72058
334 Ga0213875_10006473 3300021388 Bacteria 6141
335 Ga0213875_10009519 3300021388 Bacteria 4920
336 Ga0213875_10017115 3300021388 Bacteria 3507
337 Ga0213875_10163890 3300021388 Bacteria 1043
338 Ga0213875_10181444 3300021388 Bacteria 989
339 Ga0213875_10188806 3300021388 Bacteria 968
340 Ga0213875_10214336 3300021388 Bacteria 907
341 Ga0213875_10289573 3300021388 Bacteria 774
342 Ga0207656_10000180 3300025321 Bacteria 22842
343 Ga0207656_10009888 3300025321 Bacteria 3553
344 Ga0207656_10129913 3300025321 Bacteria 1179
345 Ga0207692_10332375 3300025898 Bacteria 933
346 Ga0207642_10088053 3300025899 Bacteria 1526
347 Ga0207642_10262985 3300025899 Bacteria 984
348 Ga0207642_10310195 3300025899 Bacteria 918
349 Ga0207710_10024439 3300025900 Bacteria 2602
350 Ga0207688_10001744 3300025901 Bacteria 11542
351 Ga0207688_10097685 3300025901 Bacteria 1692
352 Ga0207680_10004019 3300025903 Bacteria 6949
353 Ga0207699_10679641 3300025906 Bacteria 753
354 Ga0207643_10045359 3300025908 Bacteria 2483
355 Ga0207643_10155169 3300025908 Bacteria 1375
356 Ga0207643_10469698 3300025908 Bacteria 802
357 Ga0207705_10015308 3300025909 Bacteria 5505
358 Ga0207705_10095930 3300025909 Bacteria 2177
359 Ga0207705_10229382 3300025909 Bacteria 1412
360 Ga0207654_10857775 3300025911 Bacteria 657
361 Ga0207707_10030725 3300025912 Bacteria 4699
362 Ga0207707_10906610 3300025912 Bacteria 728
363 Ga0207693_10002345 3300025915 Bacteria 16445
364 Ga0207693_10008714 3300025915 Bacteria 8292
365 Ga0207693_10049782 3300025915 Bacteria 3290
366 Ga0207693_10855562 3300025915 Bacteria 699
367 Ga0207663_10015163 3300025916 Bacteria 4244
368 Ga0207660_10435925 3300025917 Bacteria 1058
369 Ga0207660_10585568 3300025917 Bacteria 908
370 Ga0207662_10037290 3300025918 Bacteria 2844
371 Ga0207657_10006150 3300025919 Bacteria 12477
372 Ga0207657_10013240 3300025919 Bacteria 8094
373 Ga0207657_10411720 3300025919 Bacteria 1063
374 Ga0207657_11166309 3300025919 Bacteria 587
375 Ga0207649_10000166 3300025920 Bacteria 53758
376 Ga0207649_10036301 3300025920 Bacteria 2968
377 Ga0207652_10039125 3300025921 Bacteria 4024
378 Ga0207652_10385053 3300025921 Bacteria 1266
379 Ga0207652_11180695 3300025921 Bacteria 667
380 Ga0207652_11298054 3300025921 Bacteria 630
381 Ga0207646_10000162 3300025922 Bacteria 90943
382 Ga0207646_10397311 3300025922 Bacteria 1245
383 Ga0207681_10063338 3300025923 Bacteria 2550
384 Ga0207681_10165208 3300025923 Bacteria 1673
385 Ga0207694_10072598 3300025924 Bacteria 2691
386 Ga0207694_10314980 3300025924 Bacteria 1290
387 Ga0207659_10000032 3300025926 Bacteria 119492
388 Ga0207659_10135601 3300025926 Bacteria 1905
389 Ga0207659_10549605 3300025926 Bacteria 981
390 Ga0207687_10000007 3300025927 Bacteria 604185
391 Ga0207687_10008027 3300025927 Bacteria 6909
392 Ga0207687_10070881 3300025927 Bacteria 2489
393 Ga0207687_10074228 3300025927 Bacteria 2437
394 Ga0207687_10446632 3300025927 Bacteria 1072
395 Ga0207700_10000027 3300025928 Bacteria 137708
396 Ga0207700_10047064 3300025928 Bacteria 3195
397 Ga0207700_10335382 3300025928 Bacteria 1313
398 Ga0207700_10654257 3300025928 Bacteria 937
399 Ga0207700_10663157 3300025928 Bacteria 930
400 Ga0207664_10001411 3300025929 Bacteria 15808
401 Ga0207664_10028937 3300025929 Bacteria 4217
402 Ga0207664_10035475 3300025929 Bacteria 3849
403 Ga0207664_10258904 3300025929 Bacteria 1521
404 Ga0207664_11531885 3300025929 Bacteria 588
405 Ga0207690_10046474 3300025932 Bacteria 2876
406 Ga0207690_10287309 3300025932 Bacteria 1283
407 Ga0207690_10430343 3300025932 Bacteria 1057
408 Ga0207690_11180371 3300025932 Bacteria 639
409 Ga0207706_10019718 3300025933 Bacteria 6066
410 Ga0207706_10029844 3300025933 Bacteria 4866
411 Ga0207706_10052839 3300025933 Bacteria 3587
412 Ga0207706_10180759 3300025933 Bacteria 1852
413 Ga0207686_10001027 3300025934 Bacteria 16514
414 Ga0207686_10207069 3300025934 Bacteria 1408
415 Ga0207686_10213473 3300025934 Bacteria 1389
416 Ga0207686_10536650 3300025934 Bacteria 913
417 Ga0207709_10015789 3300025935 Bacteria 4191
418 Ga0207709_10074278 3300025935 Bacteria 2169
419 Ga0207709_10104154 3300025935 Bacteria 1882
420 Ga0207709_10533339 3300025935 Bacteria 921
421 Ga0207709_10900847 3300025935 Bacteria 719
422 Ga0207670_10138907 3300025936 Bacteria 1790
423 Ga0207670_10203452 3300025936 Bacteria 1506
424 Ga0207669_10012356 3300025937 Bacteria 4195
425 Ga0207669_10379461 3300025937 Bacteria 1101
426 Ga0207669_10459763 3300025937 Bacteria 1010
427 Ga0207704_10000068 3300025938 Bacteria 65896
428 Ga0207704_10065797 3300025938 Bacteria 2271
429 Ga0207704_10172203 3300025938 Bacteria 1554
430 Ga0207704_11175401 3300025938 Bacteria 654
431 Ga0207691_10000525 3300025940 Bacteria 38219
432 Ga0207691_10013227 3300025940 Bacteria 7903
433 Ga0207691_10255159 3300025940 Bacteria 1513
434 Ga0207691_10286749 3300025940 Bacteria 1416
435 Ga0207691_11605624 3300025940 Bacteria 529
436 Ga0207711_11821502 3300025941 Bacteria 552
437 Ga0207689_10133971 3300025942 Bacteria 2040
438 Ga0207689_10516277 3300025942 Bacteria 1002
439 Ga0207689_11185909 3300025942 Bacteria 643
440 Ga0207689_11595433 3300025942 Bacteria 543
441 Ga0207661_10000398 3300025944 Bacteria 28097
442 Ga0207661_10153276 3300025944 Bacteria 1994
443 Ga0207661_10201853 3300025944 Bacteria 1748
444 Ga0207661_10323914 3300025944 Bacteria 1386
445 Ga0207661_10595514 3300025944 Bacteria 1014
446 Ga0207661_11007417 3300025944 Bacteria 767
447 Ga0207661_11437002 3300025944 Bacteria 633
448 Ga0207661_11687359 3300025944 Bacteria 579
449 Ga0207679_10126312 3300025945 Bacteria 2044
450 Ga0207679_10213296 3300025945 Bacteria 1620
451 Ga0207679_10244736 3300025945 Bacteria 1521
452 Ga0207679_11219163 3300025945 Bacteria 691
453 Ga0207667_10429440 3300025949 Bacteria 1344
454 Ga0207667_10456813 3300025949 Bacteria 1298
455 Ga0207651_10210280 3300025960 Bacteria 1565
456 Ga0207651_10804756 3300025960 Bacteria 833
457 Ga0207712_10067426 3300025961 Bacteria 2561
458 Ga0207668_10584821 3300025972 Bacteria 971
459 Ga0207668_10735982 3300025972 Bacteria 869
460 Ga0207668_11375246 3300025972 Bacteria 636
461 Ga0207640_10000778 3300025981 Bacteria 18133
462 Ga0207640_10152069 3300025981 Bacteria 1701
463 Ga0207640_10192376 3300025981 Bacteria 1539
464 Ga0207640_10479643 3300025981 Bacteria 1031
465 Ga0207640_10860749 3300025981 Bacteria 789
466 Ga0207677_10001122 3300026023 Bacteria 14593
467 Ga0207677_10144987 3300026023 Bacteria 1823
468 Ga0207677_10341196 3300026023 Bacteria 1252
469 Ga0207677_10581092 3300026023 Bacteria 981
470 Ga0207677_10751288 3300026023 Bacteria 869
471 Ga0207677_10803451 3300026023 Bacteria 842
472 Ga0207677_10928959 3300026023 Bacteria 786
473 Ga0207703_10636745 3300026035 Bacteria 1011
474 Ga0207639_10741133 3300026041 Bacteria 913
475 Ga0207678_10001328 3300026067 Bacteria 22835
476 Ga0207678_10047028 3300026067 Bacteria 3731
477 Ga0207678_10094513 3300026067 Bacteria 2554
478 Ga0207678_11634229 3300026067 Bacteria 567
479 Ga0207708_10000157 3300026075 Bacteria 53448
480 Ga0207708_10001758 3300026075 Bacteria 16002
481 Ga0207708_10177943 3300026075 Bacteria 1688
482 Ga0207708_10249088 3300026075 Bacteria 1431
483 Ga0207708_10346396 3300026075 Bacteria 1218
484 Ga0207702_10088418 3300026078 Bacteria 2706
485 Ga0207702_10434701 3300026078 Bacteria 1271
486 Ga0207641_10007103 3300026088 Bacteria 9352
487 Ga0207641_10829429 3300026088 Bacteria 916
488 Ga0207648_10068357 3300026089 Bacteria 3095
489 Ga0207648_10073706 3300026089 Bacteria 2975
490 Ga0207648_10079595 3300026089 Bacteria 2859
491 Ga0207648_10158415 3300026089 Bacteria 1999
492 Ga0207676_10054536 3300026095 Bacteria 3134
493 Ga0207676_10233620 3300026095 Bacteria 1645
494 Ga0207676_11211118 3300026095 Bacteria 748
495 Ga0207674_10044201 3300026116 Bacteria 4589
496 Ga0207674_10287460 3300026116 Bacteria 1593
497 Ga0207675_100062080 3300026118 Bacteria 3489
498 Ga0207675_100090817 3300026118 Bacteria 2871
499 Ga0207675_100122575 3300026118 Bacteria 2461
500 Ga0207675_100323396 3300026118 Bacteria 1506
501 Ga0207675_100432322 3300026118 Bacteria 1302
502 Ga0207675_100874894 3300026118 Bacteria 914
503 Ga0207683_10001623 3300026121 Bacteria 20159
504 Ga0207683_10026990 3300026121 Bacteria 4962
505 Ga0207683_11446571 3300026121 Bacteria 635
506 Ga0207698_10000013 3300026142 Bacteria 255414
507 Ga0207698_10018223 3300026142 Bacteria 4779
508 Ga0207428_10001807 3300027907 Bacteria 21908
509 Ga0207428_10017745 3300027907 Bacteria 6103
510 Ga0207428_10206663 3300027907 Bacteria 1476
511 Ga0207428_10255028 3300027907 Bacteria 1307
512 Ga0207428_10256163 3300027907 Bacteria 1304
513 Ga0268266_10033402 3300028379 Bacteria 4374
514 Ga0268266_10197221 3300028379 Bacteria 1841
515 Ga0268266_10244987 3300028379 Bacteria 1656
516 Ga0268266_11613944 3300028379 Bacteria 624
517 Ga0268265_10292873 3300028380 Bacteria 1462
518 Ga0268264_10133948 3300028381 Bacteria 2201
519 Ga0268264_10232960 3300028381 Bacteria 1702
520 Ga0268264_10780218 3300028381 Bacteria 954
521 Ga0265334_10140996 3300028573 Bacteria 854
522 Ga0307408_101075719 3300031548 Bacteria 745
523 Ga0307405_10557817 3300031731 Bacteria 928
524 Ga0307410_10523411 3300031852 Bacteria 979
525 Ga0307410_10845217 3300031852 Bacteria 781
526 Ga0307407_10191028 3300031903 Bacteria 1365
527 Ga0307407_10395530 3300031903 Bacteria 990
528 Ga0307407_10711896 3300031903 Unclassified 757
529 Ga0307412_10703347 3300031911 Bacteria 868
530 Ga0307409_100039378 3300031995 Bacteria 3507
531 Ga0307416_100038250 3300032002 Bacteria 3701
532 Ga0307416_100424452 3300032002 Bacteria 1375
533 Ga0307416_100797759 3300032002 Bacteria 1040
534 Ga0307411_10234766 3300032005 Bacteria 1432
535 Ga0307415_100002829 3300032126 Bacteria 8688
536 Ga0307415_100205028 3300032126 Bacteria 1568
537 Ga0307415_100244925 3300032126 Bacteria 1453
538 Ga0307415_100636672 3300032126 Bacteria 954
539 Ga0373923_0238991 3300035111 Bacteria 848
540 Ga0373941_0467729 3300035115 Bacteria 532
541 Ga0373953_0052036 3300035117 Bacteria 1657
542 Ga0373955_0052893 3300035172 Bacteria 2216
543 Ga0316574_0073131 3300035398 Bacteria 2167
544 Ga0373924_0304577 3300035410 Bacteria 708
545 Ga0373931_1102134 3300035691 Bacteria 541
546 Ga0373935_0143470 3300035692 Bacteria 1615
547 Ga0373937_0601405 3300036401 Bacteria 1044
548 Ga0373937_0628956 3300036401 Bacteria 1018
549 Ga0316582_0238719 3300036647 Bacteria 1245
550 Ga0395900_0052131 3300037418 Bacteria 4212
551 Ga0395898_0000894 3300037466 Bacteria 48455
552 Ga0395898_0021778 3300037466 Bacteria 6495
553 Ga0395905_0186693 3300037471 Bacteria 1946
554 Ga0316581_0214286 3300037588 Bacteria 592
555 Ga0436364_0115266 3300037853 Bacteria 1322
556 Ga0436364_0118612 3300037853 Bacteria 3657
557 Ga0436364_0159150 3300037853 Bacteria 9191
558 Ga0436364_0159207 3300037853 Bacteria 28255
559 Ga0436364_0286486 3300037853 Bacteria 824
560 Ga0436364_0334646 3300037853 Bacteria 5280
561 Ga0436364_0503224 3300037853 Bacteria 5084
562 Ga0436364_0744537 3300037853 Bacteria 1077
563 Ga0436364_0810387 3300037853 Bacteria 781
564 Ga0436364_1245246 3300037853 Bacteria 3910
565 Ga0436364_1339551 3300037853 Bacteria 15044
566 Ga0436364_1372536 3300037853 Bacteria 1430
567 Ga0436364_1375186 3300037853 Bacteria 86866
568 Ga0436364_1467838 3300037853 Bacteria 3986
569 Ga0395901_0019363 3300038443 Bacteria 6958
570 Ga0395901_0205625 3300038443 Bacteria 2063
571 Ga0395901_1063397 3300038443 Bacteria 782
572 Ga0395901_1758017 3300038443 Bacteria 570
573 Ga0436365_0004038 3300039437 Bacteria 26265
574 Ga0436365_0405628 3300039437 Bacteria 733
575 Ga0436365_0896130 3300039437 Bacteria 22043
576 Ga0436365_1001279 3300039437 Bacteria 29327
577 Ga0436365_1500157 3300039437 Bacteria 750
578 Ga0436365_1510673 3300039437 Bacteria 7863
579 Ga0436365_1758755 3300039437 Bacteria 3726
580 Ga0436365_1811968 3300039437 Bacteria 1332
581 Ga0436363_0134081 3300039450 Bacteria 1035
582 Ga0436363_0294066 3300039450 Bacteria 957
583 Ga0436363_0550340 3300039450 Bacteria 612
584 Ga0436363_0760459 3300039450 Bacteria 34430
585 Ga0436363_0843533 3300039450 Bacteria 7913
586 Ga0436363_1431625 3300039450 Bacteria 5053
587 Ga0436363_1449147 3300039450 Bacteria 548
588 Ga0436363_1608452 3300039450 Bacteria 1603
589 Ga0436363_1691717 3300039450 Bacteria 5219
590 Ga0436362_0339746 3300039453 Bacteria 4301
591 Ga0436362_0344812 3300039453 Bacteria 591
592 Ga0436362_0400860 3300039453 Bacteria 3040
593 Ga0436362_0712899 3300039453 Bacteria 535
594 Ga0436362_0787061 3300039453 Bacteria 1396
595 Ga0451789_0804322 3300041443 Bacteria 633
596 Ga0451800_1619457 3300041459 Bacteria 512
597 Ga0451802_0871605 3300041460 Bacteria 597
598 Ga0451833_0916368 3300041491 Bacteria 989
599 Ga0451853_1043671 3300041512 Bacteria 595
600 Ga0439460_0125632 3300042461 Bacteria 842
601 Ga0439460_0183014 3300042461 Bacteria 709
602 Ga0466969_0221621 3300044656 Bacteria 860
603 Ga0466969_0223196 3300044656 Bacteria 857
604 Ga0466969_0284550 3300044656 Bacteria 748
605 Ga0466969_0502549 3300044656 Bacteria 553
606 Ga0466965_0853340 3300044683 Bacteria 529
607 Ga0466966_0112517 3300044684 Bacteria 1677
608 Ga0466966_0157141 3300044684 Bacteria 1385
609 Ga0466966_0172649 3300044684 Bacteria 1313
610 Ga0466966_0349418 3300044684 Bacteria 889
611 Ga0466966_0655980 3300044684 Bacteria 632
612 Ga0466961_0004704 3300044693 Bacteria 8585
613 Ga0466961_0041318 3300044693 Bacteria 2957
614 Ga0466961_0207612 3300044693 Bacteria 1210
615 Ga0466961_0360147 3300044693 Bacteria 885
616 Ga0466961_0525364 3300044693 Bacteria 714
617 Ga0466961_0794879 3300044693 Bacteria 565
618 Ga0466963_0007807 3300044694 Bacteria 6400
619 Ga0466963_0013255 3300044694 Bacteria 5060
620 Ga0466963_0049400 3300044694 Bacteria 2782
621 Ga0466963_0051798 3300044694 Bacteria 2722
622 Ga0466963_0065596 3300044694 Bacteria 2434
623 Ga0466963_0105953 3300044694 Bacteria 1927
624 Ga0466963_0158205 3300044694 Bacteria 1576
625 Ga0466963_0230379 3300044694 Bacteria 1298
626 Ga0466963_0269254 3300044694 Bacteria 1197
627 Ga0466963_0351371 3300044694 Bacteria 1038
628 Ga0466963_0366966 3300044694 Bacteria 1014
629 Ga0466963_0438048 3300044694 Bacteria 922
630 Ga0466963_0734848 3300044694 Bacteria 696
631 Ga0466963_0985236 3300044694 Bacteria 594
632 Ga0453684_0194694 3300044712 Bacteria 2368
633 Ga0466971_0005233 3300044719 Bacteria 5617
634 Ga0466971_0041424 3300044719 Bacteria 2068
635 Ga0466971_0106899 3300044719 Bacteria 1289
636 Ga0466971_0111028 3300044719 Bacteria 1265
637 Ga0466971_0203027 3300044719 Bacteria 936
638 Ga0466968_0070826 3300044735 Bacteria 1518
639 Ga0466968_0091123 3300044735 Bacteria 1351
640 Ga0466968_0151471 3300044735 Bacteria 1066
641 Ga0466968_0185461 3300044735 Bacteria 969
642 Ga0466970_0410857 3300044765 Bacteria 773
643 Ga0466970_0812029 3300044765 Bacteria 548
644 Ga0466957_0005549 3300044842 Bacteria 7086
645 Ga0466957_0080081 3300044842 Bacteria 2033
646 Ga0466957_0154050 3300044842 Bacteria 1488
647 Ga0466957_0169457 3300044842 Bacteria 1422
648 Ga0466957_0337386 3300044842 Bacteria 1020
649 Ga0466957_0741153 3300044842 Bacteria 695
650 Ga0466960_0000064 3300044901 Bacteria 35453
651 Ga0466960_0229807 3300044901 Bacteria 1024
652 Ga0466960_0297199 3300044901 Bacteria 909
653 Ga0466960_0454690 3300044901 Bacteria 745
654 Ga0466960_0830518 3300044901 Bacteria 561
655 Ga0466959_0018317 3300045049 Bacteria 5141
656 Ga0466959_0054464 3300045049 Bacteria 2922
657 Ga0466959_0096623 3300045049 Bacteria 2118
658 Ga0466959_0098486 3300045049 Bacteria 2095
659 Ga0466959_0102830 3300045049 Bacteria 2044
660 Ga0466959_0118442 3300045049 Bacteria 1885
661 Ga0466959_0125962 3300045049 Bacteria 1818
662 Ga0466959_0147463 3300045049 Bacteria 1660
663 Ga0466959_0244931 3300045049 Bacteria 1237
664 Ga0466959_0691815 3300045049 Bacteria 684
665 Ga0466959_0984842 3300045049 Bacteria 562
666 Ga0466958_0001574 3300045836 Bacteria 10946
667 Ga0466958_0011629 3300045836 Bacteria 4961
668 Ga0466958_0014890 3300045836 Bacteria 4446
669 Ga0466958_0023271 3300045836 Bacteria 3634
670 Ga0466958_0067510 3300045836 Bacteria 2185
671 Ga0466958_0067718 3300045836 Bacteria 2181
672 Ga0466958_0177414 3300045836 Bacteria 1351
673 Ga0466958_0238515 3300045836 Bacteria 1162
674 Ga0466958_0330839 3300045836 Bacteria 979
675 Ga0466958_0740000 3300045836 Bacteria 641
676 Ga0466958_0954554 3300045836 Bacteria 559
677 Ga0466967_0004705 3300045976 Bacteria 9276
678 Ga0466967_0005204 3300045976 Bacteria 8958
679 Ga0466967_0008602 3300045976 Bacteria 7502
680 Ga0466967_0012278 3300045976 Bacteria 6543
681 Ga0466967_0023706 3300045976 Bacteria 5033
682 Ga0466967_0023917 3300045976 Bacteria 5015
683 Ga0466967_0080963 3300045976 Bacteria 2932
684 Ga0466967_0089796 3300045976 Bacteria 2790
685 Ga0466967_0140119 3300045976 Bacteria 2252
686 Ga0466967_0178602 3300045976 Bacteria 2001
687 Ga0466967_0331438 3300045976 Bacteria 1470
688 Ga0466967_0432383 3300045976 Bacteria 1284
689 Ga0466967_0439199 3300045976 Bacteria 1274
690 Ga0466967_0489296 3300045976 Bacteria 1206
691 Ga0466967_0498869 3300045976 Bacteria 1194
692 Ga0466967_0689907 3300045976 Bacteria 1011
693 Ga0466967_0791826 3300045976 Bacteria 941
694 Ga0466967_1787722 3300045976 Bacteria 612
695 Ga0466967_1877793 3300045976 Bacteria 596
696 Ga0466967_2275972 3300045976 Bacteria 538
697 Ga0495592_0466152 3300046454 Bacteria 789
698 Ga0495641_0001080 3300046461 Bacteria 23509
699 Ga0495641_0112982 3300046461 Bacteria 1212
700 Ga0495641_0488691 3300046461 Bacteria 561
701 Ga0495651_0006559 3300046462 Bacteria 8886
702 Ga0495653_0014652 3300046463 Bacteria 6397
703 Ga0495650_0000053 3300046471 Bacteria 316684
704 Ga0495582_0544777 3300046473 Bacteria 671
705 Ga0495585_0343213 3300046492 Bacteria 727
706 Ga0495606_0000072 3300046507 Bacteria 173678
707 Ga0495608_0056557 3300046511 Unclassified 2590
708 Ga0495618_0009790 3300046514 Bacteria 5794
709 Ga0495618_0281270 3300046514 Bacteria 1038
710 Ga0495628_0036020 3300046516 Bacteria 3974
711 Ga0495628_0144247 3300046516 Bacteria 1816
712 Ga0495630_0000020 3300046517 Bacteria 176389
713 Ga0495652_0028874 3300046529 Bacteria 4876
714 Ga0495652_0035637 3300046529 Bacteria 4330
715 Ga0495640_0132726 3300046533 Bacteria 1610
716 Ga0495640_0360231 3300046533 Bacteria 897
717 Ga0495587_0009780 3300046536 Bacteria 6129
718 Ga0495645_0170386 3300046543 Bacteria 1499
719 Ga0495645_0280815 3300046543 Unclassified 1095
720 Ga0495622_0000789 3300046557 Bacteria 17646
721 Ga0495667_0001023 3300046559 Bacteria 18094
722 Ga0495656_0346050 3300046615 Bacteria 769
723 Ga0495634_0066330 3300046642 Bacteria 2390
724 Ga0495635_0222215 3300046663 Bacteria 1277
725 Ga0495588_0343354 3300046674 Bacteria 785
726 Ga0495657_0021964 3300046675 Bacteria 4575
727 Ga0495599_0008369 3300046678 Bacteria 6286
728 Ga0495599_0308155 3300046678 Bacteria 955
729 Ga0495646_0015211 3300046680 Bacteria 4887
730 Ga0495658_0217581 3300046683 Bacteria 1195
731 Ga0495613_0719357 3300046689 Bacteria 656
732 Ga0495649_0005280 3300046694 Bacteria 8253
733 Ga0495600_0047127 3300046809 Bacteria 2811
734 Ga0495600_0130333 3300046809 Bacteria 1635
735 Ga0495660_0200929 3300046810 Bacteria 952
736 Ga0495581_0724179 3300047315 Bacteria 573
737 Ga0495604_0006333 3300047317 Bacteria 9386
738 Ga0495604_0066597 3300047317 Bacteria 2739
739 Ga0495604_0130850 3300047317 Bacteria 1804
740 Ga0495674_0076400 3300047319 Bacteria 2881
741 Ga0495674_0306717 3300047319 Bacteria 1296
742 Ga0495672_0084135 3300047320 Bacteria 1765
743 Ga0495680_0080447 3300047322 Bacteria 2462
744 Ga0495684_0006748 3300047471 Bacteria 8912
745 Ga0495686_0689727 3300047472 Bacteria 522
746 Ga0495593_0246985 3300047673 Bacteria 894
747 Ga0495602_0000070 3300048088 Bacteria 100656
748 Ga0495602_0130794 3300048088 Bacteria 2002
749 Ga0495602_0380243 3300048088 Bacteria 1012
750 Ga0495614_0151794 3300048089 Bacteria 1034
751 Ga0496100_0011865 3300048903 Bacteria 4974
752 Ga0496100_0116816 3300048903 Bacteria 1862
753 Ga0496100_0396129 3300048903 Bacteria 1051
754 Ga0496100_0590180 3300048903 Bacteria 862
755 Ga0496100_0996514 3300048903 Bacteria 659
756 Ga0496100_1263026 3300048903 Bacteria 583
757 Ga0496101_0029261 3300048904 Bacteria 3853
758 Ga0496101_0099390 3300048904 Bacteria 2175
759 Ga0496101_0408568 3300048904 Bacteria 1070
760 Ga0496101_0611504 3300048904 Bacteria 861
761 Ga0496102_0013835 3300048905 Bacteria 7003
762 Ga0496102_0018938 3300048905 Bacteria 6056
763 Ga0496102_0319883 3300048905 Bacteria 1462
764 Ga0496102_0479607 3300048905 Bacteria 1165
765 Ga0496102_0480703 3300048905 Bacteria 1163
766 Ga0496103_0107501 3300048906 Bacteria 1770
767 Ga0496103_0669782 3300048906 Bacteria 659
768 Ga0496104_0006465 3300048907 Bacteria 10301
769 Ga0496104_0012549 3300048907 Bacteria 7624
770 Ga0496104_0031238 3300048907 Bacteria 4952
771 Ga0496104_0496185 3300048907 Bacteria 1132
772 Ga0496104_0944022 3300048907 Bacteria 767
773 Ga0496105_0010069 3300048908 Bacteria 7420
774 Ga0496105_0043554 3300048908 Bacteria 3702
775 Ga0496105_0073928 3300048908 Bacteria 2816
776 Ga0496106_0000013 3300048909 Bacteria 202263
777 Ga0496106_0001792 3300048909 Bacteria 16049
778 Ga0496106_0026312 3300048909 Bacteria 4331
779 Ga0496106_0063292 3300048909 Bacteria 2811
780 Ga0496106_0072232 3300048909 Bacteria 2639
781 Ga0496106_0086508 3300048909 Bacteria 2414
782 Ga0496107_0036827 3300048910 Bacteria 3510
783 Ga0496107_0053073 3300048910 Bacteria 2924
784 Ga0496107_0067100 3300048910 Bacteria 2602
785 Ga0496107_0109180 3300048910 Bacteria 2032
786 Ga0496107_0713766 3300048910 Bacteria 737
787 Ga0496107_0908657 3300048910 Bacteria 641
788 Ga0496108_0000146 3300048911 Bacteria 67618
789 Ga0496108_0000832 3300048911 Bacteria 24019
790 Ga0496108_0026006 3300048911 Bacteria 4827
791 Ga0496108_0058642 3300048911 Bacteria 3236
792 Ga0496108_0098170 3300048911 Bacteria 2496
793 Ga0496108_0494064 3300048911 Bacteria 1069
794 Ga0496108_0847941 3300048911 Bacteria 786
795 Ga0496109_0000146 3300048912 Bacteria 69777
796 Ga0496109_0000226 3300048912 Bacteria 54895
797 Ga0496109_0000297 3300048912 Bacteria 47127
798 Ga0496109_0020937 3300048912 Bacteria 5780
799 Ga0496109_0032131 3300048912 Bacteria 4715
800 Ga0496109_0080083 3300048912 Bacteria 3009
801 Ga0496109_0117167 3300048912 Bacteria 2479
802 Ga0496109_0216489 3300048912 Bacteria 1801
803 Ga0496109_0223882 3300048912 Bacteria 1769
804 Ga0496109_1116073 3300048912 Bacteria 726
805 Ga0496109_1167737 3300048912 Bacteria 707
806 Ga0496110_0034676 3300048913 Bacteria 4373
807 Ga0496110_0070834 3300048913 Bacteria 3090
808 Ga0496110_0268505 3300048913 Bacteria 1553
809 Ga0496110_0299285 3300048913 Bacteria 1465
810 Ga0496110_0365975 3300048913 Bacteria 1314
811 Ga0496110_0845407 3300048913 Bacteria 820
812 Ga0496111_0029976 3300048914 Bacteria 3867
813 Ga0496111_0036409 3300048914 Bacteria 3518
814 Ga0496111_0204695 3300048914 Bacteria 1467
815 Ga0496111_0215665 3300048914 Bacteria 1426
816 Ga0496111_0318860 3300048914 Bacteria 1151
817 Ga0496112_0000153 3300048915 Bacteria 43240
818 Ga0496112_0004480 3300048915 Bacteria 11847
819 Ga0496112_0013821 3300048915 Bacteria 7468
820 Ga0496112_0037880 3300048915 Bacteria 4709
821 Ga0496112_0040461 3300048915 Bacteria 4557
822 Ga0496112_0054181 3300048915 Bacteria 3940
823 Ga0496112_0072498 3300048915 Bacteria 3405
824 Ga0496112_0224619 3300048915 Bacteria 1833
825 Ga0496112_0502535 3300048915 Bacteria 1148
826 Ga0496112_1325304 3300048915 Bacteria 635
827 Ga0496113_0000004 3300048916 Bacteria 109489
828 Ga0496113_0002975 3300048916 Bacteria 10026
829 Ga0496113_0009800 3300048916 Bacteria 6302
830 Ga0496113_0015578 3300048916 Bacteria 5231
831 Ga0496113_0017293 3300048916 Bacteria 5002
832 Ga0496113_0028738 3300048916 Bacteria 4003
833 Ga0496113_0178271 3300048916 Bacteria 1684
834 Ga0496113_0267868 3300048916 Bacteria 1365
835 Ga0496113_0449583 3300048916 Bacteria 1035
836 Ga0496114_0073737 3300048917 Bacteria 2873
837 Ga0496114_0093555 3300048917 Bacteria 2556
838 Ga0496114_0179768 3300048917 Bacteria 1847
839 Ga0496114_0607477 3300048917 Bacteria 964
840 Ga0496115_0000070 3300048918 Bacteria 91981
841 Ga0496115_0000243 3300048918 Bacteria 49388
842 Ga0496115_0003897 3300048918 Bacteria 10750
843 Ga0496115_0019289 3300048918 Bacteria 5248
844 Ga0496121_0079589 3300048924 Bacteria 2601
845 Ga0501032_0006397 3300049569 Bacteria 8668
846 Ga0501033_0116250 3300049570 Bacteria 1943
847 Ga0501034_0093581 3300049571 Bacteria 3002
848 Ga0501034_0589921 3300049571 Bacteria 1017
849 Ga0501036_0189743 3300049572 Bacteria 1729
850 Ga0501038_0015020 3300049574 Bacteria 7053
851 Ga0501042_0030232 3300049578 Bacteria 3824
852 Ga0501043_0320154 3300049579 Bacteria 1182
853 Ga0501043_1016887 3300049579 Bacteria 589
854 Ga0501046_0135884 3300049580 Bacteria 1862
855 Ga0501047_0282569 3300049581 Bacteria 1504
856 Ga0501047_0578950 3300049581 Bacteria 945
857 Ga0501048_0118322 3300049582 Bacteria 1872
858 Ga0501048_0291099 3300049582 Bacteria 1161
859 Ga0501067_0105310 3300049583 Bacteria 1567
860 Ga0501069_0058814 3300049585 Bacteria 2144
861 Ga0501070_0375198 3300049586 Bacteria 1152
862 Ga0501071_0694418 3300049587 Bacteria 783
863 Ga0501072_0481792 3300049588 Bacteria 982
864 Ga0501072_0637491 3300049588 Bacteria 839
865 Ga0501073_0003796 3300049589 Bacteria 11355
866 Ga0501074_0216437 3300049590 Bacteria 1364
867 Ga0501080_1498292 3300049742 Bacteria 573
868 Ga0501083_0121759 3300049744 Bacteria 1711
869 Ga0501044_0067143 3300049823 Bacteria 3654
870 Ga0501044_0159492 3300049823 Bacteria 2234
871 Ga0501045_0487507 3300049824 Bacteria 916
872 nmdc:mga03n38_231540_c1 3300050490 Bacteria 969
873 nmdc:mga00v17_175309_c1 3300050491 Bacteria 1383
874 nmdc:mga00v17_177348_c1 3300050491 Bacteria 1375
875 nmdc:mga00v17_189584_c1 3300050491 Bacteria 1328
876 nmdc:mga0yw44_2043_c2 3300050492 Bacteria 4356
877 nmdc:mga0yw44_95271_c1 3300050492 Bacteria 1888
878 nmdc:mga06z11_44670_c1 3300050494 Bacteria 2235
879 nmdc:mga06z11_551729_c1 3300050494 Bacteria 700
880 nmdc:mga05p37_1099293_c1 3300050507 Bacteria 833
881 nmdc:mga05p37_24410_c1 3300050507 Bacteria 7347
882 nmdc:mga05p37_46413_c1 3300050507 Bacteria 5342
883 nmdc:mga09592_11930_c1 3300050508 Bacteria 7070
884 nmdc:mga09592_318697_c1 3300050508 Bacteria 1347
885 nmdc:mga09592_333385_c1 3300050508 Bacteria 1313
886 nmdc:mga09592_773877_c1 3300050508 Bacteria 813
887 nmdc:mga06r32_30770_c1 3300050510 Bacteria 5037
888 nmdc:mga06r32_499245_c1 3300050510 Unclassified 1194
889 nmdc:mga08y16_1008343_c1 3300050511 Bacteria 812
890 nmdc:mga08y16_33168_c1 3300050511 Bacteria 5424
891 nmdc:mga08y16_37344_c1 3300050511 Bacteria 5102
892 nmdc:mga08y16_4830_c1 3300050511 Bacteria 14064
893 nmdc:mga08y16_69212_c1 3300050511 Bacteria 3679
894 nmdc:mga08y16_868032_c1 3300050511 Bacteria 890
895 nmdc:mga0n895_1085036_c1 3300050512 Bacteria 778
896 nmdc:mga0n895_662377_c1 3300050512 Bacteria 1042
897 nmdc:mga0rr50_42833_c1 3300050513 Bacteria 3309
898 nmdc:mga08x19_268735_c1 3300050514 Bacteria 1180
899 nmdc:mga08x19_978916_c1 3300050514 Bacteria 601
900 nmdc:mga0a205_121071_c1 3300050515 Bacteria 2516
901 nmdc:mga0a205_304390_c1 3300050515 Bacteria 1466
902 Ga0495601_0000032 3300053077 Bacteria 102174
903 Ga0495601_0260804 3300053077 Bacteria 1131
904 Ga0495612_0016370 3300053078 Bacteria 2972
905 Ga0495612_0307795 3300053078 Bacteria 711
906 Ga0495655_0031357 3300053083 Bacteria 1293
907 Ga0495655_0048773 3300053083 Bacteria 1113
908 Ga0495595_0010720 3300053084 Bacteria 3818
909 Ga0495595_0028266 3300053084 Bacteria 2504
910 Ga0495595_0111842 3300053084 Bacteria 1325
911 Ga0500614_001722 3300053123 Bacteria 5104
912 Ga0501082_0007829 3300060353 Bacteria 9223
913 Ga0501082_0642955 3300060353 Bacteria 928
914 Ga0466962_0026617 3300061719 Bacteria 2776
915 Ga0466962_0028941 3300061719 Bacteria 2653
916 Ga0466962_0035984 3300061719 Bacteria 2369
917 Ga0466962_0181769 3300061719 Bacteria 1025
918 Ga0466962_0381449 3300061719 Bacteria 704
919 Ga0466962_0736130 3300061719 Bacteria 507

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005344 Ga0070661_101291559 Ga0070661_1012915592 132
2 3300005329 Ga0070683_100026711 Ga0070683_1000267115 137
3 3300005337 Ga0070682_100055481 Ga0070682_1000554812 137
4 3300005338 Ga0068868_100538467 Ga0068868_1005384673 137
5 3300005345 Ga0070692_10028829 Ga0070692_100288294 137
6 3300005438 Ga0070701_10120835 Ga0070701_101208352 137
7 3300005444 Ga0070694_100138373 Ga0070694_1001383733 137
8 3300005455 Ga0070663_100170054 Ga0070663_1001700543 137
9 3300005456 Ga0070678_100560205 Ga0070678_1005602052 137
10 3300005459 Ga0068867_100110699 Ga0068867_1001106993 137
11 3300005535 Ga0070684_100148946 Ga0070684_1001489464 137
12 3300005547 Ga0070693_100250045 Ga0070693_1002500452 137
13 3300005548 Ga0070665_100240530 Ga0070665_1002405301 137
14 3300005549 Ga0070704_100174082 Ga0070704_1001740823 137
15 3300005578 Ga0068854_100129861 Ga0068854_1001298613 137
16 3300005614 Ga0068856_100249054 Ga0068856_1002490543 137
17 3300005615 Ga0070702_100006043 Ga0070702_1000060434 137
18 3300005615 Ga0070702_100851200 Ga0070702_1008512001 137
19 3300005618 Ga0068864_100063321 Ga0068864_1000633214 137
20 3300005618 Ga0068864_101016690 Ga0068864_1010166902 137
21 3300005718 Ga0068866_10684796 Ga0068866_106847961 137
22 3300005719 Ga0068861_100344640 Ga0068861_1003446402 137
23 3300005840 Ga0068870_10019487 Ga0068870_100194875 137
24 3300005843 Ga0068860_100292313 Ga0068860_1002923132 137
25 3300005844 Ga0068862_100101142 Ga0068862_1001011424 137
26 3300006852 Ga0075433_10556818 Ga0075433_105568182 137
27 3300006871 Ga0075434_102325798 Ga0075434_1023257982 137
28 3300009011 Ga0105251_10328108 Ga0105251_103281082 137
29 3300009094 Ga0111539_10228597 Ga0111539_102285974 137
30 3300009098 Ga0105245_10019669 Ga0105245_100196693 137
31 3300009147 Ga0114129_13338273 Ga0114129_133382731 137
32 3300009176 Ga0105242_12552559 Ga0105242_125525591 137
33 3300009551 Ga0105238_10268058 Ga0105238_102680583 137
34 3300009553 Ga0105249_10063268 Ga0105249_100632684 137
35 3300013296 Ga0157374_10351592 Ga0157374_103515921 137
36 3300013306 Ga0163162_13492383 Ga0163162_134923832 137
37 3300014325 Ga0163163_10113311 Ga0163163_101133113 137
38 3300014325 Ga0163163_10300942 Ga0163163_103009423 137
39 3300014968 Ga0157379_10005485 Ga0157379_100054856 137
40 3300014969 Ga0157376_11168804 Ga0157376_111688041 137
41 3300025908 Ga0207643_10155169 Ga0207643_101551693 137
42 3300025918 Ga0207662_10037290 Ga0207662_100372901 137
43 3300025921 Ga0207652_10385053 Ga0207652_103850532 137
44 3300025921 Ga0207652_11298054 Ga0207652_112980541 137
45 3300025927 Ga0207687_10074228 Ga0207687_100742283 137
46 3300025932 Ga0207690_10287309 Ga0207690_102873093 137
47 3300025934 Ga0207686_10536650 Ga0207686_105366501 137
48 3300025936 Ga0207670_10138907 Ga0207670_101389073 137
49 3300025940 Ga0207691_10286749 Ga0207691_102867491 137
50 3300025944 Ga0207661_11437002 Ga0207661_114370021 137
51 3300025972 Ga0207668_10735982 Ga0207668_107359822 137
52 3300025981 Ga0207640_10479643 Ga0207640_104796432 137
53 3300026067 Ga0207678_10047028 Ga0207678_100470284 137
54 3300026089 Ga0207648_10073706 Ga0207648_100737062 137
55 3300026095 Ga0207676_11211118 Ga0207676_112111182 137
56 3300026118 Ga0207675_100432322 Ga0207675_1004323222 137
57 3300026121 Ga0207683_10026990 Ga0207683_100269905 137
58 3300028379 Ga0268266_10197221 Ga0268266_101972211 137
59 3300028381 Ga0268264_10133948 Ga0268264_101339484 137
60 3300032002 Ga0307416_100797759 Ga0307416_1007977592 137
61 3300035115 Ga0373941_0467729 Ga0373941_0467729_49_465 137
62 3300035691 Ga0373931_1102134 Ga0373931_1102134_109_525 137
63 3300037466 Ga0395898_0021778 Ga0395898_0021778_1143_1559 137
64 3300037471 Ga0395905_0186693 Ga0395905_0186693_605_1021 137
65 3300038443 Ga0395901_0019363 Ga0395901_0019363_4508_4924 137
66 3300038443 Ga0395901_1758017 Ga0395901_1758017_75_491 137
67 3300046471 Ga0495650_0000053 Ga0495650_0000053_280624_281040 137
68 3300046674 Ga0495588_0343354 Ga0495588_0343354_152_568 137
69 3300047472 Ga0495686_0689727 Ga0495686_0689727_79_504 137
70 3300048903 Ga0496100_0396129 Ga0496100_0396129_299_715 137
71 3300048904 Ga0496101_0029261 Ga0496101_0029261_3322_3738 137
72 3300048904 Ga0496101_0611504 Ga0496101_0611504_91_507 137
73 3300048905 Ga0496102_0013835 Ga0496102_0013835_4305_4721 137
74 3300048905 Ga0496102_0480703 Ga0496102_0480703_711_1127 137
75 3300048906 Ga0496103_0107501 Ga0496103_0107501_626_1042 137
76 3300048909 Ga0496106_0086508 Ga0496106_0086508_68_484 137
77 3300048910 Ga0496107_0053073 Ga0496107_0053073_465_881 137
78 3300048911 Ga0496108_0847941 Ga0496108_0847941_291_707 137
79 3300048912 Ga0496109_0080083 Ga0496109_0080083_1203_1619 137
80 3300048913 Ga0496110_0845407 Ga0496110_0845407_299_715 137
81 3300048914 Ga0496111_0318860 Ga0496111_0318860_262_678 137
82 3300048915 Ga0496112_0040461 Ga0496112_0040461_2621_3037 137
83 3300048915 Ga0496112_0224619 Ga0496112_0224619_241_657 137
84 3300048916 Ga0496113_0028738 Ga0496113_0028738_65_481 137
85 3300048916 Ga0496113_0449583 Ga0496113_0449583_499_915 137
86 3300048917 Ga0496114_0607477 Ga0496114_0607477_458_874 137
87 3300050512 nmdc:mga0n895_1085036_c1 nmdc:mga0n895_1085036_c1_10_426 137
88 3300050514 nmdc:mga08x19_978916_c1 nmdc:mga08x19_978916_c1_70_486 137
89 3300053083 Ga0495655_0048773 Ga0495655_0048773_528_944 137
90 3300000549 LJQas_1011064 LJQas_10110642 138
91 3300001991 JGI24743J22301_10097128 JGI24743J22301_100971282 138
92 3300002067 JGI24735J21928_10131152 JGI24735J21928_101311522 138
93 3300002075 JGI24738J21930_10089376 JGI24738J21930_100893762 138
94 3300005327 Ga0070658_10042605 Ga0070658_100426052 138
95 3300005327 Ga0070658_10297396 Ga0070658_102973962 138
96 3300005329 Ga0070683_100047029 Ga0070683_1000470293 138
97 3300005329 Ga0070683_100205873 Ga0070683_1002058732 138
98 3300005329 Ga0070683_100241392 Ga0070683_1002413922 138
99 3300005329 Ga0070683_101382764 Ga0070683_1013827642 138
100 3300005331 Ga0070670_100021832 Ga0070670_1000218326 138
101 3300005334 Ga0068869_100351431 Ga0068869_1003514311 138
102 3300005334 Ga0068869_100356138 Ga0068869_1003561382 138
103 3300005334 Ga0068869_100681778 Ga0068869_1006817781 138
104 3300005336 Ga0070680_100198605 Ga0070680_1001986053 138
105 3300005337 Ga0070682_100032367 Ga0070682_1000323672 138
106 3300005337 Ga0070682_101389634 Ga0070682_1013896341 138
107 3300005338 Ga0068868_100236685 Ga0068868_1002366852 138
108 3300005338 Ga0068868_100324923 Ga0068868_1003249233 138
109 3300005338 Ga0068868_100620307 Ga0068868_1006203072 138
110 3300005339 Ga0070660_100002077 Ga0070660_1000020773 138
111 3300005339 Ga0070660_100009618 Ga0070660_1000096188 138
112 3300005339 Ga0070660_100511027 Ga0070660_1005110272 138
113 3300005344 Ga0070661_100016519 Ga0070661_1000165191 138
114 3300005344 Ga0070661_101249890 Ga0070661_1012498901 138
115 3300005345 Ga0070692_10001942 Ga0070692_100019427 138
116 3300005345 Ga0070692_10027075 Ga0070692_100270751 138
117 3300005347 Ga0070668_100112766 Ga0070668_1001127662 138
118 3300005347 Ga0070668_100149824 Ga0070668_1001498242 138
119 3300005353 Ga0070669_100314808 Ga0070669_1003148082 138
120 3300005354 Ga0070675_100184136 Ga0070675_1001841362 138
121 3300005354 Ga0070675_101073403 Ga0070675_1010734032 138
122 3300005356 Ga0070674_100021654 Ga0070674_1000216545 138
123 3300005364 Ga0070673_100171894 Ga0070673_1001718943 138
124 3300005365 Ga0070688_100148159 Ga0070688_1001481592 138
125 3300005366 Ga0070659_100000051 Ga0070659_10000005117 138
126 3300005366 Ga0070659_100009171 Ga0070659_1000091713 138
127 3300005435 Ga0070714_100235963 Ga0070714_1002359632 138
128 3300005436 Ga0070713_100122520 Ga0070713_1001225202 138
129 3300005438 Ga0070701_10126534 Ga0070701_101265343 138
130 3300005438 Ga0070701_10161515 Ga0070701_101615152 138
131 3300005438 Ga0070701_10423234 Ga0070701_104232342 138
132 3300005441 Ga0070700_100030018 Ga0070700_1000300185 138
133 3300005441 Ga0070700_100063360 Ga0070700_1000633603 138
134 3300005441 Ga0070700_101932304 Ga0070700_1019323041 138
135 3300005455 Ga0070663_100041109 Ga0070663_1000411092 138
136 3300005457 Ga0070662_100008536 Ga0070662_1000085366 138
137 3300005458 Ga0070681_10748227 Ga0070681_107482272 138
138 3300005459 Ga0068867_100050141 Ga0068867_1000501412 138
139 3300005466 Ga0070685_10143495 Ga0070685_101434953 138
140 3300005530 Ga0070679_100132456 Ga0070679_1001324563 138
141 3300005535 Ga0070684_100015111 Ga0070684_1000151115 138
142 3300005535 Ga0070684_100222054 Ga0070684_1002220543 138
143 3300005539 Ga0068853_100769096 Ga0068853_1007690961 138
144 3300005543 Ga0070672_100025741 Ga0070672_1000257415 138
145 3300005544 Ga0070686_100198158 Ga0070686_1001981582 138
146 3300005546 Ga0070696_100203014 Ga0070696_1002030142 138
147 3300005547 Ga0070693_100067701 Ga0070693_1000677013 138
148 3300005564 Ga0070664_100011227 Ga0070664_1000112272 138
149 3300005564 Ga0070664_100089256 Ga0070664_1000892564 138
150 3300005578 Ga0068854_100208098 Ga0068854_1002080983 138
151 3300005615 Ga0070702_100614531 Ga0070702_1006145312 138
152 3300005617 Ga0068859_100039669 Ga0068859_1000396697 138
153 3300005618 Ga0068864_100673657 Ga0068864_1006736572 138
154 3300005719 Ga0068861_100252453 Ga0068861_1002524532 138
155 3300005834 Ga0068851_10498430 Ga0068851_104984302 138
156 3300005840 Ga0068870_10035752 Ga0068870_100357523 138
157 3300005840 Ga0068870_10538826 Ga0068870_105388262 138
158 3300005842 Ga0068858_100211195 Ga0068858_1002111953 138
159 3300005937 Ga0081455_10551628 Ga0081455_105516281 138
160 3300005983 Ga0081540_1126892 Ga0081540_11268921 138
161 3300006028 Ga0070717_10024989 Ga0070717_100249894 138
162 3300006038 Ga0075365_10044157 Ga0075365_100441574 138
163 3300006038 Ga0075365_10046863 Ga0075365_100468632 138
164 3300006048 Ga0075363_100020772 Ga0075363_1000207725 138
165 3300006051 Ga0075364_10016188 Ga0075364_100161885 138
166 3300006051 Ga0075364_10175443 Ga0075364_101754433 138
167 3300006051 Ga0075364_10200801 Ga0075364_102008012 138
168 3300006051 Ga0075364_10445662 Ga0075364_104456622 138
169 3300006175 Ga0070712_100883404 Ga0070712_1008834042 138
170 3300006178 Ga0075367_10061809 Ga0075367_100618093 138
171 3300006178 Ga0075367_10269922 Ga0075367_102699222 138
172 3300006844 Ga0075428_101367392 Ga0075428_1013673922 138
173 3300006844 Ga0075428_101490690 Ga0075428_1014906902 138
174 3300006871 Ga0075434_100432270 Ga0075434_1004322703 138
175 3300006880 Ga0075429_100069997 Ga0075429_1000699972 138
176 3300006881 Ga0068865_100008559 Ga0068865_1000085592 138
177 3300006931 Ga0097620_100039672 Ga0097620_1000396727 138
178 3300009094 Ga0111539_10081111 Ga0111539_100811115 138
179 3300009094 Ga0111539_10223314 Ga0111539_102233142 138
180 3300009094 Ga0111539_11609505 Ga0111539_116095051 138
181 3300009098 Ga0105245_10155160 Ga0105245_101551603 138
182 3300009148 Ga0105243_10006380 Ga0105243_100063805 138
183 3300009174 Ga0105241_11083928 Ga0105241_110839282 138
184 3300009551 Ga0105238_10114853 Ga0105238_101148533 138
185 3300009553 Ga0105249_10045832 Ga0105249_100458322 138
186 3300010375 Ga0105239_10053648 Ga0105239_100536483 138
187 3300011119 Ga0105246_10663679 Ga0105246_106636792 138
188 3300013296 Ga0157374_10335622 Ga0157374_103356223 138
189 3300013306 Ga0163162_10224868 Ga0163162_102248683 138
190 3300013308 Ga0157375_10218274 Ga0157375_102182743 138
191 3300013308 Ga0157375_11822847 Ga0157375_118228471 138
192 3300014326 Ga0157380_10530144 Ga0157380_105301442 138
193 3300014326 Ga0157380_11853547 Ga0157380_118535472 138
194 3300014745 Ga0157377_10011798 Ga0157377_100117984 138
195 3300014968 Ga0157379_10592601 Ga0157379_105926012 138
196 3300017792 Ga0163161_10515644 Ga0163161_105156442 138
197 3300021388 Ga0213875_10181444 Ga0213875_101814442 138
198 3300025321 Ga0207656_10129913 Ga0207656_101299132 138
199 3300025901 Ga0207688_10097685 Ga0207688_100976852 138
200 3300025908 Ga0207643_10045359 Ga0207643_100453592 138
201 3300025909 Ga0207705_10015308 Ga0207705_100153086 138
202 3300025909 Ga0207705_10229382 Ga0207705_102293822 138
203 3300025911 Ga0207654_10857775 Ga0207654_108577752 138
204 3300025912 Ga0207707_10906610 Ga0207707_109066102 138
205 3300025915 Ga0207693_10855562 Ga0207693_108555622 138
206 3300025917 Ga0207660_10585568 Ga0207660_105855682 138
207 3300025919 Ga0207657_10006150 Ga0207657_1000615010 138
208 3300025919 Ga0207657_10013240 Ga0207657_1001324010 138
209 3300025919 Ga0207657_10411720 Ga0207657_104117202 138
210 3300025920 Ga0207649_10036301 Ga0207649_100363012 138
211 3300025921 Ga0207652_10039125 Ga0207652_100391252 138
212 3300025923 Ga0207681_10165208 Ga0207681_101652082 138
213 3300025924 Ga0207694_10072598 Ga0207694_100725982 138
214 3300025926 Ga0207659_10135601 Ga0207659_101356013 138
215 3300025928 Ga0207700_10335382 Ga0207700_103353822 138
216 3300025929 Ga0207664_10001411 Ga0207664_1000141111 138
217 3300025932 Ga0207690_10430343 Ga0207690_104303432 138
218 3300025932 Ga0207690_11180371 Ga0207690_111803712 138
219 3300025933 Ga0207706_10029844 Ga0207706_100298442 138
220 3300025935 Ga0207709_10533339 Ga0207709_105333392 138
221 3300025936 Ga0207670_10203452 Ga0207670_102034522 138
222 3300025937 Ga0207669_10012356 Ga0207669_100123566 138
223 3300025940 Ga0207691_10013227 Ga0207691_100132276 138
224 3300025940 Ga0207691_11605624 Ga0207691_116056242 138
225 3300025942 Ga0207689_10516277 Ga0207689_105162772 138
226 3300025944 Ga0207661_10201853 Ga0207661_102018532 138
227 3300025944 Ga0207661_10323914 Ga0207661_103239142 138
228 3300025944 Ga0207661_10595514 Ga0207661_105955142 138
229 3300025944 Ga0207661_11687359 Ga0207661_116873592 138
230 3300025945 Ga0207679_10213296 Ga0207679_102132962 138
231 3300025945 Ga0207679_10244736 Ga0207679_102447362 138
232 3300025945 Ga0207679_11219163 Ga0207679_112191632 138
233 3300025960 Ga0207651_10210280 Ga0207651_102102803 138
234 3300025981 Ga0207640_10192376 Ga0207640_101923763 138
235 3300026023 Ga0207677_10144987 Ga0207677_101449872 138
236 3300026023 Ga0207677_10341196 Ga0207677_103411962 138
237 3300026023 Ga0207677_10581092 Ga0207677_105810922 138
238 3300026023 Ga0207677_10751288 Ga0207677_107512881 138
239 3300026041 Ga0207639_10741133 Ga0207639_107411332 138
240 3300026067 Ga0207678_10001328 Ga0207678_1000132818 138
241 3300026067 Ga0207678_11634229 Ga0207678_116342292 138
242 3300026075 Ga0207708_10249088 Ga0207708_102490882 138
243 3300026089 Ga0207648_10068357 Ga0207648_100683574 138
244 3300026118 Ga0207675_100323396 Ga0207675_1003233962 138
245 3300026118 Ga0207675_100874894 Ga0207675_1008748942 138
246 3300026121 Ga0207683_11446571 Ga0207683_114465711 138
247 3300027907 Ga0207428_10206663 Ga0207428_102066633 138
248 3300028379 Ga0268266_10033402 Ga0268266_100334025 138
249 3300028379 Ga0268266_11613944 Ga0268266_116139442 138
250 3300028381 Ga0268264_10780218 Ga0268264_107802181 138
251 3300031548 Ga0307408_101075719 Ga0307408_1010757191 138
252 3300031731 Ga0307405_10557817 Ga0307405_105578171 138
253 3300031903 Ga0307407_10711896 Ga0307407_107118961 138
254 3300031995 Ga0307409_100039378 Ga0307409_1000393783 138
255 3300032002 Ga0307416_100424452 Ga0307416_1004244522 138
256 3300032126 Ga0307415_100205028 Ga0307415_1002050282 138
257 3300035398 Ga0316574_0073131 Ga0316574_0073131_205_624 138
258 3300036647 Ga0316582_0238719 Ga0316582_0238719_461_880 138
259 3300037588 Ga0316581_0214286 Ga0316581_0214286_10_429 138
260 3300037853 Ga0436364_1372536 Ga0436364_1372536_534_953 138
261 3300038443 Ga0395901_1063397 Ga0395901_1063397_280_699 138
262 3300041459 Ga0451800_1619457 Ga0451800_1619457_35_454 138
263 3300041491 Ga0451833_0916368 Ga0451833_0916368_430_849 138
264 3300041512 Ga0451853_1043671 Ga0451853_1043671_53_472 138
265 3300042461 Ga0439460_0183014 Ga0439460_0183014_91_510 138
266 3300044656 Ga0466969_0223196 Ga0466969_0223196_310_729 138
267 3300044693 Ga0466961_0004704 Ga0466961_0004704_905_1324 138
268 3300044693 Ga0466961_0207612 Ga0466961_0207612_708_1127 138
269 3300044694 Ga0466963_0013255 Ga0466963_0013255_4378_4797 138
270 3300044694 Ga0466963_0065596 Ga0466963_0065596_1791_2210 138
271 3300044694 Ga0466963_0269254 Ga0466963_0269254_319_738 138
272 3300044694 Ga0466963_0366966 Ga0466963_0366966_421_840 138
273 3300044694 Ga0466963_0438048 Ga0466963_0438048_415_834 138
274 3300044694 Ga0466963_0985236 Ga0466963_0985236_60_479 138
275 3300044712 Ga0453684_0194694 Ga0453684_0194694_1154_1573 138
276 3300044719 Ga0466971_0005233 Ga0466971_0005233_2536_2955 138
277 3300044719 Ga0466971_0203027 Ga0466971_0203027_354_773 138
278 3300044842 Ga0466957_0005549 Ga0466957_0005549_4779_5198 138
279 3300044842 Ga0466957_0080081 Ga0466957_0080081_1432_1851 138
280 3300044842 Ga0466957_0169457 Ga0466957_0169457_881_1300 138
281 3300044842 Ga0466957_0741153 Ga0466957_0741153_212_631 138
282 3300044901 Ga0466960_0454690 Ga0466960_0454690_70_489 138
283 3300044901 Ga0466960_0830518 Ga0466960_0830518_28_450 138
284 3300045049 Ga0466959_0018317 Ga0466959_0018317_411_830 138
285 3300045049 Ga0466959_0054464 Ga0466959_0054464_2392_2811 138
286 3300045836 Ga0466958_0011629 Ga0466958_0011629_4101_4520 138
287 3300045836 Ga0466958_0023271 Ga0466958_0023271_318_737 138
288 3300045836 Ga0466958_0177414 Ga0466958_0177414_236_655 138
289 3300045836 Ga0466958_0954554 Ga0466958_0954554_84_503 138
290 3300045976 Ga0466967_0004705 Ga0466967_0004705_7630_8049 138
291 3300045976 Ga0466967_0080963 Ga0466967_0080963_2249_2668 138
292 3300045976 Ga0466967_0331438 Ga0466967_0331438_753_1172 138
293 3300045976 Ga0466967_0489296 Ga0466967_0489296_497_916 138
294 3300045976 Ga0466967_0498869 Ga0466967_0498869_385_804 138
295 3300045976 Ga0466967_0791826 Ga0466967_0791826_211_630 138
296 3300045976 Ga0466967_1787722 Ga0466967_1787722_162_581 138
297 3300046461 Ga0495641_0488691 Ga0495641_0488691_23_442 138
298 3300046517 Ga0495630_0000020 Ga0495630_0000020_132442_132861 138
299 3300048903 Ga0496100_0590180 Ga0496100_0590180_327_746 138
300 3300048905 Ga0496102_0319883 Ga0496102_0319883_116_535 138
301 3300048909 Ga0496106_0063292 Ga0496106_0063292_51_470 138
302 3300048910 Ga0496107_0908657 Ga0496107_0908657_52_471 138
303 3300048911 Ga0496108_0026006 Ga0496108_0026006_3918_4337 138
304 3300048912 Ga0496109_0032131 Ga0496109_0032131_3868_4287 138
305 3300048912 Ga0496109_0117167 Ga0496109_0117167_1217_1636 138
306 3300048912 Ga0496109_1167737 Ga0496109_1167737_89_508 138
307 3300048913 Ga0496110_0070834 Ga0496110_0070834_2344_2763 138
308 3300048914 Ga0496111_0036409 Ga0496111_0036409_2806_3225 138
309 3300048914 Ga0496111_0204695 Ga0496111_0204695_511_930 138
310 3300048915 Ga0496112_0004480 Ga0496112_0004480_3737_4156 138
311 3300048916 Ga0496113_0017293 Ga0496113_0017293_2520_2939 138
312 3300048924 Ga0496121_0079589 Ga0496121_0079589_1608_2027 138
313 3300049582 Ga0501048_0118322 Ga0501048_0118322_936_1355 138
314 3300049588 Ga0501072_0637491 Ga0501072_0637491_407_826 138
315 3300050490 nmdc:mga03n38_231540_c1 nmdc:mga03n38_231540_c1_493_912 138
316 3300050491 nmdc:mga00v17_175309_c1 nmdc:mga00v17_175309_c1_516_935 138
317 3300050491 nmdc:mga00v17_177348_c1 nmdc:mga00v17_177348_c1_583_1002 138
318 3300050491 nmdc:mga00v17_189584_c1 nmdc:mga00v17_189584_c1_897_1316 138
319 3300050492 nmdc:mga0yw44_2043_c2 nmdc:mga0yw44_2043_c2_2315_2734 138
320 3300050492 nmdc:mga0yw44_95271_c1 nmdc:mga0yw44_95271_c1_425_844 138
321 3300050494 nmdc:mga06z11_44670_c1 nmdc:mga06z11_44670_c1_1301_1720 138
322 3300050494 nmdc:mga06z11_551729_c1 nmdc:mga06z11_551729_c1_97_516 138
323 3300050508 nmdc:mga09592_11930_c1 nmdc:mga09592_11930_c1_5873_6292 138
324 3300050510 nmdc:mga06r32_30770_c1 nmdc:mga06r32_30770_c1_2778_3197 138
325 3300050511 nmdc:mga08y16_69212_c1 nmdc:mga08y16_69212_c1_465_884 138
326 3300050511 nmdc:mga08y16_868032_c1 nmdc:mga08y16_868032_c1_396_815 138
327 3300061719 Ga0466962_0026617 Ga0466962_0026617_207_626 138
328 3300061719 Ga0466962_0035984 Ga0466962_0035984_519_938 138
329 3300061719 Ga0466962_0181769 Ga0466962_0181769_318_737 138
330 3300061719 Ga0466962_0736130 Ga0466962_0736130_48_467 138
331 3300001991 JGI24743J22301_10057169 JGI24743J22301_100571691 139
332 3300002075 JGI24738J21930_10051752 JGI24738J21930_100517522 139
333 3300003203 JGI25406J46586_10014524 JGI25406J46586_100145244 139
334 3300005329 Ga0070683_100101038 Ga0070683_1001010382 139
335 3300005334 Ga0068869_100338910 Ga0068869_1003389102 139
336 3300005336 Ga0070680_100572141 Ga0070680_1005721412 139
337 3300005337 Ga0070682_100028386 Ga0070682_1000283864 139
338 3300005338 Ga0068868_100092207 Ga0068868_1000922073 139
339 3300005341 Ga0070691_10212994 Ga0070691_102129943 139
340 3300005344 Ga0070661_100054871 Ga0070661_1000548713 139
341 3300005353 Ga0070669_101064725 Ga0070669_1010647251 139
342 3300005354 Ga0070675_100039559 Ga0070675_1000395593 139
343 3300005355 Ga0070671_100038372 Ga0070671_1000383722 139
344 3300005356 Ga0070674_100422521 Ga0070674_1004225212 139
345 3300005364 Ga0070673_100035079 Ga0070673_1000350794 139
346 3300005365 Ga0070688_100149331 Ga0070688_1001493312 139
347 3300005366 Ga0070659_100119855 Ga0070659_1001198552 139
348 3300005367 Ga0070667_100263872 Ga0070667_1002638722 139
349 3300005438 Ga0070701_10103993 Ga0070701_101039932 139
350 3300005438 Ga0070701_10264338 Ga0070701_102643383 139
351 3300005441 Ga0070700_100001146 Ga0070700_1000011469 139
352 3300005444 Ga0070694_100249074 Ga0070694_1002490742 139
353 3300005455 Ga0070663_100108647 Ga0070663_1001086472 139
354 3300005457 Ga0070662_100197330 Ga0070662_1001973302 139
355 3300005459 Ga0068867_100182406 Ga0068867_1001824063 139
356 3300005466 Ga0070685_10043544 Ga0070685_100435444 139
357 3300005535 Ga0070684_100010940 Ga0070684_10001094010 139
358 3300005535 Ga0070684_101588502 Ga0070684_1015885021 139
359 3300005543 Ga0070672_100316098 Ga0070672_1003160982 139
360 3300005544 Ga0070686_100091723 Ga0070686_1000917234 139
361 3300005546 Ga0070696_100596907 Ga0070696_1005969072 139
362 3300005546 Ga0070696_101073228 Ga0070696_1010732282 139
363 3300005547 Ga0070693_100446279 Ga0070693_1004462792 139
364 3300005548 Ga0070665_100410840 Ga0070665_1004108402 139
365 3300005549 Ga0070704_100433691 Ga0070704_1004336912 139
366 3300005563 Ga0068855_100085845 Ga0068855_1000858456 139
367 3300005577 Ga0068857_100221353 Ga0068857_1002213533 139
368 3300005578 Ga0068854_100016779 Ga0068854_1000167796 139
369 3300005578 Ga0068854_100137525 Ga0068854_1001375251 139
370 3300005578 Ga0068854_100339119 Ga0068854_1003391192 139
371 3300005614 Ga0068856_100103144 Ga0068856_1001031443 139
372 3300005615 Ga0070702_100008205 Ga0070702_1000082057 139
373 3300005615 Ga0070702_100074794 Ga0070702_1000747941 139
374 3300005616 Ga0068852_100057753 Ga0068852_1000577533 139
375 3300005617 Ga0068859_100421512 Ga0068859_1004215122 139
376 3300005618 Ga0068864_100043380 Ga0068864_1000433803 139
377 3300005618 Ga0068864_100181624 Ga0068864_1001816242 139
378 3300005718 Ga0068866_10124895 Ga0068866_101248952 139
379 3300005718 Ga0068866_10398397 Ga0068866_103983972 139
380 3300005719 Ga0068861_100082055 Ga0068861_1000820555 139
381 3300005719 Ga0068861_100724284 Ga0068861_1007242842 139
382 3300005719 Ga0068861_100836486 Ga0068861_1008364862 139
383 3300005719 Ga0068861_100952141 Ga0068861_1009521411 139
384 3300005842 Ga0068858_100169993 Ga0068858_1001699932 139
385 3300005844 Ga0068862_100327409 Ga0068862_1003274092 139
386 3300005981 Ga0081538_10131903 Ga0081538_101319032 139
387 3300005985 Ga0081539_10003976 Ga0081539_1000397620 139
388 3300006175 Ga0070712_100061563 Ga0070712_1000615633 139
389 3300006844 Ga0075428_100044308 Ga0075428_1000443081 139
390 3300006844 Ga0075428_100483260 Ga0075428_1004832602 139
391 3300006852 Ga0075433_10051223 Ga0075433_100512234 139
392 3300006871 Ga0075434_100190087 Ga0075434_1001900872 139
393 3300006871 Ga0075434_101051440 Ga0075434_1010514401 139
394 3300006880 Ga0075429_100585398 Ga0075429_1005853982 139
395 3300006881 Ga0068865_100036684 Ga0068865_1000366842 139
396 3300006914 Ga0075436_100007266 Ga0075436_1000072669 139
397 3300006931 Ga0097620_100421453 Ga0097620_1004214532 139
398 3300007076 Ga0075435_100042083 Ga0075435_1000420832 139
399 3300009094 Ga0111539_10050474 Ga0111539_100504745 139
400 3300009094 Ga0111539_10099745 Ga0111539_100997455 139
401 3300009094 Ga0111539_10220435 Ga0111539_102204353 139
402 3300009098 Ga0105245_10001037 Ga0105245_1000103712 139
403 3300009098 Ga0105245_10540187 Ga0105245_105401871 139
404 3300009101 Ga0105247_10126407 Ga0105247_101264073 139
405 3300009147 Ga0114129_10093825 Ga0114129_100938253 139
406 3300009147 Ga0114129_10240888 Ga0114129_102408882 139
407 3300009147 Ga0114129_10244692 Ga0114129_102446922 139
408 3300009147 Ga0114129_10751474 Ga0114129_107514742 139
409 3300009147 Ga0114129_12514213 Ga0114129_125142131 139
410 3300009148 Ga0105243_10027186 Ga0105243_100271864 139
411 3300009148 Ga0105243_10280762 Ga0105243_102807622 139
412 3300009148 Ga0105243_12182703 Ga0105243_121827031 139
413 3300009176 Ga0105242_10000756 Ga0105242_1000075613 139
414 3300009176 Ga0105242_10048984 Ga0105242_100489842 139
415 3300009176 Ga0105242_10853871 Ga0105242_108538712 139
416 3300009176 Ga0105242_13137574 Ga0105242_131375741 139
417 3300009545 Ga0105237_11692488 Ga0105237_116924882 139
418 3300009551 Ga0105238_12381915 Ga0105238_123819152 139
419 3300010375 Ga0105239_10007908 Ga0105239_100079083 139
420 3300011119 Ga0105246_10034379 Ga0105246_100343794 139
421 3300011119 Ga0105246_10094870 Ga0105246_100948703 139
422 3300013105 Ga0157369_10242289 Ga0157369_102422893 139
423 3300013296 Ga0157374_10056528 Ga0157374_100565284 139
424 3300013307 Ga0157372_10353584 Ga0157372_103535842 139
425 3300013308 Ga0157375_10044794 Ga0157375_100447946 139
426 3300013308 Ga0157375_10396597 Ga0157375_103965973 139
427 3300014326 Ga0157380_11636956 Ga0157380_116369561 139
428 3300014745 Ga0157377_10000243 Ga0157377_1000024312 139
429 3300014968 Ga0157379_10479740 Ga0157379_104797403 139
430 3300025899 Ga0207642_10310195 Ga0207642_103101952 139
431 3300025901 Ga0207688_10001744 Ga0207688_100017446 139
432 3300025908 Ga0207643_10469698 Ga0207643_104696982 139
433 3300025917 Ga0207660_10435925 Ga0207660_104359252 139
434 3300025919 Ga0207657_11166309 Ga0207657_111663092 139
435 3300025921 Ga0207652_11180695 Ga0207652_111806952 139
436 3300025923 Ga0207681_10063338 Ga0207681_100633382 139
437 3300025924 Ga0207694_10314980 Ga0207694_103149802 139
438 3300025926 Ga0207659_10549605 Ga0207659_105496052 139
439 3300025927 Ga0207687_10070881 Ga0207687_100708814 139
440 3300025929 Ga0207664_11531885 Ga0207664_115318851 139
441 3300025932 Ga0207690_10046474 Ga0207690_100464744 139
442 3300025933 Ga0207706_10019718 Ga0207706_100197187 139
443 3300025933 Ga0207706_10052839 Ga0207706_100528394 139
444 3300025933 Ga0207706_10180759 Ga0207706_101807592 139
445 3300025934 Ga0207686_10001027 Ga0207686_100010272 139
446 3300025934 Ga0207686_10207069 Ga0207686_102070692 139
447 3300025934 Ga0207686_10213473 Ga0207686_102134732 139
448 3300025935 Ga0207709_10074278 Ga0207709_100742784 139
449 3300025937 Ga0207669_10459763 Ga0207669_104597632 139
450 3300025938 Ga0207704_10172203 Ga0207704_101722033 139
451 3300025940 Ga0207691_10255159 Ga0207691_102551592 139
452 3300025942 Ga0207689_10133971 Ga0207689_101339712 139
453 3300025942 Ga0207689_11185909 Ga0207689_111859091 139
454 3300025942 Ga0207689_11595433 Ga0207689_115954331 139
455 3300025945 Ga0207679_10126312 Ga0207679_101263122 139
456 3300025949 Ga0207667_10456813 Ga0207667_104568132 139
457 3300025961 Ga0207712_10067426 Ga0207712_100674264 139
458 3300025972 Ga0207668_10584821 Ga0207668_105848213 139
459 3300025981 Ga0207640_10152069 Ga0207640_101520692 139
460 3300025981 Ga0207640_10860749 Ga0207640_108607492 139
461 3300026023 Ga0207677_10803451 Ga0207677_108034512 139
462 3300026035 Ga0207703_10636745 Ga0207703_106367452 139
463 3300026067 Ga0207678_10094513 Ga0207678_100945133 139
464 3300026075 Ga0207708_10000157 Ga0207708_1000015716 139
465 3300026075 Ga0207708_10001758 Ga0207708_1000175818 139
466 3300026075 Ga0207708_10177943 Ga0207708_101779433 139
467 3300026078 Ga0207702_10088418 Ga0207702_100884184 139
468 3300026088 Ga0207641_10829429 Ga0207641_108294292 139
469 3300026089 Ga0207648_10079595 Ga0207648_100795953 139
470 3300026095 Ga0207676_10054536 Ga0207676_100545363 139
471 3300026095 Ga0207676_10233620 Ga0207676_102336203 139
472 3300026116 Ga0207674_10044201 Ga0207674_100442015 139
473 3300026118 Ga0207675_100062080 Ga0207675_1000620802 139
474 3300026118 Ga0207675_100090817 Ga0207675_1000908173 139
475 3300026118 Ga0207675_100122575 Ga0207675_1001225754 139
476 3300026142 Ga0207698_10018223 Ga0207698_100182237 139
477 3300027907 Ga0207428_10017745 Ga0207428_100177456 139
478 3300027907 Ga0207428_10256163 Ga0207428_102561632 139
479 3300028379 Ga0268266_10244987 Ga0268266_102449873 139
480 3300028380 Ga0268265_10292873 Ga0268265_102928732 139
481 3300028381 Ga0268264_10232960 Ga0268264_102329602 139
482 3300028573 Ga0265334_10140996 Ga0265334_101409962 139
483 3300031852 Ga0307410_10845217 Ga0307410_108452172 139
484 3300031903 Ga0307407_10395530 Ga0307407_103955302 139
485 3300031911 Ga0307412_10703347 Ga0307412_107033472 139
486 3300032002 Ga0307416_100038250 Ga0307416_1000382504 139
487 3300032005 Ga0307411_10234766 Ga0307411_102347663 139
488 3300032126 Ga0307415_100636672 Ga0307415_1006366722 139
489 3300037853 Ga0436364_0115266 Ga0436364_0115266_587_1009 139
490 3300037853 Ga0436364_0159150 Ga0436364_0159150_7314_7772 139
491 3300038443 Ga0395901_0205625 Ga0395901_0205625_520_942 139
492 3300039450 Ga0436363_1449147 Ga0436363_1449147_24_455 139
493 3300039453 Ga0436362_0344812 Ga0436362_0344812_101_523 139
494 3300041460 Ga0451802_0871605 Ga0451802_0871605_144_566 139
495 3300042461 Ga0439460_0125632 Ga0439460_0125632_151_573 139
496 3300044684 Ga0466966_0112517 Ga0466966_0112517_752_1174 139
497 3300044684 Ga0466966_0349418 Ga0466966_0349418_437_859 139
498 3300044693 Ga0466961_0794879 Ga0466961_0794879_32_454 139
499 3300044694 Ga0466963_0230379 Ga0466963_0230379_745_1167 139
500 3300044694 Ga0466963_0351371 Ga0466963_0351371_441_863 139
501 3300044765 Ga0466970_0812029 Ga0466970_0812029_58_480 139
502 3300044901 Ga0466960_0000064 Ga0466960_0000064_25473_25895 139
503 3300044901 Ga0466960_0297199 Ga0466960_0297199_343_765 139
504 3300045049 Ga0466959_0118442 Ga0466959_0118442_994_1416 139
505 3300045049 Ga0466959_0984842 Ga0466959_0984842_13_435 139
506 3300045976 Ga0466967_2275972 Ga0466967_2275972_27_449 139
507 3300046473 Ga0495582_0544777 Ga0495582_0544777_137_559 139
508 3300046683 Ga0495658_0217581 Ga0495658_0217581_650_1072 139
509 3300048903 Ga0496100_0116816 Ga0496100_0116816_630_1052 139
510 3300048903 Ga0496100_1263026 Ga0496100_1263026_56_478 139
511 3300048904 Ga0496101_0408568 Ga0496101_0408568_188_610 139
512 3300048905 Ga0496102_0018938 Ga0496102_0018938_3657_4079 139
513 3300048907 Ga0496104_0031238 Ga0496104_0031238_470_892 139
514 3300048908 Ga0496105_0043554 Ga0496105_0043554_1089_1511 139
515 3300048909 Ga0496106_0026312 Ga0496106_0026312_35_457 139
516 3300048909 Ga0496106_0072232 Ga0496106_0072232_880_1302 139
517 3300048910 Ga0496107_0067100 Ga0496107_0067100_1703_2125 139
518 3300048911 Ga0496108_0000832 Ga0496108_0000832_10933_11355 139
519 3300048911 Ga0496108_0494064 Ga0496108_0494064_428_850 139
520 3300048912 Ga0496109_0020937 Ga0496109_0020937_4643_5065 139
521 3300048912 Ga0496109_1116073 Ga0496109_1116073_81_503 139
522 3300048913 Ga0496110_0034676 Ga0496110_0034676_696_1118 139
523 3300048914 Ga0496111_0029976 Ga0496111_0029976_1013_1435 139
524 3300048915 Ga0496112_0072498 Ga0496112_0072498_678_1100 139
525 3300048916 Ga0496113_0015578 Ga0496113_0015578_1055_1477 139
526 3300049571 Ga0501034_0093581 Ga0501034_0093581_860_1291 139
527 3300049579 Ga0501043_1016887 Ga0501043_1016887_44_466 139
528 3300049581 Ga0501047_0282569 Ga0501047_0282569_1060_1482 139
529 3300049587 Ga0501071_0694418 Ga0501071_0694418_229_648 139
530 3300049742 Ga0501080_1498292 Ga0501080_1498292_62_484 139
531 3300049823 Ga0501044_0159492 Ga0501044_0159492_1686_2108 139
532 3300050508 nmdc:mga09592_318697_c1 nmdc:mga09592_318697_c1_433_855 139
533 3300050508 nmdc:mga09592_773877_c1 nmdc:mga09592_773877_c1_49_471 139
534 3300050511 nmdc:mga08y16_33168_c1 nmdc:mga08y16_33168_c1_2754_3176 139
535 3300050512 nmdc:mga0n895_662377_c1 nmdc:mga0n895_662377_c1_286_708 139
536 3300050513 nmdc:mga0rr50_42833_c1 nmdc:mga0rr50_42833_c1_529_951 139
537 3300050514 nmdc:mga08x19_268735_c1 nmdc:mga08x19_268735_c1_296_718 139
538 3300050515 nmdc:mga0a205_121071_c1 nmdc:mga0a205_121071_c1_242_664 139
539 3300005329 Ga0070683_100324326 Ga0070683_1003243262 140
540 3300005337 Ga0070682_100000102 Ga0070682_10000010241 140
541 3300005339 Ga0070660_100607361 Ga0070660_1006073612 140
542 3300005436 Ga0070713_100446516 Ga0070713_1004465162 140
543 3300005444 Ga0070694_100301892 Ga0070694_1003018922 140
544 3300005458 Ga0070681_10014223 Ga0070681_100142234 140
545 3300005530 Ga0070679_100000537 Ga0070679_10000053742 140
546 3300005544 Ga0070686_100491311 Ga0070686_1004913112 140
547 3300005549 Ga0070704_100785468 Ga0070704_1007854682 140
548 3300005563 Ga0068855_100499475 Ga0068855_1004994753 140
549 3300005616 Ga0068852_101209325 Ga0068852_1012093252 140
550 3300005841 Ga0068863_100009331 Ga0068863_10000933110 140
551 3300006028 Ga0070717_10014762 Ga0070717_100147625 140
552 3300006028 Ga0070717_10053959 Ga0070717_100539594 140
553 3300006028 Ga0070717_10783712 Ga0070717_107837122 140
554 3300006038 Ga0075365_10664162 Ga0075365_106641622 140
555 3300006051 Ga0075364_10118494 Ga0075364_101184942 140
556 3300009093 Ga0105240_10750025 Ga0105240_107500252 140
557 3300009147 Ga0114129_10017653 Ga0114129_100176538 140
558 3300009148 Ga0105243_10027113 Ga0105243_100271135 140
559 3300009148 Ga0105243_10414586 Ga0105243_104145862 140
560 3300009176 Ga0105242_10412249 Ga0105242_104122492 140
561 3300013306 Ga0163162_11739675 Ga0163162_117396751 140
562 3300014326 Ga0157380_10166829 Ga0157380_101668292 140
563 3300017792 Ga0163161_10251371 Ga0163161_102513712 140
564 3300021358 Ga0213873_10273733 Ga0213873_102737331 140
565 3300021377 Ga0213874_10003788 Ga0213874_100037883 140
566 3300021384 Ga0213876_10005606 Ga0213876_100056066 140
567 3300021388 Ga0213875_10006473 Ga0213875_100064734 140
568 3300021388 Ga0213875_10009519 Ga0213875_100095196 140
569 3300021388 Ga0213875_10163890 Ga0213875_101638902 140
570 3300021388 Ga0213875_10188806 Ga0213875_101888062 140
571 3300021388 Ga0213875_10214336 Ga0213875_102143362 140
572 3300021388 Ga0213875_10289573 Ga0213875_102895732 140
573 3300025899 Ga0207642_10088053 Ga0207642_100880533 140
574 3300025900 Ga0207710_10024439 Ga0207710_100244393 140
575 3300025912 Ga0207707_10030725 Ga0207707_100307255 140
576 3300025927 Ga0207687_10446632 Ga0207687_104466322 140
577 3300025928 Ga0207700_10654257 Ga0207700_106542572 140
578 3300025929 Ga0207664_10258904 Ga0207664_102589042 140
579 3300025935 Ga0207709_10015789 Ga0207709_100157894 140
580 3300025935 Ga0207709_10104154 Ga0207709_101041543 140
581 3300025937 Ga0207669_10379461 Ga0207669_103794611 140
582 3300025938 Ga0207704_10065797 Ga0207704_100657973 140
583 3300025944 Ga0207661_10153276 Ga0207661_101532762 140
584 3300025949 Ga0207667_10429440 Ga0207667_104294402 140
585 3300025960 Ga0207651_10804756 Ga0207651_108047562 140
586 3300025972 Ga0207668_11375246 Ga0207668_113752461 140
587 3300026023 Ga0207677_10928959 Ga0207677_109289592 140
588 3300026088 Ga0207641_10007103 Ga0207641_100071033 140
589 3300026089 Ga0207648_10158415 Ga0207648_101584153 140
590 3300026142 Ga0207698_10000013 Ga0207698_1000001381 140
591 3300027907 Ga0207428_10255028 Ga0207428_102550282 140
592 3300032126 Ga0307415_100002829 Ga0307415_1000028297 140
593 3300037418 Ga0395900_0052131 Ga0395900_0052131_969_1394 140
594 3300037466 Ga0395898_0000894 Ga0395898_0000894_6656_7081 140
595 3300037853 Ga0436364_0118612 Ga0436364_0118612_573_998 140
596 3300037853 Ga0436364_0286486 Ga0436364_0286486_207_632 140
597 3300037853 Ga0436364_0334646 Ga0436364_0334646_2638_3063 140
598 3300037853 Ga0436364_0503224 Ga0436364_0503224_329_754 140
599 3300037853 Ga0436364_0810387 Ga0436364_0810387_235_660 140
600 3300037853 Ga0436364_1245246 Ga0436364_1245246_3172_3597 140
601 3300037853 Ga0436364_1339551 Ga0436364_1339551_4398_4823 140
602 3300039437 Ga0436365_0405628 Ga0436365_0405628_242_667 140
603 3300039437 Ga0436365_1500157 Ga0436365_1500157_43_468 140
604 3300039437 Ga0436365_1510673 Ga0436365_1510673_1948_2373 140
605 3300039437 Ga0436365_1811968 Ga0436365_1811968_14_439 140
606 3300039450 Ga0436363_0294066 Ga0436363_0294066_439_864 140
607 3300039450 Ga0436363_0550340 Ga0436363_0550340_111_536 140
608 3300039450 Ga0436363_1608452 Ga0436363_1608452_552_977 140
609 3300039453 Ga0436362_0400860 Ga0436362_0400860_1294_1719 140
610 3300041443 Ga0451789_0804322 Ga0451789_0804322_149_574 140
611 3300044693 Ga0466961_0041318 Ga0466961_0041318_862_1287 140
612 3300044693 Ga0466961_0525364 Ga0466961_0525364_154_579 140
613 3300044694 Ga0466963_0051798 Ga0466963_0051798_1080_1505 140
614 3300044694 Ga0466963_0105953 Ga0466963_0105953_369_794 140
615 3300044694 Ga0466963_0158205 Ga0466963_0158205_227_652 140
616 3300044719 Ga0466971_0041424 Ga0466971_0041424_766_1191 140
617 3300044719 Ga0466971_0106899 Ga0466971_0106899_88_513 140
618 3300044735 Ga0466968_0070826 Ga0466968_0070826_780_1205 140
619 3300044735 Ga0466968_0185461 Ga0466968_0185461_203_628 140
620 3300044765 Ga0466970_0410857 Ga0466970_0410857_262_687 140
621 3300044842 Ga0466957_0337386 Ga0466957_0337386_496_921 140
622 3300044901 Ga0466960_0229807 Ga0466960_0229807_409_834 140
623 3300045049 Ga0466959_0691815 Ga0466959_0691815_204_629 140
624 3300045836 Ga0466958_0014890 Ga0466958_0014890_3994_4419 140
625 3300045836 Ga0466958_0067718 Ga0466958_0067718_1649_2074 140
626 3300045976 Ga0466967_0005204 Ga0466967_0005204_7102_7527 140
627 3300045976 Ga0466967_0012278 Ga0466967_0012278_5543_5968 140
628 3300045976 Ga0466967_0023706 Ga0466967_0023706_492_917 140
629 3300045976 Ga0466967_0023917 Ga0466967_0023917_4070_4495 140
630 3300045976 Ga0466967_0089796 Ga0466967_0089796_2291_2716 140
631 3300045976 Ga0466967_0140119 Ga0466967_0140119_513_938 140
632 3300046461 Ga0495641_0001080 Ga0495641_0001080_14536_14961 140
633 3300046511 Ga0495608_0056557 Ga0495608_0056557_678_1103 140
634 3300046516 Ga0495628_0144247 Ga0495628_0144247_242_667 140
635 3300046529 Ga0495652_0035637 Ga0495652_0035637_46_471 140
636 3300046543 Ga0495645_0170386 Ga0495645_0170386_366_791 140
637 3300046543 Ga0495645_0280815 Ga0495645_0280815_36_461 140
638 3300046694 Ga0495649_0005280 Ga0495649_0005280_1023_1448 140
639 3300047317 Ga0495604_0006333 Ga0495604_0006333_5246_5671 140
640 3300047317 Ga0495604_0066597 Ga0495604_0066597_1959_2384 140
641 3300047317 Ga0495604_0130850 Ga0495604_0130850_380_805 140
642 3300047319 Ga0495674_0306717 Ga0495674_0306717_34_459 140
643 3300048088 Ga0495602_0000070 Ga0495602_0000070_27276_27701 140
644 3300048088 Ga0495602_0380243 Ga0495602_0380243_121_546 140
645 3300048907 Ga0496104_0006465 Ga0496104_0006465_8138_8563 140
646 3300048908 Ga0496105_0010069 Ga0496105_0010069_4136_4561 140
647 3300048910 Ga0496107_0713766 Ga0496107_0713766_120_545 140
648 3300048911 Ga0496108_0058642 Ga0496108_0058642_1925_2350 140
649 3300048912 Ga0496109_0000146 Ga0496109_0000146_310_735 140
650 3300048912 Ga0496109_0216489 Ga0496109_0216489_649_1074 140
651 3300048914 Ga0496111_0215665 Ga0496111_0215665_247_687 140
652 3300048915 Ga0496112_0000153 Ga0496112_0000153_24776_25201 140
653 3300048915 Ga0496112_0037880 Ga0496112_0037880_2572_2997 140
654 3300048915 Ga0496112_0502535 Ga0496112_0502535_134_559 140
655 3300048916 Ga0496113_0000004 Ga0496113_0000004_91012_91437 140
656 3300048916 Ga0496113_0178271 Ga0496113_0178271_610_1035 140
657 3300049569 Ga0501032_0006397 Ga0501032_0006397_5825_6250 140
658 3300049570 Ga0501033_0116250 Ga0501033_0116250_1047_1472 140
659 3300049571 Ga0501034_0589921 Ga0501034_0589921_45_470 140
660 3300049572 Ga0501036_0189743 Ga0501036_0189743_978_1403 140
661 3300049574 Ga0501038_0015020 Ga0501038_0015020_978_1403 140
662 3300049578 Ga0501042_0030232 Ga0501042_0030232_2596_3021 140
663 3300049579 Ga0501043_0320154 Ga0501043_0320154_174_599 140
664 3300049580 Ga0501046_0135884 Ga0501046_0135884_487_912 140
665 3300049581 Ga0501047_0578950 Ga0501047_0578950_468_893 140
666 3300049582 Ga0501048_0291099 Ga0501048_0291099_664_1089 140
667 3300049583 Ga0501067_0105310 Ga0501067_0105310_648_1073 140
668 3300049585 Ga0501069_0058814 Ga0501069_0058814_1396_1821 140
669 3300049586 Ga0501070_0375198 Ga0501070_0375198_691_1116 140
670 3300049588 Ga0501072_0481792 Ga0501072_0481792_243_668 140
671 3300049589 Ga0501073_0003796 Ga0501073_0003796_2764_3189 140
672 3300049590 Ga0501074_0216437 Ga0501074_0216437_324_749 140
673 3300049744 Ga0501083_0121759 Ga0501083_0121759_1089_1514 140
674 3300049823 Ga0501044_0067143 Ga0501044_0067143_515_940 140
675 3300049824 Ga0501045_0487507 Ga0501045_0487507_115_540 140
676 3300050507 nmdc:mga05p37_46413_c1 nmdc:mga05p37_46413_c1_1528_1953 140
677 3300050511 nmdc:mga08y16_1008343_c1 nmdc:mga08y16_1008343_c1_181_606 140
678 3300050511 nmdc:mga08y16_37344_c1 nmdc:mga08y16_37344_c1_1685_2110 140
679 3300053083 Ga0495655_0031357 Ga0495655_0031357_21_446 140
680 3300053084 Ga0495595_0028266 Ga0495595_0028266_1956_2381 140
681 3300053084 Ga0495595_0111842 Ga0495595_0111842_251_676 140
682 3300053123 Ga0500614_001722 Ga0500614_001722_4208_4633 140
683 3300060353 Ga0501082_0007829 Ga0501082_0007829_4904_5329 140
684 3300061719 Ga0466962_0028941 Ga0466962_0028941_1382_1807 140
685 3300005327 Ga0070658_10552800 Ga0070658_105528002 141
686 3300005329 Ga0070683_100001866 Ga0070683_10000186615 141
687 3300005345 Ga0070692_11298873 Ga0070692_112988731 141
688 3300005435 Ga0070714_100056593 Ga0070714_1000565932 141
689 3300005436 Ga0070713_100000085 Ga0070713_10000008549 141
690 3300005436 Ga0070713_100031459 Ga0070713_1000314596 141
691 3300005439 Ga0070711_101884115 Ga0070711_1018841151 141
692 3300005466 Ga0070685_10085868 Ga0070685_100858683 141
693 3300005535 Ga0070684_100068532 Ga0070684_1000685322 141
694 3300005578 Ga0068854_100000090 Ga0068854_1000000903 141
695 3300005614 Ga0068856_100340510 Ga0068856_1003405102 141
696 3300006028 Ga0070717_10047485 Ga0070717_100474853 141
697 3300006028 Ga0070717_10506019 Ga0070717_105060192 141
698 3300006175 Ga0070712_100005528 Ga0070712_1000055289 141
699 3300006175 Ga0070712_101649628 Ga0070712_1016496281 141
700 3300006881 Ga0068865_101500352 Ga0068865_1015003522 141
701 3300009098 Ga0105245_10014323 Ga0105245_100143239 141
702 3300009177 Ga0105248_12456526 Ga0105248_124565261 141
703 3300011119 Ga0105246_10042491 Ga0105246_100424912 141
704 3300013297 Ga0157378_10000770 Ga0157378_1000077023 141
705 3300013307 Ga0157372_10000112 Ga0157372_100001129 141
706 3300021358 Ga0213873_10021329 Ga0213873_100213292 141
707 3300021377 Ga0213874_10009280 Ga0213874_100092803 141
708 3300021377 Ga0213874_10034927 Ga0213874_100349272 141
709 3300021384 Ga0213876_10018016 Ga0213876_100180163 141
710 3300021388 Ga0213875_10000156 Ga0213875_1000015630 141
711 3300021388 Ga0213875_10017115 Ga0213875_100171153 141
712 3300025899 Ga0207642_10262985 Ga0207642_102629852 141
713 3300025909 Ga0207705_10095930 Ga0207705_100959302 141
714 3300025915 Ga0207693_10008714 Ga0207693_100087142 141
715 3300025927 Ga0207687_10008027 Ga0207687_100080279 141
716 3300025928 Ga0207700_10000027 Ga0207700_1000002717 141
717 3300025929 Ga0207664_10028937 Ga0207664_100289376 141
718 3300025938 Ga0207704_11175401 Ga0207704_111754012 141
719 3300025941 Ga0207711_11821502 Ga0207711_118215021 141
720 3300025944 Ga0207661_10000398 Ga0207661_1000039818 141
721 3300025981 Ga0207640_10000778 Ga0207640_100007783 141
722 3300026075 Ga0207708_10346396 Ga0207708_103463962 141
723 3300026078 Ga0207702_10434701 Ga0207702_104347012 141
724 3300026116 Ga0207674_10287460 Ga0207674_102874603 141
725 3300037853 Ga0436364_0159207 Ga0436364_0159207_13570_13998 141
726 3300037853 Ga0436364_0744537 Ga0436364_0744537_466_894 141
727 3300037853 Ga0436364_1375186 Ga0436364_1375186_27282_27710 141
728 3300037853 Ga0436364_1467838 Ga0436364_1467838_2335_2763 141
729 3300039437 Ga0436365_0004038 Ga0436365_0004038_5573_6001 141
730 3300039437 Ga0436365_1001279 Ga0436365_1001279_22095_22523 141
731 3300039450 Ga0436363_0134081 Ga0436363_0134081_62_490 141
732 3300039450 Ga0436363_0843533 Ga0436363_0843533_2215_2643 141
733 3300039450 Ga0436363_1431625 Ga0436363_1431625_784_1212 141
734 3300039450 Ga0436363_1691717 Ga0436363_1691717_2623_3051 141
735 3300039453 Ga0436362_0339746 Ga0436362_0339746_2516_2944 141
736 3300044656 Ga0466969_0284550 Ga0466969_0284550_158_586 141
737 3300044656 Ga0466969_0502549 Ga0466969_0502549_113_541 141
738 3300044683 Ga0466965_0853340 Ga0466965_0853340_72_500 141
739 3300044719 Ga0466971_0111028 Ga0466971_0111028_823_1251 141
740 3300044735 Ga0466968_0091123 Ga0466968_0091123_104_532 141
741 3300044842 Ga0466957_0154050 Ga0466957_0154050_601_1029 141
742 3300045049 Ga0466959_0098486 Ga0466959_0098486_1108_1536 141
743 3300045049 Ga0466959_0125962 Ga0466959_0125962_817_1245 141
744 3300045836 Ga0466958_0330839 Ga0466958_0330839_336_764 141
745 3300045836 Ga0466958_0740000 Ga0466958_0740000_134_562 141
746 3300045976 Ga0466967_0432383 Ga0466967_0432383_232_660 141
747 3300045976 Ga0466967_0689907 Ga0466967_0689907_300_728 141
748 3300045976 Ga0466967_1877793 Ga0466967_1877793_133_561 141
749 3300046492 Ga0495585_0343213 Ga0495585_0343213_108_536 141
750 3300046514 Ga0495618_0281270 Ga0495618_0281270_416_847 141
751 3300048904 Ga0496101_0099390 Ga0496101_0099390_1704_2132 141
752 3300048907 Ga0496104_0944022 Ga0496104_0944022_299_727 141
753 3300048908 Ga0496105_0073928 Ga0496105_0073928_1018_1446 141
754 3300048909 Ga0496106_0000013 Ga0496106_0000013_141594_142022 141
755 3300048910 Ga0496107_0036827 Ga0496107_0036827_606_1034 141
756 3300048910 Ga0496107_0109180 Ga0496107_0109180_118_546 141
757 3300048911 Ga0496108_0098170 Ga0496108_0098170_171_599 141
758 3300048912 Ga0496109_0223882 Ga0496109_0223882_496_924 141
759 3300048913 Ga0496110_0365975 Ga0496110_0365975_103_531 141
760 3300048915 Ga0496112_0013821 Ga0496112_0013821_5113_5541 141
761 3300048916 Ga0496113_0002975 Ga0496113_0002975_9142_9570 141
762 3300048917 Ga0496114_0073737 Ga0496114_0073737_1680_2108 141
763 3300053077 Ga0495601_0260804 Ga0495601_0260804_241_669 141
764 3300053078 Ga0495612_0307795 Ga0495612_0307795_99_527 141
765 3300005334 Ga0068869_100899801 Ga0068869_1008998011 142
766 3300005338 Ga0068868_100000978 Ga0068868_1000009789 142
767 3300005344 Ga0070661_100000032 Ga0070661_1000000324 142
768 3300005365 Ga0070688_100000168 Ga0070688_10000016825 142
769 3300005435 Ga0070714_100098843 Ga0070714_1000988432 142
770 3300005436 Ga0070713_100137499 Ga0070713_1001374992 142
771 3300005436 Ga0070713_101228536 Ga0070713_1012285361 142
772 3300005437 Ga0070710_10429106 Ga0070710_104291062 142
773 3300005456 Ga0070678_100002153 Ga0070678_10000215311 142
774 3300005466 Ga0070685_10000246 Ga0070685_1000024625 142
775 3300005468 Ga0070707_100308761 Ga0070707_1003087613 142
776 3300006028 Ga0070717_10371434 Ga0070717_103714342 142
777 3300006028 Ga0070717_10815858 Ga0070717_108158582 142
778 3300006163 Ga0070715_10298335 Ga0070715_102983351 142
779 3300006173 Ga0070716_100069070 Ga0070716_1000690703 142
780 3300006175 Ga0070712_101429329 Ga0070712_1014293291 142
781 3300006881 Ga0068865_100000023 Ga0068865_10000002351 142
782 3300009147 Ga0114129_10909179 Ga0114129_109091792 142
783 3300021384 Ga0213876_10078539 Ga0213876_100785392 142
784 3300025898 Ga0207692_10332375 Ga0207692_103323751 142
785 3300025906 Ga0207699_10679641 Ga0207699_106796412 142
786 3300025915 Ga0207693_10002345 Ga0207693_1000234513 142
787 3300025915 Ga0207693_10049782 Ga0207693_100497821 142
788 3300025916 Ga0207663_10015163 Ga0207663_100151635 142
789 3300025920 Ga0207649_10000166 Ga0207649_1000016632 142
790 3300025922 Ga0207646_10397311 Ga0207646_103973111 142
791 3300025928 Ga0207700_10047064 Ga0207700_100470642 142
792 3300025928 Ga0207700_10663157 Ga0207700_106631571 142
793 3300025935 Ga0207709_10900847 Ga0207709_109008472 142
794 3300025938 Ga0207704_10000068 Ga0207704_1000006825 142
795 3300025944 Ga0207661_11007417 Ga0207661_110074171 142
796 3300026023 Ga0207677_10001122 Ga0207677_1000112215 142
797 3300026121 Ga0207683_10001623 Ga0207683_1000162322 142
798 3300035111 Ga0373923_0238991 Ga0373923_0238991_183_614 142
799 3300035117 Ga0373953_0052036 Ga0373953_0052036_392_823 142
800 3300035172 Ga0373955_0052893 Ga0373955_0052893_1148_1579 142
801 3300035410 Ga0373924_0304577 Ga0373924_0304577_223_654 142
802 3300036401 Ga0373937_0628956 Ga0373937_0628956_573_1004 142
803 3300039437 Ga0436365_0896130 Ga0436365_0896130_5412_5843 142
804 3300039453 Ga0436362_0712899 Ga0436362_0712899_13_444 142
805 3300044656 Ga0466969_0221621 Ga0466969_0221621_326_757 142
806 3300044684 Ga0466966_0172649 Ga0466966_0172649_47_478 142
807 3300044684 Ga0466966_0655980 Ga0466966_0655980_178_609 142
808 3300044693 Ga0466961_0360147 Ga0466961_0360147_313_744 142
809 3300044694 Ga0466963_0007807 Ga0466963_0007807_1151_1582 142
810 3300045049 Ga0466959_0102830 Ga0466959_0102830_1316_1747 142
811 3300045049 Ga0466959_0147463 Ga0466959_0147463_493_924 142
812 3300045836 Ga0466958_0001574 Ga0466958_0001574_10219_10650 142
813 3300045836 Ga0466958_0067510 Ga0466958_0067510_739_1170 142
814 3300045836 Ga0466958_0238515 Ga0466958_0238515_571_1002 142
815 3300045976 Ga0466967_0008602 Ga0466967_0008602_3331_3762 142
816 3300045976 Ga0466967_0178602 Ga0466967_0178602_731_1162 142
817 3300046454 Ga0495592_0466152 Ga0495592_0466152_251_682 142
818 3300046461 Ga0495641_0112982 Ga0495641_0112982_320_751 142
819 3300046462 Ga0495651_0006559 Ga0495651_0006559_5413_5844 142
820 3300046463 Ga0495653_0014652 Ga0495653_0014652_4910_5341 142
821 3300046514 Ga0495618_0009790 Ga0495618_0009790_1279_1710 142
822 3300046516 Ga0495628_0036020 Ga0495628_0036020_1149_1580 142
823 3300046529 Ga0495652_0028874 Ga0495652_0028874_892_1323 142
824 3300046533 Ga0495640_0132726 Ga0495640_0132726_134_565 142
825 3300046533 Ga0495640_0360231 Ga0495640_0360231_453_884 142
826 3300046536 Ga0495587_0009780 Ga0495587_0009780_5651_6082 142
827 3300046557 Ga0495622_0000789 Ga0495622_0000789_123_554 142
828 3300046559 Ga0495667_0001023 Ga0495667_0001023_10016_10447 142
829 3300046642 Ga0495634_0066330 Ga0495634_0066330_920_1351 142
830 3300046663 Ga0495635_0222215 Ga0495635_0222215_811_1242 142
831 3300046675 Ga0495657_0021964 Ga0495657_0021964_1247_1678 142
832 3300046678 Ga0495599_0308155 Ga0495599_0308155_393_824 142
833 3300046680 Ga0495646_0015211 Ga0495646_0015211_3755_4186 142
834 3300046689 Ga0495613_0719357 Ga0495613_0719357_40_471 142
835 3300046809 Ga0495600_0047127 Ga0495600_0047127_873_1304 142
836 3300046809 Ga0495600_0130333 Ga0495600_0130333_735_1166 142
837 3300047315 Ga0495581_0724179 Ga0495581_0724179_31_462 142
838 3300047319 Ga0495674_0076400 Ga0495674_0076400_1925_2356 142
839 3300047320 Ga0495672_0084135 Ga0495672_0084135_701_1132 142
840 3300047322 Ga0495680_0080447 Ga0495680_0080447_118_549 142
841 3300047673 Ga0495593_0246985 Ga0495593_0246985_442_873 142
842 3300048088 Ga0495602_0130794 Ga0495602_0130794_1186_1617 142
843 3300048089 Ga0495614_0151794 Ga0495614_0151794_480_911 142
844 3300048903 Ga0496100_0011865 Ga0496100_0011865_985_1416 142
845 3300048903 Ga0496100_0996514 Ga0496100_0996514_39_470 142
846 3300048905 Ga0496102_0479607 Ga0496102_0479607_258_689 142
847 3300048906 Ga0496103_0669782 Ga0496103_0669782_88_519 142
848 3300048907 Ga0496104_0012549 Ga0496104_0012549_1175_1606 142
849 3300048907 Ga0496104_0496185 Ga0496104_0496185_308_739 142
850 3300048909 Ga0496106_0001792 Ga0496106_0001792_6459_6890 142
851 3300048913 Ga0496110_0299285 Ga0496110_0299285_811_1242 142
852 3300048915 Ga0496112_0054181 Ga0496112_0054181_3221_3652 142
853 3300048915 Ga0496112_1325304 Ga0496112_1325304_29_460 142
854 3300048916 Ga0496113_0009800 Ga0496113_0009800_1455_1886 142
855 3300048916 Ga0496113_0267868 Ga0496113_0267868_259_690 142
856 3300048917 Ga0496114_0093555 Ga0496114_0093555_1873_2304 142
857 3300048917 Ga0496114_0179768 Ga0496114_0179768_1293_1724 142
858 3300048918 Ga0496115_0000070 Ga0496115_0000070_49704_50135 142
859 3300048918 Ga0496115_0000243 Ga0496115_0000243_7395_7826 142
860 3300048918 Ga0496115_0003897 Ga0496115_0003897_1243_1674 142
861 3300048918 Ga0496115_0019289 Ga0496115_0019289_1529_1960 142
862 3300050507 nmdc:mga05p37_1099293_c1 nmdc:mga05p37_1099293_c1_240_680 142
863 3300050515 nmdc:mga0a205_304390_c1 nmdc:mga0a205_304390_c1_766_1197 142
864 3300053077 Ga0495601_0000032 Ga0495601_0000032_4997_5428 142
865 3300053078 Ga0495612_0016370 Ga0495612_0016370_83_514 142
866 3300053084 Ga0495595_0010720 Ga0495595_0010720_3020_3451 142
867 3300005354 Ga0070675_100000015 Ga0070675_100000015123 143
868 3300025926 Ga0207659_10000032 Ga0207659_10000032102 143
869 3300035692 Ga0373935_0143470 Ga0373935_0143470_1038_1472 143
870 3300036401 Ga0373937_0601405 Ga0373937_0601405_222_656 143
871 3300046507 Ga0495606_0000072 Ga0495606_0000072_48285_48719 143
872 3300046615 Ga0495656_0346050 Ga0495656_0346050_108_542 143
873 3300046810 Ga0495660_0200929 Ga0495660_0200929_313_747 143
874 3300048912 Ga0496109_0000226 Ga0496109_0000226_37213_37656 143
875 3300048913 Ga0496110_0268505 Ga0496110_0268505_160_594 143
876 3300061719 Ga0466962_0381449 Ga0466962_0381449_25_459 143
877 3300009098 Ga0105245_10000254 Ga0105245_1000025449 144
878 3300013105 Ga0157369_10000020 Ga0157369_10000020145 144
879 3300021358 Ga0213873_10027021 Ga0213873_100270212 144
880 3300021377 Ga0213874_10000005 Ga0213874_1000000513 144
881 3300021384 Ga0213876_10116779 Ga0213876_101167792 144
882 3300025321 Ga0207656_10009888 Ga0207656_100098882 144
883 3300025927 Ga0207687_10000007 Ga0207687_10000007475 144
884 3300025929 Ga0207664_10035475 Ga0207664_100354753 144
885 3300031852 Ga0307410_10523411 Ga0307410_105234112 144
886 3300031903 Ga0307407_10191028 Ga0307407_101910282 144
887 3300032126 Ga0307415_100244925 Ga0307415_1002449252 144
888 3300039437 Ga0436365_1758755 Ga0436365_1758755_762_1202 144
889 3300039450 Ga0436363_0760459 Ga0436363_0760459_13804_14244 144
890 3300039453 Ga0436362_0787061 Ga0436362_0787061_346_786 144
891 3300044694 Ga0466963_0049400 Ga0466963_0049400_1870_2310 144
892 3300044735 Ga0466968_0151471 Ga0466968_0151471_185_622 144
893 3300045976 Ga0466967_0439199 Ga0466967_0439199_122_559 144
894 3300046678 Ga0495599_0008369 Ga0495599_0008369_2422_2859 144
895 3300047471 Ga0495684_0006748 Ga0495684_0006748_1724_2161 144
896 3300048911 Ga0496108_0000146 Ga0496108_0000146_42009_42455 144
897 3300048912 Ga0496109_0000297 Ga0496109_0000297_24766_25212 144
898 3300005289 Ga0065704_10107272 Ga0065704_101072724 145
899 3300005834 Ga0068851_10000233 Ga0068851_100002337 145
900 3300006847 Ga0075431_100589448 Ga0075431_1005894482 145
901 3300009094 Ga0111539_10205519 Ga0111539_102055191 145
902 3300009147 Ga0114129_10085083 Ga0114129_100850834 145
903 3300025321 Ga0207656_10000180 Ga0207656_1000018018 145
904 3300027907 Ga0207428_10001807 Ga0207428_1000180713 145
905 3300050507 nmdc:mga05p37_24410_c1 nmdc:mga05p37_24410_c1_6523_6975 145
906 3300050508 nmdc:mga09592_333385_c1 nmdc:mga09592_333385_c1_816_1268 145
907 3300050510 nmdc:mga06r32_499245_c1 nmdc:mga06r32_499245_c1_234_686 145
908 3300050511 nmdc:mga08y16_4830_c1 nmdc:mga08y16_4830_c1_4095_4547 145
909 3300060353 Ga0501082_0642955 Ga0501082_0642955_397_846 145
910 3300044684 Ga0466966_0157141 Ga0466966_0157141_330_773 146
911 3300045049 Ga0466959_0244931 Ga0466959_0244931_686_1129 146
912 3300005543 Ga0070672_100000007 Ga0070672_10000000777 147
913 3300025940 Ga0207691_10000525 Ga0207691_1000052545 147
914 3300005518 Ga0070699_100128058 Ga0070699_1001280581 148
915 3300025922 Ga0207646_10000162 Ga0207646_1000016254 148
916 3300044694 Ga0466963_0734848 Ga0466963_0734848_204_656 148
917 3300045049 Ga0466959_0096623 Ga0466959_0096623_1274_1762 148
918 iso_pu_bacteria 2687453341 2688394974 148
919 3300025903 Ga0207680_10004019 Ga0207680_100040192 149
920 2162886007 SwRhRL2b_contig_3932664 SwRhRL2b_0969.00010440 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

39

157

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vph-assembly2.cif.gz_E crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution 0.8863 7 146
1ve0-assembly1.cif.gz_A crystal structure of uncharacterized protein st2072 from sulfolobus tokodaii 0.8848 9 143
1vph-assembly2.cif.gz_E crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution 0.8804 7 146
2cu5-assembly1.cif.gz_C crystal structure of the conserved hypothetical protein tt1486 from thermus thermophilus hb8 0.8743 11 142
1vmf-assembly1.cif.gz_C crystal structure of a ybjq-like fold protein of unknown function (bh3498) from bacillus halodurans at 1.46 a resolution 0.8726 12 140
ID Description Score Start End Superfamily
af_O14155_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9903 9 143 2.60.120.460
af_P0AF48_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9777 9 146 2.60.120.460
af_P0AF48_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9707 9 146 2.60.120.460
af_O14155_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.962 9 143 2.60.120.460
af_P9WFP9_1_132_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.887 11 143 2.60.120.460
ID Description Score Start End GO Terms
AF-A0A350QL25-F1-model_v4 YjbQ family protein 0.9974 9 146
AF-A0A0H0Y7M9-F1-model_v4 deleted 0.9973 9 146
AF-A0A7C6ZTY1-F1-model_v4 YjbQ family protein 0.9971 7 148
AF-A0A7X1FCT8-F1-model_v4 YjbQ family protein 0.9971 9 148
AF-A0A1A8TK41-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9968 9 146

Feature Viewer

pLDDT pTM Quality
92.11 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map