F485667

General Info

Members Datasets Scaffolds Average Seq Length
918 383 882 283

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10017010|Ga0081455_100170102
Length 312
Sequence VTWPHREQLAFPSPLPVPGVPSVPEASYAPHVRVDLSSFSDLLRRQAPELLPVNRSGPFDAVPSGALPHGTTIVALKFPGGVVLAGDRRSTQGNMIAGRDVQKVYITDDYTATGIAGTAAIAVEFARLYAVELEHYEKTEGVPLTFRGKVNRLATMVRGNLGAALQGFVALPLLAAYDLDDPDPQAAGRIVSFDAAGGWNLEEEGYQSVGSGSIFAKSSIKKLYSQVVDADSALRVAIEGLYDAADDDSATGGPDLVRGIYPTAVILHAEGAEEVPETRIAELAREVIESRSRSDTFGPDAAHRSADARGDS

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
3 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
4 2643221711 Terrabacter sp. Root85 Isolate Unclassified
5 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
6 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
7 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
8 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
9 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
10 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
11 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
12 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
13 2739367898 Nocardioides sp. CF479 Isolate Unclassified
14 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
15 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
16 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
17 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
18 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
19 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
20 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
21 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
22 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
23 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
24 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
25 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
26 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
27 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
28 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
29 2922554459 Rhodococcus sp. 66b Isolate Unclassified
30 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
31 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
32 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
33 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
34 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
35 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
36 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
37 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
38 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
39 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
40 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
41 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
42 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
43 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
44 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
45 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
46 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
47 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
48 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
49 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
50 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
51 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
52 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
53 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
54 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
55 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
56 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
57 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
58 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
59 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
60 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
61 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
62 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
63 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
64 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
65 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
66 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
67 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
68 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
69 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
70 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
71 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
72 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
73 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
74 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
75 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
76 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
77 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
78 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
79 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
80 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
81 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
82 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
83 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
84 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
85 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
86 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
89 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
90 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
91 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
92 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
93 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
94 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
95 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
96 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
97 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
98 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
99 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
100 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
101 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
102 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
103 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
104 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
105 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
106 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
107 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
108 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
109 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
110 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
111 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
112 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
113 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
114 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
116 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
117 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
118 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
119 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
120 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
121 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
123 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
124 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
125 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
126 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
127 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
130 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
131 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
136 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
137 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
138 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
139 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
140 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
141 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
142 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
143 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
144 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
145 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
146 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
147 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
148 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
149 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
150 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
151 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
159 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
160 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
161 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
219 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
220 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
222 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
223 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
224 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
225 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
226 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
227 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
228 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
229 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
230 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
231 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
232 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
233 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
235 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
236 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
237 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
238 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
239 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
240 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
241 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
242 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
243 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
244 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
245 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
246 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
247 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
248 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
249 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
250 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
251 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
252 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
253 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
254 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
255 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
256 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
257 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
258 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
259 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
260 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
261 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
262 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
263 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
264 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
265 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
266 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
267 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
268 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
269 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
270 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
271 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
272 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
273 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
274 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
275 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
276 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
277 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
278 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
279 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
280 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
281 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
282 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
283 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
284 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
285 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
286 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
287 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
288 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
289 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
290 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
291 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
292 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
293 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
294 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
295 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
296 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
297 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
298 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
299 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
300 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
301 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
302 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
303 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
304 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
305 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
306 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
307 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
308 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
309 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
310 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
311 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
314 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
315 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
316 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
317 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
318 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
319 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
320 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
321 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
322 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
323 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
324 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
325 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
326 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
327 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
328 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
329 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
330 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
331 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
332 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
333 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
334 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
335 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
336 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
337 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
351 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
352 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
353 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
354 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
355 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
356 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
359 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
360 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
361 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
362 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
363 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
364 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
365 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
366 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
367 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
368 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
369 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
370 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
371 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
372 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
373 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
374 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
375 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
376 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
377 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
378 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
379 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
380 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
381 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
383 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.34
Metatranscriptomes 1.74
Isolates 3.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.3
Nodule 0.11
Rhizoplane 12.64
Rhizosphere 70.92
Stem 0
Stem Tuber 0.11
Unclassified 8.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1001556 3300001977 Bacteria 3658
2 JGI24737J22298_10042961 3300001990 Bacteria 1384
3 JGI24743J22301_10003990 3300001991 Bacteria 2372
4 JGI24735J21928_10041998 3300002067 Bacteria 1332
5 JGI24738J21930_10007588 3300002075 Bacteria 2497
6 JGI24738J21930_10013856 3300002075 Bacteria 1736
7 JGI24744J21845_10003124 3300002077 Bacteria 3396
8 JGI24744J21845_10005466 3300002077 Bacteria 2629
9 JGI24034J26672_10013165 3300002239 Bacteria 1254
10 rootL2_10062985 3300003322 Bacteria 3061
11 Ga0055540_1001305 3300003792 Bacteria 15075
12 Ga0055540_1002845 3300003792 Bacteria 8809
13 Ga0055540_1008869 3300003792 Bacteria 3560
14 Ga0070658_10047833 3300005327 Bacteria 3462
15 Ga0070676_10027785 3300005328 Bacteria 3211
16 Ga0070683_100037531 3300005329 Bacteria 4435
17 Ga0070683_100082793 3300005329 Bacteria 3005
18 Ga0070683_100152867 3300005329 Bacteria 2188
19 Ga0068869_100017978 3300005334 Bacteria 4805
20 Ga0068869_100020301 3300005334 Bacteria 4554
21 Ga0070666_10221518 3300005335 Bacteria 1335
22 Ga0070680_100354431 3300005336 Bacteria 1248
23 Ga0070682_100047587 3300005337 Bacteria 2667
24 Ga0070682_100125579 3300005337 Bacteria 1729
25 Ga0070682_100150455 3300005337 Bacteria 1596
26 Ga0068868_100005264 3300005338 Bacteria 9081
27 Ga0068868_100049862 3300005338 Bacteria 3286
28 Ga0068868_100095915 3300005338 Bacteria 2395
29 Ga0070660_100069801 3300005339 Bacteria 2741
30 Ga0070660_100177347 3300005339 Bacteria 1723
31 Ga0070689_100003359 3300005340 Bacteria 10637
32 Ga0070691_10010299 3300005341 Bacteria 4267
33 Ga0070692_10111031 3300005345 Bacteria 1516
34 Ga0070692_10126683 3300005345 Bacteria 1430
35 Ga0070668_100002289 3300005347 Bacteria 14123
36 Ga0070668_100126623 3300005347 Bacteria 2046
37 Ga0070668_100458063 3300005347 Bacteria 1098
38 Ga0070669_100017202 3300005353 Bacteria 5158
39 Ga0070669_100133442 3300005353 Bacteria 1908
40 Ga0070671_100003579 3300005355 Bacteria 12151
41 Ga0070671_100104700 3300005355 Bacteria 2375
42 Ga0070671_100114225 3300005355 Bacteria 2270
43 Ga0070674_100000471 3300005356 Bacteria 20281
44 Ga0070674_100033147 3300005356 Bacteria 3436
45 Ga0070673_100028669 3300005364 Bacteria 4143
46 Ga0070688_100012339 3300005365 Bacteria 4786
47 Ga0070659_100009523 3300005366 Bacteria 7138
48 Ga0070659_100086939 3300005366 Bacteria 2502
49 Ga0070667_100000223 3300005367 Bacteria 65543
50 Ga0070667_100007458 3300005367 Bacteria 9082
51 Ga0070667_100016968 3300005367 Bacteria 6027
52 Ga0070667_100070944 3300005367 Bacteria 2966
53 Ga0070667_100332217 3300005367 Bacteria 1373
54 Ga0070709_10161941 3300005434 Bacteria 1557
55 Ga0070709_10174314 3300005434 Bacteria 1505
56 Ga0070709_10259509 3300005434 Bacteria 1255
57 Ga0070714_100000002 3300005435 Bacteria 386673
58 Ga0070714_100001157 3300005435 Bacteria 18993
59 Ga0070714_100002560 3300005435 Bacteria 13392
60 Ga0070714_100069562 3300005435 Bacteria 3041
61 Ga0070714_100183991 3300005435 Bacteria 1903
62 Ga0070713_100475504 3300005436 Bacteria 1176
63 Ga0070710_10001183 3300005437 Bacteria 12311
64 Ga0070710_10058120 3300005437 Bacteria 2193
65 Ga0070710_10058156 3300005437 Bacteria 2192
66 Ga0070701_10003260 3300005438 Bacteria 6388
67 Ga0070711_100000406 3300005439 Bacteria 22315
68 Ga0070711_100001458 3300005439 Bacteria 13004
69 Ga0070711_100179428 3300005439 Bacteria 1620
70 Ga0070705_100001938 3300005440 Bacteria 10609
71 Ga0070700_100001602 3300005441 Bacteria 11285
72 Ga0070700_100295886 3300005441 Bacteria 1179
73 Ga0070694_100009611 3300005444 Bacteria 5934
74 Ga0070663_100000482 3300005455 Bacteria 20982
75 Ga0070663_100013543 3300005455 Bacteria 5205
76 Ga0070663_100106913 3300005455 Bacteria 2097
77 Ga0070678_100000482 3300005456 Bacteria 19049
78 Ga0070678_100282215 3300005456 Bacteria 1405
79 Ga0070678_100339739 3300005456 Bacteria 1288
80 Ga0070662_100015443 3300005457 Bacteria 5115
81 Ga0070681_10036461 3300005458 Bacteria 4938
82 Ga0070681_10099073 3300005458 Bacteria 2861
83 Ga0068867_100000934 3300005459 Bacteria 19870
84 Ga0068867_100026719 3300005459 Bacteria 4146
85 Ga0070679_100008082 3300005530 Bacteria 9889
86 Ga0070679_100328067 3300005530 Bacteria 1479
87 Ga0070684_100110136 3300005535 Bacteria 2469
88 Ga0068853_100009617 3300005539 Bacteria 7791
89 Ga0068853_100105292 3300005539 Bacteria 2499
90 Ga0068853_100243795 3300005539 Bacteria 1648
91 Ga0070686_100166929 3300005544 Bacteria 1554
92 Ga0070696_100030928 3300005546 Bacteria 3666
93 Ga0070665_100005604 3300005548 Bacteria 12910
94 Ga0070665_100079456 3300005548 Bacteria 3285
95 Ga0070665_100225747 3300005548 Bacteria 1873
96 Ga0070704_100002252 3300005549 Bacteria 10770
97 Ga0068855_100086047 3300005563 Bacteria 3635
98 Ga0068855_100146959 3300005563 Bacteria 2682
99 Ga0068855_100448108 3300005563 Bacteria 1409
100 Ga0068855_100763640 3300005563 Bacteria 1030
101 Ga0070664_100073369 3300005564 Bacteria 2936
102 Ga0068857_100216013 3300005577 Bacteria 1750
103 Ga0068854_100009065 3300005578 Bacteria 6412
104 Ga0068854_100239728 3300005578 Bacteria 1443
105 Ga0068854_100311278 3300005578 Bacteria 1277
106 Ga0068854_100320542 3300005578 Bacteria 1259
107 Ga0068856_100070832 3300005614 Bacteria 3450
108 Ga0068856_100126969 3300005614 Bacteria 2554
109 Ga0068856_100130685 3300005614 Bacteria 2516
110 Ga0068856_100160997 3300005614 Bacteria 2255
111 Ga0068856_100251973 3300005614 Bacteria 1781
112 Ga0068856_100636810 3300005614 Bacteria 1087
113 Ga0070702_100004933 3300005615 Bacteria 6152
114 Ga0070702_100051015 3300005615 Bacteria 2366
115 Ga0068852_100008929 3300005616 Bacteria 7419
116 Ga0068852_100164332 3300005616 Bacteria 2075
117 Ga0068859_100000174 3300005617 Bacteria 62740
118 Ga0068859_100002361 3300005617 Bacteria 19217
119 Ga0068859_100266404 3300005617 Bacteria 1805
120 Ga0068866_10000543 3300005718 Bacteria 17242
121 Ga0068866_10278566 3300005718 Bacteria 1035
122 Ga0068861_100000669 3300005719 Bacteria 20400
123 Ga0068861_100092328 3300005719 Bacteria 2391
124 Ga0068861_100192641 3300005719 Bacteria 1705
125 Ga0068851_10046768 3300005834 Bacteria 2190
126 Ga0068863_100001502 3300005841 Bacteria 23086
127 Ga0068863_100013710 3300005841 Bacteria 7816
128 Ga0068863_100671027 3300005841 Bacteria 1029
129 Ga0068858_100019851 3300005842 Bacteria 6284
130 Ga0068858_100030525 3300005842 Bacteria 5005
131 Ga0068858_100123995 3300005842 Bacteria 2418
132 Ga0068858_100511308 3300005842 Bacteria 1161
133 Ga0068860_100000044 3300005843 Bacteria 225595
134 Ga0068860_100004988 3300005843 Bacteria 13522
135 Ga0068860_100007980 3300005843 Bacteria 10558
136 Ga0068860_100152545 3300005843 Bacteria 2225
137 Ga0068862_100000003 3300005844 Bacteria 369793
138 Ga0068862_100004477 3300005844 Bacteria 11776
139 Ga0068862_100046183 3300005844 Bacteria 3716
140 Ga0081455_10004103 3300005937 Bacteria 16483
141 Ga0081455_10004245 3300005937 Bacteria 16161
142 Ga0081455_10005680 3300005937 Bacteria 13614
143 Ga0081455_10017010 3300005937 Bacteria 6990
144 Ga0081455_10248051 3300005937 Bacteria 1304
145 Ga0081538_10079482 3300005981 Bacteria 1754
146 Ga0070717_10084392 3300006028 Bacteria 2672
147 Ga0070717_10148509 3300006028 Bacteria 2027
148 Ga0075365_10003069 3300006038 Bacteria 8479
149 Ga0075365_10015269 3300006038 Bacteria 4641
150 Ga0075365_10030422 3300006038 Bacteria 3458
151 Ga0075365_10033987 3300006038 Bacteria 3290
152 Ga0075365_10049787 3300006038 Bacteria 2761
153 Ga0075365_10108574 3300006038 Bacteria 1905
154 Ga0075363_100002096 3300006048 Bacteria 7991
155 Ga0075363_100002452 3300006048 Bacteria 7581
156 Ga0075363_100004795 3300006048 Bacteria 5965
157 Ga0075363_100005479 3300006048 Bacteria 5654
158 Ga0075363_100025102 3300006048 Bacteria 3036
159 Ga0075364_10003636 3300006051 Bacteria 8795
160 Ga0075364_10009652 3300006051 Bacteria 5798
161 Ga0075364_10030965 3300006051 Bacteria 3436
162 Ga0075364_10132179 3300006051 Bacteria 1676
163 Ga0070715_10146171 3300006163 Bacteria 1153
164 Ga0070716_100004348 3300006173 Bacteria 6762
165 Ga0070716_100005819 3300006173 Bacteria 5988
166 Ga0070712_100002733 3300006175 Bacteria 10893
167 Ga0070712_100021230 3300006175 Bacteria 4261
168 Ga0070712_100191344 3300006175 Bacteria 1601
169 Ga0075362_10010187 3300006177 Bacteria 3663
170 Ga0075367_10002207 3300006178 Bacteria 8785
171 Ga0075369_10005350 3300006186 Bacteria 4789
172 Ga0075369_10010120 3300006186 Bacteria 3683
173 Ga0075369_10061175 3300006186 Bacteria 1643
174 Ga0097621_100369856 3300006237 Bacteria 1279
175 Ga0075370_10005252 3300006353 Bacteria 6412
176 Ga0075370_10011670 3300006353 Bacteria 4623
177 Ga0075370_10014522 3300006353 Bacteria 4203
178 Ga0075370_10080733 3300006353 Bacteria 1869
179 Ga0068871_100448624 3300006358 Bacteria 1156
180 Ga0075428_100013479 3300006844 Bacteria 9098
181 Ga0075430_100031786 3300006846 Bacteria 4480
182 Ga0075431_100092085 3300006847 Bacteria 3129
183 Ga0068865_100000375 3300006881 Bacteria 24788
184 Ga0097620_100000174 3300006931 Bacteria 62740
185 Ga0097620_100002361 3300006931 Bacteria 19217
186 Ga0097620_100266375 3300006931 Bacteria 1805
187 Ga0097620_100926545 3300006931 Bacteria 955
188 Ga0075435_100558358 3300007076 Bacteria 992
189 Ga0105250_10043332 3300009092 Bacteria 1803
190 Ga0105240_10206316 3300009093 Bacteria 2300
191 Ga0105240_10707493 3300009093 Bacteria 1099
192 Ga0105245_10001215 3300009098 Bacteria 23288
193 Ga0105245_10013569 3300009098 Bacteria 7097
194 Ga0105245_10054329 3300009098 Bacteria 3597
195 Ga0105245_10098676 3300009098 Bacteria 2699
196 Ga0105247_10000006 3300009101 Bacteria 416061
197 Ga0105247_10001445 3300009101 Bacteria 17165
198 Ga0105247_10003264 3300009101 Bacteria 10634
199 Ga0105247_10061866 3300009101 Bacteria 2322
200 Ga0105247_10282773 3300009101 Bacteria 1145
201 Ga0114129_10152595 3300009147 Bacteria 3161
202 Ga0105243_10001235 3300009148 Bacteria 23033
203 Ga0105243_10278934 3300009148 Bacteria 1504
204 Ga0105243_10456623 3300009148 Bacteria 1200
205 Ga0105243_10629568 3300009148 Bacteria 1037
206 Ga0105241_10053111 3300009174 Bacteria 3097
207 Ga0105242_10019364 3300009176 Bacteria 5333
208 Ga0105242_10118330 3300009176 Bacteria 2269
209 Ga0105248_10000042 3300009177 Bacteria 167583
210 Ga0105248_10004628 3300009177 Bacteria 15218
211 Ga0105248_10130627 3300009177 Bacteria 2834
212 Ga0105237_10005606 3300009545 Bacteria 14149
213 Ga0105237_10030990 3300009545 Bacteria 5425
214 Ga0105237_10092580 3300009545 Bacteria 3012
215 Ga0105237_10095068 3300009545 Bacteria 2969
216 Ga0105237_10176345 3300009545 Bacteria 2137
217 Ga0105238_10095118 3300009551 Bacteria 2966
218 Ga0105238_10295694 3300009551 Bacteria 1602
219 Ga0105249_10000008 3300009553 Bacteria 341271
220 Ga0105249_10032703 3300009553 Bacteria 4706
221 Ga0105249_10068831 3300009553 Bacteria 3265
222 Ga0105249_10082444 3300009553 Bacteria 2992
223 Ga0099796_10059832 3300010159 Bacteria 1347
224 Ga0105239_10002249 3300010375 Bacteria 24678
225 Ga0105239_10158674 3300010375 Bacteria 2527
226 Ga0105246_10043905 3300011119 Bacteria 3035
227 Ga0105246_10496382 3300011119 Bacteria 1036
228 Ga0157370_10047047 3300013104 Bacteria 4136
229 Ga0157369_10027215 3300013105 Bacteria 6340
230 Ga0157369_10151735 3300013105 Bacteria 2449
231 Ga0157374_10077044 3300013296 Bacteria 3154
232 Ga0157374_10515138 3300013296 Bacteria 1202
233 Ga0157378_10004183 3300013297 Bacteria 12744
234 Ga0157378_10829066 3300013297 Bacteria 952
235 Ga0163162_10040329 3300013306 Bacteria 4669
236 Ga0163162_10055357 3300013306 Bacteria 3993
237 Ga0163162_10060455 3300013306 Bacteria 3824
238 Ga0157372_10006800 3300013307 Bacteria 12158
239 Ga0157375_10004087 3300013308 Bacteria 12650
240 Ga0157375_10159637 3300013308 Bacteria 2396
241 Ga0157375_10192559 3300013308 Bacteria 2194
242 Ga0163163_10026112 3300014325 Bacteria 5578
243 Ga0163163_10083220 3300014325 Bacteria 3205
244 Ga0163163_10122872 3300014325 Bacteria 2631
245 Ga0157380_10001110 3300014326 Bacteria 17350
246 Ga0157380_10494969 3300014326 Bacteria 1186
247 Ga0157377_10129611 3300014745 Bacteria 1539
248 Ga0157379_10050480 3300014968 Bacteria 3714
249 Ga0157379_10088164 3300014968 Bacteria 2782
250 Ga0157379_10168598 3300014968 Bacteria 1976
251 Ga0157379_10277181 3300014968 Bacteria 1526
252 Ga0157376_10242369 3300014969 Bacteria 1680
253 Ga0163161_10008820 3300017792 Bacteria 6970
254 Ga0163161_10064177 3300017792 Bacteria 2678
255 Ga0163161_10100607 3300017792 Bacteria 2151
256 Ga0197907_10431376 3300020069 Bacteria 1137
257 Ga0197907_10461530 3300020069 Bacteria 2385
258 Ga0197907_10466403 3300020069 Bacteria 2604
259 Ga0206356_10444711 3300020070 Bacteria 1508
260 Ga0206356_11020425 3300020070 Bacteria 2406
261 Ga0206349_1164363 3300020075 Bacteria 1058
262 Ga0206351_10225639 3300020077 Bacteria 1557
263 Ga0206351_10437193 3300020077 Bacteria 1399
264 Ga0206350_10078532 3300020080 Bacteria 1209
265 Ga0206354_10468886 3300020081 Bacteria 2290
266 Ga0206353_10462189 3300020082 Bacteria 6229
267 Ga0206353_11702945 3300020082 Bacteria 3277
268 Ga0213873_10000053 3300021358 Bacteria 25736
269 Ga0213876_10002254 3300021384 Bacteria 11393
270 Ga0213876_10091830 3300021384 Bacteria 1608
271 Ga0213875_10005854 3300021388 Bacteria 6539
272 Ga0213875_10094498 3300021388 Bacteria 1394
273 Ga0224712_10084439 3300022467 Bacteria 1317
274 Ga0209673_1008842 3300025273 Bacteria 4436
275 Ga0209673_1056658 3300025273 Bacteria 1002
276 Ga0209051_1000075 3300025303 Bacteria 205011
277 Ga0209051_1001162 3300025303 Bacteria 23957
278 Ga0209051_1002980 3300025303 Bacteria 11528
279 Ga0209051_1011514 3300025303 Bacteria 4359
280 Ga0209051_1031448 3300025303 Bacteria 2042
281 Ga0209051_1037337 3300025303 Bacteria 1782
282 Ga0207696_1019145 3300025711 Bacteria 2235
283 Ga0207692_10002301 3300025898 Bacteria 7329
284 Ga0207692_10004267 3300025898 Bacteria 5651
285 Ga0207692_10112640 3300025898 Bacteria 1511
286 Ga0207642_10001569 3300025899 Bacteria 7038
287 Ga0207710_10000025 3300025900 Bacteria 314658
288 Ga0207710_10001933 3300025900 Bacteria 9920
289 Ga0207710_10004333 3300025900 Bacteria 6209
290 Ga0207688_10000454 3300025901 Bacteria 19450
291 Ga0207688_10010480 3300025901 Bacteria 5043
292 Ga0207680_10009035 3300025903 Bacteria 4923
293 Ga0207647_10086873 3300025904 Bacteria 1869
294 Ga0207647_10103716 3300025904 Bacteria 1686
295 Ga0207699_10012267 3300025906 Bacteria 4356
296 Ga0207699_10076787 3300025906 Bacteria 2059
297 Ga0207699_10086856 3300025906 Bacteria 1954
298 Ga0207645_10030401 3300025907 Bacteria 3479
299 Ga0207705_10116186 3300025909 Bacteria 1981
300 Ga0207705_10239754 3300025909 Bacteria 1381
301 Ga0207654_10037937 3300025911 Bacteria 2700
302 Ga0207707_10019173 3300025912 Bacteria 5971
303 Ga0207707_10091566 3300025912 Bacteria 2657
304 Ga0207695_10137555 3300025913 Bacteria 2394
305 Ga0207671_10010925 3300025914 Bacteria 7441
306 Ga0207671_10027259 3300025914 Bacteria 4271
307 Ga0207671_10068019 3300025914 Bacteria 2653
308 Ga0207671_10131627 3300025914 Bacteria 1920
309 Ga0207693_10001043 3300025915 Bacteria 24769
310 Ga0207693_10002779 3300025915 Bacteria 15146
311 Ga0207693_10020056 3300025915 Bacteria 5317
312 Ga0207693_10286712 3300025915 Bacteria 1290
313 Ga0207663_10008634 3300025916 Bacteria 5344
314 Ga0207663_10094500 3300025916 Bacteria 1992
315 Ga0207663_10107599 3300025916 Bacteria 1886
316 Ga0207663_10151550 3300025916 Bacteria 1627
317 Ga0207657_10109507 3300025919 Bacteria 2282
318 Ga0207652_10021282 3300025921 Bacteria 5352
319 Ga0207652_10445336 3300025921 Bacteria 1168
320 Ga0207681_10003522 3300025923 Bacteria 9749
321 Ga0207681_10345128 3300025923 Bacteria 1190
322 Ga0207687_10010540 3300025927 Bacteria 6040
323 Ga0207687_10026990 3300025927 Bacteria 3849
324 Ga0207687_10137715 3300025927 Bacteria 1848
325 Ga0207664_10000038 3300025929 Bacteria 166264
326 Ga0207664_10000615 3300025929 Bacteria 24687
327 Ga0207664_10012150 3300025929 Bacteria 6152
328 Ga0207664_10091950 3300025929 Bacteria 2489
329 Ga0207644_10002811 3300025931 Bacteria 11222
330 Ga0207644_10095252 3300025931 Bacteria 2226
331 Ga0207644_10142158 3300025931 Bacteria 1849
332 Ga0207690_10183572 3300025932 Bacteria 1577
333 Ga0207690_10304902 3300025932 Bacteria 1247
334 Ga0207706_10013244 3300025933 Bacteria 7503
335 Ga0207706_10054732 3300025933 Bacteria 3520
336 Ga0207686_10020172 3300025934 Bacteria 3804
337 Ga0207709_10006901 3300025935 Bacteria 6355
338 Ga0207669_10003546 3300025937 Bacteria 6759
339 Ga0207704_10000983 3300025938 Bacteria 12653
340 Ga0207665_10002392 3300025939 Bacteria 12678
341 Ga0207665_10004004 3300025939 Bacteria 9845
342 Ga0207665_10058523 3300025939 Bacteria 2606
343 Ga0207691_10053293 3300025940 Bacteria 3693
344 Ga0207711_10000697 3300025941 Bacteria 33164
345 Ga0207711_10004749 3300025941 Bacteria 11536
346 Ga0207689_10009086 3300025942 Bacteria 8604
347 Ga0207689_10059640 3300025942 Bacteria 3138
348 Ga0207661_10082312 3300025944 Bacteria 2661
349 Ga0207661_10195571 3300025944 Bacteria 1775
350 Ga0207667_10087359 3300025949 Bacteria 3225
351 Ga0207667_10150114 3300025949 Bacteria 2399
352 Ga0207667_10422068 3300025949 Bacteria 1357
353 Ga0207712_10000011 3300025961 Bacteria 412321
354 Ga0207712_10008487 3300025961 Bacteria 6496
355 Ga0207712_10309105 3300025961 Bacteria 1300
356 Ga0207668_10005691 3300025972 Bacteria 7339
357 Ga0207668_10007628 3300025972 Bacteria 6442
358 Ga0207668_10417182 3300025972 Bacteria 1138
359 Ga0207640_10008708 3300025981 Bacteria 5645
360 Ga0207640_10472180 3300025981 Bacteria 1038
361 Ga0207658_10000307 3300025986 Bacteria 50415
362 Ga0207658_10000423 3300025986 Bacteria 40097
363 Ga0207658_10002974 3300025986 Bacteria 12126
364 Ga0207658_10019255 3300025986 Bacteria 4719
365 Ga0207677_10006124 3300026023 Bacteria 6569
366 Ga0207677_10262562 3300026023 Bacteria 1408
367 Ga0207677_10381973 3300026023 Bacteria 1189
368 Ga0207703_10005256 3300026035 Bacteria 10443
369 Ga0207703_10006939 3300026035 Bacteria 9013
370 Ga0207703_10134024 3300026035 Bacteria 2142
371 Ga0207639_10005060 3300026041 Bacteria 8881
372 Ga0207639_10016358 3300026041 Bacteria 5246
373 Ga0207678_10005592 3300026067 Bacteria 11237
374 Ga0207678_10021422 3300026067 Bacteria 5667
375 Ga0207678_10024812 3300026067 Bacteria 5234
376 Ga0207678_10107313 3300026067 Bacteria 2382
377 Ga0207678_10126879 3300026067 Bacteria 2176
378 Ga0207678_10565113 3300026067 Bacteria 996
379 Ga0207708_10001649 3300026075 Bacteria 16609
380 Ga0207708_10163519 3300026075 Bacteria 1759
381 Ga0207708_10165363 3300026075 Bacteria 1749
382 Ga0207702_10074608 3300026078 Bacteria 2928
383 Ga0207702_10099159 3300026078 Bacteria 2568
384 Ga0207702_10143448 3300026078 Bacteria 2164
385 Ga0207702_10274305 3300026078 Bacteria 1592
386 Ga0207702_10533737 3300026078 Bacteria 1146
387 Ga0207641_10005680 3300026088 Bacteria 10618
388 Ga0207641_10058734 3300026088 Bacteria 3274
389 Ga0207641_10365635 3300026088 Bacteria 1378
390 Ga0207648_10001183 3300026089 Bacteria 29207
391 Ga0207648_10021818 3300026089 Bacteria 5753
392 Ga0207648_10199794 3300026089 Bacteria 1773
393 Ga0207676_10114078 3300026095 Bacteria 2266
394 Ga0207676_10142511 3300026095 Bacteria 2054
395 Ga0207674_10123151 3300026116 Bacteria 2559
396 Ga0207674_10164449 3300026116 Bacteria 2173
397 Ga0207675_100001210 3300026118 Bacteria 25719
398 Ga0207675_100277085 3300026118 Bacteria 1629
399 Ga0207683_10000829 3300026121 Bacteria 28292
400 Ga0207698_10006356 3300026142 Bacteria 7362
401 Ga0207698_10148048 3300026142 Bacteria 2033
402 Ga0268266_10004771 3300028379 Bacteria 12890
403 Ga0268266_10009241 3300028379 Bacteria 8695
404 Ga0268266_10010048 3300028379 Bacteria 8298
405 Ga0268266_10064183 3300028379 Bacteria 3172
406 Ga0268265_10000010 3300028380 Bacteria 370129
407 Ga0268265_10010559 3300028380 Bacteria 6236
408 Ga0268265_10284382 3300028380 Bacteria 1481
409 Ga0268264_10000007 3300028381 Bacteria 815790
410 Ga0268264_10030433 3300028381 Bacteria 4424
411 Ga0307515_10033617 3300028794 Bacteria 8431
412 Ga0265338_10028604 3300028800 Bacteria 5553
413 Ga0265762_1018837 3300030760 Bacteria 1261
414 Ga0265327_10000071 3300031251 Bacteria 215502
415 Ga0265327_10001438 3300031251 Bacteria 30041
416 Ga0265327_10026106 3300031251 Bacteria 3390
417 Ga0307405_10093827 3300031731 Bacteria 1995
418 Ga0307410_10003168 3300031852 Bacteria 8188
419 Ga0307410_10064569 3300031852 Bacteria 2516
420 Ga0307406_10014618 3300031901 Bacteria 4519
421 Ga0307409_100105986 3300031995 Bacteria 2345
422 Ga0307416_100030526 3300032002 Bacteria 4045
423 Ga0307411_10203895 3300032005 Bacteria 1521
424 Ga0316053_101122 3300032120 Bacteria 1366
425 Ga0307510_10036189 3300033180 Bacteria 5497
426 Ga0373926_0003619 3300035083 Bacteria 5016
427 Ga0373944_0004838 3300035089 Bacteria 3526
428 Ga0373923_0087016 3300035111 Bacteria 1362
429 Ga0373936_0021481 3300035113 Bacteria 2510
430 Ga0373945_0009190 3300035116 Bacteria 3234
431 Ga0373943_0003085 3300035170 Bacteria 7565
432 Ga0373946_0000053 3300035171 Bacteria 30553
433 Ga0373955_0203515 3300035172 Bacteria 1179
434 Ga0373962_0013580 3300035242 Bacteria 2066
435 Ga0373962_0047212 3300035242 Bacteria 1231
436 Ga0373924_0012473 3300035410 Bacteria 3176
437 Ga0373931_0033289 3300035691 Bacteria 2670
438 Ga0373935_0230121 3300035692 Bacteria 1290
439 Ga0373927_0010035 3300035695 Bacteria 6342
440 Ga0373947_0004259 3300035725 Bacteria 8396
441 Ga0373947_0180197 3300035725 Bacteria 1375
442 Ga0373937_0071237 3300036401 Bacteria 3206
443 Ga0316584_0087933 3300036712 Bacteria 2326
444 Ga0373925_0011700 3300037068 Bacteria 6345
445 Ga0395900_0013323 3300037418 Bacteria 8408
446 Ga0395900_0132193 3300037418 Bacteria 2557
447 Ga0395898_0180447 3300037466 Bacteria 2018
448 Ga0395898_0201488 3300037466 Bacteria 1900
449 Ga0395905_0035991 3300037471 Bacteria 4649
450 Ga0436364_0196904 3300037853 Bacteria 6966
451 Ga0436364_0865025 3300037853 Bacteria 3966
452 Ga0436364_0935155 3300037853 Bacteria 14870
453 Ga0436364_1280826 3300037853 Bacteria 93394
454 Ga0395901_0008725 3300038443 Bacteria 10245
455 Ga0395901_0603169 3300038443 Bacteria 1107
456 Ga0436365_0351846 3300039437 Bacteria 2162
457 Ga0436365_0544792 3300039437 Bacteria 2661
458 Ga0436365_0659401 3300039437 Bacteria 13791
459 Ga0436365_1273418 3300039437 Bacteria 2401
460 Ga0436365_1892189 3300039437 Bacteria 2881
461 Ga0436365_1921824 3300039437 Bacteria 7818
462 Ga0436360_0211352 3300039438 Bacteria 867
463 Ga0436362_0957350 3300039453 Bacteria 35880
464 Ga0439461_0000802 3300041410 Bacteria 4622
465 Ga0439465_0001407 3300041413 Bacteria 7777
466 Ga0439465_0030469 3300041413 Bacteria 1716
467 Ga0451797_0832390 3300041453 Bacteria 1587
468 Ga0451795_1090199 3300041456 Bacteria 2566
469 Ga0451807_1411141 3300041486 Bacteria 1625
470 Ga0451853_2011291 3300041512 Bacteria 1745
471 Ga0439431_0004643 3300041997 Bacteria 3019
472 Ga0439445_0013920 3300042004 Bacteria 1953
473 Ga0439445_0023198 3300042004 Bacteria 1569
474 Ga0439448_0001366 3300042005 Bacteria 6272
475 Ga0439434_0004809 3300042435 Bacteria 3953
476 Ga0466969_0001933 3300044656 Bacteria 11068
477 Ga0466969_0012565 3300044656 Bacteria 4462
478 Ga0466969_0021405 3300044656 Bacteria 3344
479 Ga0466972_0015724 3300044658 Bacteria 3783
480 Ga0466972_0016495 3300044658 Bacteria 3693
481 Ga0466972_0028126 3300044658 Bacteria 2776
482 Ga0466972_0031616 3300044658 Bacteria 2602
483 Ga0466972_0036399 3300044658 Bacteria 2408
484 Ga0466972_0050899 3300044658 Bacteria 1999
485 Ga0466972_0092498 3300044658 Bacteria 1434
486 Ga0466965_0001599 3300044683 Bacteria 9244
487 Ga0466965_0012158 3300044683 Bacteria 4044
488 Ga0466965_0013330 3300044683 Bacteria 3878
489 Ga0466965_0167925 3300044683 Bacteria 1153
490 Ga0466966_0002540 3300044684 Bacteria 11954
491 Ga0466966_0004759 3300044684 Bacteria 8936
492 Ga0466966_0005803 3300044684 Bacteria 8140
493 Ga0466966_0008557 3300044684 Bacteria 6774
494 Ga0466966_0010077 3300044684 Bacteria 6267
495 Ga0466966_0016972 3300044684 Bacteria 4811
496 Ga0466966_0161773 3300044684 Bacteria 1363
497 Ga0466961_0002569 3300044693 Bacteria 11249
498 Ga0466961_0013055 3300044693 Bacteria 5314
499 Ga0466961_0018419 3300044693 Bacteria 4491
500 Ga0466961_0020131 3300044693 Bacteria 4295
501 Ga0466961_0024042 3300044693 Bacteria 3920
502 Ga0466961_0026668 3300044693 Bacteria 3714
503 Ga0466961_0030983 3300044693 Bacteria 3438
504 Ga0466961_0035710 3300044693 Bacteria 3191
505 Ga0466961_0081681 3300044693 Bacteria 2045
506 Ga0466961_0175209 3300044693 Bacteria 1333
507 Ga0466961_0226963 3300044693 Bacteria 1150
508 Ga0466961_0322912 3300044693 Bacteria 941
509 Ga0466963_0004806 3300044694 Bacteria 7874
510 Ga0466963_0012034 3300044694 Bacteria 5285
511 Ga0466963_0017877 3300044694 Bacteria 4424
512 Ga0466963_0040300 3300044694 Bacteria 3061
513 Ga0466963_0052345 3300044694 Bacteria 2709
514 Ga0466963_0067353 3300044694 Bacteria 2403
515 Ga0466963_0190697 3300044694 Bacteria 1432
516 Ga0466964_0036102 3300044706 Bacteria 1980
517 Ga0466964_0041325 3300044706 Bacteria 1865
518 Ga0466964_0070693 3300044706 Bacteria 1475
519 Ga0466964_0099774 3300044706 Bacteria 1278
520 Ga0466971_0002929 3300044719 Bacteria 7245
521 Ga0466971_0022776 3300044719 Bacteria 2791
522 Ga0466971_0030942 3300044719 Bacteria 2396
523 Ga0466971_0031477 3300044719 Bacteria 2375
524 Ga0466971_0056342 3300044719 Bacteria 1773
525 Ga0466968_0000903 3300044735 Bacteria 10453
526 Ga0466968_0003185 3300044735 Bacteria 6051
527 Ga0466968_0019573 3300044735 Bacteria 2725
528 Ga0466968_0098941 3300044735 Bacteria 1300
529 Ga0466970_0004663 3300044765 Bacteria 6766
530 Ga0466970_0005871 3300044765 Bacteria 6113
531 Ga0466970_0056456 3300044765 Bacteria 2098
532 Ga0466970_0093687 3300044765 Bacteria 1632
533 Ga0466957_0001407 3300044842 Bacteria 12539
534 Ga0466957_0010080 3300044842 Bacteria 5407
535 Ga0466957_0031071 3300044842 Bacteria 3190
536 Ga0466957_0059961 3300044842 Bacteria 2333
537 Ga0466957_0224054 3300044842 Bacteria 1242
538 Ga0466957_0280111 3300044842 Bacteria 1116
539 Ga0466957_0398864 3300044842 Bacteria 940
540 Ga0466960_0000406 3300044901 Bacteria 14770
541 Ga0466960_0024183 3300044901 Bacteria 2738
542 Ga0466960_0109314 3300044901 Bacteria 1434
543 Ga0466960_0110377 3300044901 Bacteria 1428
544 Ga0466960_0175950 3300044901 Bacteria 1157
545 Ga0466960_0227074 3300044901 Bacteria 1029
546 Ga0466959_0002496 3300045049 Bacteria 11779
547 Ga0466959_0008449 3300045049 Bacteria 7281
548 Ga0466959_0018047 3300045049 Bacteria 5177
549 Ga0466959_0029100 3300045049 Bacteria 4093
550 Ga0466959_0042249 3300045049 Bacteria 3362
551 Ga0466959_0080707 3300045049 Bacteria 2344
552 Ga0466959_0116470 3300045049 Bacteria 1903
553 Ga0466959_0144046 3300045049 Bacteria 1682
554 Ga0466958_0004306 3300045836 Bacteria 7497
555 Ga0466958_0006150 3300045836 Bacteria 6509
556 Ga0466958_0007246 3300045836 Bacteria 6084
557 Ga0466958_0011621 3300045836 Bacteria 4962
558 Ga0466958_0045296 3300045836 Bacteria 2652
559 Ga0466958_0104738 3300045836 Bacteria 1762
560 Ga0466958_0170694 3300045836 Bacteria 1377
561 Ga0466967_0005450 3300045976 Bacteria 8822
562 Ga0466967_0022567 3300045976 Bacteria 5139
563 Ga0466967_0024674 3300045976 Bacteria 4947
564 Ga0466967_0029889 3300045976 Bacteria 4566
565 Ga0466967_0038457 3300045976 Bacteria 4104
566 Ga0466967_0038987 3300045976 Bacteria 4080
567 Ga0466967_0068438 3300045976 Bacteria 3170
568 Ga0466967_0123648 3300045976 Bacteria 2394
569 Ga0466967_0129735 3300045976 Bacteria 2339
570 Ga0466967_0427921 3300045976 Bacteria 1291
571 Ga0466967_0524830 3300045976 Bacteria 1164
572 Ga0495629_0006511 3300046459 Bacteria 8654
573 Ga0495629_0092021 3300046459 Bacteria 2117
574 Ga0495638_0001150 3300046460 Bacteria 25489
575 Ga0495638_0014705 3300046460 Bacteria 5279
576 Ga0495641_0017740 3300046461 Bacteria 3697
577 Ga0495651_0056525 3300046462 Bacteria 3014
578 Ga0495651_0246885 3300046462 Bacteria 1221
579 Ga0495653_0012397 3300046463 Bacteria 6960
580 Ga0495662_0019069 3300046476 Bacteria 3319
581 Ga0495664_0003023 3300046477 Bacteria 9104
582 Ga0495618_0117307 3300046514 Bacteria 1704
583 Ga0495630_0067420 3300046517 Bacteria 2690
584 Ga0495648_0109144 3300046524 Bacteria 1509
585 Ga0495652_0062008 3300046529 Bacteria 3154
586 Ga0495665_0034722 3300046531 Bacteria 2697
587 Ga0495640_0053963 3300046533 Bacteria 2755
588 Ga0495667_0166393 3300046559 Bacteria 1417
589 Ga0495625_0203837 3300046660 Bacteria 1304
590 Ga0495635_0041152 3300046663 Bacteria 3192
591 Ga0495657_0174821 3300046675 Bacteria 1321
592 Ga0495599_0047405 3300046678 Bacteria 2693
593 Ga0495646_0069644 3300046680 Bacteria 2075
594 Ga0495624_0014151 3300046690 Bacteria 5422
595 Ga0495624_0106835 3300046690 Bacteria 1722
596 Ga0495600_0041629 3300046809 Bacteria 2994
597 Ga0495581_0180806 3300047315 Bacteria 1233
598 Ga0495674_0011031 3300047319 Bacteria 8532
599 Ga0495672_0034340 3300047320 Bacteria 3135
600 Ga0495672_0140392 3300047320 Bacteria 1262
601 Ga0495672_0158864 3300047320 Bacteria 1164
602 Ga0495676_0048986 3300047321 Bacteria 3401
603 Ga0495673_0004361 3300047469 Bacteria 8882
604 Ga0495673_0129766 3300047469 Bacteria 991
605 Ga0495684_0001345 3300047471 Bacteria 19793
606 Ga0495686_0002871 3300047472 Bacteria 15491
607 Ga0495593_0016678 3300047673 Bacteria 4140
608 Ga0495593_0110988 3300047673 Bacteria 1400
609 Ga0495626_0064966 3300048091 Bacteria 1652
610 Ga0496100_0000092 3300048903 Bacteria 50831
611 Ga0496100_0008810 3300048903 Bacteria 5643
612 Ga0496100_0011220 3300048903 Bacteria 5095
613 Ga0496100_0063343 3300048903 Bacteria 2443
614 Ga0496101_0000018 3300048904 Bacteria 236102
615 Ga0496101_0000019 3300048904 Bacteria 220382
616 Ga0496101_0000622 3300048904 Bacteria 21624
617 Ga0496101_0007107 3300048904 Bacteria 7239
618 Ga0496101_0037201 3300048904 Bacteria 3451
619 Ga0496101_0075063 3300048904 Bacteria 2488
620 Ga0496101_0087236 3300048904 Bacteria 2316
621 Ga0496101_0134854 3300048904 Bacteria 1878
622 Ga0496101_0157541 3300048904 Bacteria 1740
623 Ga0496101_0229061 3300048904 Bacteria 1444
624 Ga0496101_0393210 3300048904 Bacteria 1091
625 Ga0496102_0000007 3300048905 Bacteria 417224
626 Ga0496102_0000060 3300048905 Bacteria 167774
627 Ga0496102_0000474 3300048905 Bacteria 44502
628 Ga0496102_0011349 3300048905 Bacteria 7675
629 Ga0496102_0022101 3300048905 Bacteria 5635
630 Ga0496102_0040067 3300048905 Bacteria 4236
631 Ga0496102_0073913 3300048905 Bacteria 3133
632 Ga0496102_0129113 3300048905 Bacteria 2364
633 Ga0496102_0231337 3300048905 Bacteria 1743
634 Ga0496102_0246343 3300048905 Bacteria 1685
635 Ga0496102_0534102 3300048905 Bacteria 1095
636 Ga0496103_0000013 3300048906 Bacteria 297928
637 Ga0496103_0000500 3300048906 Bacteria 32364
638 Ga0496103_0000976 3300048906 Bacteria 20250
639 Ga0496103_0002674 3300048906 Bacteria 11148
640 Ga0496103_0009275 3300048906 Bacteria 5830
641 Ga0496103_0072454 3300048906 Bacteria 2158
642 Ga0496103_0136342 3300048906 Bacteria 1568
643 Ga0496104_0009915 3300048907 Bacteria 8505
644 Ga0496104_0013456 3300048907 Bacteria 7372
645 Ga0496104_0016581 3300048907 Bacteria 6694
646 Ga0496104_0026535 3300048907 Bacteria 5351
647 Ga0496104_0078872 3300048907 Bacteria 3138
648 Ga0496104_0178544 3300048907 Bacteria 2033
649 Ga0496104_0204092 3300048907 Bacteria 1888
650 Ga0496104_0429255 3300048907 Bacteria 1233
651 Ga0496104_0531779 3300048907 Bacteria 1087
652 Ga0496104_0634215 3300048907 Bacteria 978
653 Ga0496104_0753334 3300048907 Bacteria 881
654 Ga0496105_0012622 3300048908 Bacteria 6691
655 Ga0496105_0039766 3300048908 Bacteria 3877
656 Ga0496105_0049958 3300048908 Bacteria 3455
657 Ga0496105_0063595 3300048908 Bacteria 3044
658 Ga0496105_0083314 3300048908 Bacteria 2641
659 Ga0496105_0291336 3300048908 Bacteria 1314
660 Ga0496106_0002072 3300048909 Bacteria 15020
661 Ga0496106_0004090 3300048909 Bacteria 10874
662 Ga0496106_0008621 3300048909 Bacteria 7545
663 Ga0496106_0022637 3300048909 Bacteria 4670
664 Ga0496106_0338855 3300048909 Bacteria 1207
665 Ga0496106_0465129 3300048909 Bacteria 1016
666 Ga0496107_0000616 3300048910 Bacteria 19928
667 Ga0496107_0001625 3300048910 Bacteria 14005
668 Ga0496107_0011269 3300048910 Bacteria 6222
669 Ga0496107_0013411 3300048910 Bacteria 5728
670 Ga0496107_0123542 3300048910 Bacteria 1907
671 Ga0496108_0007756 3300048911 Bacteria 8694
672 Ga0496108_0037091 3300048911 Bacteria 4059
673 Ga0496108_0042961 3300048911 Bacteria 3775
674 Ga0496108_0051664 3300048911 Bacteria 3444
675 Ga0496108_0108354 3300048911 Bacteria 2373
676 Ga0496108_0348425 3300048911 Bacteria 1292
677 Ga0496108_0388407 3300048911 Bacteria 1219
678 Ga0496109_0001095 3300048912 Bacteria 22432
679 Ga0496109_0002261 3300048912 Bacteria 16004
680 Ga0496109_0030624 3300048912 Bacteria 4823
681 Ga0496109_0089867 3300048912 Bacteria 2840
682 Ga0496109_0113276 3300048912 Bacteria 2523
683 Ga0496109_0174685 3300048912 Bacteria 2016
684 Ga0496109_0284980 3300048912 Bacteria 1557
685 Ga0496109_0416274 3300048912 Bacteria 1270
686 Ga0496110_0006864 3300048913 Bacteria 9049
687 Ga0496110_0090896 3300048913 Bacteria 2730
688 Ga0496110_0103698 3300048913 Bacteria 2551
689 Ga0496110_0179896 3300048913 Bacteria 1920
690 Ga0496110_0310557 3300048913 Bacteria 1436
691 Ga0496110_0390614 3300048913 Bacteria 1268
692 Ga0496111_0020815 3300048914 Bacteria 4573
693 Ga0496111_0098484 3300048914 Bacteria 2147
694 Ga0496111_0183760 3300048914 Bacteria 1554
695 Ga0496112_0013714 3300048915 Bacteria 7492
696 Ga0496112_0014578 3300048915 Bacteria 7302
697 Ga0496112_0014985 3300048915 Bacteria 7216
698 Ga0496112_0089920 3300048915 Bacteria 3039
699 Ga0496112_0211828 3300048915 Bacteria 1895
700 Ga0496112_0238183 3300048915 Bacteria 1773
701 Ga0496112_0311132 3300048915 Bacteria 1520
702 Ga0496112_0755497 3300048915 Bacteria 898
703 Ga0496113_0010272 3300048916 Bacteria 6185
704 Ga0496113_0143688 3300048916 Bacteria 1879
705 Ga0496113_0247628 3300048916 Bacteria 1422
706 Ga0496113_0406662 3300048916 Bacteria 1093
707 Ga0496113_0534310 3300048916 Bacteria 941
708 Ga0496113_0539744 3300048916 Bacteria 936
709 Ga0496113_0634238 3300048916 Bacteria 855
710 Ga0496114_0000914 3300048917 Bacteria 22111
711 Ga0496114_0002275 3300048917 Bacteria 14629
712 Ga0496114_0003938 3300048917 Bacteria 11449
713 Ga0496114_0013695 3300048917 Bacteria 6502
714 Ga0496114_0018819 3300048917 Bacteria 5590
715 Ga0496114_0131197 3300048917 Bacteria 2164
716 Ga0496114_0164436 3300048917 Bacteria 1931
717 Ga0496114_0367586 3300048917 Bacteria 1273
718 Ga0496114_0397670 3300048917 Bacteria 1220
719 Ga0496115_0001526 3300048918 Bacteria 16636
720 Ga0496115_0004170 3300048918 Bacteria 10437
721 Ga0496115_0070134 3300048918 Bacteria 2841
722 Ga0496115_0242321 3300048918 Bacteria 1486
723 Ga0496116_0000033 3300048919 Bacteria 418191
724 Ga0496116_0011976 3300048919 Bacteria 7124
725 Ga0496116_0041798 3300048919 Bacteria 3141
726 Ga0496117_0000025 3300048920 Bacteria 418106
727 Ga0496117_0002026 3300048920 Bacteria 26844
728 Ga0496117_0015208 3300048920 Bacteria 6580
729 Ga0496118_0000023 3300048921 Bacteria 418106
730 Ga0496118_0001179 3300048921 Bacteria 40343
731 Ga0496118_0001792 3300048921 Bacteria 31016
732 Ga0496118_0007091 3300048921 Bacteria 12029
733 Ga0496118_0012867 3300048921 Bacteria 7975
734 Ga0496118_0144793 3300048921 Bacteria 1498
735 Ga0496119_0000403 3300048922 Bacteria 59313
736 Ga0496119_0001193 3300048922 Bacteria 32523
737 Ga0496119_0008097 3300048922 Bacteria 9316
738 Ga0496119_0013630 3300048922 Bacteria 6452
739 Ga0496119_0015822 3300048922 Bacteria 5778
740 Ga0496120_0000798 3300048923 Bacteria 45360
741 Ga0496120_0004413 3300048923 Bacteria 11807
742 Ga0496120_0009640 3300048923 Bacteria 6820
743 Ga0496120_0033976 3300048923 Bacteria 3059
744 Ga0496120_0067811 3300048923 Bacteria 1970
745 Ga0496120_0124555 3300048923 Bacteria 1328
746 Ga0496121_0000023 3300048924 Bacteria 463448
747 Ga0496121_0000039 3300048924 Bacteria 351444
748 Ga0496121_0023668 3300048924 Bacteria 5904
749 Ga0496121_0067014 3300048924 Bacteria 2911
750 Ga0496122_0000164 3300048925 Bacteria 158055
751 Ga0496122_0029305 3300048925 Bacteria 4645
752 Ga0496123_0010993 3300048926 Bacteria 7910
753 Ga0496124_0000014 3300048927 Bacteria 463448
754 Ga0496125_0000020 3300048928 Bacteria 463448
755 Ga0496125_0030353 3300048928 Bacteria 4837
756 Ga0496125_0031601 3300048928 Bacteria 4715
757 Ga0496126_0000023 3300048929 Bacteria 463448
758 Ga0496126_0000405 3300048929 Bacteria 87676
759 Ga0496126_0002407 3300048929 Bacteria 25404
760 Ga0496126_0007878 3300048929 Bacteria 11601
761 Ga0496126_0008248 3300048929 Bacteria 11251
762 Ga0496126_0016663 3300048929 Bacteria 7343
763 Ga0496126_0357052 3300048929 Bacteria 1194
764 Ga0501031_0063699 3300049568 Bacteria 2401
765 Ga0501032_0001368 3300049569 Bacteria 19347
766 Ga0501032_0005359 3300049569 Bacteria 9544
767 Ga0501032_0008865 3300049569 Bacteria 7313
768 Ga0501032_0042454 3300049569 Bacteria 3084
769 Ga0501032_0063533 3300049569 Bacteria 2472
770 Ga0501033_0000974 3300049570 Bacteria 25983
771 Ga0501034_0003976 3300049571 Bacteria 16614
772 Ga0501034_0004481 3300049571 Bacteria 15524
773 Ga0501034_0075669 3300049571 Bacteria 3373
774 Ga0501034_0124760 3300049571 Bacteria 2560
775 Ga0501036_0003363 3300049572 Bacteria 12779
776 Ga0501036_0013974 3300049572 Bacteria 6675
777 Ga0501036_0028655 3300049572 Bacteria 4706
778 Ga0501036_0139970 3300049572 Bacteria 2042
779 Ga0501036_0420429 3300049572 Bacteria 1114
780 Ga0501036_0443444 3300049572 Bacteria 1082
781 Ga0501037_0000490 3300049573 Bacteria 32020
782 Ga0501037_0003686 3300049573 Bacteria 11117
783 Ga0501037_0004291 3300049573 Bacteria 10343
784 Ga0501037_0016194 3300049573 Bacteria 5486
785 Ga0501038_0001165 3300049574 Bacteria 23870
786 Ga0501038_0001252 3300049574 Bacteria 23042
787 Ga0501038_0003596 3300049574 Bacteria 14425
788 Ga0501039_0000463 3300049575 Bacteria 29494
789 Ga0501039_0367480 3300049575 Bacteria 1130
790 Ga0501042_0089527 3300049578 Bacteria 2208
791 Ga0501043_0000729 3300049579 Bacteria 29184
792 Ga0501043_0006491 3300049579 Bacteria 9390
793 Ga0501043_0187159 3300049579 Bacteria 1611
794 Ga0501043_0194675 3300049579 Bacteria 1575
795 Ga0501046_0001843 3300049580 Bacteria 20194
796 Ga0501046_0016932 3300049580 Bacteria 6097
797 Ga0501046_0025807 3300049580 Bacteria 4804
798 Ga0501046_0038720 3300049580 Bacteria 3824
799 Ga0501046_0049390 3300049580 Bacteria 3327
800 Ga0501047_0000015 3300049581 Bacteria 307932
801 Ga0501047_0003673 3300049581 Bacteria 14463
802 Ga0501047_0007286 3300049581 Bacteria 10399
803 Ga0501047_0012498 3300049581 Bacteria 8042
804 Ga0501047_0040856 3300049581 Bacteria 4484
805 Ga0501047_0236674 3300049581 Bacteria 1678
806 Ga0501048_0000047 3300049582 Bacteria 59594
807 Ga0501048_0001968 3300049582 Bacteria 15623
808 Ga0501048_0005999 3300049582 Bacteria 9252
809 Ga0501069_0078274 3300049585 Bacteria 1859
810 Ga0501069_0123393 3300049585 Bacteria 1480
811 Ga0501070_0003864 3300049586 Bacteria 12919
812 Ga0501070_0027988 3300049586 Bacteria 4727
813 Ga0501070_0063022 3300049586 Bacteria 3071
814 Ga0501070_0095382 3300049586 Bacteria 2461
815 Ga0501070_0405736 3300049586 Bacteria 1102
816 Ga0501073_0085517 3300049589 Bacteria 2194
817 Ga0501074_0403281 3300049590 Bacteria 970
818 Ga0501080_0024341 3300049742 Bacteria 5614
819 Ga0501080_0171591 3300049742 Bacteria 2000
820 Ga0501081_0072348 3300049743 Bacteria 2404
821 Ga0501035_0000417 3300049822 Bacteria 48134
822 Ga0501035_0000419 3300049822 Bacteria 47893
823 Ga0501035_0020795 3300049822 Bacteria 6030
824 Ga0501044_0001166 3300049823 Bacteria 31147
825 Ga0501044_0006425 3300049823 Bacteria 12987
826 Ga0501044_0034997 3300049823 Bacteria 5261
827 Ga0501044_0049016 3300049823 Bacteria 4360
828 Ga0501044_0078177 3300049823 Bacteria 3353
829 Ga0501044_0079321 3300049823 Bacteria 3326
830 Ga0501044_0084013 3300049823 Bacteria 3218
831 Ga0501044_0102047 3300049823 Bacteria 2885
832 Ga0501045_0240928 3300049824 Bacteria 1346
833 nmdc:mga03683_8444_c1 3300050489 Bacteria 3622
834 nmdc:mga03n38_11416_c1 3300050490 Bacteria 3309
835 nmdc:mga03n38_125105_c1 3300050490 Bacteria 1268
836 nmdc:mga03n38_19236_c1 3300050490 Bacteria 2710
837 nmdc:mga03n38_44005_c1 3300050490 Bacteria 1959
838 nmdc:mga03n38_6482_c1 3300050490 Bacteria 4070
839 nmdc:mga00v17_10237_c3 3300050491 Bacteria 2988
840 nmdc:mga00v17_1756_c1 3300050491 Bacteria 11255
841 nmdc:mga00v17_48471_c1 3300050491 Bacteria 2575
842 nmdc:mga00v17_5341_c1 3300050491 Bacteria 6765
843 nmdc:mga00v17_5641_c1 3300050491 Bacteria 6601
844 nmdc:mga0yw44_106282_c1 3300050492 Bacteria 1794
845 nmdc:mga0yw44_188315_c1 3300050492 Bacteria 1360
846 nmdc:mga0yw44_34565_c1 3300050492 Bacteria 2963
847 nmdc:mga0yw44_50295_c1 3300050492 Bacteria 2519
848 nmdc:mga0yw44_54505_c1 3300050492 Bacteria 2430
849 nmdc:mga0yw44_77538_c1 3300050492 Bacteria 2076
850 nmdc:mga0yw44_8431_c1 3300050492 Bacteria 5135
851 nmdc:mga06z11_17517_c1 3300050494 Bacteria 3253
852 nmdc:mga07m45_142308_c1 3300050496 Bacteria 1389
853 nmdc:mga07m45_29225_c1 3300050496 Bacteria 3046
854 nmdc:mga07m45_35585_c1 3300050496 Bacteria 2770
855 nmdc:mga07m45_46133_c1 3300050496 Bacteria 2447
856 nmdc:mga05p37_143120_c1 3300050507 Bacteria 2929
857 nmdc:mga0qj67_13681_c1 3300050509 Bacteria 6124
858 nmdc:mga06r32_246128_c1 3300050510 Bacteria 1775
859 nmdc:mga06r32_249_c2 3300050510 Bacteria 5552
860 nmdc:mga08y16_737197_c1 3300050511 Bacteria 982
861 nmdc:mga0sz30_10206_c1 3300050516 Bacteria 3594
862 nmdc:mga0sz30_190306_c1 3300050516 Bacteria 911
863 nmdc:mga0sz30_842_c2 3300050516 Bacteria 10759
864 Ga0495601_0171665 3300053077 Bacteria 1417
865 Ga0495601_0400952 3300053077 Bacteria 889
866 Ga0495612_0123642 3300053078 Bacteria 1114
867 Ga0495655_0020857 3300053083 Bacteria 1475
868 Ga0495619_0026105 3300053085 Bacteria 3757
869 Ga0495619_0174699 3300053085 Bacteria 1486
870 Ga0500643_002122 3300053087 Bacteria 10513
871 Ga0500556_0004430 3300053104 Bacteria 4000
872 Ga0500562_006369 3300053108 Bacteria 2977
873 Ga0500573_0060938 3300053140 Bacteria 2161
874 Ga0500627_0002578 3300053158 Bacteria 5411
875 Ga0500645_000054 3300053730 Bacteria 93914
876 Ga0501084_0242332 3300054114 Bacteria 1522
877 Ga0587070_014254 3300059491 Bacteria 1240
878 Ga0501082_0350044 3300060353 Bacteria 1288
879 Ga0466962_0000795 3300061719 Bacteria 14218
880 Ga0466962_0003314 3300061719 Bacteria 7651
881 Ga0466962_0006031 3300061719 Bacteria 5827
882 Ga0466962_0041679 3300061719 Bacteria 2196

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044694 Ga0466963_0190697 Ga0466963_0190697_775_1416 211
2 3300025904 Ga0207647_10086873 Ga0207647_100868733 234
3 3300037418 Ga0395900_0013323 Ga0395900_0013323_6383_7222 236
4 3300048907 Ga0496104_0531779 Ga0496104_0531779_228_974 237
5 3300048917 Ga0496114_0367586 Ga0496114_0367586_117_926 247
6 3300044658 Ga0466972_0050899 Ga0466972_0050899_559_1392 248
7 3300045976 Ga0466967_0038987 Ga0466967_0038987_1779_2612 248
8 3300044684 Ga0466966_0005803 Ga0466966_0005803_5736_6563 249
9 3300044693 Ga0466961_0035710 Ga0466961_0035710_514_1341 249
10 3300045049 Ga0466959_0029100 Ga0466959_0029100_1331_2158 249
11 3300005435 Ga0070714_100002560 Ga0070714_1000025606 250
12 3300048916 Ga0496113_0634238 Ga0496113_0634238_51_839 251
13 3300050492 nmdc:mga0yw44_188315_c1 nmdc:mga0yw44_188315_c1_291_1049 251
14 3300044684 Ga0466966_0002540 Ga0466966_0002540_1631_2461 252
15 3300044693 Ga0466961_0020131 Ga0466961_0020131_535_1365 252
16 3300044693 Ga0466961_0226963 Ga0466961_0226963_219_1049 252
17 3300044765 Ga0466970_0093687 Ga0466970_0093687_677_1507 252
18 3300045049 Ga0466959_0116470 Ga0466959_0116470_846_1676 252
19 3300045976 Ga0466967_0427921 Ga0466967_0427921_123_890 253
20 3300049569 Ga0501032_0001368 Ga0501032_0001368_16410_17237 253
21 3300049571 Ga0501034_0003976 Ga0501034_0003976_8340_9167 253
22 3300049572 Ga0501036_0013974 Ga0501036_0013974_1616_2443 253
23 3300049573 Ga0501037_0000490 Ga0501037_0000490_29514_30341 253
24 3300049574 Ga0501038_0003596 Ga0501038_0003596_8213_9040 253
25 3300049575 Ga0501039_0000463 Ga0501039_0000463_17518_18345 253
26 3300049579 Ga0501043_0000729 Ga0501043_0000729_27013_27840 253
27 3300049586 Ga0501070_0003864 Ga0501070_0003864_9379_10206 253
28 3300049589 Ga0501073_0085517 Ga0501073_0085517_340_1167 253
29 3300049823 Ga0501044_0049016 Ga0501044_0049016_569_1396 253
30 3300005435 Ga0070714_100069562 Ga0070714_1000695622 254
31 3300006048 Ga0075363_100002096 Ga0075363_1000020965 254
32 3300006051 Ga0075364_10132179 Ga0075364_101321792 254
33 3300006177 Ga0075362_10010187 Ga0075362_100101872 254
34 3300006353 Ga0075370_10014522 Ga0075370_100145223 254
35 3300009101 Ga0105247_10003264 Ga0105247_1000326414 254
36 3300044656 Ga0466969_0001933 Ga0466969_0001933_9712_10512 254
37 3300044684 Ga0466966_0010077 Ga0466966_0010077_1859_2659 254
38 3300044693 Ga0466961_0018419 Ga0466961_0018419_2305_3105 254
39 3300044719 Ga0466971_0030942 Ga0466971_0030942_819_1619 254
40 3300045049 Ga0466959_0002496 Ga0466959_0002496_4799_5599 254
41 3300048904 Ga0496101_0157541 Ga0496101_0157541_751_1545 254
42 3300048905 Ga0496102_0000474 Ga0496102_0000474_12255_13049 254
43 3300048906 Ga0496103_0000976 Ga0496103_0000976_12036_12830 254
44 3300048921 Ga0496118_0007091 Ga0496118_0007091_6227_7021 254
45 3300048922 Ga0496119_0008097 Ga0496119_0008097_3098_3892 254
46 3300048924 Ga0496121_0067014 Ga0496121_0067014_668_1462 254
47 3300049580 Ga0501046_0038720 Ga0501046_0038720_3006_3809 254
48 3300049823 Ga0501044_0078177 Ga0501044_0078177_210_1166 254
49 3300050492 nmdc:mga0yw44_50295_c1 nmdc:mga0yw44_50295_c1_1334_2134 254
50 3300061719 Ga0466962_0000795 Ga0466962_0000795_11009_11809 254
51 3300005329 Ga0070683_100152867 Ga0070683_1001528672 255
52 3300005337 Ga0070682_100125579 Ga0070682_1001255792 255
53 3300005456 Ga0070678_100339739 Ga0070678_1003397392 255
54 3300005530 Ga0070679_100328067 Ga0070679_1003280671 255
55 3300005539 Ga0068853_100243795 Ga0068853_1002437952 255
56 3300005578 Ga0068854_100320542 Ga0068854_1003205421 255
57 3300025932 Ga0207690_10183572 Ga0207690_101835722 255
58 3300025981 Ga0207640_10472180 Ga0207640_104721802 255
59 3300026067 Ga0207678_10005592 Ga0207678_100055923 255
60 3300048912 Ga0496109_0089867 Ga0496109_0089867_2034_2819 255
61 3300049570 Ga0501033_0000974 Ga0501033_0000974_18493_19296 255
62 3300049579 Ga0501043_0187159 Ga0501043_0187159_671_1474 255
63 3300049580 Ga0501046_0016932 Ga0501046_0016932_300_1103 255
64 3300053077 Ga0495601_0400952 Ga0495601_0400952_35_820 255
65 3300037418 Ga0395900_0132193 Ga0395900_0132193_1205_2038 256
66 3300037466 Ga0395898_0201488 Ga0395898_0201488_114_947 256
67 3300045976 Ga0466967_0129735 Ga0466967_0129735_178_981 256
68 3300050496 nmdc:mga07m45_29225_c1 nmdc:mga07m45_29225_c1_1719_2528 256
69 iso_pu_bacteria 2946024296 2946025763 256
70 3300005563 Ga0068855_100086047 Ga0068855_1000860473 257
71 3300006173 Ga0070716_100004348 Ga0070716_1000043487 257
72 3300009101 Ga0105247_10001445 Ga0105247_1000144515 257
73 3300009176 Ga0105242_10019364 Ga0105242_100193649 257
74 3300009545 Ga0105237_10176345 Ga0105237_101763452 257
75 3300013296 Ga0157374_10077044 Ga0157374_100770444 257
76 3300014968 Ga0157379_10088164 Ga0157379_100881644 257
77 3300025911 Ga0207654_10037937 Ga0207654_100379373 257
78 3300025914 Ga0207671_10131627 Ga0207671_101316272 257
79 3300025916 Ga0207663_10008634 Ga0207663_100086346 257
80 3300025935 Ga0207709_10006901 Ga0207709_100069015 257
81 3300025986 Ga0207658_10019255 Ga0207658_100192552 257
82 3300028381 Ga0268264_10030433 Ga0268264_100304333 257
83 3300035242 Ga0373962_0047212 Ga0373962_0047212_212_985 257
84 3300035691 Ga0373931_0033289 Ga0373931_0033289_1828_2601 257
85 3300038443 Ga0395901_0008725 Ga0395901_0008725_7733_8542 257
86 3300048903 Ga0496100_0011220 Ga0496100_0011220_130_903 257
87 3300048904 Ga0496101_0007107 Ga0496101_0007107_4265_5038 257
88 3300048906 Ga0496103_0002674 Ga0496103_0002674_7698_8471 257
89 3300048909 Ga0496106_0008621 Ga0496106_0008621_3921_4694 257
90 3300048910 Ga0496107_0000616 Ga0496107_0000616_4288_5061 257
91 3300048917 Ga0496114_0018819 Ga0496114_0018819_219_992 257
92 3300048918 Ga0496115_0004170 Ga0496115_0004170_4091_4864 257
93 3300006048 Ga0075363_100025102 Ga0075363_1000251024 258
94 3300006051 Ga0075364_10003636 Ga0075364_100036363 258
95 3300006186 Ga0075369_10010120 Ga0075369_100101203 258
96 3300037471 Ga0395905_0035991 Ga0395905_0035991_1813_2634 258
97 3300039437 Ga0436365_0351846 Ga0436365_0351846_375_1178 258
98 3300039453 Ga0436362_0957350 Ga0436362_0957350_24343_25146 258
99 iso_pu_bacteria 2739367898 2740168935 259
100 3300003322 rootL2_10062985 rootL2_100629852 260
101 3300005614 Ga0068856_100130685 Ga0068856_1001306854 260
102 3300005616 Ga0068852_100008929 Ga0068852_1000089298 260
103 3300005616 Ga0068852_100164332 Ga0068852_1001643321 260
104 3300005617 Ga0068859_100002361 Ga0068859_10000236125 260
105 3300006028 Ga0070717_10148509 Ga0070717_101485092 260
106 3300006931 Ga0097620_100002361 Ga0097620_1000023614 260
107 3300013297 Ga0157378_10829066 Ga0157378_108290662 260
108 3300020075 Ga0206349_1164363 Ga0206349_11643631 260
109 3300025900 Ga0207710_10001933 Ga0207710_100019333 260
110 3300025907 Ga0207645_10030401 Ga0207645_100304013 260
111 3300025927 Ga0207687_10137715 Ga0207687_101377152 260
112 3300026078 Ga0207702_10274305 Ga0207702_102743051 260
113 3300026142 Ga0207698_10006356 Ga0207698_100063562 260
114 3300026142 Ga0207698_10148048 Ga0207698_101480482 260
115 3300037853 Ga0436364_1280826 Ga0436364_1280826_45576_46496 260
116 3300041413 Ga0439465_0030469 Ga0439465_0030469_513_1304 260
117 3300042004 Ga0439445_0013920 Ga0439445_0013920_714_1505 260
118 3300042005 Ga0439448_0001366 Ga0439448_0001366_2811_3593 260
119 3300044693 Ga0466961_0024042 Ga0466961_0024042_2825_3640 260
120 3300044706 Ga0466964_0036102 Ga0466964_0036102_552_1367 260
121 3300044719 Ga0466971_0031477 Ga0466971_0031477_1057_1872 260
122 3300044842 Ga0466957_0031071 Ga0466957_0031071_728_1543 260
123 3300045836 Ga0466958_0004306 Ga0466958_0004306_4352_5167 260
124 3300048912 Ga0496109_0416274 Ga0496109_0416274_148_1035 260
125 3300050490 nmdc:mga03n38_125105_c1 nmdc:mga03n38_125105_c1_206_988 260
126 3300050492 nmdc:mga0yw44_54505_c1 nmdc:mga0yw44_54505_c1_1377_2159 260
127 3300061719 Ga0466962_0003314 Ga0466962_0003314_4447_5262 260
128 3300005564 Ga0070664_100073369 Ga0070664_1000733693 261
129 3300009551 Ga0105238_10295694 Ga0105238_102956941 261
130 3300044694 Ga0466963_0012034 Ga0466963_0012034_2232_3020 261
131 3300044706 Ga0466964_0041325 Ga0466964_0041325_67_855 261
132 3300044901 Ga0466960_0175950 Ga0466960_0175950_275_1063 261
133 3300045049 Ga0466959_0080707 Ga0466959_0080707_1383_2174 261
134 iso_pu_bacteria 2643221711 2644609794 261
135 iso_pu_bacteria 2811994882 2812374953 261
136 iso_pu_bacteria 2818991318 2819427700 261
137 iso_pu_bacteria 2818991458 2819666551 261
138 iso_pu_bacteria 2818991462 2819691710 261
139 iso_pu_bacteria 2818991469 2819729518 261
140 3300005614 Ga0068856_100636810 Ga0068856_1006368101 262
141 3300009148 Ga0105243_10456623 Ga0105243_104566232 262
142 3300025915 Ga0207693_10020056 Ga0207693_100200565 262
143 3300025929 Ga0207664_10091950 Ga0207664_100919503 262
144 3300026116 Ga0207674_10164449 Ga0207674_101644492 262
145 3300039438 Ga0436360_0211352 Ga0436360_0211352_34_831 262
146 3300044694 Ga0466963_0017877 Ga0466963_0017877_3076_4005 262
147 3300045976 Ga0466967_0022567 Ga0466967_0022567_737_1648 262
148 3300045976 Ga0466967_0024674 Ga0466967_0024674_1654_2445 262
149 3300049571 Ga0501034_0004481 Ga0501034_0004481_2367_3158 262
150 3300049572 Ga0501036_0028655 Ga0501036_0028655_932_1723 262
151 3300049573 Ga0501037_0004291 Ga0501037_0004291_7248_8039 262
152 3300049580 Ga0501046_0001843 Ga0501046_0001843_16864_17655 262
153 3300049581 Ga0501047_0007286 Ga0501047_0007286_4434_5225 262
154 3300049582 Ga0501048_0005999 Ga0501048_0005999_2486_3277 262
155 3300049585 Ga0501069_0078274 Ga0501069_0078274_209_1000 262
156 3300049586 Ga0501070_0027988 Ga0501070_0027988_2327_3118 262
157 3300049742 Ga0501080_0024341 Ga0501080_0024341_2529_3320 262
158 3300049822 Ga0501035_0000419 Ga0501035_0000419_4625_5416 262
159 3300049823 Ga0501044_0034997 Ga0501044_0034997_2274_3065 262
160 iso_pu_bacteria 2861520306 2861523890 262
161 3300005329 Ga0070683_100037531 Ga0070683_1000375313 263
162 3300005458 Ga0070681_10099073 Ga0070681_100990732 263
163 3300005563 Ga0068855_100448108 Ga0068855_1004481082 263
164 3300005563 Ga0068855_100763640 Ga0068855_1007636402 263
165 3300005614 Ga0068856_100251973 Ga0068856_1002519732 263
166 3300010159 Ga0099796_10059832 Ga0099796_100598322 263
167 3300013105 Ga0157369_10027215 Ga0157369_100272158 263
168 3300020069 Ga0197907_10461530 Ga0197907_104615303 263
169 3300020069 Ga0197907_10466403 Ga0197907_104664034 263
170 3300020070 Ga0206356_10444711 Ga0206356_104447112 263
171 3300020080 Ga0206350_10078532 Ga0206350_100785321 263
172 3300020081 Ga0206354_10468886 Ga0206354_104688862 263
173 3300020082 Ga0206353_10462189 Ga0206353_104621897 263
174 3300025909 Ga0207705_10239754 Ga0207705_102397542 263
175 3300025912 Ga0207707_10091566 Ga0207707_100915664 263
176 3300025915 Ga0207693_10286712 Ga0207693_102867122 263
177 3300025944 Ga0207661_10082312 Ga0207661_100823124 263
178 3300025949 Ga0207667_10087359 Ga0207667_100873595 263
179 3300025949 Ga0207667_10422068 Ga0207667_104220681 263
180 3300026067 Ga0207678_10126879 Ga0207678_101268791 263
181 3300026078 Ga0207702_10533737 Ga0207702_105337372 263
182 3300026089 Ga0207648_10199794 Ga0207648_101997942 263
183 3300044656 Ga0466969_0021405 Ga0466969_0021405_668_1492 263
184 3300044693 Ga0466961_0322912 Ga0466961_0322912_92_916 263
185 3300045836 Ga0466958_0170694 Ga0466958_0170694_62_886 263
186 3300048903 Ga0496100_0063343 Ga0496100_0063343_657_1490 263
187 3300048904 Ga0496101_0075063 Ga0496101_0075063_775_1608 263
188 3300048904 Ga0496101_0393210 Ga0496101_0393210_237_1070 263
189 3300048905 Ga0496102_0040067 Ga0496102_0040067_745_1578 263
190 3300048905 Ga0496102_0246343 Ga0496102_0246343_722_1555 263
191 3300048907 Ga0496104_0009915 Ga0496104_0009915_519_1352 263
192 3300048907 Ga0496104_0078872 Ga0496104_0078872_1784_2617 263
193 3300048907 Ga0496104_0178544 Ga0496104_0178544_677_1510 263
194 3300048908 Ga0496105_0039766 Ga0496105_0039766_748_1581 263
195 3300048908 Ga0496105_0049958 Ga0496105_0049958_1777_2610 263
196 3300048908 Ga0496105_0083314 Ga0496105_0083314_984_1817 263
197 3300048908 Ga0496105_0291336 Ga0496105_0291336_240_1073 263
198 3300048911 Ga0496108_0348425 Ga0496108_0348425_151_984 263
199 3300048912 Ga0496109_0030624 Ga0496109_0030624_3497_4330 263
200 3300048913 Ga0496110_0103698 Ga0496110_0103698_892_1725 263
201 3300048913 Ga0496110_0390614 Ga0496110_0390614_367_1200 263
202 3300048914 Ga0496111_0098484 Ga0496111_0098484_1219_2052 263
203 3300048914 Ga0496111_0183760 Ga0496111_0183760_33_866 263
204 3300048915 Ga0496112_0211828 Ga0496112_0211828_401_1234 263
205 3300048916 Ga0496113_0247628 Ga0496113_0247628_120_953 263
206 3300048916 Ga0496113_0539744 Ga0496113_0539744_72_905 263
207 3300048917 Ga0496114_0003938 Ga0496114_0003938_582_1415 263
208 3300048917 Ga0496114_0013695 Ga0496114_0013695_4554_5387 263
209 3300048921 Ga0496118_0144793 Ga0496118_0144793_45_905 263
210 3300049569 Ga0501032_0005359 Ga0501032_0005359_5721_6551 263
211 3300049572 Ga0501036_0139970 Ga0501036_0139970_217_1047 263
212 3300049574 Ga0501038_0001252 Ga0501038_0001252_20929_21759 263
213 3300049579 Ga0501043_0194675 Ga0501043_0194675_10_840 263
214 3300049581 Ga0501047_0003673 Ga0501047_0003673_2732_3562 263
215 3300049582 Ga0501048_0000047 Ga0501048_0000047_2041_2871 263
216 3300049586 Ga0501070_0063022 Ga0501070_0063022_500_1330 263
217 3300049823 Ga0501044_0006425 Ga0501044_0006425_14_844 263
218 3300050510 nmdc:mga06r32_246128_c1 nmdc:mga06r32_246128_c1_26_859 263
219 3300060353 Ga0501082_0350044 Ga0501082_0350044_433_1263 263
220 iso_pu_bacteria 2932431166 2932431731 263
221 3300005434 Ga0070709_10259509 Ga0070709_102595091 264
222 3300005435 Ga0070714_100183991 Ga0070714_1001839912 264
223 3300005437 Ga0070710_10058120 Ga0070710_100581202 264
224 3300005439 Ga0070711_100179428 Ga0070711_1001794282 264
225 3300005614 Ga0068856_100070832 Ga0068856_1000708322 264
226 3300005614 Ga0068856_100160997 Ga0068856_1001609974 264
227 3300006175 Ga0070712_100191344 Ga0070712_1001913442 264
228 3300007076 Ga0075435_100558358 Ga0075435_1005583581 264
229 3300009093 Ga0105240_10206316 Ga0105240_102063162 264
230 3300009098 Ga0105245_10054329 Ga0105245_100543295 264
231 3300009545 Ga0105237_10095068 Ga0105237_100950684 264
232 3300025898 Ga0207692_10112640 Ga0207692_101126401 264
233 3300025906 Ga0207699_10012267 Ga0207699_100122671 264
234 3300025906 Ga0207699_10076787 Ga0207699_100767871 264
235 3300025913 Ga0207695_10137555 Ga0207695_101375552 264
236 3300025916 Ga0207663_10094500 Ga0207663_100945002 264
237 3300025939 Ga0207665_10058523 Ga0207665_100585234 264
238 3300026075 Ga0207708_10165363 Ga0207708_101653632 264
239 3300026078 Ga0207702_10099159 Ga0207702_100991592 264
240 3300035083 Ga0373926_0003619 Ga0373926_0003619_43_891 264
241 3300035089 Ga0373944_0004838 Ga0373944_0004838_1118_1966 264
242 3300035111 Ga0373923_0087016 Ga0373923_0087016_450_1298 264
243 3300035113 Ga0373936_0021481 Ga0373936_0021481_1524_2372 264
244 3300035116 Ga0373945_0009190 Ga0373945_0009190_2180_3028 264
245 3300035170 Ga0373943_0003085 Ga0373943_0003085_6556_7404 264
246 3300035171 Ga0373946_0000053 Ga0373946_0000053_11237_12085 264
247 3300035172 Ga0373955_0203515 Ga0373955_0203515_57_905 264
248 3300035410 Ga0373924_0012473 Ga0373924_0012473_782_1630 264
249 3300035692 Ga0373935_0230121 Ga0373935_0230121_169_1017 264
250 3300035695 Ga0373927_0010035 Ga0373927_0010035_4017_4865 264
251 3300035725 Ga0373947_0004259 Ga0373947_0004259_1493_2341 264
252 3300036401 Ga0373937_0071237 Ga0373937_0071237_396_1244 264
253 3300037068 Ga0373925_0011700 Ga0373925_0011700_347_1195 264
254 3300044658 Ga0466972_0031616 Ga0466972_0031616_1324_2151 264
255 3300044658 Ga0466972_0036399 Ga0466972_0036399_706_1533 264
256 3300044684 Ga0466966_0161773 Ga0466966_0161773_88_915 264
257 3300044693 Ga0466961_0081681 Ga0466961_0081681_335_1162 264
258 3300044694 Ga0466963_0004806 Ga0466963_0004806_3805_4632 264
259 3300044694 Ga0466963_0067353 Ga0466963_0067353_43_891 264
260 3300044735 Ga0466968_0019573 Ga0466968_0019573_1198_2025 264
261 3300044842 Ga0466957_0010080 Ga0466957_0010080_1835_2662 264
262 3300044901 Ga0466960_0024183 Ga0466960_0024183_1271_2098 264
263 3300044901 Ga0466960_0227074 Ga0466960_0227074_142_969 264
264 3300045836 Ga0466958_0045296 Ga0466958_0045296_778_1605 264
265 3300045836 Ga0466958_0104738 Ga0466958_0104738_26_853 264
266 3300045976 Ga0466967_0029889 Ga0466967_0029889_3573_4406 264
267 3300046461 Ga0495641_0017740 Ga0495641_0017740_212_1060 264
268 3300046462 Ga0495651_0056525 Ga0495651_0056525_771_1619 264
269 3300046463 Ga0495653_0012397 Ga0495653_0012397_2231_3079 264
270 3300046476 Ga0495662_0019069 Ga0495662_0019069_913_1761 264
271 3300046477 Ga0495664_0003023 Ga0495664_0003023_6907_7755 264
272 3300046514 Ga0495618_0117307 Ga0495618_0117307_783_1631 264
273 3300046517 Ga0495630_0067420 Ga0495630_0067420_382_1230 264
274 3300046524 Ga0495648_0109144 Ga0495648_0109144_351_1157 264
275 3300046529 Ga0495652_0062008 Ga0495652_0062008_807_1655 264
276 3300046531 Ga0495665_0034722 Ga0495665_0034722_1455_2303 264
277 3300046559 Ga0495667_0166393 Ga0495667_0166393_353_1201 264
278 3300046663 Ga0495635_0041152 Ga0495635_0041152_1530_2378 264
279 3300046678 Ga0495599_0047405 Ga0495599_0047405_1518_2366 264
280 3300046680 Ga0495646_0069644 Ga0495646_0069644_553_1401 264
281 3300046690 Ga0495624_0014151 Ga0495624_0014151_3152_4000 264
282 3300046809 Ga0495600_0041629 Ga0495600_0041629_645_1493 264
283 3300047319 Ga0495674_0011031 Ga0495674_0011031_646_1494 264
284 3300047320 Ga0495672_0140392 Ga0495672_0140392_47_853 264
285 3300047320 Ga0495672_0158864 Ga0495672_0158864_312_1118 264
286 3300047321 Ga0495676_0048986 Ga0495676_0048986_1699_2547 264
287 3300047469 Ga0495673_0004361 Ga0495673_0004361_7348_8154 264
288 3300047469 Ga0495673_0129766 Ga0495673_0129766_157_963 264
289 3300047471 Ga0495684_0001345 Ga0495684_0001345_1498_2346 264
290 3300047673 Ga0495593_0110988 Ga0495593_0110988_466_1314 264
291 3300048916 Ga0496113_0534310 Ga0496113_0534310_41_889 264
292 3300048918 Ga0496115_0242321 Ga0496115_0242321_413_1261 264
293 3300048928 Ga0496125_0031601 Ga0496125_0031601_2853_3686 264
294 3300049568 Ga0501031_0063699 Ga0501031_0063699_1401_2234 264
295 3300049569 Ga0501032_0042454 Ga0501032_0042454_165_998 264
296 3300049571 Ga0501034_0075669 Ga0501034_0075669_2106_2939 264
297 3300049572 Ga0501036_0420429 Ga0501036_0420429_111_944 264
298 3300049572 Ga0501036_0443444 Ga0501036_0443444_226_1053 264
299 3300049573 Ga0501037_0003686 Ga0501037_0003686_7189_8022 264
300 3300049578 Ga0501042_0089527 Ga0501042_0089527_866_1699 264
301 3300049579 Ga0501043_0006491 Ga0501043_0006491_5559_6392 264
302 3300049580 Ga0501046_0049390 Ga0501046_0049390_2431_3264 264
303 3300049581 Ga0501047_0236674 Ga0501047_0236674_840_1667 264
304 3300049582 Ga0501048_0001968 Ga0501048_0001968_11625_12458 264
305 3300049586 Ga0501070_0095382 Ga0501070_0095382_361_1194 264
306 3300049586 Ga0501070_0405736 Ga0501070_0405736_190_1017 264
307 3300049742 Ga0501080_0171591 Ga0501080_0171591_185_1018 264
308 3300049823 Ga0501044_0079321 Ga0501044_0079321_383_1216 264
309 3300049823 Ga0501044_0084013 Ga0501044_0084013_2330_3157 264
310 3300050490 nmdc:mga03n38_11416_c1 nmdc:mga03n38_11416_c1_2465_3298 264
311 3300050491 nmdc:mga00v17_48471_c1 nmdc:mga00v17_48471_c1_680_1513 264
312 3300053087 Ga0500643_002122 Ga0500643_002122_6165_6971 264
313 3300054114 Ga0501084_0242332 Ga0501084_0242332_330_1163 264
314 3300059491 Ga0587070_014254 Ga0587070_014254_361_1209 264
315 3300061719 Ga0466962_0006031 Ga0466962_0006031_494_1321 264
316 iso_pu_bacteria 2643221690 2644504166 264
317 iso_pu_bacteria 2643221694 2644526757 264
318 iso_pu_bacteria 2643221722 2644670503 264
319 iso_pu_bacteria 2867346516 2867350712 264
320 3300005436 Ga0070713_100475504 Ga0070713_1004755041 265
321 3300005548 Ga0070665_100225747 Ga0070665_1002257473 265
322 3300005937 Ga0081455_10005680 Ga0081455_100056803 265
323 3300020077 Ga0206351_10225639 Ga0206351_102256392 265
324 3300025273 Ga0209673_1056658 Ga0209673_10566582 265
325 3300025303 Ga0209051_1000075 Ga0209051_1000075174 265
326 3300044693 Ga0466961_0013055 Ga0466961_0013055_340_1173 265
327 3300044693 Ga0466961_0175209 Ga0466961_0175209_371_1210 265
328 3300044694 Ga0466963_0040300 Ga0466963_0040300_637_1476 265
329 3300044842 Ga0466957_0001407 Ga0466957_0001407_4736_5575 265
330 3300048907 Ga0496104_0429255 Ga0496104_0429255_187_1023 265
331 3300048913 Ga0496110_0310557 Ga0496110_0310557_55_891 265
332 3300048917 Ga0496114_0131197 Ga0496114_0131197_1123_1959 265
333 3300049569 Ga0501032_0008865 Ga0501032_0008865_4470_5315 265
334 3300049581 Ga0501047_0000015 Ga0501047_0000015_74345_75211 265
335 3300049743 Ga0501081_0072348 Ga0501081_0072348_1402_2238 265
336 3300005577 Ga0068857_100216013 Ga0068857_1002160131 266
337 3300009093 Ga0105240_10707493 Ga0105240_107074932 266
338 3300020077 Ga0206351_10437193 Ga0206351_104371931 266
339 3300026116 Ga0207674_10123151 Ga0207674_101231513 266
340 3300028794 Ga0307515_10033617 Ga0307515_100336175 266
341 3300031251 Ga0265327_10001438 Ga0265327_1000143825 266
342 3300031995 Ga0307409_100105986 Ga0307409_1001059861 266
343 3300032120 Ga0316053_101122 Ga0316053_1011222 266
344 3300037466 Ga0395898_0180447 Ga0395898_0180447_400_1293 266
345 3300041486 Ga0451807_1411141 Ga0451807_1411141_679_1527 266
346 3300044658 Ga0466972_0016495 Ga0466972_0016495_2841_3641 266
347 3300044658 Ga0466972_0092498 Ga0466972_0092498_122_961 266
348 3300044684 Ga0466966_0016972 Ga0466966_0016972_1263_2063 266
349 3300044693 Ga0466961_0026668 Ga0466961_0026668_1438_2238 266
350 3300044719 Ga0466971_0002929 Ga0466971_0002929_6300_7100 266
351 3300044719 Ga0466971_0056342 Ga0466971_0056342_829_1668 266
352 3300044765 Ga0466970_0004663 Ga0466970_0004663_2290_3129 266
353 3300044765 Ga0466970_0056456 Ga0466970_0056456_756_1595 266
354 3300044842 Ga0466957_0398864 Ga0466957_0398864_44_883 266
355 3300044901 Ga0466960_0109314 Ga0466960_0109314_211_1050 266
356 3300045049 Ga0466959_0008449 Ga0466959_0008449_6463_7263 266
357 3300045836 Ga0466958_0007246 Ga0466958_0007246_5266_6066 266
358 3300046459 Ga0495629_0092021 Ga0495629_0092021_112_957 266
359 3300048907 Ga0496104_0753334 Ga0496104_0753334_37_870 266
360 3300048916 Ga0496113_0143688 Ga0496113_0143688_603_1496 266
361 3300048922 Ga0496119_0001193 Ga0496119_0001193_5263_6096 266
362 3300048923 Ga0496120_0009640 Ga0496120_0009640_2886_3719 266
363 3300002075 JGI24738J21930_10013856 JGI24738J21930_100138562 267
364 3300006038 Ga0075365_10015269 Ga0075365_100152692 267
365 3300013105 Ga0157369_10151735 Ga0157369_101517353 267
366 3300041453 Ga0451797_0832390 Ga0451797_0832390_416_1258 267
367 3300044842 Ga0466957_0280111 Ga0466957_0280111_254_1102 267
368 3300048907 Ga0496104_0204092 Ga0496104_0204092_118_960 267
369 3300050492 nmdc:mga0yw44_106282_c1 nmdc:mga0yw44_106282_c1_241_1083 267
370 3300050510 nmdc:mga06r32_249_c2 nmdc:mga06r32_249_c2_232_1077 267
371 3300053140 Ga0500573_0060938 Ga0500573_0060938_1194_2036 267
372 iso_pu_bacteria 2643221687 2644488745 267
373 iso_pu_bacteria 2891326441 2891329414 267
374 3300005327 Ga0070658_10047833 Ga0070658_100478333 268
375 3300005329 Ga0070683_100082793 Ga0070683_1000827931 268
376 3300005337 Ga0070682_100047587 Ga0070682_1000475874 268
377 3300005339 Ga0070660_100177347 Ga0070660_1001773472 268
378 3300005345 Ga0070692_10111031 Ga0070692_101110311 268
379 3300005435 Ga0070714_100001157 Ga0070714_1000011576 268
380 3300005458 Ga0070681_10036461 Ga0070681_100364614 268
381 3300005530 Ga0070679_100008082 Ga0070679_1000080825 268
382 3300005535 Ga0070684_100110136 Ga0070684_1001101363 268
383 3300005578 Ga0068854_100311278 Ga0068854_1003112781 268
384 3300006028 Ga0070717_10084392 Ga0070717_100843923 268
385 3300013104 Ga0157370_10047047 Ga0157370_100470471 268
386 3300020069 Ga0197907_10431376 Ga0197907_104313762 268
387 3300020070 Ga0206356_11020425 Ga0206356_110204252 268
388 3300020082 Ga0206353_11702945 Ga0206353_117029454 268
389 3300022467 Ga0224712_10084439 Ga0224712_100844391 268
390 3300025909 Ga0207705_10116186 Ga0207705_101161863 268
391 3300025912 Ga0207707_10019173 Ga0207707_100191736 268
392 3300025919 Ga0207657_10109507 Ga0207657_101095072 268
393 3300025921 Ga0207652_10021282 Ga0207652_100212825 268
394 3300025929 Ga0207664_10000615 Ga0207664_1000061512 268
395 3300025944 Ga0207661_10195571 Ga0207661_101955711 268
396 3300026067 Ga0207678_10107313 Ga0207678_101073133 268
397 3300044658 Ga0466972_0015724 Ga0466972_0015724_140_997 268
398 3300044683 Ga0466965_0001599 Ga0466965_0001599_6104_6961 268
399 3300044706 Ga0466964_0070693 Ga0466964_0070693_551_1408 268
400 3300044735 Ga0466968_0003185 Ga0466968_0003185_916_1773 268
401 3300044901 Ga0466960_0000406 Ga0466960_0000406_3818_4675 268
402 3300045049 Ga0466959_0018047 Ga0466959_0018047_2223_3080 268
403 3300045976 Ga0466967_0005450 Ga0466967_0005450_957_1814 268
404 3300048907 Ga0496104_0026535 Ga0496104_0026535_2548_3513 268
405 iso_pu_bacteria 2842134933 2842137635 268
406 iso_pu_bacteria 2902837492 2902838627 268
407 3300009545 Ga0105237_10092580 Ga0105237_100925802 269
408 3300025914 Ga0207671_10068019 Ga0207671_100680193 269
409 3300039437 Ga0436365_0544792 Ga0436365_0544792_682_1494 269
410 3300046462 Ga0495651_0246885 Ga0495651_0246885_176_1033 269
411 3300053077 Ga0495601_0171665 Ga0495601_0171665_328_1185 269
412 3300053078 Ga0495612_0123642 Ga0495612_0123642_180_1037 269
413 3300053085 Ga0495619_0026105 Ga0495619_0026105_976_1833 269
414 iso_pu_bacteria 2899370129 2899370869 269
415 iso_pu_bacteria 2939582691 2939588273 269
416 iso_pu_bacteria 3001119090 3001119918 269
417 3300005435 Ga0070714_100000002 Ga0070714_100000002303 270
418 3300005539 Ga0068853_100009617 Ga0068853_1000096175 270
419 3300005614 Ga0068856_100126969 Ga0068856_1001269693 270
420 3300009147 Ga0114129_10152595 Ga0114129_101525953 270
421 3300013296 Ga0157374_10515138 Ga0157374_105151382 270
422 3300013308 Ga0157375_10192559 Ga0157375_101925593 270
423 3300025929 Ga0207664_10000038 Ga0207664_1000003898 270
424 3300025929 Ga0207664_10012150 Ga0207664_100121502 270
425 3300026041 Ga0207639_10005060 Ga0207639_100050605 270
426 3300026078 Ga0207702_10074608 Ga0207702_100746083 270
427 3300047472 Ga0495686_0002871 Ga0495686_0002871_14041_14859 270
428 3300048905 Ga0496102_0231337 Ga0496102_0231337_903_1715 270
429 3300048911 Ga0496108_0108354 Ga0496108_0108354_725_1537 270
430 3300048912 Ga0496109_0113276 Ga0496109_0113276_738_1550 270
431 3300050507 nmdc:mga05p37_143120_c1 nmdc:mga05p37_143120_c1_960_1772 270
432 3300050509 nmdc:mga0qj67_13681_c1 nmdc:mga0qj67_13681_c1_3910_4722 270
433 iso_pu_bacteria 2929212328 2929216179 270
434 3300003792 Ga0055540_1008869 Ga0055540_10088693 271
435 3300025303 Ga0209051_1001162 Ga0209051_100116225 271
436 3300025303 Ga0209051_1002980 Ga0209051_10029802 271
437 3300025303 Ga0209051_1031448 Ga0209051_10314483 271
438 3300030760 Ga0265762_1018837 Ga0265762_10188372 271
439 3300039437 Ga0436365_1921824 Ga0436365_1921824_6359_7183 271
440 3300041456 Ga0451795_1090199 Ga0451795_1090199_565_1383 271
441 3300049569 Ga0501032_0063533 Ga0501032_0063533_857_1711 271
442 3300049571 Ga0501034_0124760 Ga0501034_0124760_1287_2141 271
443 3300049572 Ga0501036_0003363 Ga0501036_0003363_10745_11599 271
444 3300049573 Ga0501037_0016194 Ga0501037_0016194_2665_3519 271
445 3300049574 Ga0501038_0001165 Ga0501038_0001165_1402_2256 271
446 3300049580 Ga0501046_0025807 Ga0501046_0025807_1141_1995 271
447 3300049581 Ga0501047_0040856 Ga0501047_0040856_3269_4123 271
448 3300049822 Ga0501035_0020795 Ga0501035_0020795_3612_4466 271
449 3300049823 Ga0501044_0102047 Ga0501044_0102047_965_1819 271
450 3300049824 Ga0501045_0240928 Ga0501045_0240928_309_1163 271
451 3300050489 nmdc:mga03683_8444_c1 nmdc:mga03683_8444_c1_1910_2725 271
452 3300050490 nmdc:mga03n38_6482_c1 nmdc:mga03n38_6482_c1_1332_2147 271
453 3300050491 nmdc:mga00v17_5341_c1 nmdc:mga00v17_5341_c1_1291_2106 271
454 3300050516 nmdc:mga0sz30_10206_c1 nmdc:mga0sz30_10206_c1_1746_2561 271
455 3300005338 Ga0068868_100095915 Ga0068868_1000959152 272
456 3300005455 Ga0070663_100000482 Ga0070663_1000004826 272
457 3300005937 Ga0081455_10004103 Ga0081455_100041033 272
458 3300021358 Ga0213873_10000053 Ga0213873_100000535 272
459 3300021388 Ga0213875_10005854 Ga0213875_100058547 272
460 3300033180 Ga0307510_10036189 Ga0307510_100361892 272
461 3300037853 Ga0436364_0935155 Ga0436364_0935155_4799_5725 272
462 3300038443 Ga0395901_0603169 Ga0395901_0603169_189_1052 272
463 3300048905 Ga0496102_0000007 Ga0496102_0000007_346741_347571 272
464 3300048906 Ga0496103_0000013 Ga0496103_0000013_227598_228428 272
465 3300048911 Ga0496108_0388407 Ga0496108_0388407_162_992 272
466 3300048921 Ga0496118_0000023 Ga0496118_0000023_346747_347577 272
467 3300003792 Ga0055540_1001305 Ga0055540_100130514 273
468 3300003792 Ga0055540_1002845 Ga0055540_10028452 273
469 3300005347 Ga0070668_100458063 Ga0070668_1004580631 273
470 3300005367 Ga0070667_100000223 Ga0070667_10000022321 273
471 3300005548 Ga0070665_100005604 Ga0070665_1000056049 273
472 3300005617 Ga0068859_100000174 Ga0068859_10000017412 273
473 3300005719 Ga0068861_100092328 Ga0068861_1000923283 273
474 3300005841 Ga0068863_100001502 Ga0068863_1000015024 273
475 3300005843 Ga0068860_100000044 Ga0068860_100000044129 273
476 3300005844 Ga0068862_100000003 Ga0068862_100000003102 273
477 3300006038 Ga0075365_10033987 Ga0075365_100339874 273
478 3300006931 Ga0097620_100000174 Ga0097620_10000017412 273
479 3300009101 Ga0105247_10000006 Ga0105247_10000006219 273
480 3300009177 Ga0105248_10000042 Ga0105248_10000042147 273
481 3300009553 Ga0105249_10000008 Ga0105249_10000008194 273
482 3300013306 Ga0163162_10060455 Ga0163162_100604553 273
483 3300014325 Ga0163163_10026112 Ga0163163_100261126 273
484 3300014968 Ga0157379_10168598 Ga0157379_101685982 273
485 3300025273 Ga0209673_1008842 Ga0209673_10088425 273
486 3300025303 Ga0209051_1011514 Ga0209051_10115142 273
487 3300025900 Ga0207710_10000025 Ga0207710_1000002569 273
488 3300025923 Ga0207681_10003522 Ga0207681_100035226 273
489 3300025941 Ga0207711_10000697 Ga0207711_1000069714 273
490 3300025961 Ga0207712_10000011 Ga0207712_10000011127 273
491 3300025986 Ga0207658_10000307 Ga0207658_1000030736 273
492 3300026035 Ga0207703_10006939 Ga0207703_100069395 273
493 3300026088 Ga0207641_10005680 Ga0207641_100056809 273
494 3300028379 Ga0268266_10010048 Ga0268266_100100486 273
495 3300028380 Ga0268265_10000010 Ga0268265_10000010103 273
496 3300028381 Ga0268264_10000007 Ga0268264_10000007637 273
497 3300031251 Ga0265327_10026106 Ga0265327_100261064 273
498 3300031852 Ga0307410_10064569 Ga0307410_100645692 273
499 3300044842 Ga0466957_0224054 Ga0466957_0224054_103_957 273
500 3300048903 Ga0496100_0008810 Ga0496100_0008810_3899_4729 273
501 3300048904 Ga0496101_0037201 Ga0496101_0037201_457_1287 273
502 3300048905 Ga0496102_0000060 Ga0496102_0000060_84355_85185 273
503 3300048906 Ga0496103_0000500 Ga0496103_0000500_22840_23670 273
504 3300048915 Ga0496112_0755497 Ga0496112_0755497_27_863 273
505 3300048919 Ga0496116_0011976 Ga0496116_0011976_5679_6509 273
506 3300048920 Ga0496117_0002026 Ga0496117_0002026_834_1664 273
507 3300048921 Ga0496118_0001179 Ga0496118_0001179_33836_34666 273
508 3300048922 Ga0496119_0015822 Ga0496119_0015822_2682_3512 273
509 3300048923 Ga0496120_0004413 Ga0496120_0004413_4117_4947 273
510 3300048924 Ga0496121_0023668 Ga0496121_0023668_3102_3932 273
511 3300048928 Ga0496125_0030353 Ga0496125_0030353_899_1729 273
512 3300048929 Ga0496126_0008248 Ga0496126_0008248_5590_6420 273
513 3300050492 nmdc:mga0yw44_77538_c1 nmdc:mga0yw44_77538_c1_863_1684 273
514 iso_pu_bacteria 2738541264 2738667596 273
515 iso_pu_bacteria 2738541356 2739146666 273
516 3300009098 Ga0105245_10098676 Ga0105245_100986762 274
517 3300009148 Ga0105243_10278934 Ga0105243_102789341 274
518 3300009551 Ga0105238_10095118 Ga0105238_100951183 274
519 3300010375 Ga0105239_10158674 Ga0105239_101586743 274
520 3300014325 Ga0163163_10122872 Ga0163163_101228723 274
521 3300028800 Ga0265338_10028604 Ga0265338_100286044 274
522 3300039437 Ga0436365_1892189 Ga0436365_1892189_1100_1933 274
523 3300046460 Ga0495638_0001150 Ga0495638_0001150_23882_24715 274
524 3300047320 Ga0495672_0034340 Ga0495672_0034340_1438_2274 274
525 3300048904 Ga0496101_0134854 Ga0496101_0134854_412_1254 274
526 3300048909 Ga0496106_0465129 Ga0496106_0465129_120_962 274
527 3300048913 Ga0496110_0090896 Ga0496110_0090896_111_953 274
528 3300048915 Ga0496112_0014578 Ga0496112_0014578_2915_3757 274
529 3300049590 Ga0501074_0403281 Ga0501074_0403281_67_891 274
530 3300050490 nmdc:mga03n38_19236_c1 nmdc:mga03n38_19236_c1_1194_2036 274
531 3300053083 Ga0495655_0020857 Ga0495655_0020857_580_1422 274
532 3300053085 Ga0495619_0174699 Ga0495619_0174699_598_1440 274
533 3300053104 Ga0500556_0004430 Ga0500556_0004430_3138_3971 274
534 iso_pu_bacteria 2643221715 2644633858 274
535 iso_pu_bacteria 2795385470 2795786726 274
536 iso_pu_bacteria 2902810491 2902810775 274
537 iso_pu_bacteria 2922554459 2922555368 274
538 iso_pu_bacteria 2956939328 2956939541 274
539 3300005843 Ga0068860_100004988 Ga0068860_1000049887 275
540 3300006038 Ga0075365_10108574 Ga0075365_101085742 275
541 3300006048 Ga0075363_100002452 Ga0075363_1000024526 275
542 3300006051 Ga0075364_10030965 Ga0075364_100309654 275
543 3300006353 Ga0075370_10011670 Ga0075370_100116704 275
544 3300031251 Ga0265327_10000071 Ga0265327_10000071186 275
545 3300035725 Ga0373947_0180197 Ga0373947_0180197_96_1061 275
546 3300041512 Ga0451853_2011291 Ga0451853_2011291_809_1663 275
547 3300046675 Ga0495657_0174821 Ga0495657_0174821_306_1271 275
548 3300049575 Ga0501039_0367480 Ga0501039_0367480_139_1011 275
549 3300049585 Ga0501069_0123393 Ga0501069_0123393_618_1451 275
550 3300050491 nmdc:mga00v17_10237_c3 nmdc:mga00v17_10237_c3_497_1324 275
551 iso_pu_bacteria 2738543005 2739205047 275
552 3300006051 Ga0075364_10009652 Ga0075364_100096526 276
553 3300006931 Ga0097620_100926545 Ga0097620_1009265451 276
554 3300009545 Ga0105237_10005606 Ga0105237_1000560611 276
555 3300025914 Ga0207671_10027259 Ga0207671_100272592 276
556 3300025986 Ga0207658_10000423 Ga0207658_1000042331 276
557 3300031901 Ga0307406_10014618 Ga0307406_100146184 276
558 3300041410 Ga0439461_0000802 Ga0439461_0000802_2748_3599 276
559 3300041997 Ga0439431_0004643 Ga0439431_0004643_820_1671 276
560 3300042004 Ga0439445_0023198 Ga0439445_0023198_498_1349 276
561 3300042435 Ga0439434_0004809 Ga0439434_0004809_528_1379 276
562 3300044656 Ga0466969_0012565 Ga0466969_0012565_1988_2860 276
563 3300044683 Ga0466965_0012158 Ga0466965_0012158_25_867 276
564 3300044683 Ga0466965_0167925 Ga0466965_0167925_47_877 276
565 3300045976 Ga0466967_0038457 Ga0466967_0038457_979_1809 276
566 3300045976 Ga0466967_0123648 Ga0466967_0123648_584_1414 276
567 3300048903 Ga0496100_0000092 Ga0496100_0000092_20471_21316 276
568 3300048904 Ga0496101_0000018 Ga0496101_0000018_20345_21190 276
569 3300048905 Ga0496102_0011349 Ga0496102_0011349_4750_5595 276
570 3300048906 Ga0496103_0009275 Ga0496103_0009275_1713_2558 276
571 3300048909 Ga0496106_0002072 Ga0496106_0002072_10115_10960 276
572 3300048910 Ga0496107_0011269 Ga0496107_0011269_2559_3404 276
573 3300048911 Ga0496108_0042961 Ga0496108_0042961_2313_3158 276
574 3300048912 Ga0496109_0001095 Ga0496109_0001095_1348_2193 276
575 3300048913 Ga0496110_0006864 Ga0496110_0006864_3831_4676 276
576 3300048914 Ga0496111_0020815 Ga0496111_0020815_54_899 276
577 3300048915 Ga0496112_0013714 Ga0496112_0013714_2726_3577 276
578 3300048916 Ga0496113_0010272 Ga0496113_0010272_937_1788 276
579 3300048917 Ga0496114_0000914 Ga0496114_0000914_282_1127 276
580 3300048918 Ga0496115_0070134 Ga0496115_0070134_893_1738 276
581 3300048919 Ga0496116_0041798 Ga0496116_0041798_1269_2114 276
582 3300048920 Ga0496117_0015208 Ga0496117_0015208_1256_2101 276
583 3300048921 Ga0496118_0012867 Ga0496118_0012867_5875_6720 276
584 3300048922 Ga0496119_0013630 Ga0496119_0013630_4352_5197 276
585 3300048923 Ga0496120_0033976 Ga0496120_0033976_1084_1929 276
586 3300048923 Ga0496120_0067811 Ga0496120_0067811_1082_1933 276
587 3300048924 Ga0496121_0000023 Ga0496121_0000023_432315_433160 276
588 3300048925 Ga0496122_0000164 Ga0496122_0000164_136652_137497 276
589 3300048925 Ga0496122_0029305 Ga0496122_0029305_1306_2157 276
590 3300048926 Ga0496123_0010993 Ga0496123_0010993_4266_5111 276
591 3300048927 Ga0496124_0000014 Ga0496124_0000014_432315_433160 276
592 3300048928 Ga0496125_0000020 Ga0496125_0000020_30289_31134 276
593 3300048929 Ga0496126_0000023 Ga0496126_0000023_432315_433160 276
594 3300048929 Ga0496126_0007878 Ga0496126_0007878_2156_3007 276
595 3300050491 nmdc:mga00v17_1756_c1 nmdc:mga00v17_1756_c1_9795_10646 276
596 iso_pu_bacteria 2738543011 2739235306 276
597 iso_pu_bacteria 2889300758 2889301697 276
598 iso_pu_bacteria 2939743619 2939747306 276
599 3300005548 Ga0070665_100079456 Ga0070665_1000794562 277
600 3300005841 Ga0068863_100013710 Ga0068863_1000137105 277
601 3300005842 Ga0068858_100123995 Ga0068858_1001239953 277
602 3300009092 Ga0105250_10043332 Ga0105250_100433321 277
603 3300009101 Ga0105247_10282773 Ga0105247_102827732 277
604 3300009553 Ga0105249_10082444 Ga0105249_100824443 277
605 3300014325 Ga0163163_10083220 Ga0163163_100832203 277
606 3300025711 Ga0207696_1019145 Ga0207696_10191453 277
607 3300025931 Ga0207644_10002811 Ga0207644_1000281110 277
608 3300025931 Ga0207644_10095252 Ga0207644_100952522 277
609 3300025986 Ga0207658_10002974 Ga0207658_100029744 277
610 3300026035 Ga0207703_10134024 Ga0207703_101340242 277
611 3300026088 Ga0207641_10058734 Ga0207641_100587343 277
612 3300028379 Ga0268266_10004771 Ga0268266_1000477110 277
613 3300048905 Ga0496102_0129113 Ga0496102_0129113_528_1361 277
614 3300048906 Ga0496103_0072454 Ga0496103_0072454_116_949 277
615 3300048907 Ga0496104_0634215 Ga0496104_0634215_31_864 277
616 3300048911 Ga0496108_0037091 Ga0496108_0037091_498_1331 277
617 3300048911 Ga0496108_0051664 Ga0496108_0051664_1889_2722 277
618 3300048912 Ga0496109_0174685 Ga0496109_0174685_963_1796 277
619 3300048915 Ga0496112_0311132 Ga0496112_0311132_276_1109 277
620 3300048916 Ga0496113_0406662 Ga0496113_0406662_39_872 277
621 3300050496 nmdc:mga07m45_142308_c1 nmdc:mga07m45_142308_c1_104_937 277
622 3300050496 nmdc:mga07m45_35585_c1 nmdc:mga07m45_35585_c1_20_856 277
623 3300013306 Ga0163162_10055357 Ga0163162_100553574 278
624 3300044658 Ga0466972_0028126 Ga0466972_0028126_582_1427 278
625 3300044683 Ga0466965_0013330 Ga0466965_0013330_2577_3422 278
626 3300044735 Ga0466968_0098941 Ga0466968_0098941_202_1038 278
627 3300045049 Ga0466959_0144046 Ga0466959_0144046_744_1580 278
628 3300006844 Ga0075428_100013479 Ga0075428_1000134799 279
629 3300006846 Ga0075430_100031786 Ga0075430_1000317863 279
630 3300006847 Ga0075431_100092085 Ga0075431_1000920853 279
631 3300009098 Ga0105245_10001215 Ga0105245_100012153 279
632 3300009148 Ga0105243_10001235 Ga0105243_100012357 279
633 3300009174 Ga0105241_10053111 Ga0105241_100531113 279
634 3300009177 Ga0105248_10004628 Ga0105248_100046287 279
635 3300009553 Ga0105249_10032703 Ga0105249_100327035 279
636 3300009553 Ga0105249_10068831 Ga0105249_100688315 279
637 3300013297 Ga0157378_10004183 Ga0157378_1000418314 279
638 3300013306 Ga0163162_10040329 Ga0163162_100403297 279
639 3300013307 Ga0157372_10006800 Ga0157372_100068007 279
640 3300013308 Ga0157375_10004087 Ga0157375_1000408712 279
641 3300014326 Ga0157380_10001110 Ga0157380_100011103 279
642 3300041413 Ga0439465_0001407 Ga0439465_0001407_5634_6473 279
643 3300048905 Ga0496102_0534102 Ga0496102_0534102_48_887 279
644 3300048915 Ga0496112_0089920 Ga0496112_0089920_913_1752 279
645 3300021384 Ga0213876_10002254 Ga0213876_100022549 282
646 3300021388 Ga0213875_10094498 Ga0213875_100944982 282
647 3300037853 Ga0436364_0865025 Ga0436364_0865025_2912_3763 282
648 3300044684 Ga0466966_0004759 Ga0466966_0004759_4552_5406 282
649 3300044693 Ga0466961_0030983 Ga0466961_0030983_1423_2277 282
650 3300044735 Ga0466968_0000903 Ga0466968_0000903_2793_3647 282
651 3300044765 Ga0466970_0005871 Ga0466970_0005871_1916_2770 282
652 3300044842 Ga0466957_0059961 Ga0466957_0059961_618_1472 282
653 3300045836 Ga0466958_0006150 Ga0466958_0006150_4760_5614 282
654 3300025921 Ga0207652_10445336 Ga0207652_104453362 285
655 3300048929 Ga0496126_0002407 Ga0496126_0002407_14266_15147 285
656 3300048904 Ga0496101_0087236 Ga0496101_0087236_749_1636 287
657 3300048905 Ga0496102_0073913 Ga0496102_0073913_1568_2455 287
658 3300048923 Ga0496120_0124555 Ga0496120_0124555_291_1163 287
659 iso_pu_bacteria 2738541274 2738704034 287
660 iso_pu_bacteria 2738543028 2739334408 287
661 iso_pu_bacteria 2902799365 2902800985 287
662 3300036712 Ga0316584_0087933 Ga0316584_0087933_977_1855 290
663 3300037853 Ga0436364_0196904 Ga0436364_0196904_2526_3404 290
664 3300045976 Ga0466967_0068438 Ga0466967_0068438_2269_3144 290
665 3300045976 Ga0466967_0524830 Ga0466967_0524830_183_1073 290
666 3300050491 nmdc:mga00v17_5641_c1 nmdc:mga00v17_5641_c1_2216_3091 290
667 3300050496 nmdc:mga07m45_46133_c1 nmdc:mga07m45_46133_c1_916_1791 290
668 3300005718 Ga0068866_10278566 Ga0068866_102785661 291
669 3300006038 Ga0075365_10049787 Ga0075365_100497873 291
670 3300006186 Ga0075369_10005350 Ga0075369_100053504 291
671 3300025303 Ga0209051_1037337 Ga0209051_10373373 291
672 3300046460 Ga0495638_0014705 Ga0495638_0014705_3215_4093 291
673 3300048929 Ga0496126_0016663 Ga0496126_0016663_2892_3770 291
674 3300050492 nmdc:mga0yw44_8431_c1 nmdc:mga0yw44_8431_c1_4161_5039 291
675 3300050516 nmdc:mga0sz30_190306_c1 nmdc:mga0sz30_190306_c1_22_900 291
676 3300053158 Ga0500627_0002578 Ga0500627_0002578_77_955 291
677 3300053730 Ga0500645_000054 Ga0500645_000054_25943_26821 291
678 3300005842 Ga0068858_100511308 Ga0068858_1005113082 292
679 3300009545 Ga0105237_10030990 Ga0105237_100309903 292
680 3300010375 Ga0105239_10002249 Ga0105239_1000224920 292
681 3300025914 Ga0207671_10010925 Ga0207671_100109255 292
682 3300026095 Ga0207676_10142511 Ga0207676_101425112 292
683 3300048904 Ga0496101_0000019 Ga0496101_0000019_198717_199607 292
684 3300048909 Ga0496106_0022637 Ga0496106_0022637_39_929 292
685 3300048910 Ga0496107_0013411 Ga0496107_0013411_2436_3326 292
686 3300048919 Ga0496116_0000033 Ga0496116_0000033_70540_71430 292
687 3300048920 Ga0496117_0000025 Ga0496117_0000025_70470_71360 292
688 3300048922 Ga0496119_0000403 Ga0496119_0000403_31911_32801 292
689 3300048923 Ga0496120_0000798 Ga0496120_0000798_12560_13450 292
690 3300048924 Ga0496121_0000039 Ga0496121_0000039_181660_182550 292
691 3300048929 Ga0496126_0000405 Ga0496126_0000405_68355_69245 292
692 3300005937 Ga0081455_10004245 Ga0081455_1000424515 293
693 3300025916 Ga0207663_10107599 Ga0207663_101075992 293
694 3300039437 Ga0436365_0659401 Ga0436365_0659401_8274_9170 293
695 3300044684 Ga0466966_0008557 Ga0466966_0008557_5270_6166 293
696 3300044693 Ga0466961_0002569 Ga0466961_0002569_1124_2020 293
697 3300044694 Ga0466963_0052345 Ga0466963_0052345_1564_2460 293
698 3300044706 Ga0466964_0099774 Ga0466964_0099774_164_1060 293
699 3300044719 Ga0466971_0022776 Ga0466971_0022776_1097_1984 293
700 3300044901 Ga0466960_0110377 Ga0466960_0110377_25_921 293
701 3300045049 Ga0466959_0042249 Ga0466959_0042249_2046_2942 293
702 3300045836 Ga0466958_0011621 Ga0466958_0011621_2314_3210 293
703 3300048917 Ga0496114_0397670 Ga0496114_0397670_189_1079 293
704 3300048921 Ga0496118_0001792 Ga0496118_0001792_19570_20460 293
705 3300048929 Ga0496126_0357052 Ga0496126_0357052_253_1155 293
706 3300049581 Ga0501047_0012498 Ga0501047_0012498_1002_1889 293
707 3300049822 Ga0501035_0000417 Ga0501035_0000417_21713_22600 293
708 3300049823 Ga0501044_0001166 Ga0501044_0001166_18213_19100 293
709 3300061719 Ga0466962_0041679 Ga0466962_0041679_1222_2109 293
710 3300050516 nmdc:mga0sz30_842_c2 nmdc:mga0sz30_842_c2_4781_5749 294
711 3300005347 Ga0070668_100002289 Ga0070668_10000228916 295
712 3300005841 Ga0068863_100671027 Ga0068863_1006710271 295
713 3300009148 Ga0105243_10629568 Ga0105243_106295681 295
714 3300009176 Ga0105242_10118330 Ga0105242_101183302 295
715 3300011119 Ga0105246_10496382 Ga0105246_104963822 295
716 3300014968 Ga0157379_10277181 Ga0157379_102771812 295
717 3300017792 Ga0163161_10064177 Ga0163161_100641772 295
718 3300025972 Ga0207668_10005691 Ga0207668_100056916 295
719 3300026118 Ga0207675_100277085 Ga0207675_1002770852 295
720 3300046660 Ga0495625_0203837 Ga0495625_0203837_100_996 295
721 3300048091 Ga0495626_0064966 Ga0495626_0064966_296_1192 295
722 3300048904 Ga0496101_0000622 Ga0496101_0000622_12337_13236 295
723 3300048905 Ga0496102_0022101 Ga0496102_0022101_1273_2172 295
724 3300048907 Ga0496104_0013456 Ga0496104_0013456_4311_5210 295
725 3300048908 Ga0496105_0012622 Ga0496105_0012622_3866_4765 295
726 3300048909 Ga0496106_0004090 Ga0496106_0004090_4462_5361 295
727 3300048910 Ga0496107_0001625 Ga0496107_0001625_8962_9861 295
728 3300048912 Ga0496109_0284980 Ga0496109_0284980_455_1354 295
729 3300048917 Ga0496114_0002275 Ga0496114_0002275_12948_13847 295
730 3300048918 Ga0496115_0001526 Ga0496115_0001526_6240_7139 295
731 3300053108 Ga0500562_006369 Ga0500562_006369_1357_2253 295
732 3300005455 Ga0070663_100106913 Ga0070663_1001069132 296
733 3300005456 Ga0070678_100282215 Ga0070678_1002822153 296
734 3300021384 Ga0213876_10091830 Ga0213876_100918303 296
735 3300026067 Ga0207678_10565113 Ga0207678_105651131 296
736 3300039437 Ga0436365_1273418 Ga0436365_1273418_39_935 296
737 3300006038 Ga0075365_10030422 Ga0075365_100304223 297
738 3300031731 Ga0307405_10093827 Ga0307405_100938273 298
739 3300031852 Ga0307410_10003168 Ga0307410_100031684 298
740 3300032002 Ga0307416_100030526 Ga0307416_1000305264 298
741 3300032005 Ga0307411_10203895 Ga0307411_102038953 298
742 3300005355 Ga0070671_100003579 Ga0070671_1000035795 299
743 3300005355 Ga0070671_100104700 Ga0070671_1001047002 299
744 3300005367 Ga0070667_100016968 Ga0070667_1000169684 299
745 3300005367 Ga0070667_100332217 Ga0070667_1003322172 299
746 3300005544 Ga0070686_100166929 Ga0070686_1001669292 299
747 3300006038 Ga0075365_10003069 Ga0075365_100030699 299
748 3300006048 Ga0075363_100004795 Ga0075363_1000047957 299
749 3300006048 Ga0075363_100005479 Ga0075363_1000054795 299
750 3300006178 Ga0075367_10002207 Ga0075367_100022073 299
751 3300006353 Ga0075370_10005252 Ga0075370_100052527 299
752 3300006353 Ga0075370_10080733 Ga0075370_100807332 299
753 3300025961 Ga0207712_10309105 Ga0207712_103091052 299
754 3300050490 nmdc:mga03n38_44005_c1 nmdc:mga03n38_44005_c1_432_1331 299
755 3300050492 nmdc:mga0yw44_34565_c1 nmdc:mga0yw44_34565_c1_257_1159 299
756 3300050494 nmdc:mga06z11_17517_c1 nmdc:mga06z11_17517_c1_120_1022 299
757 3300050511 nmdc:mga08y16_737197_c1 nmdc:mga08y16_737197_c1_70_969 299
758 3300026023 Ga0207677_10381973 Ga0207677_103819731 300
759 3300046459 Ga0495629_0006511 Ga0495629_0006511_7242_8162 300
760 3300046533 Ga0495640_0053963 Ga0495640_0053963_1255_2175 300
761 3300046690 Ga0495624_0106835 Ga0495624_0106835_771_1691 300
762 3300047315 Ga0495581_0180806 Ga0495581_0180806_280_1200 300
763 3300047673 Ga0495593_0016678 Ga0495593_0016678_1255_2175 300
764 3300048915 Ga0496112_0238183 Ga0496112_0238183_813_1733 300
765 3300006186 Ga0075369_10061175 Ga0075369_100611753 301
766 3300001990 JGI24737J22298_10042961 JGI24737J22298_100429612 303
767 3300002067 JGI24735J21928_10041998 JGI24735J21928_100419982 303
768 3300002075 JGI24738J21930_10007588 JGI24738J21930_100075882 303
769 3300002077 JGI24744J21845_10003124 JGI24744J21845_100031246 303
770 3300005334 Ga0068869_100017978 Ga0068869_1000179783 303
771 3300005335 Ga0070666_10221518 Ga0070666_102215182 303
772 3300005336 Ga0070680_100354431 Ga0070680_1003544312 303
773 3300005337 Ga0070682_100150455 Ga0070682_1001504553 303
774 3300005338 Ga0068868_100005264 Ga0068868_10000526412 303
775 3300005340 Ga0070689_100003359 Ga0070689_1000033598 303
776 3300005341 Ga0070691_10010299 Ga0070691_100102994 303
777 3300005353 Ga0070669_100017202 Ga0070669_1000172023 303
778 3300005356 Ga0070674_100000471 Ga0070674_10000047115 303
779 3300005365 Ga0070688_100012339 Ga0070688_1000123394 303
780 3300005366 Ga0070659_100009523 Ga0070659_1000095239 303
781 3300005367 Ga0070667_100007458 Ga0070667_1000074589 303
782 3300005437 Ga0070710_10001183 Ga0070710_100011831 303
783 3300005438 Ga0070701_10003260 Ga0070701_100032606 303
784 3300005439 Ga0070711_100001458 Ga0070711_10000145811 303
785 3300005440 Ga0070705_100001938 Ga0070705_1000019383 303
786 3300005441 Ga0070700_100001602 Ga0070700_1000016029 303
787 3300005444 Ga0070694_100009611 Ga0070694_1000096114 303
788 3300005455 Ga0070663_100013543 Ga0070663_1000135431 303
789 3300005456 Ga0070678_100000482 Ga0070678_10000048211 303
790 3300005457 Ga0070662_100015443 Ga0070662_1000154435 303
791 3300005459 Ga0068867_100000934 Ga0068867_10000093415 303
792 3300005539 Ga0068853_100105292 Ga0068853_1001052923 303
793 3300005549 Ga0070704_100002252 Ga0070704_1000022525 303
794 3300005578 Ga0068854_100009065 Ga0068854_1000090657 303
795 3300005615 Ga0070702_100004933 Ga0070702_1000049335 303
796 3300005718 Ga0068866_10000543 Ga0068866_1000054311 303
797 3300005719 Ga0068861_100000669 Ga0068861_10000066912 303
798 3300005842 Ga0068858_100030525 Ga0068858_1000305256 303
799 3300005843 Ga0068860_100007980 Ga0068860_10000798012 303
800 3300005844 Ga0068862_100004477 Ga0068862_1000044775 303
801 3300005937 Ga0081455_10017010 Ga0081455_100170102 303
802 3300005981 Ga0081538_10079482 Ga0081538_100794822 303
803 3300006175 Ga0070712_100002733 Ga0070712_1000027339 303
804 3300006237 Ga0097621_100369856 Ga0097621_1003698562 303
805 3300006358 Ga0068871_100448624 Ga0068871_1004486242 303
806 3300006881 Ga0068865_100000375 Ga0068865_10000037521 303
807 3300017792 Ga0163161_10008820 Ga0163161_100088207 303
808 3300025898 Ga0207692_10002301 Ga0207692_1000230110 303
809 3300025899 Ga0207642_10001569 Ga0207642_100015697 303
810 3300025900 Ga0207710_10004333 Ga0207710_100043335 303
811 3300025901 Ga0207688_10010480 Ga0207688_100104808 303
812 3300025903 Ga0207680_10009035 Ga0207680_100090355 303
813 3300025915 Ga0207693_10001043 Ga0207693_1000104321 303
814 3300025927 Ga0207687_10010540 Ga0207687_100105404 303
815 3300025933 Ga0207706_10013244 Ga0207706_100132442 303
816 3300025934 Ga0207686_10020172 Ga0207686_100201726 303
817 3300025937 Ga0207669_10003546 Ga0207669_100035464 303
818 3300025938 Ga0207704_10000983 Ga0207704_100009834 303
819 3300025939 Ga0207665_10002392 Ga0207665_100023922 303
820 3300025941 Ga0207711_10004749 Ga0207711_100047494 303
821 3300025942 Ga0207689_10059640 Ga0207689_100596404 303
822 3300025949 Ga0207667_10150114 Ga0207667_101501143 303
823 3300025961 Ga0207712_10008487 Ga0207712_100084874 303
824 3300025972 Ga0207668_10007628 Ga0207668_100076285 303
825 3300025981 Ga0207640_10008708 Ga0207640_100087085 303
826 3300026023 Ga0207677_10006124 Ga0207677_100061245 303
827 3300026035 Ga0207703_10005256 Ga0207703_100052564 303
828 3300026041 Ga0207639_10016358 Ga0207639_100163583 303
829 3300026067 Ga0207678_10024812 Ga0207678_100248129 303
830 3300026075 Ga0207708_10001649 Ga0207708_1000164914 303
831 3300026078 Ga0207702_10143448 Ga0207702_101434483 303
832 3300026089 Ga0207648_10001183 Ga0207648_1000118315 303
833 3300026118 Ga0207675_100001210 Ga0207675_10000121016 303
834 3300026121 Ga0207683_10000829 Ga0207683_1000082915 303
835 3300028379 Ga0268266_10064183 Ga0268266_100641832 303
836 3300028380 Ga0268265_10010559 Ga0268265_100105594 303
837 3300001977 JGI24746J21847_1001556 JGI24746J21847_10015562 305
838 3300001991 JGI24743J22301_10003990 JGI24743J22301_100039902 305
839 3300002077 JGI24744J21845_10005466 JGI24744J21845_100054663 305
840 3300002239 JGI24034J26672_10013165 JGI24034J26672_100131652 305
841 3300005328 Ga0070676_10027785 Ga0070676_100277853 305
842 3300005334 Ga0068869_100020301 Ga0068869_1000203013 305
843 3300005338 Ga0068868_100049862 Ga0068868_1000498622 305
844 3300005339 Ga0070660_100069801 Ga0070660_1000698012 305
845 3300005345 Ga0070692_10126683 Ga0070692_101266832 305
846 3300005347 Ga0070668_100126623 Ga0070668_1001266233 305
847 3300005353 Ga0070669_100133442 Ga0070669_1001334422 305
848 3300005355 Ga0070671_100114225 Ga0070671_1001142253 305
849 3300005356 Ga0070674_100033147 Ga0070674_1000331474 305
850 3300005364 Ga0070673_100028669 Ga0070673_1000286693 305
851 3300005366 Ga0070659_100086939 Ga0070659_1000869393 305
852 3300005367 Ga0070667_100070944 Ga0070667_1000709442 305
853 3300005434 Ga0070709_10161941 Ga0070709_101619412 305
854 3300005434 Ga0070709_10174314 Ga0070709_101743142 305
855 3300005437 Ga0070710_10058156 Ga0070710_100581563 305
856 3300005439 Ga0070711_100000406 Ga0070711_10000040622 305
857 3300005441 Ga0070700_100295886 Ga0070700_1002958862 305
858 3300005459 Ga0068867_100026719 Ga0068867_1000267193 305
859 3300005546 Ga0070696_100030928 Ga0070696_1000309285 305
860 3300005563 Ga0068855_100146959 Ga0068855_1001469593 305
861 3300005578 Ga0068854_100239728 Ga0068854_1002397282 305
862 3300005615 Ga0070702_100051015 Ga0070702_1000510152 305
863 3300005617 Ga0068859_100266404 Ga0068859_1002664043 305
864 3300005719 Ga0068861_100192641 Ga0068861_1001926412 305
865 3300005834 Ga0068851_10046768 Ga0068851_100467683 305
866 3300005842 Ga0068858_100019851 Ga0068858_1000198513 305
867 3300005843 Ga0068860_100152545 Ga0068860_1001525453 305
868 3300005844 Ga0068862_100046183 Ga0068862_1000461834 305
869 3300005937 Ga0081455_10248051 Ga0081455_102480513 305
870 3300006163 Ga0070715_10146171 Ga0070715_101461712 305
871 3300006173 Ga0070716_100005819 Ga0070716_1000058195 305
872 3300006175 Ga0070712_100021230 Ga0070712_1000212303 305
873 3300006931 Ga0097620_100266375 Ga0097620_1002663752 305
874 3300009098 Ga0105245_10013569 Ga0105245_100135698 305
875 3300009101 Ga0105247_10061866 Ga0105247_100618662 305
876 3300009177 Ga0105248_10130627 Ga0105248_101306273 305
877 3300011119 Ga0105246_10043905 Ga0105246_100439052 305
878 3300013308 Ga0157375_10159637 Ga0157375_101596373 305
879 3300014326 Ga0157380_10494969 Ga0157380_104949692 305
880 3300014745 Ga0157377_10129611 Ga0157377_101296112 305
881 3300014968 Ga0157379_10050480 Ga0157379_100504804 305
882 3300014969 Ga0157376_10242369 Ga0157376_102423692 305
883 3300017792 Ga0163161_10100607 Ga0163161_101006073 305
884 3300025898 Ga0207692_10004267 Ga0207692_100042672 305
885 3300025901 Ga0207688_10000454 Ga0207688_100004547 305
886 3300025904 Ga0207647_10103716 Ga0207647_101037162 305
887 3300025906 Ga0207699_10086856 Ga0207699_100868562 305
888 3300025915 Ga0207693_10002779 Ga0207693_1000277914 305
889 3300025916 Ga0207663_10151550 Ga0207663_101515502 305
890 3300025923 Ga0207681_10345128 Ga0207681_103451282 305
891 3300025927 Ga0207687_10026990 Ga0207687_100269904 305
892 3300025931 Ga0207644_10142158 Ga0207644_101421583 305
893 3300025932 Ga0207690_10304902 Ga0207690_103049022 305
894 3300025933 Ga0207706_10054732 Ga0207706_100547322 305
895 3300025939 Ga0207665_10004004 Ga0207665_100040048 305
896 3300025940 Ga0207691_10053293 Ga0207691_100532933 305
897 3300025942 Ga0207689_10009086 Ga0207689_100090869 305
898 3300025972 Ga0207668_10417182 Ga0207668_104171822 305
899 3300026023 Ga0207677_10262562 Ga0207677_102625621 305
900 3300026067 Ga0207678_10021422 Ga0207678_100214223 305
901 3300026075 Ga0207708_10163519 Ga0207708_101635192 305
902 3300026088 Ga0207641_10365635 Ga0207641_103656352 305
903 3300026089 Ga0207648_10021818 Ga0207648_100218187 305
904 3300026095 Ga0207676_10114078 Ga0207676_101140783 305
905 3300028379 Ga0268266_10009241 Ga0268266_100092413 305
906 3300028380 Ga0268265_10284382 Ga0268265_102843822 305
907 3300035242 Ga0373962_0013580 Ga0373962_0013580_565_1482 305
908 3300048904 Ga0496101_0229061 Ga0496101_0229061_426_1343 305
909 3300048906 Ga0496103_0136342 Ga0496103_0136342_628_1545 305
910 3300048907 Ga0496104_0016581 Ga0496104_0016581_4374_5291 305
911 3300048908 Ga0496105_0063595 Ga0496105_0063595_728_1645 305
912 3300048909 Ga0496106_0338855 Ga0496106_0338855_38_955 305
913 3300048910 Ga0496107_0123542 Ga0496107_0123542_968_1885 305
914 3300048911 Ga0496108_0007756 Ga0496108_0007756_241_1158 305
915 3300048912 Ga0496109_0002261 Ga0496109_0002261_14612_15529 305
916 3300048913 Ga0496110_0179896 Ga0496110_0179896_180_1097 305
917 3300048915 Ga0496112_0014985 Ga0496112_0014985_196_1113 305
918 3300048917 Ga0496114_0164436 Ga0496114_0164436_240_1157 305

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00227

Proteasome

Proteasome subunit

67

257

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lzp-assembly1.cif.gz_G binding of the c-terminal gqyl motif of the bacterial proteasome activator bpa to the 20s proteasome 0.9951 65 284
7pxd-assembly1.cif.gz_Y substrate-engaged mycobacterial proteasome-associated atpase in complex with open-gate 20s cp - composite map (state b) 0.9949 64 285
3mka-assembly1.cif.gz_V crystal structure of mycobacterium tuberculosis proteasome with propetide and an t1a mutation at beta-subunit 0.9903 27 285
3mka-assembly1.cif.gz_E crystal structure of mycobacterium tuberculosis proteasome with propetide and an t1a mutation at beta-subunit 0.9879 27 285
3h6i-assembly1.cif.gz_H crystal structure of mycobacterium tuberculosis proteasome modified by inhibitor gl1 0.9867 66 284
ID Description Score Start End Superfamily
3h6fR00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9805 66 291 3.60.20.10
af_P9WHT9_20_291_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9679 27 293 3.60.20.10
3h6fR00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9674 66 291 3.60.20.10
2jayA00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9607 64 279 3.60.20.10
2jayA00 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.951 64 279 3.60.20.10
ID Description Score Start End GO Terms
AF-A0A2S8N7V0-F1-model_v4 deleted 0.9996 112 195
AF-X8BGF9-F1-model_v4 Proteasome subunit beta (EC 3.4.25.1) 0.9995 98 195 GO:0000502
GO:0016787
AF-A0A6N7GHP8-F1-model_v4 Proteasome subunit beta (EC 3.4.25.1) 0.9921 60 214 GO:0004298
GO:0005737
GO:0005839
GO:0010498
AF-A0A2S8N7V0-F1-model_v4 deleted 0.9878 112 195
AF-A0A7K0P564-F1-model_v4 Proteasome subunit beta (EC 3.4.25.1) 0.9804 60 286 GO:0004298
GO:0005737
GO:0005839
GO:0010498

Feature Viewer

pLDDT pTM Quality
84.11 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map