F485667
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 918 | 383 | 882 | 283 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10017010|Ga0081455_100170102 |
| Length | 312 |
| Sequence | VTWPHREQLAFPSPLPVPGVPSVPEASYAPHVRVDLSSFSDLLRRQAPELLPVNRSGPFDAVPSGALPHGTTIVALKFPGGVVLAGDRRSTQGNMIAGRDVQKVYITDDYTATGIAGTAAIAVEFARLYAVELEHYEKTEGVPLTFRGKVNRLATMVRGNLGAALQGFVALPLLAAYDLDDPDPQAAGRIVSFDAAGGWNLEEEGYQSVGSGSIFAKSSIKKLYSQVVDADSALRVAIEGLYDAADDDSATGGPDLVRGIYPTAVILHAEGAEEVPETRIAELAREVIESRSRSDTFGPDAAHRSADARGDS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 2 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 3 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 4 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 5 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 6 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 7 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 8 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 9 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 10 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 11 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 12 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 13 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 14 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 15 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 16 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 17 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 18 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 19 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 20 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 21 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 22 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 23 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 24 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 25 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 26 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 27 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 28 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 29 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 30 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 31 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 32 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 33 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 34 | 2946024296 | Arthrobacter woluwensis W4I2 | Isolate | Rhizosphere |
| 35 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 36 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 37 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 38 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 39 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 40 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 41 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 42 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 43 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 44 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 45 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 46 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 50 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 54 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 64 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 80 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 81 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 83 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 88 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 90 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 91 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 92 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 94 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 95 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 96 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 97 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 98 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 99 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 100 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 101 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 102 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 103 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 104 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 106 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 107 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 108 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 112 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 113 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 114 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 116 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 117 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 118 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 119 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 120 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 121 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 123 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 136 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 156 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 157 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 158 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 159 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 160 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 161 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 162 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 219 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 222 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 223 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 224 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 225 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 226 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 227 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 228 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 229 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 230 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 231 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 232 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 233 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 234 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 236 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 238 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 239 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 240 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 242 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 243 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 244 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 246 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 248 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 249 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 250 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 251 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 252 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 253 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 254 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 255 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 256 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 257 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 261 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 262 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 263 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 264 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 265 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 266 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 267 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 268 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 269 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 270 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 271 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 272 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 273 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 274 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 275 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 276 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 277 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 278 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 279 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 280 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 313 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 314 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 315 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 316 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 317 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 318 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 321 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 322 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 323 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 324 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 325 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 326 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 327 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 328 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 329 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 330 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 331 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 332 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 333 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 334 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 335 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 336 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 337 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 360 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 361 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 362 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 363 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 364 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 365 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 370 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 375 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 376 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 377 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 378 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 379 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 380 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.34 |
| Metatranscriptomes | 1.74 |
| Isolates | 3.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.3 |
| Nodule | 0.11 |
| Rhizoplane | 12.64 |
| Rhizosphere | 70.92 |
| Stem | 0 |
| Stem Tuber | 0.11 |
| Unclassified | 8.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1001556 | 3300001977 | Bacteria | 3658 |
| 2 | JGI24737J22298_10042961 | 3300001990 | Bacteria | 1384 |
| 3 | JGI24743J22301_10003990 | 3300001991 | Bacteria | 2372 |
| 4 | JGI24735J21928_10041998 | 3300002067 | Bacteria | 1332 |
| 5 | JGI24738J21930_10007588 | 3300002075 | Bacteria | 2497 |
| 6 | JGI24738J21930_10013856 | 3300002075 | Bacteria | 1736 |
| 7 | JGI24744J21845_10003124 | 3300002077 | Bacteria | 3396 |
| 8 | JGI24744J21845_10005466 | 3300002077 | Bacteria | 2629 |
| 9 | JGI24034J26672_10013165 | 3300002239 | Bacteria | 1254 |
| 10 | rootL2_10062985 | 3300003322 | Bacteria | 3061 |
| 11 | Ga0055540_1001305 | 3300003792 | Bacteria | 15075 |
| 12 | Ga0055540_1002845 | 3300003792 | Bacteria | 8809 |
| 13 | Ga0055540_1008869 | 3300003792 | Bacteria | 3560 |
| 14 | Ga0070658_10047833 | 3300005327 | Bacteria | 3462 |
| 15 | Ga0070676_10027785 | 3300005328 | Bacteria | 3211 |
| 16 | Ga0070683_100037531 | 3300005329 | Bacteria | 4435 |
| 17 | Ga0070683_100082793 | 3300005329 | Bacteria | 3005 |
| 18 | Ga0070683_100152867 | 3300005329 | Bacteria | 2188 |
| 19 | Ga0068869_100017978 | 3300005334 | Bacteria | 4805 |
| 20 | Ga0068869_100020301 | 3300005334 | Bacteria | 4554 |
| 21 | Ga0070666_10221518 | 3300005335 | Bacteria | 1335 |
| 22 | Ga0070680_100354431 | 3300005336 | Bacteria | 1248 |
| 23 | Ga0070682_100047587 | 3300005337 | Bacteria | 2667 |
| 24 | Ga0070682_100125579 | 3300005337 | Bacteria | 1729 |
| 25 | Ga0070682_100150455 | 3300005337 | Bacteria | 1596 |
| 26 | Ga0068868_100005264 | 3300005338 | Bacteria | 9081 |
| 27 | Ga0068868_100049862 | 3300005338 | Bacteria | 3286 |
| 28 | Ga0068868_100095915 | 3300005338 | Bacteria | 2395 |
| 29 | Ga0070660_100069801 | 3300005339 | Bacteria | 2741 |
| 30 | Ga0070660_100177347 | 3300005339 | Bacteria | 1723 |
| 31 | Ga0070689_100003359 | 3300005340 | Bacteria | 10637 |
| 32 | Ga0070691_10010299 | 3300005341 | Bacteria | 4267 |
| 33 | Ga0070692_10111031 | 3300005345 | Bacteria | 1516 |
| 34 | Ga0070692_10126683 | 3300005345 | Bacteria | 1430 |
| 35 | Ga0070668_100002289 | 3300005347 | Bacteria | 14123 |
| 36 | Ga0070668_100126623 | 3300005347 | Bacteria | 2046 |
| 37 | Ga0070668_100458063 | 3300005347 | Bacteria | 1098 |
| 38 | Ga0070669_100017202 | 3300005353 | Bacteria | 5158 |
| 39 | Ga0070669_100133442 | 3300005353 | Bacteria | 1908 |
| 40 | Ga0070671_100003579 | 3300005355 | Bacteria | 12151 |
| 41 | Ga0070671_100104700 | 3300005355 | Bacteria | 2375 |
| 42 | Ga0070671_100114225 | 3300005355 | Bacteria | 2270 |
| 43 | Ga0070674_100000471 | 3300005356 | Bacteria | 20281 |
| 44 | Ga0070674_100033147 | 3300005356 | Bacteria | 3436 |
| 45 | Ga0070673_100028669 | 3300005364 | Bacteria | 4143 |
| 46 | Ga0070688_100012339 | 3300005365 | Bacteria | 4786 |
| 47 | Ga0070659_100009523 | 3300005366 | Bacteria | 7138 |
| 48 | Ga0070659_100086939 | 3300005366 | Bacteria | 2502 |
| 49 | Ga0070667_100000223 | 3300005367 | Bacteria | 65543 |
| 50 | Ga0070667_100007458 | 3300005367 | Bacteria | 9082 |
| 51 | Ga0070667_100016968 | 3300005367 | Bacteria | 6027 |
| 52 | Ga0070667_100070944 | 3300005367 | Bacteria | 2966 |
| 53 | Ga0070667_100332217 | 3300005367 | Bacteria | 1373 |
| 54 | Ga0070709_10161941 | 3300005434 | Bacteria | 1557 |
| 55 | Ga0070709_10174314 | 3300005434 | Bacteria | 1505 |
| 56 | Ga0070709_10259509 | 3300005434 | Bacteria | 1255 |
| 57 | Ga0070714_100000002 | 3300005435 | Bacteria | 386673 |
| 58 | Ga0070714_100001157 | 3300005435 | Bacteria | 18993 |
| 59 | Ga0070714_100002560 | 3300005435 | Bacteria | 13392 |
| 60 | Ga0070714_100069562 | 3300005435 | Bacteria | 3041 |
| 61 | Ga0070714_100183991 | 3300005435 | Bacteria | 1903 |
| 62 | Ga0070713_100475504 | 3300005436 | Bacteria | 1176 |
| 63 | Ga0070710_10001183 | 3300005437 | Bacteria | 12311 |
| 64 | Ga0070710_10058120 | 3300005437 | Bacteria | 2193 |
| 65 | Ga0070710_10058156 | 3300005437 | Bacteria | 2192 |
| 66 | Ga0070701_10003260 | 3300005438 | Bacteria | 6388 |
| 67 | Ga0070711_100000406 | 3300005439 | Bacteria | 22315 |
| 68 | Ga0070711_100001458 | 3300005439 | Bacteria | 13004 |
| 69 | Ga0070711_100179428 | 3300005439 | Bacteria | 1620 |
| 70 | Ga0070705_100001938 | 3300005440 | Bacteria | 10609 |
| 71 | Ga0070700_100001602 | 3300005441 | Bacteria | 11285 |
| 72 | Ga0070700_100295886 | 3300005441 | Bacteria | 1179 |
| 73 | Ga0070694_100009611 | 3300005444 | Bacteria | 5934 |
| 74 | Ga0070663_100000482 | 3300005455 | Bacteria | 20982 |
| 75 | Ga0070663_100013543 | 3300005455 | Bacteria | 5205 |
| 76 | Ga0070663_100106913 | 3300005455 | Bacteria | 2097 |
| 77 | Ga0070678_100000482 | 3300005456 | Bacteria | 19049 |
| 78 | Ga0070678_100282215 | 3300005456 | Bacteria | 1405 |
| 79 | Ga0070678_100339739 | 3300005456 | Bacteria | 1288 |
| 80 | Ga0070662_100015443 | 3300005457 | Bacteria | 5115 |
| 81 | Ga0070681_10036461 | 3300005458 | Bacteria | 4938 |
| 82 | Ga0070681_10099073 | 3300005458 | Bacteria | 2861 |
| 83 | Ga0068867_100000934 | 3300005459 | Bacteria | 19870 |
| 84 | Ga0068867_100026719 | 3300005459 | Bacteria | 4146 |
| 85 | Ga0070679_100008082 | 3300005530 | Bacteria | 9889 |
| 86 | Ga0070679_100328067 | 3300005530 | Bacteria | 1479 |
| 87 | Ga0070684_100110136 | 3300005535 | Bacteria | 2469 |
| 88 | Ga0068853_100009617 | 3300005539 | Bacteria | 7791 |
| 89 | Ga0068853_100105292 | 3300005539 | Bacteria | 2499 |
| 90 | Ga0068853_100243795 | 3300005539 | Bacteria | 1648 |
| 91 | Ga0070686_100166929 | 3300005544 | Bacteria | 1554 |
| 92 | Ga0070696_100030928 | 3300005546 | Bacteria | 3666 |
| 93 | Ga0070665_100005604 | 3300005548 | Bacteria | 12910 |
| 94 | Ga0070665_100079456 | 3300005548 | Bacteria | 3285 |
| 95 | Ga0070665_100225747 | 3300005548 | Bacteria | 1873 |
| 96 | Ga0070704_100002252 | 3300005549 | Bacteria | 10770 |
| 97 | Ga0068855_100086047 | 3300005563 | Bacteria | 3635 |
| 98 | Ga0068855_100146959 | 3300005563 | Bacteria | 2682 |
| 99 | Ga0068855_100448108 | 3300005563 | Bacteria | 1409 |
| 100 | Ga0068855_100763640 | 3300005563 | Bacteria | 1030 |
| 101 | Ga0070664_100073369 | 3300005564 | Bacteria | 2936 |
| 102 | Ga0068857_100216013 | 3300005577 | Bacteria | 1750 |
| 103 | Ga0068854_100009065 | 3300005578 | Bacteria | 6412 |
| 104 | Ga0068854_100239728 | 3300005578 | Bacteria | 1443 |
| 105 | Ga0068854_100311278 | 3300005578 | Bacteria | 1277 |
| 106 | Ga0068854_100320542 | 3300005578 | Bacteria | 1259 |
| 107 | Ga0068856_100070832 | 3300005614 | Bacteria | 3450 |
| 108 | Ga0068856_100126969 | 3300005614 | Bacteria | 2554 |
| 109 | Ga0068856_100130685 | 3300005614 | Bacteria | 2516 |
| 110 | Ga0068856_100160997 | 3300005614 | Bacteria | 2255 |
| 111 | Ga0068856_100251973 | 3300005614 | Bacteria | 1781 |
| 112 | Ga0068856_100636810 | 3300005614 | Bacteria | 1087 |
| 113 | Ga0070702_100004933 | 3300005615 | Bacteria | 6152 |
| 114 | Ga0070702_100051015 | 3300005615 | Bacteria | 2366 |
| 115 | Ga0068852_100008929 | 3300005616 | Bacteria | 7419 |
| 116 | Ga0068852_100164332 | 3300005616 | Bacteria | 2075 |
| 117 | Ga0068859_100000174 | 3300005617 | Bacteria | 62740 |
| 118 | Ga0068859_100002361 | 3300005617 | Bacteria | 19217 |
| 119 | Ga0068859_100266404 | 3300005617 | Bacteria | 1805 |
| 120 | Ga0068866_10000543 | 3300005718 | Bacteria | 17242 |
| 121 | Ga0068866_10278566 | 3300005718 | Bacteria | 1035 |
| 122 | Ga0068861_100000669 | 3300005719 | Bacteria | 20400 |
| 123 | Ga0068861_100092328 | 3300005719 | Bacteria | 2391 |
| 124 | Ga0068861_100192641 | 3300005719 | Bacteria | 1705 |
| 125 | Ga0068851_10046768 | 3300005834 | Bacteria | 2190 |
| 126 | Ga0068863_100001502 | 3300005841 | Bacteria | 23086 |
| 127 | Ga0068863_100013710 | 3300005841 | Bacteria | 7816 |
| 128 | Ga0068863_100671027 | 3300005841 | Bacteria | 1029 |
| 129 | Ga0068858_100019851 | 3300005842 | Bacteria | 6284 |
| 130 | Ga0068858_100030525 | 3300005842 | Bacteria | 5005 |
| 131 | Ga0068858_100123995 | 3300005842 | Bacteria | 2418 |
| 132 | Ga0068858_100511308 | 3300005842 | Bacteria | 1161 |
| 133 | Ga0068860_100000044 | 3300005843 | Bacteria | 225595 |
| 134 | Ga0068860_100004988 | 3300005843 | Bacteria | 13522 |
| 135 | Ga0068860_100007980 | 3300005843 | Bacteria | 10558 |
| 136 | Ga0068860_100152545 | 3300005843 | Bacteria | 2225 |
| 137 | Ga0068862_100000003 | 3300005844 | Bacteria | 369793 |
| 138 | Ga0068862_100004477 | 3300005844 | Bacteria | 11776 |
| 139 | Ga0068862_100046183 | 3300005844 | Bacteria | 3716 |
| 140 | Ga0081455_10004103 | 3300005937 | Bacteria | 16483 |
| 141 | Ga0081455_10004245 | 3300005937 | Bacteria | 16161 |
| 142 | Ga0081455_10005680 | 3300005937 | Bacteria | 13614 |
| 143 | Ga0081455_10017010 | 3300005937 | Bacteria | 6990 |
| 144 | Ga0081455_10248051 | 3300005937 | Bacteria | 1304 |
| 145 | Ga0081538_10079482 | 3300005981 | Bacteria | 1754 |
| 146 | Ga0070717_10084392 | 3300006028 | Bacteria | 2672 |
| 147 | Ga0070717_10148509 | 3300006028 | Bacteria | 2027 |
| 148 | Ga0075365_10003069 | 3300006038 | Bacteria | 8479 |
| 149 | Ga0075365_10015269 | 3300006038 | Bacteria | 4641 |
| 150 | Ga0075365_10030422 | 3300006038 | Bacteria | 3458 |
| 151 | Ga0075365_10033987 | 3300006038 | Bacteria | 3290 |
| 152 | Ga0075365_10049787 | 3300006038 | Bacteria | 2761 |
| 153 | Ga0075365_10108574 | 3300006038 | Bacteria | 1905 |
| 154 | Ga0075363_100002096 | 3300006048 | Bacteria | 7991 |
| 155 | Ga0075363_100002452 | 3300006048 | Bacteria | 7581 |
| 156 | Ga0075363_100004795 | 3300006048 | Bacteria | 5965 |
| 157 | Ga0075363_100005479 | 3300006048 | Bacteria | 5654 |
| 158 | Ga0075363_100025102 | 3300006048 | Bacteria | 3036 |
| 159 | Ga0075364_10003636 | 3300006051 | Bacteria | 8795 |
| 160 | Ga0075364_10009652 | 3300006051 | Bacteria | 5798 |
| 161 | Ga0075364_10030965 | 3300006051 | Bacteria | 3436 |
| 162 | Ga0075364_10132179 | 3300006051 | Bacteria | 1676 |
| 163 | Ga0070715_10146171 | 3300006163 | Bacteria | 1153 |
| 164 | Ga0070716_100004348 | 3300006173 | Bacteria | 6762 |
| 165 | Ga0070716_100005819 | 3300006173 | Bacteria | 5988 |
| 166 | Ga0070712_100002733 | 3300006175 | Bacteria | 10893 |
| 167 | Ga0070712_100021230 | 3300006175 | Bacteria | 4261 |
| 168 | Ga0070712_100191344 | 3300006175 | Bacteria | 1601 |
| 169 | Ga0075362_10010187 | 3300006177 | Bacteria | 3663 |
| 170 | Ga0075367_10002207 | 3300006178 | Bacteria | 8785 |
| 171 | Ga0075369_10005350 | 3300006186 | Bacteria | 4789 |
| 172 | Ga0075369_10010120 | 3300006186 | Bacteria | 3683 |
| 173 | Ga0075369_10061175 | 3300006186 | Bacteria | 1643 |
| 174 | Ga0097621_100369856 | 3300006237 | Bacteria | 1279 |
| 175 | Ga0075370_10005252 | 3300006353 | Bacteria | 6412 |
| 176 | Ga0075370_10011670 | 3300006353 | Bacteria | 4623 |
| 177 | Ga0075370_10014522 | 3300006353 | Bacteria | 4203 |
| 178 | Ga0075370_10080733 | 3300006353 | Bacteria | 1869 |
| 179 | Ga0068871_100448624 | 3300006358 | Bacteria | 1156 |
| 180 | Ga0075428_100013479 | 3300006844 | Bacteria | 9098 |
| 181 | Ga0075430_100031786 | 3300006846 | Bacteria | 4480 |
| 182 | Ga0075431_100092085 | 3300006847 | Bacteria | 3129 |
| 183 | Ga0068865_100000375 | 3300006881 | Bacteria | 24788 |
| 184 | Ga0097620_100000174 | 3300006931 | Bacteria | 62740 |
| 185 | Ga0097620_100002361 | 3300006931 | Bacteria | 19217 |
| 186 | Ga0097620_100266375 | 3300006931 | Bacteria | 1805 |
| 187 | Ga0097620_100926545 | 3300006931 | Bacteria | 955 |
| 188 | Ga0075435_100558358 | 3300007076 | Bacteria | 992 |
| 189 | Ga0105250_10043332 | 3300009092 | Bacteria | 1803 |
| 190 | Ga0105240_10206316 | 3300009093 | Bacteria | 2300 |
| 191 | Ga0105240_10707493 | 3300009093 | Bacteria | 1099 |
| 192 | Ga0105245_10001215 | 3300009098 | Bacteria | 23288 |
| 193 | Ga0105245_10013569 | 3300009098 | Bacteria | 7097 |
| 194 | Ga0105245_10054329 | 3300009098 | Bacteria | 3597 |
| 195 | Ga0105245_10098676 | 3300009098 | Bacteria | 2699 |
| 196 | Ga0105247_10000006 | 3300009101 | Bacteria | 416061 |
| 197 | Ga0105247_10001445 | 3300009101 | Bacteria | 17165 |
| 198 | Ga0105247_10003264 | 3300009101 | Bacteria | 10634 |
| 199 | Ga0105247_10061866 | 3300009101 | Bacteria | 2322 |
| 200 | Ga0105247_10282773 | 3300009101 | Bacteria | 1145 |
| 201 | Ga0114129_10152595 | 3300009147 | Bacteria | 3161 |
| 202 | Ga0105243_10001235 | 3300009148 | Bacteria | 23033 |
| 203 | Ga0105243_10278934 | 3300009148 | Bacteria | 1504 |
| 204 | Ga0105243_10456623 | 3300009148 | Bacteria | 1200 |
| 205 | Ga0105243_10629568 | 3300009148 | Bacteria | 1037 |
| 206 | Ga0105241_10053111 | 3300009174 | Bacteria | 3097 |
| 207 | Ga0105242_10019364 | 3300009176 | Bacteria | 5333 |
| 208 | Ga0105242_10118330 | 3300009176 | Bacteria | 2269 |
| 209 | Ga0105248_10000042 | 3300009177 | Bacteria | 167583 |
| 210 | Ga0105248_10004628 | 3300009177 | Bacteria | 15218 |
| 211 | Ga0105248_10130627 | 3300009177 | Bacteria | 2834 |
| 212 | Ga0105237_10005606 | 3300009545 | Bacteria | 14149 |
| 213 | Ga0105237_10030990 | 3300009545 | Bacteria | 5425 |
| 214 | Ga0105237_10092580 | 3300009545 | Bacteria | 3012 |
| 215 | Ga0105237_10095068 | 3300009545 | Bacteria | 2969 |
| 216 | Ga0105237_10176345 | 3300009545 | Bacteria | 2137 |
| 217 | Ga0105238_10095118 | 3300009551 | Bacteria | 2966 |
| 218 | Ga0105238_10295694 | 3300009551 | Bacteria | 1602 |
| 219 | Ga0105249_10000008 | 3300009553 | Bacteria | 341271 |
| 220 | Ga0105249_10032703 | 3300009553 | Bacteria | 4706 |
| 221 | Ga0105249_10068831 | 3300009553 | Bacteria | 3265 |
| 222 | Ga0105249_10082444 | 3300009553 | Bacteria | 2992 |
| 223 | Ga0099796_10059832 | 3300010159 | Bacteria | 1347 |
| 224 | Ga0105239_10002249 | 3300010375 | Bacteria | 24678 |
| 225 | Ga0105239_10158674 | 3300010375 | Bacteria | 2527 |
| 226 | Ga0105246_10043905 | 3300011119 | Bacteria | 3035 |
| 227 | Ga0105246_10496382 | 3300011119 | Bacteria | 1036 |
| 228 | Ga0157370_10047047 | 3300013104 | Bacteria | 4136 |
| 229 | Ga0157369_10027215 | 3300013105 | Bacteria | 6340 |
| 230 | Ga0157369_10151735 | 3300013105 | Bacteria | 2449 |
| 231 | Ga0157374_10077044 | 3300013296 | Bacteria | 3154 |
| 232 | Ga0157374_10515138 | 3300013296 | Bacteria | 1202 |
| 233 | Ga0157378_10004183 | 3300013297 | Bacteria | 12744 |
| 234 | Ga0157378_10829066 | 3300013297 | Bacteria | 952 |
| 235 | Ga0163162_10040329 | 3300013306 | Bacteria | 4669 |
| 236 | Ga0163162_10055357 | 3300013306 | Bacteria | 3993 |
| 237 | Ga0163162_10060455 | 3300013306 | Bacteria | 3824 |
| 238 | Ga0157372_10006800 | 3300013307 | Bacteria | 12158 |
| 239 | Ga0157375_10004087 | 3300013308 | Bacteria | 12650 |
| 240 | Ga0157375_10159637 | 3300013308 | Bacteria | 2396 |
| 241 | Ga0157375_10192559 | 3300013308 | Bacteria | 2194 |
| 242 | Ga0163163_10026112 | 3300014325 | Bacteria | 5578 |
| 243 | Ga0163163_10083220 | 3300014325 | Bacteria | 3205 |
| 244 | Ga0163163_10122872 | 3300014325 | Bacteria | 2631 |
| 245 | Ga0157380_10001110 | 3300014326 | Bacteria | 17350 |
| 246 | Ga0157380_10494969 | 3300014326 | Bacteria | 1186 |
| 247 | Ga0157377_10129611 | 3300014745 | Bacteria | 1539 |
| 248 | Ga0157379_10050480 | 3300014968 | Bacteria | 3714 |
| 249 | Ga0157379_10088164 | 3300014968 | Bacteria | 2782 |
| 250 | Ga0157379_10168598 | 3300014968 | Bacteria | 1976 |
| 251 | Ga0157379_10277181 | 3300014968 | Bacteria | 1526 |
| 252 | Ga0157376_10242369 | 3300014969 | Bacteria | 1680 |
| 253 | Ga0163161_10008820 | 3300017792 | Bacteria | 6970 |
| 254 | Ga0163161_10064177 | 3300017792 | Bacteria | 2678 |
| 255 | Ga0163161_10100607 | 3300017792 | Bacteria | 2151 |
| 256 | Ga0197907_10431376 | 3300020069 | Bacteria | 1137 |
| 257 | Ga0197907_10461530 | 3300020069 | Bacteria | 2385 |
| 258 | Ga0197907_10466403 | 3300020069 | Bacteria | 2604 |
| 259 | Ga0206356_10444711 | 3300020070 | Bacteria | 1508 |
| 260 | Ga0206356_11020425 | 3300020070 | Bacteria | 2406 |
| 261 | Ga0206349_1164363 | 3300020075 | Bacteria | 1058 |
| 262 | Ga0206351_10225639 | 3300020077 | Bacteria | 1557 |
| 263 | Ga0206351_10437193 | 3300020077 | Bacteria | 1399 |
| 264 | Ga0206350_10078532 | 3300020080 | Bacteria | 1209 |
| 265 | Ga0206354_10468886 | 3300020081 | Bacteria | 2290 |
| 266 | Ga0206353_10462189 | 3300020082 | Bacteria | 6229 |
| 267 | Ga0206353_11702945 | 3300020082 | Bacteria | 3277 |
| 268 | Ga0213873_10000053 | 3300021358 | Bacteria | 25736 |
| 269 | Ga0213876_10002254 | 3300021384 | Bacteria | 11393 |
| 270 | Ga0213876_10091830 | 3300021384 | Bacteria | 1608 |
| 271 | Ga0213875_10005854 | 3300021388 | Bacteria | 6539 |
| 272 | Ga0213875_10094498 | 3300021388 | Bacteria | 1394 |
| 273 | Ga0224712_10084439 | 3300022467 | Bacteria | 1317 |
| 274 | Ga0209673_1008842 | 3300025273 | Bacteria | 4436 |
| 275 | Ga0209673_1056658 | 3300025273 | Bacteria | 1002 |
| 276 | Ga0209051_1000075 | 3300025303 | Bacteria | 205011 |
| 277 | Ga0209051_1001162 | 3300025303 | Bacteria | 23957 |
| 278 | Ga0209051_1002980 | 3300025303 | Bacteria | 11528 |
| 279 | Ga0209051_1011514 | 3300025303 | Bacteria | 4359 |
| 280 | Ga0209051_1031448 | 3300025303 | Bacteria | 2042 |
| 281 | Ga0209051_1037337 | 3300025303 | Bacteria | 1782 |
| 282 | Ga0207696_1019145 | 3300025711 | Bacteria | 2235 |
| 283 | Ga0207692_10002301 | 3300025898 | Bacteria | 7329 |
| 284 | Ga0207692_10004267 | 3300025898 | Bacteria | 5651 |
| 285 | Ga0207692_10112640 | 3300025898 | Bacteria | 1511 |
| 286 | Ga0207642_10001569 | 3300025899 | Bacteria | 7038 |
| 287 | Ga0207710_10000025 | 3300025900 | Bacteria | 314658 |
| 288 | Ga0207710_10001933 | 3300025900 | Bacteria | 9920 |
| 289 | Ga0207710_10004333 | 3300025900 | Bacteria | 6209 |
| 290 | Ga0207688_10000454 | 3300025901 | Bacteria | 19450 |
| 291 | Ga0207688_10010480 | 3300025901 | Bacteria | 5043 |
| 292 | Ga0207680_10009035 | 3300025903 | Bacteria | 4923 |
| 293 | Ga0207647_10086873 | 3300025904 | Bacteria | 1869 |
| 294 | Ga0207647_10103716 | 3300025904 | Bacteria | 1686 |
| 295 | Ga0207699_10012267 | 3300025906 | Bacteria | 4356 |
| 296 | Ga0207699_10076787 | 3300025906 | Bacteria | 2059 |
| 297 | Ga0207699_10086856 | 3300025906 | Bacteria | 1954 |
| 298 | Ga0207645_10030401 | 3300025907 | Bacteria | 3479 |
| 299 | Ga0207705_10116186 | 3300025909 | Bacteria | 1981 |
| 300 | Ga0207705_10239754 | 3300025909 | Bacteria | 1381 |
| 301 | Ga0207654_10037937 | 3300025911 | Bacteria | 2700 |
| 302 | Ga0207707_10019173 | 3300025912 | Bacteria | 5971 |
| 303 | Ga0207707_10091566 | 3300025912 | Bacteria | 2657 |
| 304 | Ga0207695_10137555 | 3300025913 | Bacteria | 2394 |
| 305 | Ga0207671_10010925 | 3300025914 | Bacteria | 7441 |
| 306 | Ga0207671_10027259 | 3300025914 | Bacteria | 4271 |
| 307 | Ga0207671_10068019 | 3300025914 | Bacteria | 2653 |
| 308 | Ga0207671_10131627 | 3300025914 | Bacteria | 1920 |
| 309 | Ga0207693_10001043 | 3300025915 | Bacteria | 24769 |
| 310 | Ga0207693_10002779 | 3300025915 | Bacteria | 15146 |
| 311 | Ga0207693_10020056 | 3300025915 | Bacteria | 5317 |
| 312 | Ga0207693_10286712 | 3300025915 | Bacteria | 1290 |
| 313 | Ga0207663_10008634 | 3300025916 | Bacteria | 5344 |
| 314 | Ga0207663_10094500 | 3300025916 | Bacteria | 1992 |
| 315 | Ga0207663_10107599 | 3300025916 | Bacteria | 1886 |
| 316 | Ga0207663_10151550 | 3300025916 | Bacteria | 1627 |
| 317 | Ga0207657_10109507 | 3300025919 | Bacteria | 2282 |
| 318 | Ga0207652_10021282 | 3300025921 | Bacteria | 5352 |
| 319 | Ga0207652_10445336 | 3300025921 | Bacteria | 1168 |
| 320 | Ga0207681_10003522 | 3300025923 | Bacteria | 9749 |
| 321 | Ga0207681_10345128 | 3300025923 | Bacteria | 1190 |
| 322 | Ga0207687_10010540 | 3300025927 | Bacteria | 6040 |
| 323 | Ga0207687_10026990 | 3300025927 | Bacteria | 3849 |
| 324 | Ga0207687_10137715 | 3300025927 | Bacteria | 1848 |
| 325 | Ga0207664_10000038 | 3300025929 | Bacteria | 166264 |
| 326 | Ga0207664_10000615 | 3300025929 | Bacteria | 24687 |
| 327 | Ga0207664_10012150 | 3300025929 | Bacteria | 6152 |
| 328 | Ga0207664_10091950 | 3300025929 | Bacteria | 2489 |
| 329 | Ga0207644_10002811 | 3300025931 | Bacteria | 11222 |
| 330 | Ga0207644_10095252 | 3300025931 | Bacteria | 2226 |
| 331 | Ga0207644_10142158 | 3300025931 | Bacteria | 1849 |
| 332 | Ga0207690_10183572 | 3300025932 | Bacteria | 1577 |
| 333 | Ga0207690_10304902 | 3300025932 | Bacteria | 1247 |
| 334 | Ga0207706_10013244 | 3300025933 | Bacteria | 7503 |
| 335 | Ga0207706_10054732 | 3300025933 | Bacteria | 3520 |
| 336 | Ga0207686_10020172 | 3300025934 | Bacteria | 3804 |
| 337 | Ga0207709_10006901 | 3300025935 | Bacteria | 6355 |
| 338 | Ga0207669_10003546 | 3300025937 | Bacteria | 6759 |
| 339 | Ga0207704_10000983 | 3300025938 | Bacteria | 12653 |
| 340 | Ga0207665_10002392 | 3300025939 | Bacteria | 12678 |
| 341 | Ga0207665_10004004 | 3300025939 | Bacteria | 9845 |
| 342 | Ga0207665_10058523 | 3300025939 | Bacteria | 2606 |
| 343 | Ga0207691_10053293 | 3300025940 | Bacteria | 3693 |
| 344 | Ga0207711_10000697 | 3300025941 | Bacteria | 33164 |
| 345 | Ga0207711_10004749 | 3300025941 | Bacteria | 11536 |
| 346 | Ga0207689_10009086 | 3300025942 | Bacteria | 8604 |
| 347 | Ga0207689_10059640 | 3300025942 | Bacteria | 3138 |
| 348 | Ga0207661_10082312 | 3300025944 | Bacteria | 2661 |
| 349 | Ga0207661_10195571 | 3300025944 | Bacteria | 1775 |
| 350 | Ga0207667_10087359 | 3300025949 | Bacteria | 3225 |
| 351 | Ga0207667_10150114 | 3300025949 | Bacteria | 2399 |
| 352 | Ga0207667_10422068 | 3300025949 | Bacteria | 1357 |
| 353 | Ga0207712_10000011 | 3300025961 | Bacteria | 412321 |
| 354 | Ga0207712_10008487 | 3300025961 | Bacteria | 6496 |
| 355 | Ga0207712_10309105 | 3300025961 | Bacteria | 1300 |
| 356 | Ga0207668_10005691 | 3300025972 | Bacteria | 7339 |
| 357 | Ga0207668_10007628 | 3300025972 | Bacteria | 6442 |
| 358 | Ga0207668_10417182 | 3300025972 | Bacteria | 1138 |
| 359 | Ga0207640_10008708 | 3300025981 | Bacteria | 5645 |
| 360 | Ga0207640_10472180 | 3300025981 | Bacteria | 1038 |
| 361 | Ga0207658_10000307 | 3300025986 | Bacteria | 50415 |
| 362 | Ga0207658_10000423 | 3300025986 | Bacteria | 40097 |
| 363 | Ga0207658_10002974 | 3300025986 | Bacteria | 12126 |
| 364 | Ga0207658_10019255 | 3300025986 | Bacteria | 4719 |
| 365 | Ga0207677_10006124 | 3300026023 | Bacteria | 6569 |
| 366 | Ga0207677_10262562 | 3300026023 | Bacteria | 1408 |
| 367 | Ga0207677_10381973 | 3300026023 | Bacteria | 1189 |
| 368 | Ga0207703_10005256 | 3300026035 | Bacteria | 10443 |
| 369 | Ga0207703_10006939 | 3300026035 | Bacteria | 9013 |
| 370 | Ga0207703_10134024 | 3300026035 | Bacteria | 2142 |
| 371 | Ga0207639_10005060 | 3300026041 | Bacteria | 8881 |
| 372 | Ga0207639_10016358 | 3300026041 | Bacteria | 5246 |
| 373 | Ga0207678_10005592 | 3300026067 | Bacteria | 11237 |
| 374 | Ga0207678_10021422 | 3300026067 | Bacteria | 5667 |
| 375 | Ga0207678_10024812 | 3300026067 | Bacteria | 5234 |
| 376 | Ga0207678_10107313 | 3300026067 | Bacteria | 2382 |
| 377 | Ga0207678_10126879 | 3300026067 | Bacteria | 2176 |
| 378 | Ga0207678_10565113 | 3300026067 | Bacteria | 996 |
| 379 | Ga0207708_10001649 | 3300026075 | Bacteria | 16609 |
| 380 | Ga0207708_10163519 | 3300026075 | Bacteria | 1759 |
| 381 | Ga0207708_10165363 | 3300026075 | Bacteria | 1749 |
| 382 | Ga0207702_10074608 | 3300026078 | Bacteria | 2928 |
| 383 | Ga0207702_10099159 | 3300026078 | Bacteria | 2568 |
| 384 | Ga0207702_10143448 | 3300026078 | Bacteria | 2164 |
| 385 | Ga0207702_10274305 | 3300026078 | Bacteria | 1592 |
| 386 | Ga0207702_10533737 | 3300026078 | Bacteria | 1146 |
| 387 | Ga0207641_10005680 | 3300026088 | Bacteria | 10618 |
| 388 | Ga0207641_10058734 | 3300026088 | Bacteria | 3274 |
| 389 | Ga0207641_10365635 | 3300026088 | Bacteria | 1378 |
| 390 | Ga0207648_10001183 | 3300026089 | Bacteria | 29207 |
| 391 | Ga0207648_10021818 | 3300026089 | Bacteria | 5753 |
| 392 | Ga0207648_10199794 | 3300026089 | Bacteria | 1773 |
| 393 | Ga0207676_10114078 | 3300026095 | Bacteria | 2266 |
| 394 | Ga0207676_10142511 | 3300026095 | Bacteria | 2054 |
| 395 | Ga0207674_10123151 | 3300026116 | Bacteria | 2559 |
| 396 | Ga0207674_10164449 | 3300026116 | Bacteria | 2173 |
| 397 | Ga0207675_100001210 | 3300026118 | Bacteria | 25719 |
| 398 | Ga0207675_100277085 | 3300026118 | Bacteria | 1629 |
| 399 | Ga0207683_10000829 | 3300026121 | Bacteria | 28292 |
| 400 | Ga0207698_10006356 | 3300026142 | Bacteria | 7362 |
| 401 | Ga0207698_10148048 | 3300026142 | Bacteria | 2033 |
| 402 | Ga0268266_10004771 | 3300028379 | Bacteria | 12890 |
| 403 | Ga0268266_10009241 | 3300028379 | Bacteria | 8695 |
| 404 | Ga0268266_10010048 | 3300028379 | Bacteria | 8298 |
| 405 | Ga0268266_10064183 | 3300028379 | Bacteria | 3172 |
| 406 | Ga0268265_10000010 | 3300028380 | Bacteria | 370129 |
| 407 | Ga0268265_10010559 | 3300028380 | Bacteria | 6236 |
| 408 | Ga0268265_10284382 | 3300028380 | Bacteria | 1481 |
| 409 | Ga0268264_10000007 | 3300028381 | Bacteria | 815790 |
| 410 | Ga0268264_10030433 | 3300028381 | Bacteria | 4424 |
| 411 | Ga0307515_10033617 | 3300028794 | Bacteria | 8431 |
| 412 | Ga0265338_10028604 | 3300028800 | Bacteria | 5553 |
| 413 | Ga0265762_1018837 | 3300030760 | Bacteria | 1261 |
| 414 | Ga0265327_10000071 | 3300031251 | Bacteria | 215502 |
| 415 | Ga0265327_10001438 | 3300031251 | Bacteria | 30041 |
| 416 | Ga0265327_10026106 | 3300031251 | Bacteria | 3390 |
| 417 | Ga0307405_10093827 | 3300031731 | Bacteria | 1995 |
| 418 | Ga0307410_10003168 | 3300031852 | Bacteria | 8188 |
| 419 | Ga0307410_10064569 | 3300031852 | Bacteria | 2516 |
| 420 | Ga0307406_10014618 | 3300031901 | Bacteria | 4519 |
| 421 | Ga0307409_100105986 | 3300031995 | Bacteria | 2345 |
| 422 | Ga0307416_100030526 | 3300032002 | Bacteria | 4045 |
| 423 | Ga0307411_10203895 | 3300032005 | Bacteria | 1521 |
| 424 | Ga0316053_101122 | 3300032120 | Bacteria | 1366 |
| 425 | Ga0307510_10036189 | 3300033180 | Bacteria | 5497 |
| 426 | Ga0373926_0003619 | 3300035083 | Bacteria | 5016 |
| 427 | Ga0373944_0004838 | 3300035089 | Bacteria | 3526 |
| 428 | Ga0373923_0087016 | 3300035111 | Bacteria | 1362 |
| 429 | Ga0373936_0021481 | 3300035113 | Bacteria | 2510 |
| 430 | Ga0373945_0009190 | 3300035116 | Bacteria | 3234 |
| 431 | Ga0373943_0003085 | 3300035170 | Bacteria | 7565 |
| 432 | Ga0373946_0000053 | 3300035171 | Bacteria | 30553 |
| 433 | Ga0373955_0203515 | 3300035172 | Bacteria | 1179 |
| 434 | Ga0373962_0013580 | 3300035242 | Bacteria | 2066 |
| 435 | Ga0373962_0047212 | 3300035242 | Bacteria | 1231 |
| 436 | Ga0373924_0012473 | 3300035410 | Bacteria | 3176 |
| 437 | Ga0373931_0033289 | 3300035691 | Bacteria | 2670 |
| 438 | Ga0373935_0230121 | 3300035692 | Bacteria | 1290 |
| 439 | Ga0373927_0010035 | 3300035695 | Bacteria | 6342 |
| 440 | Ga0373947_0004259 | 3300035725 | Bacteria | 8396 |
| 441 | Ga0373947_0180197 | 3300035725 | Bacteria | 1375 |
| 442 | Ga0373937_0071237 | 3300036401 | Bacteria | 3206 |
| 443 | Ga0316584_0087933 | 3300036712 | Bacteria | 2326 |
| 444 | Ga0373925_0011700 | 3300037068 | Bacteria | 6345 |
| 445 | Ga0395900_0013323 | 3300037418 | Bacteria | 8408 |
| 446 | Ga0395900_0132193 | 3300037418 | Bacteria | 2557 |
| 447 | Ga0395898_0180447 | 3300037466 | Bacteria | 2018 |
| 448 | Ga0395898_0201488 | 3300037466 | Bacteria | 1900 |
| 449 | Ga0395905_0035991 | 3300037471 | Bacteria | 4649 |
| 450 | Ga0436364_0196904 | 3300037853 | Bacteria | 6966 |
| 451 | Ga0436364_0865025 | 3300037853 | Bacteria | 3966 |
| 452 | Ga0436364_0935155 | 3300037853 | Bacteria | 14870 |
| 453 | Ga0436364_1280826 | 3300037853 | Bacteria | 93394 |
| 454 | Ga0395901_0008725 | 3300038443 | Bacteria | 10245 |
| 455 | Ga0395901_0603169 | 3300038443 | Bacteria | 1107 |
| 456 | Ga0436365_0351846 | 3300039437 | Bacteria | 2162 |
| 457 | Ga0436365_0544792 | 3300039437 | Bacteria | 2661 |
| 458 | Ga0436365_0659401 | 3300039437 | Bacteria | 13791 |
| 459 | Ga0436365_1273418 | 3300039437 | Bacteria | 2401 |
| 460 | Ga0436365_1892189 | 3300039437 | Bacteria | 2881 |
| 461 | Ga0436365_1921824 | 3300039437 | Bacteria | 7818 |
| 462 | Ga0436360_0211352 | 3300039438 | Bacteria | 867 |
| 463 | Ga0436362_0957350 | 3300039453 | Bacteria | 35880 |
| 464 | Ga0439461_0000802 | 3300041410 | Bacteria | 4622 |
| 465 | Ga0439465_0001407 | 3300041413 | Bacteria | 7777 |
| 466 | Ga0439465_0030469 | 3300041413 | Bacteria | 1716 |
| 467 | Ga0451797_0832390 | 3300041453 | Bacteria | 1587 |
| 468 | Ga0451795_1090199 | 3300041456 | Bacteria | 2566 |
| 469 | Ga0451807_1411141 | 3300041486 | Bacteria | 1625 |
| 470 | Ga0451853_2011291 | 3300041512 | Bacteria | 1745 |
| 471 | Ga0439431_0004643 | 3300041997 | Bacteria | 3019 |
| 472 | Ga0439445_0013920 | 3300042004 | Bacteria | 1953 |
| 473 | Ga0439445_0023198 | 3300042004 | Bacteria | 1569 |
| 474 | Ga0439448_0001366 | 3300042005 | Bacteria | 6272 |
| 475 | Ga0439434_0004809 | 3300042435 | Bacteria | 3953 |
| 476 | Ga0466969_0001933 | 3300044656 | Bacteria | 11068 |
| 477 | Ga0466969_0012565 | 3300044656 | Bacteria | 4462 |
| 478 | Ga0466969_0021405 | 3300044656 | Bacteria | 3344 |
| 479 | Ga0466972_0015724 | 3300044658 | Bacteria | 3783 |
| 480 | Ga0466972_0016495 | 3300044658 | Bacteria | 3693 |
| 481 | Ga0466972_0028126 | 3300044658 | Bacteria | 2776 |
| 482 | Ga0466972_0031616 | 3300044658 | Bacteria | 2602 |
| 483 | Ga0466972_0036399 | 3300044658 | Bacteria | 2408 |
| 484 | Ga0466972_0050899 | 3300044658 | Bacteria | 1999 |
| 485 | Ga0466972_0092498 | 3300044658 | Bacteria | 1434 |
| 486 | Ga0466965_0001599 | 3300044683 | Bacteria | 9244 |
| 487 | Ga0466965_0012158 | 3300044683 | Bacteria | 4044 |
| 488 | Ga0466965_0013330 | 3300044683 | Bacteria | 3878 |
| 489 | Ga0466965_0167925 | 3300044683 | Bacteria | 1153 |
| 490 | Ga0466966_0002540 | 3300044684 | Bacteria | 11954 |
| 491 | Ga0466966_0004759 | 3300044684 | Bacteria | 8936 |
| 492 | Ga0466966_0005803 | 3300044684 | Bacteria | 8140 |
| 493 | Ga0466966_0008557 | 3300044684 | Bacteria | 6774 |
| 494 | Ga0466966_0010077 | 3300044684 | Bacteria | 6267 |
| 495 | Ga0466966_0016972 | 3300044684 | Bacteria | 4811 |
| 496 | Ga0466966_0161773 | 3300044684 | Bacteria | 1363 |
| 497 | Ga0466961_0002569 | 3300044693 | Bacteria | 11249 |
| 498 | Ga0466961_0013055 | 3300044693 | Bacteria | 5314 |
| 499 | Ga0466961_0018419 | 3300044693 | Bacteria | 4491 |
| 500 | Ga0466961_0020131 | 3300044693 | Bacteria | 4295 |
| 501 | Ga0466961_0024042 | 3300044693 | Bacteria | 3920 |
| 502 | Ga0466961_0026668 | 3300044693 | Bacteria | 3714 |
| 503 | Ga0466961_0030983 | 3300044693 | Bacteria | 3438 |
| 504 | Ga0466961_0035710 | 3300044693 | Bacteria | 3191 |
| 505 | Ga0466961_0081681 | 3300044693 | Bacteria | 2045 |
| 506 | Ga0466961_0175209 | 3300044693 | Bacteria | 1333 |
| 507 | Ga0466961_0226963 | 3300044693 | Bacteria | 1150 |
| 508 | Ga0466961_0322912 | 3300044693 | Bacteria | 941 |
| 509 | Ga0466963_0004806 | 3300044694 | Bacteria | 7874 |
| 510 | Ga0466963_0012034 | 3300044694 | Bacteria | 5285 |
| 511 | Ga0466963_0017877 | 3300044694 | Bacteria | 4424 |
| 512 | Ga0466963_0040300 | 3300044694 | Bacteria | 3061 |
| 513 | Ga0466963_0052345 | 3300044694 | Bacteria | 2709 |
| 514 | Ga0466963_0067353 | 3300044694 | Bacteria | 2403 |
| 515 | Ga0466963_0190697 | 3300044694 | Bacteria | 1432 |
| 516 | Ga0466964_0036102 | 3300044706 | Bacteria | 1980 |
| 517 | Ga0466964_0041325 | 3300044706 | Bacteria | 1865 |
| 518 | Ga0466964_0070693 | 3300044706 | Bacteria | 1475 |
| 519 | Ga0466964_0099774 | 3300044706 | Bacteria | 1278 |
| 520 | Ga0466971_0002929 | 3300044719 | Bacteria | 7245 |
| 521 | Ga0466971_0022776 | 3300044719 | Bacteria | 2791 |
| 522 | Ga0466971_0030942 | 3300044719 | Bacteria | 2396 |
| 523 | Ga0466971_0031477 | 3300044719 | Bacteria | 2375 |
| 524 | Ga0466971_0056342 | 3300044719 | Bacteria | 1773 |
| 525 | Ga0466968_0000903 | 3300044735 | Bacteria | 10453 |
| 526 | Ga0466968_0003185 | 3300044735 | Bacteria | 6051 |
| 527 | Ga0466968_0019573 | 3300044735 | Bacteria | 2725 |
| 528 | Ga0466968_0098941 | 3300044735 | Bacteria | 1300 |
| 529 | Ga0466970_0004663 | 3300044765 | Bacteria | 6766 |
| 530 | Ga0466970_0005871 | 3300044765 | Bacteria | 6113 |
| 531 | Ga0466970_0056456 | 3300044765 | Bacteria | 2098 |
| 532 | Ga0466970_0093687 | 3300044765 | Bacteria | 1632 |
| 533 | Ga0466957_0001407 | 3300044842 | Bacteria | 12539 |
| 534 | Ga0466957_0010080 | 3300044842 | Bacteria | 5407 |
| 535 | Ga0466957_0031071 | 3300044842 | Bacteria | 3190 |
| 536 | Ga0466957_0059961 | 3300044842 | Bacteria | 2333 |
| 537 | Ga0466957_0224054 | 3300044842 | Bacteria | 1242 |
| 538 | Ga0466957_0280111 | 3300044842 | Bacteria | 1116 |
| 539 | Ga0466957_0398864 | 3300044842 | Bacteria | 940 |
| 540 | Ga0466960_0000406 | 3300044901 | Bacteria | 14770 |
| 541 | Ga0466960_0024183 | 3300044901 | Bacteria | 2738 |
| 542 | Ga0466960_0109314 | 3300044901 | Bacteria | 1434 |
| 543 | Ga0466960_0110377 | 3300044901 | Bacteria | 1428 |
| 544 | Ga0466960_0175950 | 3300044901 | Bacteria | 1157 |
| 545 | Ga0466960_0227074 | 3300044901 | Bacteria | 1029 |
| 546 | Ga0466959_0002496 | 3300045049 | Bacteria | 11779 |
| 547 | Ga0466959_0008449 | 3300045049 | Bacteria | 7281 |
| 548 | Ga0466959_0018047 | 3300045049 | Bacteria | 5177 |
| 549 | Ga0466959_0029100 | 3300045049 | Bacteria | 4093 |
| 550 | Ga0466959_0042249 | 3300045049 | Bacteria | 3362 |
| 551 | Ga0466959_0080707 | 3300045049 | Bacteria | 2344 |
| 552 | Ga0466959_0116470 | 3300045049 | Bacteria | 1903 |
| 553 | Ga0466959_0144046 | 3300045049 | Bacteria | 1682 |
| 554 | Ga0466958_0004306 | 3300045836 | Bacteria | 7497 |
| 555 | Ga0466958_0006150 | 3300045836 | Bacteria | 6509 |
| 556 | Ga0466958_0007246 | 3300045836 | Bacteria | 6084 |
| 557 | Ga0466958_0011621 | 3300045836 | Bacteria | 4962 |
| 558 | Ga0466958_0045296 | 3300045836 | Bacteria | 2652 |
| 559 | Ga0466958_0104738 | 3300045836 | Bacteria | 1762 |
| 560 | Ga0466958_0170694 | 3300045836 | Bacteria | 1377 |
| 561 | Ga0466967_0005450 | 3300045976 | Bacteria | 8822 |
| 562 | Ga0466967_0022567 | 3300045976 | Bacteria | 5139 |
| 563 | Ga0466967_0024674 | 3300045976 | Bacteria | 4947 |
| 564 | Ga0466967_0029889 | 3300045976 | Bacteria | 4566 |
| 565 | Ga0466967_0038457 | 3300045976 | Bacteria | 4104 |
| 566 | Ga0466967_0038987 | 3300045976 | Bacteria | 4080 |
| 567 | Ga0466967_0068438 | 3300045976 | Bacteria | 3170 |
| 568 | Ga0466967_0123648 | 3300045976 | Bacteria | 2394 |
| 569 | Ga0466967_0129735 | 3300045976 | Bacteria | 2339 |
| 570 | Ga0466967_0427921 | 3300045976 | Bacteria | 1291 |
| 571 | Ga0466967_0524830 | 3300045976 | Bacteria | 1164 |
| 572 | Ga0495629_0006511 | 3300046459 | Bacteria | 8654 |
| 573 | Ga0495629_0092021 | 3300046459 | Bacteria | 2117 |
| 574 | Ga0495638_0001150 | 3300046460 | Bacteria | 25489 |
| 575 | Ga0495638_0014705 | 3300046460 | Bacteria | 5279 |
| 576 | Ga0495641_0017740 | 3300046461 | Bacteria | 3697 |
| 577 | Ga0495651_0056525 | 3300046462 | Bacteria | 3014 |
| 578 | Ga0495651_0246885 | 3300046462 | Bacteria | 1221 |
| 579 | Ga0495653_0012397 | 3300046463 | Bacteria | 6960 |
| 580 | Ga0495662_0019069 | 3300046476 | Bacteria | 3319 |
| 581 | Ga0495664_0003023 | 3300046477 | Bacteria | 9104 |
| 582 | Ga0495618_0117307 | 3300046514 | Bacteria | 1704 |
| 583 | Ga0495630_0067420 | 3300046517 | Bacteria | 2690 |
| 584 | Ga0495648_0109144 | 3300046524 | Bacteria | 1509 |
| 585 | Ga0495652_0062008 | 3300046529 | Bacteria | 3154 |
| 586 | Ga0495665_0034722 | 3300046531 | Bacteria | 2697 |
| 587 | Ga0495640_0053963 | 3300046533 | Bacteria | 2755 |
| 588 | Ga0495667_0166393 | 3300046559 | Bacteria | 1417 |
| 589 | Ga0495625_0203837 | 3300046660 | Bacteria | 1304 |
| 590 | Ga0495635_0041152 | 3300046663 | Bacteria | 3192 |
| 591 | Ga0495657_0174821 | 3300046675 | Bacteria | 1321 |
| 592 | Ga0495599_0047405 | 3300046678 | Bacteria | 2693 |
| 593 | Ga0495646_0069644 | 3300046680 | Bacteria | 2075 |
| 594 | Ga0495624_0014151 | 3300046690 | Bacteria | 5422 |
| 595 | Ga0495624_0106835 | 3300046690 | Bacteria | 1722 |
| 596 | Ga0495600_0041629 | 3300046809 | Bacteria | 2994 |
| 597 | Ga0495581_0180806 | 3300047315 | Bacteria | 1233 |
| 598 | Ga0495674_0011031 | 3300047319 | Bacteria | 8532 |
| 599 | Ga0495672_0034340 | 3300047320 | Bacteria | 3135 |
| 600 | Ga0495672_0140392 | 3300047320 | Bacteria | 1262 |
| 601 | Ga0495672_0158864 | 3300047320 | Bacteria | 1164 |
| 602 | Ga0495676_0048986 | 3300047321 | Bacteria | 3401 |
| 603 | Ga0495673_0004361 | 3300047469 | Bacteria | 8882 |
| 604 | Ga0495673_0129766 | 3300047469 | Bacteria | 991 |
| 605 | Ga0495684_0001345 | 3300047471 | Bacteria | 19793 |
| 606 | Ga0495686_0002871 | 3300047472 | Bacteria | 15491 |
| 607 | Ga0495593_0016678 | 3300047673 | Bacteria | 4140 |
| 608 | Ga0495593_0110988 | 3300047673 | Bacteria | 1400 |
| 609 | Ga0495626_0064966 | 3300048091 | Bacteria | 1652 |
| 610 | Ga0496100_0000092 | 3300048903 | Bacteria | 50831 |
| 611 | Ga0496100_0008810 | 3300048903 | Bacteria | 5643 |
| 612 | Ga0496100_0011220 | 3300048903 | Bacteria | 5095 |
| 613 | Ga0496100_0063343 | 3300048903 | Bacteria | 2443 |
| 614 | Ga0496101_0000018 | 3300048904 | Bacteria | 236102 |
| 615 | Ga0496101_0000019 | 3300048904 | Bacteria | 220382 |
| 616 | Ga0496101_0000622 | 3300048904 | Bacteria | 21624 |
| 617 | Ga0496101_0007107 | 3300048904 | Bacteria | 7239 |
| 618 | Ga0496101_0037201 | 3300048904 | Bacteria | 3451 |
| 619 | Ga0496101_0075063 | 3300048904 | Bacteria | 2488 |
| 620 | Ga0496101_0087236 | 3300048904 | Bacteria | 2316 |
| 621 | Ga0496101_0134854 | 3300048904 | Bacteria | 1878 |
| 622 | Ga0496101_0157541 | 3300048904 | Bacteria | 1740 |
| 623 | Ga0496101_0229061 | 3300048904 | Bacteria | 1444 |
| 624 | Ga0496101_0393210 | 3300048904 | Bacteria | 1091 |
| 625 | Ga0496102_0000007 | 3300048905 | Bacteria | 417224 |
| 626 | Ga0496102_0000060 | 3300048905 | Bacteria | 167774 |
| 627 | Ga0496102_0000474 | 3300048905 | Bacteria | 44502 |
| 628 | Ga0496102_0011349 | 3300048905 | Bacteria | 7675 |
| 629 | Ga0496102_0022101 | 3300048905 | Bacteria | 5635 |
| 630 | Ga0496102_0040067 | 3300048905 | Bacteria | 4236 |
| 631 | Ga0496102_0073913 | 3300048905 | Bacteria | 3133 |
| 632 | Ga0496102_0129113 | 3300048905 | Bacteria | 2364 |
| 633 | Ga0496102_0231337 | 3300048905 | Bacteria | 1743 |
| 634 | Ga0496102_0246343 | 3300048905 | Bacteria | 1685 |
| 635 | Ga0496102_0534102 | 3300048905 | Bacteria | 1095 |
| 636 | Ga0496103_0000013 | 3300048906 | Bacteria | 297928 |
| 637 | Ga0496103_0000500 | 3300048906 | Bacteria | 32364 |
| 638 | Ga0496103_0000976 | 3300048906 | Bacteria | 20250 |
| 639 | Ga0496103_0002674 | 3300048906 | Bacteria | 11148 |
| 640 | Ga0496103_0009275 | 3300048906 | Bacteria | 5830 |
| 641 | Ga0496103_0072454 | 3300048906 | Bacteria | 2158 |
| 642 | Ga0496103_0136342 | 3300048906 | Bacteria | 1568 |
| 643 | Ga0496104_0009915 | 3300048907 | Bacteria | 8505 |
| 644 | Ga0496104_0013456 | 3300048907 | Bacteria | 7372 |
| 645 | Ga0496104_0016581 | 3300048907 | Bacteria | 6694 |
| 646 | Ga0496104_0026535 | 3300048907 | Bacteria | 5351 |
| 647 | Ga0496104_0078872 | 3300048907 | Bacteria | 3138 |
| 648 | Ga0496104_0178544 | 3300048907 | Bacteria | 2033 |
| 649 | Ga0496104_0204092 | 3300048907 | Bacteria | 1888 |
| 650 | Ga0496104_0429255 | 3300048907 | Bacteria | 1233 |
| 651 | Ga0496104_0531779 | 3300048907 | Bacteria | 1087 |
| 652 | Ga0496104_0634215 | 3300048907 | Bacteria | 978 |
| 653 | Ga0496104_0753334 | 3300048907 | Bacteria | 881 |
| 654 | Ga0496105_0012622 | 3300048908 | Bacteria | 6691 |
| 655 | Ga0496105_0039766 | 3300048908 | Bacteria | 3877 |
| 656 | Ga0496105_0049958 | 3300048908 | Bacteria | 3455 |
| 657 | Ga0496105_0063595 | 3300048908 | Bacteria | 3044 |
| 658 | Ga0496105_0083314 | 3300048908 | Bacteria | 2641 |
| 659 | Ga0496105_0291336 | 3300048908 | Bacteria | 1314 |
| 660 | Ga0496106_0002072 | 3300048909 | Bacteria | 15020 |
| 661 | Ga0496106_0004090 | 3300048909 | Bacteria | 10874 |
| 662 | Ga0496106_0008621 | 3300048909 | Bacteria | 7545 |
| 663 | Ga0496106_0022637 | 3300048909 | Bacteria | 4670 |
| 664 | Ga0496106_0338855 | 3300048909 | Bacteria | 1207 |
| 665 | Ga0496106_0465129 | 3300048909 | Bacteria | 1016 |
| 666 | Ga0496107_0000616 | 3300048910 | Bacteria | 19928 |
| 667 | Ga0496107_0001625 | 3300048910 | Bacteria | 14005 |
| 668 | Ga0496107_0011269 | 3300048910 | Bacteria | 6222 |
| 669 | Ga0496107_0013411 | 3300048910 | Bacteria | 5728 |
| 670 | Ga0496107_0123542 | 3300048910 | Bacteria | 1907 |
| 671 | Ga0496108_0007756 | 3300048911 | Bacteria | 8694 |
| 672 | Ga0496108_0037091 | 3300048911 | Bacteria | 4059 |
| 673 | Ga0496108_0042961 | 3300048911 | Bacteria | 3775 |
| 674 | Ga0496108_0051664 | 3300048911 | Bacteria | 3444 |
| 675 | Ga0496108_0108354 | 3300048911 | Bacteria | 2373 |
| 676 | Ga0496108_0348425 | 3300048911 | Bacteria | 1292 |
| 677 | Ga0496108_0388407 | 3300048911 | Bacteria | 1219 |
| 678 | Ga0496109_0001095 | 3300048912 | Bacteria | 22432 |
| 679 | Ga0496109_0002261 | 3300048912 | Bacteria | 16004 |
| 680 | Ga0496109_0030624 | 3300048912 | Bacteria | 4823 |
| 681 | Ga0496109_0089867 | 3300048912 | Bacteria | 2840 |
| 682 | Ga0496109_0113276 | 3300048912 | Bacteria | 2523 |
| 683 | Ga0496109_0174685 | 3300048912 | Bacteria | 2016 |
| 684 | Ga0496109_0284980 | 3300048912 | Bacteria | 1557 |
| 685 | Ga0496109_0416274 | 3300048912 | Bacteria | 1270 |
| 686 | Ga0496110_0006864 | 3300048913 | Bacteria | 9049 |
| 687 | Ga0496110_0090896 | 3300048913 | Bacteria | 2730 |
| 688 | Ga0496110_0103698 | 3300048913 | Bacteria | 2551 |
| 689 | Ga0496110_0179896 | 3300048913 | Bacteria | 1920 |
| 690 | Ga0496110_0310557 | 3300048913 | Bacteria | 1436 |
| 691 | Ga0496110_0390614 | 3300048913 | Bacteria | 1268 |
| 692 | Ga0496111_0020815 | 3300048914 | Bacteria | 4573 |
| 693 | Ga0496111_0098484 | 3300048914 | Bacteria | 2147 |
| 694 | Ga0496111_0183760 | 3300048914 | Bacteria | 1554 |
| 695 | Ga0496112_0013714 | 3300048915 | Bacteria | 7492 |
| 696 | Ga0496112_0014578 | 3300048915 | Bacteria | 7302 |
| 697 | Ga0496112_0014985 | 3300048915 | Bacteria | 7216 |
| 698 | Ga0496112_0089920 | 3300048915 | Bacteria | 3039 |
| 699 | Ga0496112_0211828 | 3300048915 | Bacteria | 1895 |
| 700 | Ga0496112_0238183 | 3300048915 | Bacteria | 1773 |
| 701 | Ga0496112_0311132 | 3300048915 | Bacteria | 1520 |
| 702 | Ga0496112_0755497 | 3300048915 | Bacteria | 898 |
| 703 | Ga0496113_0010272 | 3300048916 | Bacteria | 6185 |
| 704 | Ga0496113_0143688 | 3300048916 | Bacteria | 1879 |
| 705 | Ga0496113_0247628 | 3300048916 | Bacteria | 1422 |
| 706 | Ga0496113_0406662 | 3300048916 | Bacteria | 1093 |
| 707 | Ga0496113_0534310 | 3300048916 | Bacteria | 941 |
| 708 | Ga0496113_0539744 | 3300048916 | Bacteria | 936 |
| 709 | Ga0496113_0634238 | 3300048916 | Bacteria | 855 |
| 710 | Ga0496114_0000914 | 3300048917 | Bacteria | 22111 |
| 711 | Ga0496114_0002275 | 3300048917 | Bacteria | 14629 |
| 712 | Ga0496114_0003938 | 3300048917 | Bacteria | 11449 |
| 713 | Ga0496114_0013695 | 3300048917 | Bacteria | 6502 |
| 714 | Ga0496114_0018819 | 3300048917 | Bacteria | 5590 |
| 715 | Ga0496114_0131197 | 3300048917 | Bacteria | 2164 |
| 716 | Ga0496114_0164436 | 3300048917 | Bacteria | 1931 |
| 717 | Ga0496114_0367586 | 3300048917 | Bacteria | 1273 |
| 718 | Ga0496114_0397670 | 3300048917 | Bacteria | 1220 |
| 719 | Ga0496115_0001526 | 3300048918 | Bacteria | 16636 |
| 720 | Ga0496115_0004170 | 3300048918 | Bacteria | 10437 |
| 721 | Ga0496115_0070134 | 3300048918 | Bacteria | 2841 |
| 722 | Ga0496115_0242321 | 3300048918 | Bacteria | 1486 |
| 723 | Ga0496116_0000033 | 3300048919 | Bacteria | 418191 |
| 724 | Ga0496116_0011976 | 3300048919 | Bacteria | 7124 |
| 725 | Ga0496116_0041798 | 3300048919 | Bacteria | 3141 |
| 726 | Ga0496117_0000025 | 3300048920 | Bacteria | 418106 |
| 727 | Ga0496117_0002026 | 3300048920 | Bacteria | 26844 |
| 728 | Ga0496117_0015208 | 3300048920 | Bacteria | 6580 |
| 729 | Ga0496118_0000023 | 3300048921 | Bacteria | 418106 |
| 730 | Ga0496118_0001179 | 3300048921 | Bacteria | 40343 |
| 731 | Ga0496118_0001792 | 3300048921 | Bacteria | 31016 |
| 732 | Ga0496118_0007091 | 3300048921 | Bacteria | 12029 |
| 733 | Ga0496118_0012867 | 3300048921 | Bacteria | 7975 |
| 734 | Ga0496118_0144793 | 3300048921 | Bacteria | 1498 |
| 735 | Ga0496119_0000403 | 3300048922 | Bacteria | 59313 |
| 736 | Ga0496119_0001193 | 3300048922 | Bacteria | 32523 |
| 737 | Ga0496119_0008097 | 3300048922 | Bacteria | 9316 |
| 738 | Ga0496119_0013630 | 3300048922 | Bacteria | 6452 |
| 739 | Ga0496119_0015822 | 3300048922 | Bacteria | 5778 |
| 740 | Ga0496120_0000798 | 3300048923 | Bacteria | 45360 |
| 741 | Ga0496120_0004413 | 3300048923 | Bacteria | 11807 |
| 742 | Ga0496120_0009640 | 3300048923 | Bacteria | 6820 |
| 743 | Ga0496120_0033976 | 3300048923 | Bacteria | 3059 |
| 744 | Ga0496120_0067811 | 3300048923 | Bacteria | 1970 |
| 745 | Ga0496120_0124555 | 3300048923 | Bacteria | 1328 |
| 746 | Ga0496121_0000023 | 3300048924 | Bacteria | 463448 |
| 747 | Ga0496121_0000039 | 3300048924 | Bacteria | 351444 |
| 748 | Ga0496121_0023668 | 3300048924 | Bacteria | 5904 |
| 749 | Ga0496121_0067014 | 3300048924 | Bacteria | 2911 |
| 750 | Ga0496122_0000164 | 3300048925 | Bacteria | 158055 |
| 751 | Ga0496122_0029305 | 3300048925 | Bacteria | 4645 |
| 752 | Ga0496123_0010993 | 3300048926 | Bacteria | 7910 |
| 753 | Ga0496124_0000014 | 3300048927 | Bacteria | 463448 |
| 754 | Ga0496125_0000020 | 3300048928 | Bacteria | 463448 |
| 755 | Ga0496125_0030353 | 3300048928 | Bacteria | 4837 |
| 756 | Ga0496125_0031601 | 3300048928 | Bacteria | 4715 |
| 757 | Ga0496126_0000023 | 3300048929 | Bacteria | 463448 |
| 758 | Ga0496126_0000405 | 3300048929 | Bacteria | 87676 |
| 759 | Ga0496126_0002407 | 3300048929 | Bacteria | 25404 |
| 760 | Ga0496126_0007878 | 3300048929 | Bacteria | 11601 |
| 761 | Ga0496126_0008248 | 3300048929 | Bacteria | 11251 |
| 762 | Ga0496126_0016663 | 3300048929 | Bacteria | 7343 |
| 763 | Ga0496126_0357052 | 3300048929 | Bacteria | 1194 |
| 764 | Ga0501031_0063699 | 3300049568 | Bacteria | 2401 |
| 765 | Ga0501032_0001368 | 3300049569 | Bacteria | 19347 |
| 766 | Ga0501032_0005359 | 3300049569 | Bacteria | 9544 |
| 767 | Ga0501032_0008865 | 3300049569 | Bacteria | 7313 |
| 768 | Ga0501032_0042454 | 3300049569 | Bacteria | 3084 |
| 769 | Ga0501032_0063533 | 3300049569 | Bacteria | 2472 |
| 770 | Ga0501033_0000974 | 3300049570 | Bacteria | 25983 |
| 771 | Ga0501034_0003976 | 3300049571 | Bacteria | 16614 |
| 772 | Ga0501034_0004481 | 3300049571 | Bacteria | 15524 |
| 773 | Ga0501034_0075669 | 3300049571 | Bacteria | 3373 |
| 774 | Ga0501034_0124760 | 3300049571 | Bacteria | 2560 |
| 775 | Ga0501036_0003363 | 3300049572 | Bacteria | 12779 |
| 776 | Ga0501036_0013974 | 3300049572 | Bacteria | 6675 |
| 777 | Ga0501036_0028655 | 3300049572 | Bacteria | 4706 |
| 778 | Ga0501036_0139970 | 3300049572 | Bacteria | 2042 |
| 779 | Ga0501036_0420429 | 3300049572 | Bacteria | 1114 |
| 780 | Ga0501036_0443444 | 3300049572 | Bacteria | 1082 |
| 781 | Ga0501037_0000490 | 3300049573 | Bacteria | 32020 |
| 782 | Ga0501037_0003686 | 3300049573 | Bacteria | 11117 |
| 783 | Ga0501037_0004291 | 3300049573 | Bacteria | 10343 |
| 784 | Ga0501037_0016194 | 3300049573 | Bacteria | 5486 |
| 785 | Ga0501038_0001165 | 3300049574 | Bacteria | 23870 |
| 786 | Ga0501038_0001252 | 3300049574 | Bacteria | 23042 |
| 787 | Ga0501038_0003596 | 3300049574 | Bacteria | 14425 |
| 788 | Ga0501039_0000463 | 3300049575 | Bacteria | 29494 |
| 789 | Ga0501039_0367480 | 3300049575 | Bacteria | 1130 |
| 790 | Ga0501042_0089527 | 3300049578 | Bacteria | 2208 |
| 791 | Ga0501043_0000729 | 3300049579 | Bacteria | 29184 |
| 792 | Ga0501043_0006491 | 3300049579 | Bacteria | 9390 |
| 793 | Ga0501043_0187159 | 3300049579 | Bacteria | 1611 |
| 794 | Ga0501043_0194675 | 3300049579 | Bacteria | 1575 |
| 795 | Ga0501046_0001843 | 3300049580 | Bacteria | 20194 |
| 796 | Ga0501046_0016932 | 3300049580 | Bacteria | 6097 |
| 797 | Ga0501046_0025807 | 3300049580 | Bacteria | 4804 |
| 798 | Ga0501046_0038720 | 3300049580 | Bacteria | 3824 |
| 799 | Ga0501046_0049390 | 3300049580 | Bacteria | 3327 |
| 800 | Ga0501047_0000015 | 3300049581 | Bacteria | 307932 |
| 801 | Ga0501047_0003673 | 3300049581 | Bacteria | 14463 |
| 802 | Ga0501047_0007286 | 3300049581 | Bacteria | 10399 |
| 803 | Ga0501047_0012498 | 3300049581 | Bacteria | 8042 |
| 804 | Ga0501047_0040856 | 3300049581 | Bacteria | 4484 |
| 805 | Ga0501047_0236674 | 3300049581 | Bacteria | 1678 |
| 806 | Ga0501048_0000047 | 3300049582 | Bacteria | 59594 |
| 807 | Ga0501048_0001968 | 3300049582 | Bacteria | 15623 |
| 808 | Ga0501048_0005999 | 3300049582 | Bacteria | 9252 |
| 809 | Ga0501069_0078274 | 3300049585 | Bacteria | 1859 |
| 810 | Ga0501069_0123393 | 3300049585 | Bacteria | 1480 |
| 811 | Ga0501070_0003864 | 3300049586 | Bacteria | 12919 |
| 812 | Ga0501070_0027988 | 3300049586 | Bacteria | 4727 |
| 813 | Ga0501070_0063022 | 3300049586 | Bacteria | 3071 |
| 814 | Ga0501070_0095382 | 3300049586 | Bacteria | 2461 |
| 815 | Ga0501070_0405736 | 3300049586 | Bacteria | 1102 |
| 816 | Ga0501073_0085517 | 3300049589 | Bacteria | 2194 |
| 817 | Ga0501074_0403281 | 3300049590 | Bacteria | 970 |
| 818 | Ga0501080_0024341 | 3300049742 | Bacteria | 5614 |
| 819 | Ga0501080_0171591 | 3300049742 | Bacteria | 2000 |
| 820 | Ga0501081_0072348 | 3300049743 | Bacteria | 2404 |
| 821 | Ga0501035_0000417 | 3300049822 | Bacteria | 48134 |
| 822 | Ga0501035_0000419 | 3300049822 | Bacteria | 47893 |
| 823 | Ga0501035_0020795 | 3300049822 | Bacteria | 6030 |
| 824 | Ga0501044_0001166 | 3300049823 | Bacteria | 31147 |
| 825 | Ga0501044_0006425 | 3300049823 | Bacteria | 12987 |
| 826 | Ga0501044_0034997 | 3300049823 | Bacteria | 5261 |
| 827 | Ga0501044_0049016 | 3300049823 | Bacteria | 4360 |
| 828 | Ga0501044_0078177 | 3300049823 | Bacteria | 3353 |
| 829 | Ga0501044_0079321 | 3300049823 | Bacteria | 3326 |
| 830 | Ga0501044_0084013 | 3300049823 | Bacteria | 3218 |
| 831 | Ga0501044_0102047 | 3300049823 | Bacteria | 2885 |
| 832 | Ga0501045_0240928 | 3300049824 | Bacteria | 1346 |
| 833 | nmdc:mga03683_8444_c1 | 3300050489 | Bacteria | 3622 |
| 834 | nmdc:mga03n38_11416_c1 | 3300050490 | Bacteria | 3309 |
| 835 | nmdc:mga03n38_125105_c1 | 3300050490 | Bacteria | 1268 |
| 836 | nmdc:mga03n38_19236_c1 | 3300050490 | Bacteria | 2710 |
| 837 | nmdc:mga03n38_44005_c1 | 3300050490 | Bacteria | 1959 |
| 838 | nmdc:mga03n38_6482_c1 | 3300050490 | Bacteria | 4070 |
| 839 | nmdc:mga00v17_10237_c3 | 3300050491 | Bacteria | 2988 |
| 840 | nmdc:mga00v17_1756_c1 | 3300050491 | Bacteria | 11255 |
| 841 | nmdc:mga00v17_48471_c1 | 3300050491 | Bacteria | 2575 |
| 842 | nmdc:mga00v17_5341_c1 | 3300050491 | Bacteria | 6765 |
| 843 | nmdc:mga00v17_5641_c1 | 3300050491 | Bacteria | 6601 |
| 844 | nmdc:mga0yw44_106282_c1 | 3300050492 | Bacteria | 1794 |
| 845 | nmdc:mga0yw44_188315_c1 | 3300050492 | Bacteria | 1360 |
| 846 | nmdc:mga0yw44_34565_c1 | 3300050492 | Bacteria | 2963 |
| 847 | nmdc:mga0yw44_50295_c1 | 3300050492 | Bacteria | 2519 |
| 848 | nmdc:mga0yw44_54505_c1 | 3300050492 | Bacteria | 2430 |
| 849 | nmdc:mga0yw44_77538_c1 | 3300050492 | Bacteria | 2076 |
| 850 | nmdc:mga0yw44_8431_c1 | 3300050492 | Bacteria | 5135 |
| 851 | nmdc:mga06z11_17517_c1 | 3300050494 | Bacteria | 3253 |
| 852 | nmdc:mga07m45_142308_c1 | 3300050496 | Bacteria | 1389 |
| 853 | nmdc:mga07m45_29225_c1 | 3300050496 | Bacteria | 3046 |
| 854 | nmdc:mga07m45_35585_c1 | 3300050496 | Bacteria | 2770 |
| 855 | nmdc:mga07m45_46133_c1 | 3300050496 | Bacteria | 2447 |
| 856 | nmdc:mga05p37_143120_c1 | 3300050507 | Bacteria | 2929 |
| 857 | nmdc:mga0qj67_13681_c1 | 3300050509 | Bacteria | 6124 |
| 858 | nmdc:mga06r32_246128_c1 | 3300050510 | Bacteria | 1775 |
| 859 | nmdc:mga06r32_249_c2 | 3300050510 | Bacteria | 5552 |
| 860 | nmdc:mga08y16_737197_c1 | 3300050511 | Bacteria | 982 |
| 861 | nmdc:mga0sz30_10206_c1 | 3300050516 | Bacteria | 3594 |
| 862 | nmdc:mga0sz30_190306_c1 | 3300050516 | Bacteria | 911 |
| 863 | nmdc:mga0sz30_842_c2 | 3300050516 | Bacteria | 10759 |
| 864 | Ga0495601_0171665 | 3300053077 | Bacteria | 1417 |
| 865 | Ga0495601_0400952 | 3300053077 | Bacteria | 889 |
| 866 | Ga0495612_0123642 | 3300053078 | Bacteria | 1114 |
| 867 | Ga0495655_0020857 | 3300053083 | Bacteria | 1475 |
| 868 | Ga0495619_0026105 | 3300053085 | Bacteria | 3757 |
| 869 | Ga0495619_0174699 | 3300053085 | Bacteria | 1486 |
| 870 | Ga0500643_002122 | 3300053087 | Bacteria | 10513 |
| 871 | Ga0500556_0004430 | 3300053104 | Bacteria | 4000 |
| 872 | Ga0500562_006369 | 3300053108 | Bacteria | 2977 |
| 873 | Ga0500573_0060938 | 3300053140 | Bacteria | 2161 |
| 874 | Ga0500627_0002578 | 3300053158 | Bacteria | 5411 |
| 875 | Ga0500645_000054 | 3300053730 | Bacteria | 93914 |
| 876 | Ga0501084_0242332 | 3300054114 | Bacteria | 1522 |
| 877 | Ga0587070_014254 | 3300059491 | Bacteria | 1240 |
| 878 | Ga0501082_0350044 | 3300060353 | Bacteria | 1288 |
| 879 | Ga0466962_0000795 | 3300061719 | Bacteria | 14218 |
| 880 | Ga0466962_0003314 | 3300061719 | Bacteria | 7651 |
| 881 | Ga0466962_0006031 | 3300061719 | Bacteria | 5827 |
| 882 | Ga0466962_0041679 | 3300061719 | Bacteria | 2196 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044694 | Ga0466963_0190697 | Ga0466963_0190697_775_1416 | 211 |
| 2 | 3300025904 | Ga0207647_10086873 | Ga0207647_100868733 | 234 |
| 3 | 3300037418 | Ga0395900_0013323 | Ga0395900_0013323_6383_7222 | 236 |
| 4 | 3300048907 | Ga0496104_0531779 | Ga0496104_0531779_228_974 | 237 |
| 5 | 3300048917 | Ga0496114_0367586 | Ga0496114_0367586_117_926 | 247 |
| 6 | 3300044658 | Ga0466972_0050899 | Ga0466972_0050899_559_1392 | 248 |
| 7 | 3300045976 | Ga0466967_0038987 | Ga0466967_0038987_1779_2612 | 248 |
| 8 | 3300044684 | Ga0466966_0005803 | Ga0466966_0005803_5736_6563 | 249 |
| 9 | 3300044693 | Ga0466961_0035710 | Ga0466961_0035710_514_1341 | 249 |
| 10 | 3300045049 | Ga0466959_0029100 | Ga0466959_0029100_1331_2158 | 249 |
| 11 | 3300005435 | Ga0070714_100002560 | Ga0070714_1000025606 | 250 |
| 12 | 3300048916 | Ga0496113_0634238 | Ga0496113_0634238_51_839 | 251 |
| 13 | 3300050492 | nmdc:mga0yw44_188315_c1 | nmdc:mga0yw44_188315_c1_291_1049 | 251 |
| 14 | 3300044684 | Ga0466966_0002540 | Ga0466966_0002540_1631_2461 | 252 |
| 15 | 3300044693 | Ga0466961_0020131 | Ga0466961_0020131_535_1365 | 252 |
| 16 | 3300044693 | Ga0466961_0226963 | Ga0466961_0226963_219_1049 | 252 |
| 17 | 3300044765 | Ga0466970_0093687 | Ga0466970_0093687_677_1507 | 252 |
| 18 | 3300045049 | Ga0466959_0116470 | Ga0466959_0116470_846_1676 | 252 |
| 19 | 3300045976 | Ga0466967_0427921 | Ga0466967_0427921_123_890 | 253 |
| 20 | 3300049569 | Ga0501032_0001368 | Ga0501032_0001368_16410_17237 | 253 |
| 21 | 3300049571 | Ga0501034_0003976 | Ga0501034_0003976_8340_9167 | 253 |
| 22 | 3300049572 | Ga0501036_0013974 | Ga0501036_0013974_1616_2443 | 253 |
| 23 | 3300049573 | Ga0501037_0000490 | Ga0501037_0000490_29514_30341 | 253 |
| 24 | 3300049574 | Ga0501038_0003596 | Ga0501038_0003596_8213_9040 | 253 |
| 25 | 3300049575 | Ga0501039_0000463 | Ga0501039_0000463_17518_18345 | 253 |
| 26 | 3300049579 | Ga0501043_0000729 | Ga0501043_0000729_27013_27840 | 253 |
| 27 | 3300049586 | Ga0501070_0003864 | Ga0501070_0003864_9379_10206 | 253 |
| 28 | 3300049589 | Ga0501073_0085517 | Ga0501073_0085517_340_1167 | 253 |
| 29 | 3300049823 | Ga0501044_0049016 | Ga0501044_0049016_569_1396 | 253 |
| 30 | 3300005435 | Ga0070714_100069562 | Ga0070714_1000695622 | 254 |
| 31 | 3300006048 | Ga0075363_100002096 | Ga0075363_1000020965 | 254 |
| 32 | 3300006051 | Ga0075364_10132179 | Ga0075364_101321792 | 254 |
| 33 | 3300006177 | Ga0075362_10010187 | Ga0075362_100101872 | 254 |
| 34 | 3300006353 | Ga0075370_10014522 | Ga0075370_100145223 | 254 |
| 35 | 3300009101 | Ga0105247_10003264 | Ga0105247_1000326414 | 254 |
| 36 | 3300044656 | Ga0466969_0001933 | Ga0466969_0001933_9712_10512 | 254 |
| 37 | 3300044684 | Ga0466966_0010077 | Ga0466966_0010077_1859_2659 | 254 |
| 38 | 3300044693 | Ga0466961_0018419 | Ga0466961_0018419_2305_3105 | 254 |
| 39 | 3300044719 | Ga0466971_0030942 | Ga0466971_0030942_819_1619 | 254 |
| 40 | 3300045049 | Ga0466959_0002496 | Ga0466959_0002496_4799_5599 | 254 |
| 41 | 3300048904 | Ga0496101_0157541 | Ga0496101_0157541_751_1545 | 254 |
| 42 | 3300048905 | Ga0496102_0000474 | Ga0496102_0000474_12255_13049 | 254 |
| 43 | 3300048906 | Ga0496103_0000976 | Ga0496103_0000976_12036_12830 | 254 |
| 44 | 3300048921 | Ga0496118_0007091 | Ga0496118_0007091_6227_7021 | 254 |
| 45 | 3300048922 | Ga0496119_0008097 | Ga0496119_0008097_3098_3892 | 254 |
| 46 | 3300048924 | Ga0496121_0067014 | Ga0496121_0067014_668_1462 | 254 |
| 47 | 3300049580 | Ga0501046_0038720 | Ga0501046_0038720_3006_3809 | 254 |
| 48 | 3300049823 | Ga0501044_0078177 | Ga0501044_0078177_210_1166 | 254 |
| 49 | 3300050492 | nmdc:mga0yw44_50295_c1 | nmdc:mga0yw44_50295_c1_1334_2134 | 254 |
| 50 | 3300061719 | Ga0466962_0000795 | Ga0466962_0000795_11009_11809 | 254 |
| 51 | 3300005329 | Ga0070683_100152867 | Ga0070683_1001528672 | 255 |
| 52 | 3300005337 | Ga0070682_100125579 | Ga0070682_1001255792 | 255 |
| 53 | 3300005456 | Ga0070678_100339739 | Ga0070678_1003397392 | 255 |
| 54 | 3300005530 | Ga0070679_100328067 | Ga0070679_1003280671 | 255 |
| 55 | 3300005539 | Ga0068853_100243795 | Ga0068853_1002437952 | 255 |
| 56 | 3300005578 | Ga0068854_100320542 | Ga0068854_1003205421 | 255 |
| 57 | 3300025932 | Ga0207690_10183572 | Ga0207690_101835722 | 255 |
| 58 | 3300025981 | Ga0207640_10472180 | Ga0207640_104721802 | 255 |
| 59 | 3300026067 | Ga0207678_10005592 | Ga0207678_100055923 | 255 |
| 60 | 3300048912 | Ga0496109_0089867 | Ga0496109_0089867_2034_2819 | 255 |
| 61 | 3300049570 | Ga0501033_0000974 | Ga0501033_0000974_18493_19296 | 255 |
| 62 | 3300049579 | Ga0501043_0187159 | Ga0501043_0187159_671_1474 | 255 |
| 63 | 3300049580 | Ga0501046_0016932 | Ga0501046_0016932_300_1103 | 255 |
| 64 | 3300053077 | Ga0495601_0400952 | Ga0495601_0400952_35_820 | 255 |
| 65 | 3300037418 | Ga0395900_0132193 | Ga0395900_0132193_1205_2038 | 256 |
| 66 | 3300037466 | Ga0395898_0201488 | Ga0395898_0201488_114_947 | 256 |
| 67 | 3300045976 | Ga0466967_0129735 | Ga0466967_0129735_178_981 | 256 |
| 68 | 3300050496 | nmdc:mga07m45_29225_c1 | nmdc:mga07m45_29225_c1_1719_2528 | 256 |
| 69 | iso_pu_bacteria | 2946024296 | 2946025763 | 256 |
| 70 | 3300005563 | Ga0068855_100086047 | Ga0068855_1000860473 | 257 |
| 71 | 3300006173 | Ga0070716_100004348 | Ga0070716_1000043487 | 257 |
| 72 | 3300009101 | Ga0105247_10001445 | Ga0105247_1000144515 | 257 |
| 73 | 3300009176 | Ga0105242_10019364 | Ga0105242_100193649 | 257 |
| 74 | 3300009545 | Ga0105237_10176345 | Ga0105237_101763452 | 257 |
| 75 | 3300013296 | Ga0157374_10077044 | Ga0157374_100770444 | 257 |
| 76 | 3300014968 | Ga0157379_10088164 | Ga0157379_100881644 | 257 |
| 77 | 3300025911 | Ga0207654_10037937 | Ga0207654_100379373 | 257 |
| 78 | 3300025914 | Ga0207671_10131627 | Ga0207671_101316272 | 257 |
| 79 | 3300025916 | Ga0207663_10008634 | Ga0207663_100086346 | 257 |
| 80 | 3300025935 | Ga0207709_10006901 | Ga0207709_100069015 | 257 |
| 81 | 3300025986 | Ga0207658_10019255 | Ga0207658_100192552 | 257 |
| 82 | 3300028381 | Ga0268264_10030433 | Ga0268264_100304333 | 257 |
| 83 | 3300035242 | Ga0373962_0047212 | Ga0373962_0047212_212_985 | 257 |
| 84 | 3300035691 | Ga0373931_0033289 | Ga0373931_0033289_1828_2601 | 257 |
| 85 | 3300038443 | Ga0395901_0008725 | Ga0395901_0008725_7733_8542 | 257 |
| 86 | 3300048903 | Ga0496100_0011220 | Ga0496100_0011220_130_903 | 257 |
| 87 | 3300048904 | Ga0496101_0007107 | Ga0496101_0007107_4265_5038 | 257 |
| 88 | 3300048906 | Ga0496103_0002674 | Ga0496103_0002674_7698_8471 | 257 |
| 89 | 3300048909 | Ga0496106_0008621 | Ga0496106_0008621_3921_4694 | 257 |
| 90 | 3300048910 | Ga0496107_0000616 | Ga0496107_0000616_4288_5061 | 257 |
| 91 | 3300048917 | Ga0496114_0018819 | Ga0496114_0018819_219_992 | 257 |
| 92 | 3300048918 | Ga0496115_0004170 | Ga0496115_0004170_4091_4864 | 257 |
| 93 | 3300006048 | Ga0075363_100025102 | Ga0075363_1000251024 | 258 |
| 94 | 3300006051 | Ga0075364_10003636 | Ga0075364_100036363 | 258 |
| 95 | 3300006186 | Ga0075369_10010120 | Ga0075369_100101203 | 258 |
| 96 | 3300037471 | Ga0395905_0035991 | Ga0395905_0035991_1813_2634 | 258 |
| 97 | 3300039437 | Ga0436365_0351846 | Ga0436365_0351846_375_1178 | 258 |
| 98 | 3300039453 | Ga0436362_0957350 | Ga0436362_0957350_24343_25146 | 258 |
| 99 | iso_pu_bacteria | 2739367898 | 2740168935 | 259 |
| 100 | 3300003322 | rootL2_10062985 | rootL2_100629852 | 260 |
| 101 | 3300005614 | Ga0068856_100130685 | Ga0068856_1001306854 | 260 |
| 102 | 3300005616 | Ga0068852_100008929 | Ga0068852_1000089298 | 260 |
| 103 | 3300005616 | Ga0068852_100164332 | Ga0068852_1001643321 | 260 |
| 104 | 3300005617 | Ga0068859_100002361 | Ga0068859_10000236125 | 260 |
| 105 | 3300006028 | Ga0070717_10148509 | Ga0070717_101485092 | 260 |
| 106 | 3300006931 | Ga0097620_100002361 | Ga0097620_1000023614 | 260 |
| 107 | 3300013297 | Ga0157378_10829066 | Ga0157378_108290662 | 260 |
| 108 | 3300020075 | Ga0206349_1164363 | Ga0206349_11643631 | 260 |
| 109 | 3300025900 | Ga0207710_10001933 | Ga0207710_100019333 | 260 |
| 110 | 3300025907 | Ga0207645_10030401 | Ga0207645_100304013 | 260 |
| 111 | 3300025927 | Ga0207687_10137715 | Ga0207687_101377152 | 260 |
| 112 | 3300026078 | Ga0207702_10274305 | Ga0207702_102743051 | 260 |
| 113 | 3300026142 | Ga0207698_10006356 | Ga0207698_100063562 | 260 |
| 114 | 3300026142 | Ga0207698_10148048 | Ga0207698_101480482 | 260 |
| 115 | 3300037853 | Ga0436364_1280826 | Ga0436364_1280826_45576_46496 | 260 |
| 116 | 3300041413 | Ga0439465_0030469 | Ga0439465_0030469_513_1304 | 260 |
| 117 | 3300042004 | Ga0439445_0013920 | Ga0439445_0013920_714_1505 | 260 |
| 118 | 3300042005 | Ga0439448_0001366 | Ga0439448_0001366_2811_3593 | 260 |
| 119 | 3300044693 | Ga0466961_0024042 | Ga0466961_0024042_2825_3640 | 260 |
| 120 | 3300044706 | Ga0466964_0036102 | Ga0466964_0036102_552_1367 | 260 |
| 121 | 3300044719 | Ga0466971_0031477 | Ga0466971_0031477_1057_1872 | 260 |
| 122 | 3300044842 | Ga0466957_0031071 | Ga0466957_0031071_728_1543 | 260 |
| 123 | 3300045836 | Ga0466958_0004306 | Ga0466958_0004306_4352_5167 | 260 |
| 124 | 3300048912 | Ga0496109_0416274 | Ga0496109_0416274_148_1035 | 260 |
| 125 | 3300050490 | nmdc:mga03n38_125105_c1 | nmdc:mga03n38_125105_c1_206_988 | 260 |
| 126 | 3300050492 | nmdc:mga0yw44_54505_c1 | nmdc:mga0yw44_54505_c1_1377_2159 | 260 |
| 127 | 3300061719 | Ga0466962_0003314 | Ga0466962_0003314_4447_5262 | 260 |
| 128 | 3300005564 | Ga0070664_100073369 | Ga0070664_1000733693 | 261 |
| 129 | 3300009551 | Ga0105238_10295694 | Ga0105238_102956941 | 261 |
| 130 | 3300044694 | Ga0466963_0012034 | Ga0466963_0012034_2232_3020 | 261 |
| 131 | 3300044706 | Ga0466964_0041325 | Ga0466964_0041325_67_855 | 261 |
| 132 | 3300044901 | Ga0466960_0175950 | Ga0466960_0175950_275_1063 | 261 |
| 133 | 3300045049 | Ga0466959_0080707 | Ga0466959_0080707_1383_2174 | 261 |
| 134 | iso_pu_bacteria | 2643221711 | 2644609794 | 261 |
| 135 | iso_pu_bacteria | 2811994882 | 2812374953 | 261 |
| 136 | iso_pu_bacteria | 2818991318 | 2819427700 | 261 |
| 137 | iso_pu_bacteria | 2818991458 | 2819666551 | 261 |
| 138 | iso_pu_bacteria | 2818991462 | 2819691710 | 261 |
| 139 | iso_pu_bacteria | 2818991469 | 2819729518 | 261 |
| 140 | 3300005614 | Ga0068856_100636810 | Ga0068856_1006368101 | 262 |
| 141 | 3300009148 | Ga0105243_10456623 | Ga0105243_104566232 | 262 |
| 142 | 3300025915 | Ga0207693_10020056 | Ga0207693_100200565 | 262 |
| 143 | 3300025929 | Ga0207664_10091950 | Ga0207664_100919503 | 262 |
| 144 | 3300026116 | Ga0207674_10164449 | Ga0207674_101644492 | 262 |
| 145 | 3300039438 | Ga0436360_0211352 | Ga0436360_0211352_34_831 | 262 |
| 146 | 3300044694 | Ga0466963_0017877 | Ga0466963_0017877_3076_4005 | 262 |
| 147 | 3300045976 | Ga0466967_0022567 | Ga0466967_0022567_737_1648 | 262 |
| 148 | 3300045976 | Ga0466967_0024674 | Ga0466967_0024674_1654_2445 | 262 |
| 149 | 3300049571 | Ga0501034_0004481 | Ga0501034_0004481_2367_3158 | 262 |
| 150 | 3300049572 | Ga0501036_0028655 | Ga0501036_0028655_932_1723 | 262 |
| 151 | 3300049573 | Ga0501037_0004291 | Ga0501037_0004291_7248_8039 | 262 |
| 152 | 3300049580 | Ga0501046_0001843 | Ga0501046_0001843_16864_17655 | 262 |
| 153 | 3300049581 | Ga0501047_0007286 | Ga0501047_0007286_4434_5225 | 262 |
| 154 | 3300049582 | Ga0501048_0005999 | Ga0501048_0005999_2486_3277 | 262 |
| 155 | 3300049585 | Ga0501069_0078274 | Ga0501069_0078274_209_1000 | 262 |
| 156 | 3300049586 | Ga0501070_0027988 | Ga0501070_0027988_2327_3118 | 262 |
| 157 | 3300049742 | Ga0501080_0024341 | Ga0501080_0024341_2529_3320 | 262 |
| 158 | 3300049822 | Ga0501035_0000419 | Ga0501035_0000419_4625_5416 | 262 |
| 159 | 3300049823 | Ga0501044_0034997 | Ga0501044_0034997_2274_3065 | 262 |
| 160 | iso_pu_bacteria | 2861520306 | 2861523890 | 262 |
| 161 | 3300005329 | Ga0070683_100037531 | Ga0070683_1000375313 | 263 |
| 162 | 3300005458 | Ga0070681_10099073 | Ga0070681_100990732 | 263 |
| 163 | 3300005563 | Ga0068855_100448108 | Ga0068855_1004481082 | 263 |
| 164 | 3300005563 | Ga0068855_100763640 | Ga0068855_1007636402 | 263 |
| 165 | 3300005614 | Ga0068856_100251973 | Ga0068856_1002519732 | 263 |
| 166 | 3300010159 | Ga0099796_10059832 | Ga0099796_100598322 | 263 |
| 167 | 3300013105 | Ga0157369_10027215 | Ga0157369_100272158 | 263 |
| 168 | 3300020069 | Ga0197907_10461530 | Ga0197907_104615303 | 263 |
| 169 | 3300020069 | Ga0197907_10466403 | Ga0197907_104664034 | 263 |
| 170 | 3300020070 | Ga0206356_10444711 | Ga0206356_104447112 | 263 |
| 171 | 3300020080 | Ga0206350_10078532 | Ga0206350_100785321 | 263 |
| 172 | 3300020081 | Ga0206354_10468886 | Ga0206354_104688862 | 263 |
| 173 | 3300020082 | Ga0206353_10462189 | Ga0206353_104621897 | 263 |
| 174 | 3300025909 | Ga0207705_10239754 | Ga0207705_102397542 | 263 |
| 175 | 3300025912 | Ga0207707_10091566 | Ga0207707_100915664 | 263 |
| 176 | 3300025915 | Ga0207693_10286712 | Ga0207693_102867122 | 263 |
| 177 | 3300025944 | Ga0207661_10082312 | Ga0207661_100823124 | 263 |
| 178 | 3300025949 | Ga0207667_10087359 | Ga0207667_100873595 | 263 |
| 179 | 3300025949 | Ga0207667_10422068 | Ga0207667_104220681 | 263 |
| 180 | 3300026067 | Ga0207678_10126879 | Ga0207678_101268791 | 263 |
| 181 | 3300026078 | Ga0207702_10533737 | Ga0207702_105337372 | 263 |
| 182 | 3300026089 | Ga0207648_10199794 | Ga0207648_101997942 | 263 |
| 183 | 3300044656 | Ga0466969_0021405 | Ga0466969_0021405_668_1492 | 263 |
| 184 | 3300044693 | Ga0466961_0322912 | Ga0466961_0322912_92_916 | 263 |
| 185 | 3300045836 | Ga0466958_0170694 | Ga0466958_0170694_62_886 | 263 |
| 186 | 3300048903 | Ga0496100_0063343 | Ga0496100_0063343_657_1490 | 263 |
| 187 | 3300048904 | Ga0496101_0075063 | Ga0496101_0075063_775_1608 | 263 |
| 188 | 3300048904 | Ga0496101_0393210 | Ga0496101_0393210_237_1070 | 263 |
| 189 | 3300048905 | Ga0496102_0040067 | Ga0496102_0040067_745_1578 | 263 |
| 190 | 3300048905 | Ga0496102_0246343 | Ga0496102_0246343_722_1555 | 263 |
| 191 | 3300048907 | Ga0496104_0009915 | Ga0496104_0009915_519_1352 | 263 |
| 192 | 3300048907 | Ga0496104_0078872 | Ga0496104_0078872_1784_2617 | 263 |
| 193 | 3300048907 | Ga0496104_0178544 | Ga0496104_0178544_677_1510 | 263 |
| 194 | 3300048908 | Ga0496105_0039766 | Ga0496105_0039766_748_1581 | 263 |
| 195 | 3300048908 | Ga0496105_0049958 | Ga0496105_0049958_1777_2610 | 263 |
| 196 | 3300048908 | Ga0496105_0083314 | Ga0496105_0083314_984_1817 | 263 |
| 197 | 3300048908 | Ga0496105_0291336 | Ga0496105_0291336_240_1073 | 263 |
| 198 | 3300048911 | Ga0496108_0348425 | Ga0496108_0348425_151_984 | 263 |
| 199 | 3300048912 | Ga0496109_0030624 | Ga0496109_0030624_3497_4330 | 263 |
| 200 | 3300048913 | Ga0496110_0103698 | Ga0496110_0103698_892_1725 | 263 |
| 201 | 3300048913 | Ga0496110_0390614 | Ga0496110_0390614_367_1200 | 263 |
| 202 | 3300048914 | Ga0496111_0098484 | Ga0496111_0098484_1219_2052 | 263 |
| 203 | 3300048914 | Ga0496111_0183760 | Ga0496111_0183760_33_866 | 263 |
| 204 | 3300048915 | Ga0496112_0211828 | Ga0496112_0211828_401_1234 | 263 |
| 205 | 3300048916 | Ga0496113_0247628 | Ga0496113_0247628_120_953 | 263 |
| 206 | 3300048916 | Ga0496113_0539744 | Ga0496113_0539744_72_905 | 263 |
| 207 | 3300048917 | Ga0496114_0003938 | Ga0496114_0003938_582_1415 | 263 |
| 208 | 3300048917 | Ga0496114_0013695 | Ga0496114_0013695_4554_5387 | 263 |
| 209 | 3300048921 | Ga0496118_0144793 | Ga0496118_0144793_45_905 | 263 |
| 210 | 3300049569 | Ga0501032_0005359 | Ga0501032_0005359_5721_6551 | 263 |
| 211 | 3300049572 | Ga0501036_0139970 | Ga0501036_0139970_217_1047 | 263 |
| 212 | 3300049574 | Ga0501038_0001252 | Ga0501038_0001252_20929_21759 | 263 |
| 213 | 3300049579 | Ga0501043_0194675 | Ga0501043_0194675_10_840 | 263 |
| 214 | 3300049581 | Ga0501047_0003673 | Ga0501047_0003673_2732_3562 | 263 |
| 215 | 3300049582 | Ga0501048_0000047 | Ga0501048_0000047_2041_2871 | 263 |
| 216 | 3300049586 | Ga0501070_0063022 | Ga0501070_0063022_500_1330 | 263 |
| 217 | 3300049823 | Ga0501044_0006425 | Ga0501044_0006425_14_844 | 263 |
| 218 | 3300050510 | nmdc:mga06r32_246128_c1 | nmdc:mga06r32_246128_c1_26_859 | 263 |
| 219 | 3300060353 | Ga0501082_0350044 | Ga0501082_0350044_433_1263 | 263 |
| 220 | iso_pu_bacteria | 2932431166 | 2932431731 | 263 |
| 221 | 3300005434 | Ga0070709_10259509 | Ga0070709_102595091 | 264 |
| 222 | 3300005435 | Ga0070714_100183991 | Ga0070714_1001839912 | 264 |
| 223 | 3300005437 | Ga0070710_10058120 | Ga0070710_100581202 | 264 |
| 224 | 3300005439 | Ga0070711_100179428 | Ga0070711_1001794282 | 264 |
| 225 | 3300005614 | Ga0068856_100070832 | Ga0068856_1000708322 | 264 |
| 226 | 3300005614 | Ga0068856_100160997 | Ga0068856_1001609974 | 264 |
| 227 | 3300006175 | Ga0070712_100191344 | Ga0070712_1001913442 | 264 |
| 228 | 3300007076 | Ga0075435_100558358 | Ga0075435_1005583581 | 264 |
| 229 | 3300009093 | Ga0105240_10206316 | Ga0105240_102063162 | 264 |
| 230 | 3300009098 | Ga0105245_10054329 | Ga0105245_100543295 | 264 |
| 231 | 3300009545 | Ga0105237_10095068 | Ga0105237_100950684 | 264 |
| 232 | 3300025898 | Ga0207692_10112640 | Ga0207692_101126401 | 264 |
| 233 | 3300025906 | Ga0207699_10012267 | Ga0207699_100122671 | 264 |
| 234 | 3300025906 | Ga0207699_10076787 | Ga0207699_100767871 | 264 |
| 235 | 3300025913 | Ga0207695_10137555 | Ga0207695_101375552 | 264 |
| 236 | 3300025916 | Ga0207663_10094500 | Ga0207663_100945002 | 264 |
| 237 | 3300025939 | Ga0207665_10058523 | Ga0207665_100585234 | 264 |
| 238 | 3300026075 | Ga0207708_10165363 | Ga0207708_101653632 | 264 |
| 239 | 3300026078 | Ga0207702_10099159 | Ga0207702_100991592 | 264 |
| 240 | 3300035083 | Ga0373926_0003619 | Ga0373926_0003619_43_891 | 264 |
| 241 | 3300035089 | Ga0373944_0004838 | Ga0373944_0004838_1118_1966 | 264 |
| 242 | 3300035111 | Ga0373923_0087016 | Ga0373923_0087016_450_1298 | 264 |
| 243 | 3300035113 | Ga0373936_0021481 | Ga0373936_0021481_1524_2372 | 264 |
| 244 | 3300035116 | Ga0373945_0009190 | Ga0373945_0009190_2180_3028 | 264 |
| 245 | 3300035170 | Ga0373943_0003085 | Ga0373943_0003085_6556_7404 | 264 |
| 246 | 3300035171 | Ga0373946_0000053 | Ga0373946_0000053_11237_12085 | 264 |
| 247 | 3300035172 | Ga0373955_0203515 | Ga0373955_0203515_57_905 | 264 |
| 248 | 3300035410 | Ga0373924_0012473 | Ga0373924_0012473_782_1630 | 264 |
| 249 | 3300035692 | Ga0373935_0230121 | Ga0373935_0230121_169_1017 | 264 |
| 250 | 3300035695 | Ga0373927_0010035 | Ga0373927_0010035_4017_4865 | 264 |
| 251 | 3300035725 | Ga0373947_0004259 | Ga0373947_0004259_1493_2341 | 264 |
| 252 | 3300036401 | Ga0373937_0071237 | Ga0373937_0071237_396_1244 | 264 |
| 253 | 3300037068 | Ga0373925_0011700 | Ga0373925_0011700_347_1195 | 264 |
| 254 | 3300044658 | Ga0466972_0031616 | Ga0466972_0031616_1324_2151 | 264 |
| 255 | 3300044658 | Ga0466972_0036399 | Ga0466972_0036399_706_1533 | 264 |
| 256 | 3300044684 | Ga0466966_0161773 | Ga0466966_0161773_88_915 | 264 |
| 257 | 3300044693 | Ga0466961_0081681 | Ga0466961_0081681_335_1162 | 264 |
| 258 | 3300044694 | Ga0466963_0004806 | Ga0466963_0004806_3805_4632 | 264 |
| 259 | 3300044694 | Ga0466963_0067353 | Ga0466963_0067353_43_891 | 264 |
| 260 | 3300044735 | Ga0466968_0019573 | Ga0466968_0019573_1198_2025 | 264 |
| 261 | 3300044842 | Ga0466957_0010080 | Ga0466957_0010080_1835_2662 | 264 |
| 262 | 3300044901 | Ga0466960_0024183 | Ga0466960_0024183_1271_2098 | 264 |
| 263 | 3300044901 | Ga0466960_0227074 | Ga0466960_0227074_142_969 | 264 |
| 264 | 3300045836 | Ga0466958_0045296 | Ga0466958_0045296_778_1605 | 264 |
| 265 | 3300045836 | Ga0466958_0104738 | Ga0466958_0104738_26_853 | 264 |
| 266 | 3300045976 | Ga0466967_0029889 | Ga0466967_0029889_3573_4406 | 264 |
| 267 | 3300046461 | Ga0495641_0017740 | Ga0495641_0017740_212_1060 | 264 |
| 268 | 3300046462 | Ga0495651_0056525 | Ga0495651_0056525_771_1619 | 264 |
| 269 | 3300046463 | Ga0495653_0012397 | Ga0495653_0012397_2231_3079 | 264 |
| 270 | 3300046476 | Ga0495662_0019069 | Ga0495662_0019069_913_1761 | 264 |
| 271 | 3300046477 | Ga0495664_0003023 | Ga0495664_0003023_6907_7755 | 264 |
| 272 | 3300046514 | Ga0495618_0117307 | Ga0495618_0117307_783_1631 | 264 |
| 273 | 3300046517 | Ga0495630_0067420 | Ga0495630_0067420_382_1230 | 264 |
| 274 | 3300046524 | Ga0495648_0109144 | Ga0495648_0109144_351_1157 | 264 |
| 275 | 3300046529 | Ga0495652_0062008 | Ga0495652_0062008_807_1655 | 264 |
| 276 | 3300046531 | Ga0495665_0034722 | Ga0495665_0034722_1455_2303 | 264 |
| 277 | 3300046559 | Ga0495667_0166393 | Ga0495667_0166393_353_1201 | 264 |
| 278 | 3300046663 | Ga0495635_0041152 | Ga0495635_0041152_1530_2378 | 264 |
| 279 | 3300046678 | Ga0495599_0047405 | Ga0495599_0047405_1518_2366 | 264 |
| 280 | 3300046680 | Ga0495646_0069644 | Ga0495646_0069644_553_1401 | 264 |
| 281 | 3300046690 | Ga0495624_0014151 | Ga0495624_0014151_3152_4000 | 264 |
| 282 | 3300046809 | Ga0495600_0041629 | Ga0495600_0041629_645_1493 | 264 |
| 283 | 3300047319 | Ga0495674_0011031 | Ga0495674_0011031_646_1494 | 264 |
| 284 | 3300047320 | Ga0495672_0140392 | Ga0495672_0140392_47_853 | 264 |
| 285 | 3300047320 | Ga0495672_0158864 | Ga0495672_0158864_312_1118 | 264 |
| 286 | 3300047321 | Ga0495676_0048986 | Ga0495676_0048986_1699_2547 | 264 |
| 287 | 3300047469 | Ga0495673_0004361 | Ga0495673_0004361_7348_8154 | 264 |
| 288 | 3300047469 | Ga0495673_0129766 | Ga0495673_0129766_157_963 | 264 |
| 289 | 3300047471 | Ga0495684_0001345 | Ga0495684_0001345_1498_2346 | 264 |
| 290 | 3300047673 | Ga0495593_0110988 | Ga0495593_0110988_466_1314 | 264 |
| 291 | 3300048916 | Ga0496113_0534310 | Ga0496113_0534310_41_889 | 264 |
| 292 | 3300048918 | Ga0496115_0242321 | Ga0496115_0242321_413_1261 | 264 |
| 293 | 3300048928 | Ga0496125_0031601 | Ga0496125_0031601_2853_3686 | 264 |
| 294 | 3300049568 | Ga0501031_0063699 | Ga0501031_0063699_1401_2234 | 264 |
| 295 | 3300049569 | Ga0501032_0042454 | Ga0501032_0042454_165_998 | 264 |
| 296 | 3300049571 | Ga0501034_0075669 | Ga0501034_0075669_2106_2939 | 264 |
| 297 | 3300049572 | Ga0501036_0420429 | Ga0501036_0420429_111_944 | 264 |
| 298 | 3300049572 | Ga0501036_0443444 | Ga0501036_0443444_226_1053 | 264 |
| 299 | 3300049573 | Ga0501037_0003686 | Ga0501037_0003686_7189_8022 | 264 |
| 300 | 3300049578 | Ga0501042_0089527 | Ga0501042_0089527_866_1699 | 264 |
| 301 | 3300049579 | Ga0501043_0006491 | Ga0501043_0006491_5559_6392 | 264 |
| 302 | 3300049580 | Ga0501046_0049390 | Ga0501046_0049390_2431_3264 | 264 |
| 303 | 3300049581 | Ga0501047_0236674 | Ga0501047_0236674_840_1667 | 264 |
| 304 | 3300049582 | Ga0501048_0001968 | Ga0501048_0001968_11625_12458 | 264 |
| 305 | 3300049586 | Ga0501070_0095382 | Ga0501070_0095382_361_1194 | 264 |
| 306 | 3300049586 | Ga0501070_0405736 | Ga0501070_0405736_190_1017 | 264 |
| 307 | 3300049742 | Ga0501080_0171591 | Ga0501080_0171591_185_1018 | 264 |
| 308 | 3300049823 | Ga0501044_0079321 | Ga0501044_0079321_383_1216 | 264 |
| 309 | 3300049823 | Ga0501044_0084013 | Ga0501044_0084013_2330_3157 | 264 |
| 310 | 3300050490 | nmdc:mga03n38_11416_c1 | nmdc:mga03n38_11416_c1_2465_3298 | 264 |
| 311 | 3300050491 | nmdc:mga00v17_48471_c1 | nmdc:mga00v17_48471_c1_680_1513 | 264 |
| 312 | 3300053087 | Ga0500643_002122 | Ga0500643_002122_6165_6971 | 264 |
| 313 | 3300054114 | Ga0501084_0242332 | Ga0501084_0242332_330_1163 | 264 |
| 314 | 3300059491 | Ga0587070_014254 | Ga0587070_014254_361_1209 | 264 |
| 315 | 3300061719 | Ga0466962_0006031 | Ga0466962_0006031_494_1321 | 264 |
| 316 | iso_pu_bacteria | 2643221690 | 2644504166 | 264 |
| 317 | iso_pu_bacteria | 2643221694 | 2644526757 | 264 |
| 318 | iso_pu_bacteria | 2643221722 | 2644670503 | 264 |
| 319 | iso_pu_bacteria | 2867346516 | 2867350712 | 264 |
| 320 | 3300005436 | Ga0070713_100475504 | Ga0070713_1004755041 | 265 |
| 321 | 3300005548 | Ga0070665_100225747 | Ga0070665_1002257473 | 265 |
| 322 | 3300005937 | Ga0081455_10005680 | Ga0081455_100056803 | 265 |
| 323 | 3300020077 | Ga0206351_10225639 | Ga0206351_102256392 | 265 |
| 324 | 3300025273 | Ga0209673_1056658 | Ga0209673_10566582 | 265 |
| 325 | 3300025303 | Ga0209051_1000075 | Ga0209051_1000075174 | 265 |
| 326 | 3300044693 | Ga0466961_0013055 | Ga0466961_0013055_340_1173 | 265 |
| 327 | 3300044693 | Ga0466961_0175209 | Ga0466961_0175209_371_1210 | 265 |
| 328 | 3300044694 | Ga0466963_0040300 | Ga0466963_0040300_637_1476 | 265 |
| 329 | 3300044842 | Ga0466957_0001407 | Ga0466957_0001407_4736_5575 | 265 |
| 330 | 3300048907 | Ga0496104_0429255 | Ga0496104_0429255_187_1023 | 265 |
| 331 | 3300048913 | Ga0496110_0310557 | Ga0496110_0310557_55_891 | 265 |
| 332 | 3300048917 | Ga0496114_0131197 | Ga0496114_0131197_1123_1959 | 265 |
| 333 | 3300049569 | Ga0501032_0008865 | Ga0501032_0008865_4470_5315 | 265 |
| 334 | 3300049581 | Ga0501047_0000015 | Ga0501047_0000015_74345_75211 | 265 |
| 335 | 3300049743 | Ga0501081_0072348 | Ga0501081_0072348_1402_2238 | 265 |
| 336 | 3300005577 | Ga0068857_100216013 | Ga0068857_1002160131 | 266 |
| 337 | 3300009093 | Ga0105240_10707493 | Ga0105240_107074932 | 266 |
| 338 | 3300020077 | Ga0206351_10437193 | Ga0206351_104371931 | 266 |
| 339 | 3300026116 | Ga0207674_10123151 | Ga0207674_101231513 | 266 |
| 340 | 3300028794 | Ga0307515_10033617 | Ga0307515_100336175 | 266 |
| 341 | 3300031251 | Ga0265327_10001438 | Ga0265327_1000143825 | 266 |
| 342 | 3300031995 | Ga0307409_100105986 | Ga0307409_1001059861 | 266 |
| 343 | 3300032120 | Ga0316053_101122 | Ga0316053_1011222 | 266 |
| 344 | 3300037466 | Ga0395898_0180447 | Ga0395898_0180447_400_1293 | 266 |
| 345 | 3300041486 | Ga0451807_1411141 | Ga0451807_1411141_679_1527 | 266 |
| 346 | 3300044658 | Ga0466972_0016495 | Ga0466972_0016495_2841_3641 | 266 |
| 347 | 3300044658 | Ga0466972_0092498 | Ga0466972_0092498_122_961 | 266 |
| 348 | 3300044684 | Ga0466966_0016972 | Ga0466966_0016972_1263_2063 | 266 |
| 349 | 3300044693 | Ga0466961_0026668 | Ga0466961_0026668_1438_2238 | 266 |
| 350 | 3300044719 | Ga0466971_0002929 | Ga0466971_0002929_6300_7100 | 266 |
| 351 | 3300044719 | Ga0466971_0056342 | Ga0466971_0056342_829_1668 | 266 |
| 352 | 3300044765 | Ga0466970_0004663 | Ga0466970_0004663_2290_3129 | 266 |
| 353 | 3300044765 | Ga0466970_0056456 | Ga0466970_0056456_756_1595 | 266 |
| 354 | 3300044842 | Ga0466957_0398864 | Ga0466957_0398864_44_883 | 266 |
| 355 | 3300044901 | Ga0466960_0109314 | Ga0466960_0109314_211_1050 | 266 |
| 356 | 3300045049 | Ga0466959_0008449 | Ga0466959_0008449_6463_7263 | 266 |
| 357 | 3300045836 | Ga0466958_0007246 | Ga0466958_0007246_5266_6066 | 266 |
| 358 | 3300046459 | Ga0495629_0092021 | Ga0495629_0092021_112_957 | 266 |
| 359 | 3300048907 | Ga0496104_0753334 | Ga0496104_0753334_37_870 | 266 |
| 360 | 3300048916 | Ga0496113_0143688 | Ga0496113_0143688_603_1496 | 266 |
| 361 | 3300048922 | Ga0496119_0001193 | Ga0496119_0001193_5263_6096 | 266 |
| 362 | 3300048923 | Ga0496120_0009640 | Ga0496120_0009640_2886_3719 | 266 |
| 363 | 3300002075 | JGI24738J21930_10013856 | JGI24738J21930_100138562 | 267 |
| 364 | 3300006038 | Ga0075365_10015269 | Ga0075365_100152692 | 267 |
| 365 | 3300013105 | Ga0157369_10151735 | Ga0157369_101517353 | 267 |
| 366 | 3300041453 | Ga0451797_0832390 | Ga0451797_0832390_416_1258 | 267 |
| 367 | 3300044842 | Ga0466957_0280111 | Ga0466957_0280111_254_1102 | 267 |
| 368 | 3300048907 | Ga0496104_0204092 | Ga0496104_0204092_118_960 | 267 |
| 369 | 3300050492 | nmdc:mga0yw44_106282_c1 | nmdc:mga0yw44_106282_c1_241_1083 | 267 |
| 370 | 3300050510 | nmdc:mga06r32_249_c2 | nmdc:mga06r32_249_c2_232_1077 | 267 |
| 371 | 3300053140 | Ga0500573_0060938 | Ga0500573_0060938_1194_2036 | 267 |
| 372 | iso_pu_bacteria | 2643221687 | 2644488745 | 267 |
| 373 | iso_pu_bacteria | 2891326441 | 2891329414 | 267 |
| 374 | 3300005327 | Ga0070658_10047833 | Ga0070658_100478333 | 268 |
| 375 | 3300005329 | Ga0070683_100082793 | Ga0070683_1000827931 | 268 |
| 376 | 3300005337 | Ga0070682_100047587 | Ga0070682_1000475874 | 268 |
| 377 | 3300005339 | Ga0070660_100177347 | Ga0070660_1001773472 | 268 |
| 378 | 3300005345 | Ga0070692_10111031 | Ga0070692_101110311 | 268 |
| 379 | 3300005435 | Ga0070714_100001157 | Ga0070714_1000011576 | 268 |
| 380 | 3300005458 | Ga0070681_10036461 | Ga0070681_100364614 | 268 |
| 381 | 3300005530 | Ga0070679_100008082 | Ga0070679_1000080825 | 268 |
| 382 | 3300005535 | Ga0070684_100110136 | Ga0070684_1001101363 | 268 |
| 383 | 3300005578 | Ga0068854_100311278 | Ga0068854_1003112781 | 268 |
| 384 | 3300006028 | Ga0070717_10084392 | Ga0070717_100843923 | 268 |
| 385 | 3300013104 | Ga0157370_10047047 | Ga0157370_100470471 | 268 |
| 386 | 3300020069 | Ga0197907_10431376 | Ga0197907_104313762 | 268 |
| 387 | 3300020070 | Ga0206356_11020425 | Ga0206356_110204252 | 268 |
| 388 | 3300020082 | Ga0206353_11702945 | Ga0206353_117029454 | 268 |
| 389 | 3300022467 | Ga0224712_10084439 | Ga0224712_100844391 | 268 |
| 390 | 3300025909 | Ga0207705_10116186 | Ga0207705_101161863 | 268 |
| 391 | 3300025912 | Ga0207707_10019173 | Ga0207707_100191736 | 268 |
| 392 | 3300025919 | Ga0207657_10109507 | Ga0207657_101095072 | 268 |
| 393 | 3300025921 | Ga0207652_10021282 | Ga0207652_100212825 | 268 |
| 394 | 3300025929 | Ga0207664_10000615 | Ga0207664_1000061512 | 268 |
| 395 | 3300025944 | Ga0207661_10195571 | Ga0207661_101955711 | 268 |
| 396 | 3300026067 | Ga0207678_10107313 | Ga0207678_101073133 | 268 |
| 397 | 3300044658 | Ga0466972_0015724 | Ga0466972_0015724_140_997 | 268 |
| 398 | 3300044683 | Ga0466965_0001599 | Ga0466965_0001599_6104_6961 | 268 |
| 399 | 3300044706 | Ga0466964_0070693 | Ga0466964_0070693_551_1408 | 268 |
| 400 | 3300044735 | Ga0466968_0003185 | Ga0466968_0003185_916_1773 | 268 |
| 401 | 3300044901 | Ga0466960_0000406 | Ga0466960_0000406_3818_4675 | 268 |
| 402 | 3300045049 | Ga0466959_0018047 | Ga0466959_0018047_2223_3080 | 268 |
| 403 | 3300045976 | Ga0466967_0005450 | Ga0466967_0005450_957_1814 | 268 |
| 404 | 3300048907 | Ga0496104_0026535 | Ga0496104_0026535_2548_3513 | 268 |
| 405 | iso_pu_bacteria | 2842134933 | 2842137635 | 268 |
| 406 | iso_pu_bacteria | 2902837492 | 2902838627 | 268 |
| 407 | 3300009545 | Ga0105237_10092580 | Ga0105237_100925802 | 269 |
| 408 | 3300025914 | Ga0207671_10068019 | Ga0207671_100680193 | 269 |
| 409 | 3300039437 | Ga0436365_0544792 | Ga0436365_0544792_682_1494 | 269 |
| 410 | 3300046462 | Ga0495651_0246885 | Ga0495651_0246885_176_1033 | 269 |
| 411 | 3300053077 | Ga0495601_0171665 | Ga0495601_0171665_328_1185 | 269 |
| 412 | 3300053078 | Ga0495612_0123642 | Ga0495612_0123642_180_1037 | 269 |
| 413 | 3300053085 | Ga0495619_0026105 | Ga0495619_0026105_976_1833 | 269 |
| 414 | iso_pu_bacteria | 2899370129 | 2899370869 | 269 |
| 415 | iso_pu_bacteria | 2939582691 | 2939588273 | 269 |
| 416 | iso_pu_bacteria | 3001119090 | 3001119918 | 269 |
| 417 | 3300005435 | Ga0070714_100000002 | Ga0070714_100000002303 | 270 |
| 418 | 3300005539 | Ga0068853_100009617 | Ga0068853_1000096175 | 270 |
| 419 | 3300005614 | Ga0068856_100126969 | Ga0068856_1001269693 | 270 |
| 420 | 3300009147 | Ga0114129_10152595 | Ga0114129_101525953 | 270 |
| 421 | 3300013296 | Ga0157374_10515138 | Ga0157374_105151382 | 270 |
| 422 | 3300013308 | Ga0157375_10192559 | Ga0157375_101925593 | 270 |
| 423 | 3300025929 | Ga0207664_10000038 | Ga0207664_1000003898 | 270 |
| 424 | 3300025929 | Ga0207664_10012150 | Ga0207664_100121502 | 270 |
| 425 | 3300026041 | Ga0207639_10005060 | Ga0207639_100050605 | 270 |
| 426 | 3300026078 | Ga0207702_10074608 | Ga0207702_100746083 | 270 |
| 427 | 3300047472 | Ga0495686_0002871 | Ga0495686_0002871_14041_14859 | 270 |
| 428 | 3300048905 | Ga0496102_0231337 | Ga0496102_0231337_903_1715 | 270 |
| 429 | 3300048911 | Ga0496108_0108354 | Ga0496108_0108354_725_1537 | 270 |
| 430 | 3300048912 | Ga0496109_0113276 | Ga0496109_0113276_738_1550 | 270 |
| 431 | 3300050507 | nmdc:mga05p37_143120_c1 | nmdc:mga05p37_143120_c1_960_1772 | 270 |
| 432 | 3300050509 | nmdc:mga0qj67_13681_c1 | nmdc:mga0qj67_13681_c1_3910_4722 | 270 |
| 433 | iso_pu_bacteria | 2929212328 | 2929216179 | 270 |
| 434 | 3300003792 | Ga0055540_1008869 | Ga0055540_10088693 | 271 |
| 435 | 3300025303 | Ga0209051_1001162 | Ga0209051_100116225 | 271 |
| 436 | 3300025303 | Ga0209051_1002980 | Ga0209051_10029802 | 271 |
| 437 | 3300025303 | Ga0209051_1031448 | Ga0209051_10314483 | 271 |
| 438 | 3300030760 | Ga0265762_1018837 | Ga0265762_10188372 | 271 |
| 439 | 3300039437 | Ga0436365_1921824 | Ga0436365_1921824_6359_7183 | 271 |
| 440 | 3300041456 | Ga0451795_1090199 | Ga0451795_1090199_565_1383 | 271 |
| 441 | 3300049569 | Ga0501032_0063533 | Ga0501032_0063533_857_1711 | 271 |
| 442 | 3300049571 | Ga0501034_0124760 | Ga0501034_0124760_1287_2141 | 271 |
| 443 | 3300049572 | Ga0501036_0003363 | Ga0501036_0003363_10745_11599 | 271 |
| 444 | 3300049573 | Ga0501037_0016194 | Ga0501037_0016194_2665_3519 | 271 |
| 445 | 3300049574 | Ga0501038_0001165 | Ga0501038_0001165_1402_2256 | 271 |
| 446 | 3300049580 | Ga0501046_0025807 | Ga0501046_0025807_1141_1995 | 271 |
| 447 | 3300049581 | Ga0501047_0040856 | Ga0501047_0040856_3269_4123 | 271 |
| 448 | 3300049822 | Ga0501035_0020795 | Ga0501035_0020795_3612_4466 | 271 |
| 449 | 3300049823 | Ga0501044_0102047 | Ga0501044_0102047_965_1819 | 271 |
| 450 | 3300049824 | Ga0501045_0240928 | Ga0501045_0240928_309_1163 | 271 |
| 451 | 3300050489 | nmdc:mga03683_8444_c1 | nmdc:mga03683_8444_c1_1910_2725 | 271 |
| 452 | 3300050490 | nmdc:mga03n38_6482_c1 | nmdc:mga03n38_6482_c1_1332_2147 | 271 |
| 453 | 3300050491 | nmdc:mga00v17_5341_c1 | nmdc:mga00v17_5341_c1_1291_2106 | 271 |
| 454 | 3300050516 | nmdc:mga0sz30_10206_c1 | nmdc:mga0sz30_10206_c1_1746_2561 | 271 |
| 455 | 3300005338 | Ga0068868_100095915 | Ga0068868_1000959152 | 272 |
| 456 | 3300005455 | Ga0070663_100000482 | Ga0070663_1000004826 | 272 |
| 457 | 3300005937 | Ga0081455_10004103 | Ga0081455_100041033 | 272 |
| 458 | 3300021358 | Ga0213873_10000053 | Ga0213873_100000535 | 272 |
| 459 | 3300021388 | Ga0213875_10005854 | Ga0213875_100058547 | 272 |
| 460 | 3300033180 | Ga0307510_10036189 | Ga0307510_100361892 | 272 |
| 461 | 3300037853 | Ga0436364_0935155 | Ga0436364_0935155_4799_5725 | 272 |
| 462 | 3300038443 | Ga0395901_0603169 | Ga0395901_0603169_189_1052 | 272 |
| 463 | 3300048905 | Ga0496102_0000007 | Ga0496102_0000007_346741_347571 | 272 |
| 464 | 3300048906 | Ga0496103_0000013 | Ga0496103_0000013_227598_228428 | 272 |
| 465 | 3300048911 | Ga0496108_0388407 | Ga0496108_0388407_162_992 | 272 |
| 466 | 3300048921 | Ga0496118_0000023 | Ga0496118_0000023_346747_347577 | 272 |
| 467 | 3300003792 | Ga0055540_1001305 | Ga0055540_100130514 | 273 |
| 468 | 3300003792 | Ga0055540_1002845 | Ga0055540_10028452 | 273 |
| 469 | 3300005347 | Ga0070668_100458063 | Ga0070668_1004580631 | 273 |
| 470 | 3300005367 | Ga0070667_100000223 | Ga0070667_10000022321 | 273 |
| 471 | 3300005548 | Ga0070665_100005604 | Ga0070665_1000056049 | 273 |
| 472 | 3300005617 | Ga0068859_100000174 | Ga0068859_10000017412 | 273 |
| 473 | 3300005719 | Ga0068861_100092328 | Ga0068861_1000923283 | 273 |
| 474 | 3300005841 | Ga0068863_100001502 | Ga0068863_1000015024 | 273 |
| 475 | 3300005843 | Ga0068860_100000044 | Ga0068860_100000044129 | 273 |
| 476 | 3300005844 | Ga0068862_100000003 | Ga0068862_100000003102 | 273 |
| 477 | 3300006038 | Ga0075365_10033987 | Ga0075365_100339874 | 273 |
| 478 | 3300006931 | Ga0097620_100000174 | Ga0097620_10000017412 | 273 |
| 479 | 3300009101 | Ga0105247_10000006 | Ga0105247_10000006219 | 273 |
| 480 | 3300009177 | Ga0105248_10000042 | Ga0105248_10000042147 | 273 |
| 481 | 3300009553 | Ga0105249_10000008 | Ga0105249_10000008194 | 273 |
| 482 | 3300013306 | Ga0163162_10060455 | Ga0163162_100604553 | 273 |
| 483 | 3300014325 | Ga0163163_10026112 | Ga0163163_100261126 | 273 |
| 484 | 3300014968 | Ga0157379_10168598 | Ga0157379_101685982 | 273 |
| 485 | 3300025273 | Ga0209673_1008842 | Ga0209673_10088425 | 273 |
| 486 | 3300025303 | Ga0209051_1011514 | Ga0209051_10115142 | 273 |
| 487 | 3300025900 | Ga0207710_10000025 | Ga0207710_1000002569 | 273 |
| 488 | 3300025923 | Ga0207681_10003522 | Ga0207681_100035226 | 273 |
| 489 | 3300025941 | Ga0207711_10000697 | Ga0207711_1000069714 | 273 |
| 490 | 3300025961 | Ga0207712_10000011 | Ga0207712_10000011127 | 273 |
| 491 | 3300025986 | Ga0207658_10000307 | Ga0207658_1000030736 | 273 |
| 492 | 3300026035 | Ga0207703_10006939 | Ga0207703_100069395 | 273 |
| 493 | 3300026088 | Ga0207641_10005680 | Ga0207641_100056809 | 273 |
| 494 | 3300028379 | Ga0268266_10010048 | Ga0268266_100100486 | 273 |
| 495 | 3300028380 | Ga0268265_10000010 | Ga0268265_10000010103 | 273 |
| 496 | 3300028381 | Ga0268264_10000007 | Ga0268264_10000007637 | 273 |
| 497 | 3300031251 | Ga0265327_10026106 | Ga0265327_100261064 | 273 |
| 498 | 3300031852 | Ga0307410_10064569 | Ga0307410_100645692 | 273 |
| 499 | 3300044842 | Ga0466957_0224054 | Ga0466957_0224054_103_957 | 273 |
| 500 | 3300048903 | Ga0496100_0008810 | Ga0496100_0008810_3899_4729 | 273 |
| 501 | 3300048904 | Ga0496101_0037201 | Ga0496101_0037201_457_1287 | 273 |
| 502 | 3300048905 | Ga0496102_0000060 | Ga0496102_0000060_84355_85185 | 273 |
| 503 | 3300048906 | Ga0496103_0000500 | Ga0496103_0000500_22840_23670 | 273 |
| 504 | 3300048915 | Ga0496112_0755497 | Ga0496112_0755497_27_863 | 273 |
| 505 | 3300048919 | Ga0496116_0011976 | Ga0496116_0011976_5679_6509 | 273 |
| 506 | 3300048920 | Ga0496117_0002026 | Ga0496117_0002026_834_1664 | 273 |
| 507 | 3300048921 | Ga0496118_0001179 | Ga0496118_0001179_33836_34666 | 273 |
| 508 | 3300048922 | Ga0496119_0015822 | Ga0496119_0015822_2682_3512 | 273 |
| 509 | 3300048923 | Ga0496120_0004413 | Ga0496120_0004413_4117_4947 | 273 |
| 510 | 3300048924 | Ga0496121_0023668 | Ga0496121_0023668_3102_3932 | 273 |
| 511 | 3300048928 | Ga0496125_0030353 | Ga0496125_0030353_899_1729 | 273 |
| 512 | 3300048929 | Ga0496126_0008248 | Ga0496126_0008248_5590_6420 | 273 |
| 513 | 3300050492 | nmdc:mga0yw44_77538_c1 | nmdc:mga0yw44_77538_c1_863_1684 | 273 |
| 514 | iso_pu_bacteria | 2738541264 | 2738667596 | 273 |
| 515 | iso_pu_bacteria | 2738541356 | 2739146666 | 273 |
| 516 | 3300009098 | Ga0105245_10098676 | Ga0105245_100986762 | 274 |
| 517 | 3300009148 | Ga0105243_10278934 | Ga0105243_102789341 | 274 |
| 518 | 3300009551 | Ga0105238_10095118 | Ga0105238_100951183 | 274 |
| 519 | 3300010375 | Ga0105239_10158674 | Ga0105239_101586743 | 274 |
| 520 | 3300014325 | Ga0163163_10122872 | Ga0163163_101228723 | 274 |
| 521 | 3300028800 | Ga0265338_10028604 | Ga0265338_100286044 | 274 |
| 522 | 3300039437 | Ga0436365_1892189 | Ga0436365_1892189_1100_1933 | 274 |
| 523 | 3300046460 | Ga0495638_0001150 | Ga0495638_0001150_23882_24715 | 274 |
| 524 | 3300047320 | Ga0495672_0034340 | Ga0495672_0034340_1438_2274 | 274 |
| 525 | 3300048904 | Ga0496101_0134854 | Ga0496101_0134854_412_1254 | 274 |
| 526 | 3300048909 | Ga0496106_0465129 | Ga0496106_0465129_120_962 | 274 |
| 527 | 3300048913 | Ga0496110_0090896 | Ga0496110_0090896_111_953 | 274 |
| 528 | 3300048915 | Ga0496112_0014578 | Ga0496112_0014578_2915_3757 | 274 |
| 529 | 3300049590 | Ga0501074_0403281 | Ga0501074_0403281_67_891 | 274 |
| 530 | 3300050490 | nmdc:mga03n38_19236_c1 | nmdc:mga03n38_19236_c1_1194_2036 | 274 |
| 531 | 3300053083 | Ga0495655_0020857 | Ga0495655_0020857_580_1422 | 274 |
| 532 | 3300053085 | Ga0495619_0174699 | Ga0495619_0174699_598_1440 | 274 |
| 533 | 3300053104 | Ga0500556_0004430 | Ga0500556_0004430_3138_3971 | 274 |
| 534 | iso_pu_bacteria | 2643221715 | 2644633858 | 274 |
| 535 | iso_pu_bacteria | 2795385470 | 2795786726 | 274 |
| 536 | iso_pu_bacteria | 2902810491 | 2902810775 | 274 |
| 537 | iso_pu_bacteria | 2922554459 | 2922555368 | 274 |
| 538 | iso_pu_bacteria | 2956939328 | 2956939541 | 274 |
| 539 | 3300005843 | Ga0068860_100004988 | Ga0068860_1000049887 | 275 |
| 540 | 3300006038 | Ga0075365_10108574 | Ga0075365_101085742 | 275 |
| 541 | 3300006048 | Ga0075363_100002452 | Ga0075363_1000024526 | 275 |
| 542 | 3300006051 | Ga0075364_10030965 | Ga0075364_100309654 | 275 |
| 543 | 3300006353 | Ga0075370_10011670 | Ga0075370_100116704 | 275 |
| 544 | 3300031251 | Ga0265327_10000071 | Ga0265327_10000071186 | 275 |
| 545 | 3300035725 | Ga0373947_0180197 | Ga0373947_0180197_96_1061 | 275 |
| 546 | 3300041512 | Ga0451853_2011291 | Ga0451853_2011291_809_1663 | 275 |
| 547 | 3300046675 | Ga0495657_0174821 | Ga0495657_0174821_306_1271 | 275 |
| 548 | 3300049575 | Ga0501039_0367480 | Ga0501039_0367480_139_1011 | 275 |
| 549 | 3300049585 | Ga0501069_0123393 | Ga0501069_0123393_618_1451 | 275 |
| 550 | 3300050491 | nmdc:mga00v17_10237_c3 | nmdc:mga00v17_10237_c3_497_1324 | 275 |
| 551 | iso_pu_bacteria | 2738543005 | 2739205047 | 275 |
| 552 | 3300006051 | Ga0075364_10009652 | Ga0075364_100096526 | 276 |
| 553 | 3300006931 | Ga0097620_100926545 | Ga0097620_1009265451 | 276 |
| 554 | 3300009545 | Ga0105237_10005606 | Ga0105237_1000560611 | 276 |
| 555 | 3300025914 | Ga0207671_10027259 | Ga0207671_100272592 | 276 |
| 556 | 3300025986 | Ga0207658_10000423 | Ga0207658_1000042331 | 276 |
| 557 | 3300031901 | Ga0307406_10014618 | Ga0307406_100146184 | 276 |
| 558 | 3300041410 | Ga0439461_0000802 | Ga0439461_0000802_2748_3599 | 276 |
| 559 | 3300041997 | Ga0439431_0004643 | Ga0439431_0004643_820_1671 | 276 |
| 560 | 3300042004 | Ga0439445_0023198 | Ga0439445_0023198_498_1349 | 276 |
| 561 | 3300042435 | Ga0439434_0004809 | Ga0439434_0004809_528_1379 | 276 |
| 562 | 3300044656 | Ga0466969_0012565 | Ga0466969_0012565_1988_2860 | 276 |
| 563 | 3300044683 | Ga0466965_0012158 | Ga0466965_0012158_25_867 | 276 |
| 564 | 3300044683 | Ga0466965_0167925 | Ga0466965_0167925_47_877 | 276 |
| 565 | 3300045976 | Ga0466967_0038457 | Ga0466967_0038457_979_1809 | 276 |
| 566 | 3300045976 | Ga0466967_0123648 | Ga0466967_0123648_584_1414 | 276 |
| 567 | 3300048903 | Ga0496100_0000092 | Ga0496100_0000092_20471_21316 | 276 |
| 568 | 3300048904 | Ga0496101_0000018 | Ga0496101_0000018_20345_21190 | 276 |
| 569 | 3300048905 | Ga0496102_0011349 | Ga0496102_0011349_4750_5595 | 276 |
| 570 | 3300048906 | Ga0496103_0009275 | Ga0496103_0009275_1713_2558 | 276 |
| 571 | 3300048909 | Ga0496106_0002072 | Ga0496106_0002072_10115_10960 | 276 |
| 572 | 3300048910 | Ga0496107_0011269 | Ga0496107_0011269_2559_3404 | 276 |
| 573 | 3300048911 | Ga0496108_0042961 | Ga0496108_0042961_2313_3158 | 276 |
| 574 | 3300048912 | Ga0496109_0001095 | Ga0496109_0001095_1348_2193 | 276 |
| 575 | 3300048913 | Ga0496110_0006864 | Ga0496110_0006864_3831_4676 | 276 |
| 576 | 3300048914 | Ga0496111_0020815 | Ga0496111_0020815_54_899 | 276 |
| 577 | 3300048915 | Ga0496112_0013714 | Ga0496112_0013714_2726_3577 | 276 |
| 578 | 3300048916 | Ga0496113_0010272 | Ga0496113_0010272_937_1788 | 276 |
| 579 | 3300048917 | Ga0496114_0000914 | Ga0496114_0000914_282_1127 | 276 |
| 580 | 3300048918 | Ga0496115_0070134 | Ga0496115_0070134_893_1738 | 276 |
| 581 | 3300048919 | Ga0496116_0041798 | Ga0496116_0041798_1269_2114 | 276 |
| 582 | 3300048920 | Ga0496117_0015208 | Ga0496117_0015208_1256_2101 | 276 |
| 583 | 3300048921 | Ga0496118_0012867 | Ga0496118_0012867_5875_6720 | 276 |
| 584 | 3300048922 | Ga0496119_0013630 | Ga0496119_0013630_4352_5197 | 276 |
| 585 | 3300048923 | Ga0496120_0033976 | Ga0496120_0033976_1084_1929 | 276 |
| 586 | 3300048923 | Ga0496120_0067811 | Ga0496120_0067811_1082_1933 | 276 |
| 587 | 3300048924 | Ga0496121_0000023 | Ga0496121_0000023_432315_433160 | 276 |
| 588 | 3300048925 | Ga0496122_0000164 | Ga0496122_0000164_136652_137497 | 276 |
| 589 | 3300048925 | Ga0496122_0029305 | Ga0496122_0029305_1306_2157 | 276 |
| 590 | 3300048926 | Ga0496123_0010993 | Ga0496123_0010993_4266_5111 | 276 |
| 591 | 3300048927 | Ga0496124_0000014 | Ga0496124_0000014_432315_433160 | 276 |
| 592 | 3300048928 | Ga0496125_0000020 | Ga0496125_0000020_30289_31134 | 276 |
| 593 | 3300048929 | Ga0496126_0000023 | Ga0496126_0000023_432315_433160 | 276 |
| 594 | 3300048929 | Ga0496126_0007878 | Ga0496126_0007878_2156_3007 | 276 |
| 595 | 3300050491 | nmdc:mga00v17_1756_c1 | nmdc:mga00v17_1756_c1_9795_10646 | 276 |
| 596 | iso_pu_bacteria | 2738543011 | 2739235306 | 276 |
| 597 | iso_pu_bacteria | 2889300758 | 2889301697 | 276 |
| 598 | iso_pu_bacteria | 2939743619 | 2939747306 | 276 |
| 599 | 3300005548 | Ga0070665_100079456 | Ga0070665_1000794562 | 277 |
| 600 | 3300005841 | Ga0068863_100013710 | Ga0068863_1000137105 | 277 |
| 601 | 3300005842 | Ga0068858_100123995 | Ga0068858_1001239953 | 277 |
| 602 | 3300009092 | Ga0105250_10043332 | Ga0105250_100433321 | 277 |
| 603 | 3300009101 | Ga0105247_10282773 | Ga0105247_102827732 | 277 |
| 604 | 3300009553 | Ga0105249_10082444 | Ga0105249_100824443 | 277 |
| 605 | 3300014325 | Ga0163163_10083220 | Ga0163163_100832203 | 277 |
| 606 | 3300025711 | Ga0207696_1019145 | Ga0207696_10191453 | 277 |
| 607 | 3300025931 | Ga0207644_10002811 | Ga0207644_1000281110 | 277 |
| 608 | 3300025931 | Ga0207644_10095252 | Ga0207644_100952522 | 277 |
| 609 | 3300025986 | Ga0207658_10002974 | Ga0207658_100029744 | 277 |
| 610 | 3300026035 | Ga0207703_10134024 | Ga0207703_101340242 | 277 |
| 611 | 3300026088 | Ga0207641_10058734 | Ga0207641_100587343 | 277 |
| 612 | 3300028379 | Ga0268266_10004771 | Ga0268266_1000477110 | 277 |
| 613 | 3300048905 | Ga0496102_0129113 | Ga0496102_0129113_528_1361 | 277 |
| 614 | 3300048906 | Ga0496103_0072454 | Ga0496103_0072454_116_949 | 277 |
| 615 | 3300048907 | Ga0496104_0634215 | Ga0496104_0634215_31_864 | 277 |
| 616 | 3300048911 | Ga0496108_0037091 | Ga0496108_0037091_498_1331 | 277 |
| 617 | 3300048911 | Ga0496108_0051664 | Ga0496108_0051664_1889_2722 | 277 |
| 618 | 3300048912 | Ga0496109_0174685 | Ga0496109_0174685_963_1796 | 277 |
| 619 | 3300048915 | Ga0496112_0311132 | Ga0496112_0311132_276_1109 | 277 |
| 620 | 3300048916 | Ga0496113_0406662 | Ga0496113_0406662_39_872 | 277 |
| 621 | 3300050496 | nmdc:mga07m45_142308_c1 | nmdc:mga07m45_142308_c1_104_937 | 277 |
| 622 | 3300050496 | nmdc:mga07m45_35585_c1 | nmdc:mga07m45_35585_c1_20_856 | 277 |
| 623 | 3300013306 | Ga0163162_10055357 | Ga0163162_100553574 | 278 |
| 624 | 3300044658 | Ga0466972_0028126 | Ga0466972_0028126_582_1427 | 278 |
| 625 | 3300044683 | Ga0466965_0013330 | Ga0466965_0013330_2577_3422 | 278 |
| 626 | 3300044735 | Ga0466968_0098941 | Ga0466968_0098941_202_1038 | 278 |
| 627 | 3300045049 | Ga0466959_0144046 | Ga0466959_0144046_744_1580 | 278 |
| 628 | 3300006844 | Ga0075428_100013479 | Ga0075428_1000134799 | 279 |
| 629 | 3300006846 | Ga0075430_100031786 | Ga0075430_1000317863 | 279 |
| 630 | 3300006847 | Ga0075431_100092085 | Ga0075431_1000920853 | 279 |
| 631 | 3300009098 | Ga0105245_10001215 | Ga0105245_100012153 | 279 |
| 632 | 3300009148 | Ga0105243_10001235 | Ga0105243_100012357 | 279 |
| 633 | 3300009174 | Ga0105241_10053111 | Ga0105241_100531113 | 279 |
| 634 | 3300009177 | Ga0105248_10004628 | Ga0105248_100046287 | 279 |
| 635 | 3300009553 | Ga0105249_10032703 | Ga0105249_100327035 | 279 |
| 636 | 3300009553 | Ga0105249_10068831 | Ga0105249_100688315 | 279 |
| 637 | 3300013297 | Ga0157378_10004183 | Ga0157378_1000418314 | 279 |
| 638 | 3300013306 | Ga0163162_10040329 | Ga0163162_100403297 | 279 |
| 639 | 3300013307 | Ga0157372_10006800 | Ga0157372_100068007 | 279 |
| 640 | 3300013308 | Ga0157375_10004087 | Ga0157375_1000408712 | 279 |
| 641 | 3300014326 | Ga0157380_10001110 | Ga0157380_100011103 | 279 |
| 642 | 3300041413 | Ga0439465_0001407 | Ga0439465_0001407_5634_6473 | 279 |
| 643 | 3300048905 | Ga0496102_0534102 | Ga0496102_0534102_48_887 | 279 |
| 644 | 3300048915 | Ga0496112_0089920 | Ga0496112_0089920_913_1752 | 279 |
| 645 | 3300021384 | Ga0213876_10002254 | Ga0213876_100022549 | 282 |
| 646 | 3300021388 | Ga0213875_10094498 | Ga0213875_100944982 | 282 |
| 647 | 3300037853 | Ga0436364_0865025 | Ga0436364_0865025_2912_3763 | 282 |
| 648 | 3300044684 | Ga0466966_0004759 | Ga0466966_0004759_4552_5406 | 282 |
| 649 | 3300044693 | Ga0466961_0030983 | Ga0466961_0030983_1423_2277 | 282 |
| 650 | 3300044735 | Ga0466968_0000903 | Ga0466968_0000903_2793_3647 | 282 |
| 651 | 3300044765 | Ga0466970_0005871 | Ga0466970_0005871_1916_2770 | 282 |
| 652 | 3300044842 | Ga0466957_0059961 | Ga0466957_0059961_618_1472 | 282 |
| 653 | 3300045836 | Ga0466958_0006150 | Ga0466958_0006150_4760_5614 | 282 |
| 654 | 3300025921 | Ga0207652_10445336 | Ga0207652_104453362 | 285 |
| 655 | 3300048929 | Ga0496126_0002407 | Ga0496126_0002407_14266_15147 | 285 |
| 656 | 3300048904 | Ga0496101_0087236 | Ga0496101_0087236_749_1636 | 287 |
| 657 | 3300048905 | Ga0496102_0073913 | Ga0496102_0073913_1568_2455 | 287 |
| 658 | 3300048923 | Ga0496120_0124555 | Ga0496120_0124555_291_1163 | 287 |
| 659 | iso_pu_bacteria | 2738541274 | 2738704034 | 287 |
| 660 | iso_pu_bacteria | 2738543028 | 2739334408 | 287 |
| 661 | iso_pu_bacteria | 2902799365 | 2902800985 | 287 |
| 662 | 3300036712 | Ga0316584_0087933 | Ga0316584_0087933_977_1855 | 290 |
| 663 | 3300037853 | Ga0436364_0196904 | Ga0436364_0196904_2526_3404 | 290 |
| 664 | 3300045976 | Ga0466967_0068438 | Ga0466967_0068438_2269_3144 | 290 |
| 665 | 3300045976 | Ga0466967_0524830 | Ga0466967_0524830_183_1073 | 290 |
| 666 | 3300050491 | nmdc:mga00v17_5641_c1 | nmdc:mga00v17_5641_c1_2216_3091 | 290 |
| 667 | 3300050496 | nmdc:mga07m45_46133_c1 | nmdc:mga07m45_46133_c1_916_1791 | 290 |
| 668 | 3300005718 | Ga0068866_10278566 | Ga0068866_102785661 | 291 |
| 669 | 3300006038 | Ga0075365_10049787 | Ga0075365_100497873 | 291 |
| 670 | 3300006186 | Ga0075369_10005350 | Ga0075369_100053504 | 291 |
| 671 | 3300025303 | Ga0209051_1037337 | Ga0209051_10373373 | 291 |
| 672 | 3300046460 | Ga0495638_0014705 | Ga0495638_0014705_3215_4093 | 291 |
| 673 | 3300048929 | Ga0496126_0016663 | Ga0496126_0016663_2892_3770 | 291 |
| 674 | 3300050492 | nmdc:mga0yw44_8431_c1 | nmdc:mga0yw44_8431_c1_4161_5039 | 291 |
| 675 | 3300050516 | nmdc:mga0sz30_190306_c1 | nmdc:mga0sz30_190306_c1_22_900 | 291 |
| 676 | 3300053158 | Ga0500627_0002578 | Ga0500627_0002578_77_955 | 291 |
| 677 | 3300053730 | Ga0500645_000054 | Ga0500645_000054_25943_26821 | 291 |
| 678 | 3300005842 | Ga0068858_100511308 | Ga0068858_1005113082 | 292 |
| 679 | 3300009545 | Ga0105237_10030990 | Ga0105237_100309903 | 292 |
| 680 | 3300010375 | Ga0105239_10002249 | Ga0105239_1000224920 | 292 |
| 681 | 3300025914 | Ga0207671_10010925 | Ga0207671_100109255 | 292 |
| 682 | 3300026095 | Ga0207676_10142511 | Ga0207676_101425112 | 292 |
| 683 | 3300048904 | Ga0496101_0000019 | Ga0496101_0000019_198717_199607 | 292 |
| 684 | 3300048909 | Ga0496106_0022637 | Ga0496106_0022637_39_929 | 292 |
| 685 | 3300048910 | Ga0496107_0013411 | Ga0496107_0013411_2436_3326 | 292 |
| 686 | 3300048919 | Ga0496116_0000033 | Ga0496116_0000033_70540_71430 | 292 |
| 687 | 3300048920 | Ga0496117_0000025 | Ga0496117_0000025_70470_71360 | 292 |
| 688 | 3300048922 | Ga0496119_0000403 | Ga0496119_0000403_31911_32801 | 292 |
| 689 | 3300048923 | Ga0496120_0000798 | Ga0496120_0000798_12560_13450 | 292 |
| 690 | 3300048924 | Ga0496121_0000039 | Ga0496121_0000039_181660_182550 | 292 |
| 691 | 3300048929 | Ga0496126_0000405 | Ga0496126_0000405_68355_69245 | 292 |
| 692 | 3300005937 | Ga0081455_10004245 | Ga0081455_1000424515 | 293 |
| 693 | 3300025916 | Ga0207663_10107599 | Ga0207663_101075992 | 293 |
| 694 | 3300039437 | Ga0436365_0659401 | Ga0436365_0659401_8274_9170 | 293 |
| 695 | 3300044684 | Ga0466966_0008557 | Ga0466966_0008557_5270_6166 | 293 |
| 696 | 3300044693 | Ga0466961_0002569 | Ga0466961_0002569_1124_2020 | 293 |
| 697 | 3300044694 | Ga0466963_0052345 | Ga0466963_0052345_1564_2460 | 293 |
| 698 | 3300044706 | Ga0466964_0099774 | Ga0466964_0099774_164_1060 | 293 |
| 699 | 3300044719 | Ga0466971_0022776 | Ga0466971_0022776_1097_1984 | 293 |
| 700 | 3300044901 | Ga0466960_0110377 | Ga0466960_0110377_25_921 | 293 |
| 701 | 3300045049 | Ga0466959_0042249 | Ga0466959_0042249_2046_2942 | 293 |
| 702 | 3300045836 | Ga0466958_0011621 | Ga0466958_0011621_2314_3210 | 293 |
| 703 | 3300048917 | Ga0496114_0397670 | Ga0496114_0397670_189_1079 | 293 |
| 704 | 3300048921 | Ga0496118_0001792 | Ga0496118_0001792_19570_20460 | 293 |
| 705 | 3300048929 | Ga0496126_0357052 | Ga0496126_0357052_253_1155 | 293 |
| 706 | 3300049581 | Ga0501047_0012498 | Ga0501047_0012498_1002_1889 | 293 |
| 707 | 3300049822 | Ga0501035_0000417 | Ga0501035_0000417_21713_22600 | 293 |
| 708 | 3300049823 | Ga0501044_0001166 | Ga0501044_0001166_18213_19100 | 293 |
| 709 | 3300061719 | Ga0466962_0041679 | Ga0466962_0041679_1222_2109 | 293 |
| 710 | 3300050516 | nmdc:mga0sz30_842_c2 | nmdc:mga0sz30_842_c2_4781_5749 | 294 |
| 711 | 3300005347 | Ga0070668_100002289 | Ga0070668_10000228916 | 295 |
| 712 | 3300005841 | Ga0068863_100671027 | Ga0068863_1006710271 | 295 |
| 713 | 3300009148 | Ga0105243_10629568 | Ga0105243_106295681 | 295 |
| 714 | 3300009176 | Ga0105242_10118330 | Ga0105242_101183302 | 295 |
| 715 | 3300011119 | Ga0105246_10496382 | Ga0105246_104963822 | 295 |
| 716 | 3300014968 | Ga0157379_10277181 | Ga0157379_102771812 | 295 |
| 717 | 3300017792 | Ga0163161_10064177 | Ga0163161_100641772 | 295 |
| 718 | 3300025972 | Ga0207668_10005691 | Ga0207668_100056916 | 295 |
| 719 | 3300026118 | Ga0207675_100277085 | Ga0207675_1002770852 | 295 |
| 720 | 3300046660 | Ga0495625_0203837 | Ga0495625_0203837_100_996 | 295 |
| 721 | 3300048091 | Ga0495626_0064966 | Ga0495626_0064966_296_1192 | 295 |
| 722 | 3300048904 | Ga0496101_0000622 | Ga0496101_0000622_12337_13236 | 295 |
| 723 | 3300048905 | Ga0496102_0022101 | Ga0496102_0022101_1273_2172 | 295 |
| 724 | 3300048907 | Ga0496104_0013456 | Ga0496104_0013456_4311_5210 | 295 |
| 725 | 3300048908 | Ga0496105_0012622 | Ga0496105_0012622_3866_4765 | 295 |
| 726 | 3300048909 | Ga0496106_0004090 | Ga0496106_0004090_4462_5361 | 295 |
| 727 | 3300048910 | Ga0496107_0001625 | Ga0496107_0001625_8962_9861 | 295 |
| 728 | 3300048912 | Ga0496109_0284980 | Ga0496109_0284980_455_1354 | 295 |
| 729 | 3300048917 | Ga0496114_0002275 | Ga0496114_0002275_12948_13847 | 295 |
| 730 | 3300048918 | Ga0496115_0001526 | Ga0496115_0001526_6240_7139 | 295 |
| 731 | 3300053108 | Ga0500562_006369 | Ga0500562_006369_1357_2253 | 295 |
| 732 | 3300005455 | Ga0070663_100106913 | Ga0070663_1001069132 | 296 |
| 733 | 3300005456 | Ga0070678_100282215 | Ga0070678_1002822153 | 296 |
| 734 | 3300021384 | Ga0213876_10091830 | Ga0213876_100918303 | 296 |
| 735 | 3300026067 | Ga0207678_10565113 | Ga0207678_105651131 | 296 |
| 736 | 3300039437 | Ga0436365_1273418 | Ga0436365_1273418_39_935 | 296 |
| 737 | 3300006038 | Ga0075365_10030422 | Ga0075365_100304223 | 297 |
| 738 | 3300031731 | Ga0307405_10093827 | Ga0307405_100938273 | 298 |
| 739 | 3300031852 | Ga0307410_10003168 | Ga0307410_100031684 | 298 |
| 740 | 3300032002 | Ga0307416_100030526 | Ga0307416_1000305264 | 298 |
| 741 | 3300032005 | Ga0307411_10203895 | Ga0307411_102038953 | 298 |
| 742 | 3300005355 | Ga0070671_100003579 | Ga0070671_1000035795 | 299 |
| 743 | 3300005355 | Ga0070671_100104700 | Ga0070671_1001047002 | 299 |
| 744 | 3300005367 | Ga0070667_100016968 | Ga0070667_1000169684 | 299 |
| 745 | 3300005367 | Ga0070667_100332217 | Ga0070667_1003322172 | 299 |
| 746 | 3300005544 | Ga0070686_100166929 | Ga0070686_1001669292 | 299 |
| 747 | 3300006038 | Ga0075365_10003069 | Ga0075365_100030699 | 299 |
| 748 | 3300006048 | Ga0075363_100004795 | Ga0075363_1000047957 | 299 |
| 749 | 3300006048 | Ga0075363_100005479 | Ga0075363_1000054795 | 299 |
| 750 | 3300006178 | Ga0075367_10002207 | Ga0075367_100022073 | 299 |
| 751 | 3300006353 | Ga0075370_10005252 | Ga0075370_100052527 | 299 |
| 752 | 3300006353 | Ga0075370_10080733 | Ga0075370_100807332 | 299 |
| 753 | 3300025961 | Ga0207712_10309105 | Ga0207712_103091052 | 299 |
| 754 | 3300050490 | nmdc:mga03n38_44005_c1 | nmdc:mga03n38_44005_c1_432_1331 | 299 |
| 755 | 3300050492 | nmdc:mga0yw44_34565_c1 | nmdc:mga0yw44_34565_c1_257_1159 | 299 |
| 756 | 3300050494 | nmdc:mga06z11_17517_c1 | nmdc:mga06z11_17517_c1_120_1022 | 299 |
| 757 | 3300050511 | nmdc:mga08y16_737197_c1 | nmdc:mga08y16_737197_c1_70_969 | 299 |
| 758 | 3300026023 | Ga0207677_10381973 | Ga0207677_103819731 | 300 |
| 759 | 3300046459 | Ga0495629_0006511 | Ga0495629_0006511_7242_8162 | 300 |
| 760 | 3300046533 | Ga0495640_0053963 | Ga0495640_0053963_1255_2175 | 300 |
| 761 | 3300046690 | Ga0495624_0106835 | Ga0495624_0106835_771_1691 | 300 |
| 762 | 3300047315 | Ga0495581_0180806 | Ga0495581_0180806_280_1200 | 300 |
| 763 | 3300047673 | Ga0495593_0016678 | Ga0495593_0016678_1255_2175 | 300 |
| 764 | 3300048915 | Ga0496112_0238183 | Ga0496112_0238183_813_1733 | 300 |
| 765 | 3300006186 | Ga0075369_10061175 | Ga0075369_100611753 | 301 |
| 766 | 3300001990 | JGI24737J22298_10042961 | JGI24737J22298_100429612 | 303 |
| 767 | 3300002067 | JGI24735J21928_10041998 | JGI24735J21928_100419982 | 303 |
| 768 | 3300002075 | JGI24738J21930_10007588 | JGI24738J21930_100075882 | 303 |
| 769 | 3300002077 | JGI24744J21845_10003124 | JGI24744J21845_100031246 | 303 |
| 770 | 3300005334 | Ga0068869_100017978 | Ga0068869_1000179783 | 303 |
| 771 | 3300005335 | Ga0070666_10221518 | Ga0070666_102215182 | 303 |
| 772 | 3300005336 | Ga0070680_100354431 | Ga0070680_1003544312 | 303 |
| 773 | 3300005337 | Ga0070682_100150455 | Ga0070682_1001504553 | 303 |
| 774 | 3300005338 | Ga0068868_100005264 | Ga0068868_10000526412 | 303 |
| 775 | 3300005340 | Ga0070689_100003359 | Ga0070689_1000033598 | 303 |
| 776 | 3300005341 | Ga0070691_10010299 | Ga0070691_100102994 | 303 |
| 777 | 3300005353 | Ga0070669_100017202 | Ga0070669_1000172023 | 303 |
| 778 | 3300005356 | Ga0070674_100000471 | Ga0070674_10000047115 | 303 |
| 779 | 3300005365 | Ga0070688_100012339 | Ga0070688_1000123394 | 303 |
| 780 | 3300005366 | Ga0070659_100009523 | Ga0070659_1000095239 | 303 |
| 781 | 3300005367 | Ga0070667_100007458 | Ga0070667_1000074589 | 303 |
| 782 | 3300005437 | Ga0070710_10001183 | Ga0070710_100011831 | 303 |
| 783 | 3300005438 | Ga0070701_10003260 | Ga0070701_100032606 | 303 |
| 784 | 3300005439 | Ga0070711_100001458 | Ga0070711_10000145811 | 303 |
| 785 | 3300005440 | Ga0070705_100001938 | Ga0070705_1000019383 | 303 |
| 786 | 3300005441 | Ga0070700_100001602 | Ga0070700_1000016029 | 303 |
| 787 | 3300005444 | Ga0070694_100009611 | Ga0070694_1000096114 | 303 |
| 788 | 3300005455 | Ga0070663_100013543 | Ga0070663_1000135431 | 303 |
| 789 | 3300005456 | Ga0070678_100000482 | Ga0070678_10000048211 | 303 |
| 790 | 3300005457 | Ga0070662_100015443 | Ga0070662_1000154435 | 303 |
| 791 | 3300005459 | Ga0068867_100000934 | Ga0068867_10000093415 | 303 |
| 792 | 3300005539 | Ga0068853_100105292 | Ga0068853_1001052923 | 303 |
| 793 | 3300005549 | Ga0070704_100002252 | Ga0070704_1000022525 | 303 |
| 794 | 3300005578 | Ga0068854_100009065 | Ga0068854_1000090657 | 303 |
| 795 | 3300005615 | Ga0070702_100004933 | Ga0070702_1000049335 | 303 |
| 796 | 3300005718 | Ga0068866_10000543 | Ga0068866_1000054311 | 303 |
| 797 | 3300005719 | Ga0068861_100000669 | Ga0068861_10000066912 | 303 |
| 798 | 3300005842 | Ga0068858_100030525 | Ga0068858_1000305256 | 303 |
| 799 | 3300005843 | Ga0068860_100007980 | Ga0068860_10000798012 | 303 |
| 800 | 3300005844 | Ga0068862_100004477 | Ga0068862_1000044775 | 303 |
| 801 | 3300005937 | Ga0081455_10017010 | Ga0081455_100170102 | 303 |
| 802 | 3300005981 | Ga0081538_10079482 | Ga0081538_100794822 | 303 |
| 803 | 3300006175 | Ga0070712_100002733 | Ga0070712_1000027339 | 303 |
| 804 | 3300006237 | Ga0097621_100369856 | Ga0097621_1003698562 | 303 |
| 805 | 3300006358 | Ga0068871_100448624 | Ga0068871_1004486242 | 303 |
| 806 | 3300006881 | Ga0068865_100000375 | Ga0068865_10000037521 | 303 |
| 807 | 3300017792 | Ga0163161_10008820 | Ga0163161_100088207 | 303 |
| 808 | 3300025898 | Ga0207692_10002301 | Ga0207692_1000230110 | 303 |
| 809 | 3300025899 | Ga0207642_10001569 | Ga0207642_100015697 | 303 |
| 810 | 3300025900 | Ga0207710_10004333 | Ga0207710_100043335 | 303 |
| 811 | 3300025901 | Ga0207688_10010480 | Ga0207688_100104808 | 303 |
| 812 | 3300025903 | Ga0207680_10009035 | Ga0207680_100090355 | 303 |
| 813 | 3300025915 | Ga0207693_10001043 | Ga0207693_1000104321 | 303 |
| 814 | 3300025927 | Ga0207687_10010540 | Ga0207687_100105404 | 303 |
| 815 | 3300025933 | Ga0207706_10013244 | Ga0207706_100132442 | 303 |
| 816 | 3300025934 | Ga0207686_10020172 | Ga0207686_100201726 | 303 |
| 817 | 3300025937 | Ga0207669_10003546 | Ga0207669_100035464 | 303 |
| 818 | 3300025938 | Ga0207704_10000983 | Ga0207704_100009834 | 303 |
| 819 | 3300025939 | Ga0207665_10002392 | Ga0207665_100023922 | 303 |
| 820 | 3300025941 | Ga0207711_10004749 | Ga0207711_100047494 | 303 |
| 821 | 3300025942 | Ga0207689_10059640 | Ga0207689_100596404 | 303 |
| 822 | 3300025949 | Ga0207667_10150114 | Ga0207667_101501143 | 303 |
| 823 | 3300025961 | Ga0207712_10008487 | Ga0207712_100084874 | 303 |
| 824 | 3300025972 | Ga0207668_10007628 | Ga0207668_100076285 | 303 |
| 825 | 3300025981 | Ga0207640_10008708 | Ga0207640_100087085 | 303 |
| 826 | 3300026023 | Ga0207677_10006124 | Ga0207677_100061245 | 303 |
| 827 | 3300026035 | Ga0207703_10005256 | Ga0207703_100052564 | 303 |
| 828 | 3300026041 | Ga0207639_10016358 | Ga0207639_100163583 | 303 |
| 829 | 3300026067 | Ga0207678_10024812 | Ga0207678_100248129 | 303 |
| 830 | 3300026075 | Ga0207708_10001649 | Ga0207708_1000164914 | 303 |
| 831 | 3300026078 | Ga0207702_10143448 | Ga0207702_101434483 | 303 |
| 832 | 3300026089 | Ga0207648_10001183 | Ga0207648_1000118315 | 303 |
| 833 | 3300026118 | Ga0207675_100001210 | Ga0207675_10000121016 | 303 |
| 834 | 3300026121 | Ga0207683_10000829 | Ga0207683_1000082915 | 303 |
| 835 | 3300028379 | Ga0268266_10064183 | Ga0268266_100641832 | 303 |
| 836 | 3300028380 | Ga0268265_10010559 | Ga0268265_100105594 | 303 |
| 837 | 3300001977 | JGI24746J21847_1001556 | JGI24746J21847_10015562 | 305 |
| 838 | 3300001991 | JGI24743J22301_10003990 | JGI24743J22301_100039902 | 305 |
| 839 | 3300002077 | JGI24744J21845_10005466 | JGI24744J21845_100054663 | 305 |
| 840 | 3300002239 | JGI24034J26672_10013165 | JGI24034J26672_100131652 | 305 |
| 841 | 3300005328 | Ga0070676_10027785 | Ga0070676_100277853 | 305 |
| 842 | 3300005334 | Ga0068869_100020301 | Ga0068869_1000203013 | 305 |
| 843 | 3300005338 | Ga0068868_100049862 | Ga0068868_1000498622 | 305 |
| 844 | 3300005339 | Ga0070660_100069801 | Ga0070660_1000698012 | 305 |
| 845 | 3300005345 | Ga0070692_10126683 | Ga0070692_101266832 | 305 |
| 846 | 3300005347 | Ga0070668_100126623 | Ga0070668_1001266233 | 305 |
| 847 | 3300005353 | Ga0070669_100133442 | Ga0070669_1001334422 | 305 |
| 848 | 3300005355 | Ga0070671_100114225 | Ga0070671_1001142253 | 305 |
| 849 | 3300005356 | Ga0070674_100033147 | Ga0070674_1000331474 | 305 |
| 850 | 3300005364 | Ga0070673_100028669 | Ga0070673_1000286693 | 305 |
| 851 | 3300005366 | Ga0070659_100086939 | Ga0070659_1000869393 | 305 |
| 852 | 3300005367 | Ga0070667_100070944 | Ga0070667_1000709442 | 305 |
| 853 | 3300005434 | Ga0070709_10161941 | Ga0070709_101619412 | 305 |
| 854 | 3300005434 | Ga0070709_10174314 | Ga0070709_101743142 | 305 |
| 855 | 3300005437 | Ga0070710_10058156 | Ga0070710_100581563 | 305 |
| 856 | 3300005439 | Ga0070711_100000406 | Ga0070711_10000040622 | 305 |
| 857 | 3300005441 | Ga0070700_100295886 | Ga0070700_1002958862 | 305 |
| 858 | 3300005459 | Ga0068867_100026719 | Ga0068867_1000267193 | 305 |
| 859 | 3300005546 | Ga0070696_100030928 | Ga0070696_1000309285 | 305 |
| 860 | 3300005563 | Ga0068855_100146959 | Ga0068855_1001469593 | 305 |
| 861 | 3300005578 | Ga0068854_100239728 | Ga0068854_1002397282 | 305 |
| 862 | 3300005615 | Ga0070702_100051015 | Ga0070702_1000510152 | 305 |
| 863 | 3300005617 | Ga0068859_100266404 | Ga0068859_1002664043 | 305 |
| 864 | 3300005719 | Ga0068861_100192641 | Ga0068861_1001926412 | 305 |
| 865 | 3300005834 | Ga0068851_10046768 | Ga0068851_100467683 | 305 |
| 866 | 3300005842 | Ga0068858_100019851 | Ga0068858_1000198513 | 305 |
| 867 | 3300005843 | Ga0068860_100152545 | Ga0068860_1001525453 | 305 |
| 868 | 3300005844 | Ga0068862_100046183 | Ga0068862_1000461834 | 305 |
| 869 | 3300005937 | Ga0081455_10248051 | Ga0081455_102480513 | 305 |
| 870 | 3300006163 | Ga0070715_10146171 | Ga0070715_101461712 | 305 |
| 871 | 3300006173 | Ga0070716_100005819 | Ga0070716_1000058195 | 305 |
| 872 | 3300006175 | Ga0070712_100021230 | Ga0070712_1000212303 | 305 |
| 873 | 3300006931 | Ga0097620_100266375 | Ga0097620_1002663752 | 305 |
| 874 | 3300009098 | Ga0105245_10013569 | Ga0105245_100135698 | 305 |
| 875 | 3300009101 | Ga0105247_10061866 | Ga0105247_100618662 | 305 |
| 876 | 3300009177 | Ga0105248_10130627 | Ga0105248_101306273 | 305 |
| 877 | 3300011119 | Ga0105246_10043905 | Ga0105246_100439052 | 305 |
| 878 | 3300013308 | Ga0157375_10159637 | Ga0157375_101596373 | 305 |
| 879 | 3300014326 | Ga0157380_10494969 | Ga0157380_104949692 | 305 |
| 880 | 3300014745 | Ga0157377_10129611 | Ga0157377_101296112 | 305 |
| 881 | 3300014968 | Ga0157379_10050480 | Ga0157379_100504804 | 305 |
| 882 | 3300014969 | Ga0157376_10242369 | Ga0157376_102423692 | 305 |
| 883 | 3300017792 | Ga0163161_10100607 | Ga0163161_101006073 | 305 |
| 884 | 3300025898 | Ga0207692_10004267 | Ga0207692_100042672 | 305 |
| 885 | 3300025901 | Ga0207688_10000454 | Ga0207688_100004547 | 305 |
| 886 | 3300025904 | Ga0207647_10103716 | Ga0207647_101037162 | 305 |
| 887 | 3300025906 | Ga0207699_10086856 | Ga0207699_100868562 | 305 |
| 888 | 3300025915 | Ga0207693_10002779 | Ga0207693_1000277914 | 305 |
| 889 | 3300025916 | Ga0207663_10151550 | Ga0207663_101515502 | 305 |
| 890 | 3300025923 | Ga0207681_10345128 | Ga0207681_103451282 | 305 |
| 891 | 3300025927 | Ga0207687_10026990 | Ga0207687_100269904 | 305 |
| 892 | 3300025931 | Ga0207644_10142158 | Ga0207644_101421583 | 305 |
| 893 | 3300025932 | Ga0207690_10304902 | Ga0207690_103049022 | 305 |
| 894 | 3300025933 | Ga0207706_10054732 | Ga0207706_100547322 | 305 |
| 895 | 3300025939 | Ga0207665_10004004 | Ga0207665_100040048 | 305 |
| 896 | 3300025940 | Ga0207691_10053293 | Ga0207691_100532933 | 305 |
| 897 | 3300025942 | Ga0207689_10009086 | Ga0207689_100090869 | 305 |
| 898 | 3300025972 | Ga0207668_10417182 | Ga0207668_104171822 | 305 |
| 899 | 3300026023 | Ga0207677_10262562 | Ga0207677_102625621 | 305 |
| 900 | 3300026067 | Ga0207678_10021422 | Ga0207678_100214223 | 305 |
| 901 | 3300026075 | Ga0207708_10163519 | Ga0207708_101635192 | 305 |
| 902 | 3300026088 | Ga0207641_10365635 | Ga0207641_103656352 | 305 |
| 903 | 3300026089 | Ga0207648_10021818 | Ga0207648_100218187 | 305 |
| 904 | 3300026095 | Ga0207676_10114078 | Ga0207676_101140783 | 305 |
| 905 | 3300028379 | Ga0268266_10009241 | Ga0268266_100092413 | 305 |
| 906 | 3300028380 | Ga0268265_10284382 | Ga0268265_102843822 | 305 |
| 907 | 3300035242 | Ga0373962_0013580 | Ga0373962_0013580_565_1482 | 305 |
| 908 | 3300048904 | Ga0496101_0229061 | Ga0496101_0229061_426_1343 | 305 |
| 909 | 3300048906 | Ga0496103_0136342 | Ga0496103_0136342_628_1545 | 305 |
| 910 | 3300048907 | Ga0496104_0016581 | Ga0496104_0016581_4374_5291 | 305 |
| 911 | 3300048908 | Ga0496105_0063595 | Ga0496105_0063595_728_1645 | 305 |
| 912 | 3300048909 | Ga0496106_0338855 | Ga0496106_0338855_38_955 | 305 |
| 913 | 3300048910 | Ga0496107_0123542 | Ga0496107_0123542_968_1885 | 305 |
| 914 | 3300048911 | Ga0496108_0007756 | Ga0496108_0007756_241_1158 | 305 |
| 915 | 3300048912 | Ga0496109_0002261 | Ga0496109_0002261_14612_15529 | 305 |
| 916 | 3300048913 | Ga0496110_0179896 | Ga0496110_0179896_180_1097 | 305 |
| 917 | 3300048915 | Ga0496112_0014985 | Ga0496112_0014985_196_1113 | 305 |
| 918 | 3300048917 | Ga0496114_0164436 | Ga0496114_0164436_240_1157 | 305 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5lzp-assembly1.cif.gz_G | binding of the c-terminal gqyl motif of the bacterial proteasome activator bpa to the 20s proteasome | 0.9951 | 65 | 284 |
| 7pxd-assembly1.cif.gz_Y | substrate-engaged mycobacterial proteasome-associated atpase in complex with open-gate 20s cp - composite map (state b) | 0.9949 | 64 | 285 |
| 3mka-assembly1.cif.gz_V | crystal structure of mycobacterium tuberculosis proteasome with propetide and an t1a mutation at beta-subunit | 0.9903 | 27 | 285 |
| 3mka-assembly1.cif.gz_E | crystal structure of mycobacterium tuberculosis proteasome with propetide and an t1a mutation at beta-subunit | 0.9879 | 27 | 285 |
| 3h6i-assembly1.cif.gz_H | crystal structure of mycobacterium tuberculosis proteasome modified by inhibitor gl1 | 0.9867 | 66 | 284 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3h6fR00 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.9805 | 66 | 291 | 3.60.20.10 |
| af_P9WHT9_20_291_3.60.20.10 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.9679 | 27 | 293 | 3.60.20.10 |
| 3h6fR00 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.9674 | 66 | 291 | 3.60.20.10 |
| 2jayA00 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.9607 | 64 | 279 | 3.60.20.10 |
| 2jayA00 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.951 | 64 | 279 | 3.60.20.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S8N7V0-F1-model_v4 | deleted | 0.9996 | 112 | 195 |
|
| AF-X8BGF9-F1-model_v4 | Proteasome subunit beta (EC 3.4.25.1) | 0.9995 | 98 | 195 |
GO:0000502
GO:0016787 |
| AF-A0A6N7GHP8-F1-model_v4 | Proteasome subunit beta (EC 3.4.25.1) | 0.9921 | 60 | 214 |
GO:0004298
GO:0005737 GO:0005839 GO:0010498 |
| AF-A0A2S8N7V0-F1-model_v4 | deleted | 0.9878 | 112 | 195 |
|
| AF-A0A7K0P564-F1-model_v4 | Proteasome subunit beta (EC 3.4.25.1) | 0.9804 | 60 | 286 |
GO:0004298
GO:0005737 GO:0005839 GO:0010498 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar