F485616
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 916 | 308 | 916 | 184 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10071134|Ga0105240_100711345 |
| Length | 187 |
| Sequence | MALDDILLEAEEKMMKSTEVIQAEFAGVRTGKASPDLVTNIMVDAYGGTHMRLKELAAITTPDSRLIQIQPWDATTVEPIRKALEESKLGIMPQVDGKIIRLPIPPLSEERRQDLVKAVRKMAEEGRVSIRANRRHAIDELKKIQKSGEITEDQLADSEKEIQKLTDQYVAEIEKAVEAKEAELLKV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 8 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 9 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 81 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 98 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 115 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 130 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 192 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 193 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 195 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 198 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 199 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 200 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 203 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 204 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 205 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 208 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 209 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 210 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 211 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 212 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 213 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 214 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 216 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 217 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 218 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 219 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 220 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 221 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 222 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 223 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 224 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 225 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 264 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 265 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 266 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 267 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 268 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 271 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 272 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 273 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 274 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 275 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 276 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 277 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 291 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 292 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 293 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 304 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 305 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 306 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 307 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 308 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.86 |
| Nodule | 0 |
| Rhizoplane | 5.79 |
| Rhizosphere | 90.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_153793 | 2162886007 | Bacteria | 2840 |
| 2 | SwRhRL2b_contig_2058463 | 2162886007 | Bacteria | 2479 |
| 3 | JGI24743J22301_10001703 | 3300001991 | Bacteria | 3134 |
| 4 | rootH1_10136363 | 3300003316 | Bacteria | 1639 |
| 5 | rootH2_10026271 | 3300003320 | Bacteria | 12933 |
| 6 | rootH2_10100182 | 3300003320 | Bacteria | 2084 |
| 7 | rootH2_10182195 | 3300003320 | Bacteria | 3263 |
| 8 | rootL2_10011143 | 3300003322 | Bacteria | 9070 |
| 9 | rootL2_10127896 | 3300003322 | Bacteria | 1259 |
| 10 | rootH1_10066215 | 3300003323 | Bacteria | 25527 |
| 11 | JGI25404J52841_10017478 | 3300003659 | Bacteria | 1555 |
| 12 | JGI25405J52794_10006869 | 3300003911 | Bacteria | 2085 |
| 13 | Ga0065703_1021956 | 3300005272 | Bacteria | 1045 |
| 14 | Ga0065704_10003014 | 3300005289 | Bacteria | 6862 |
| 15 | Ga0065704_10003343 | 3300005289 | Bacteria | 4266 |
| 16 | Ga0065704_10124462 | 3300005289 | Bacteria | 1717 |
| 17 | Ga0065704_10486822 | 3300005289 | Unclassified | 667 |
| 18 | Ga0065712_10004789 | 3300005290 | Bacteria | 5445 |
| 19 | Ga0065712_10074696 | 3300005290 | Bacteria | 3980 |
| 20 | Ga0065712_10273811 | 3300005290 | Bacteria | 899 |
| 21 | Ga0065715_10000865 | 3300005293 | Bacteria | 8469 |
| 22 | Ga0065715_10001562 | 3300005293 | Bacteria | 6983 |
| 23 | Ga0065715_10140608 | 3300005293 | Bacteria | 1860 |
| 24 | Ga0065715_10161820 | 3300005293 | Unclassified | 1622 |
| 25 | Ga0065715_10177454 | 3300005293 | Bacteria | 1501 |
| 26 | Ga0065715_10240274 | 3300005293 | Bacteria | 1202 |
| 27 | Ga0065715_10331278 | 3300005293 | Bacteria | 977 |
| 28 | Ga0065715_10411910 | 3300005293 | Unclassified | 868 |
| 29 | Ga0065715_10454564 | 3300005293 | Bacteria | 822 |
| 30 | Ga0065707_10034795 | 3300005295 | Bacteria | 1170 |
| 31 | Ga0065707_10085928 | 3300005295 | Bacteria | 5785 |
| 32 | Ga0065707_10129080 | 3300005295 | Bacteria | 1954 |
| 33 | Ga0065707_10748292 | 3300005295 | Unclassified | 619 |
| 34 | Ga0070658_10005444 | 3300005327 | Bacteria | 10323 |
| 35 | Ga0070676_10014630 | 3300005328 | Bacteria | 4316 |
| 36 | Ga0070676_10015006 | 3300005328 | Bacteria | 4266 |
| 37 | Ga0070676_10024414 | 3300005328 | Bacteria | 3405 |
| 38 | Ga0070676_10352177 | 3300005328 | Bacteria | 1013 |
| 39 | Ga0070683_100166174 | 3300005329 | Bacteria | 2093 |
| 40 | Ga0070683_100714659 | 3300005329 | Bacteria | 960 |
| 41 | Ga0070683_100756990 | 3300005329 | Bacteria | 931 |
| 42 | Ga0070683_101494603 | 3300005329 | Bacteria | 649 |
| 43 | Ga0070690_100012701 | 3300005330 | Bacteria | 4960 |
| 44 | Ga0070690_100212839 | 3300005330 | Bacteria | 1350 |
| 45 | Ga0070690_100321390 | 3300005330 | Bacteria | 1115 |
| 46 | Ga0070690_100327623 | 3300005330 | Bacteria | 1105 |
| 47 | Ga0070670_100012458 | 3300005331 | Bacteria | 7277 |
| 48 | Ga0070670_100212146 | 3300005331 | Bacteria | 1683 |
| 49 | Ga0070670_100799610 | 3300005331 | Bacteria | 852 |
| 50 | Ga0070677_10068670 | 3300005333 | Unclassified | 1484 |
| 51 | Ga0068869_100110552 | 3300005334 | Bacteria | 2090 |
| 52 | Ga0070666_10014664 | 3300005335 | Bacteria | 4991 |
| 53 | Ga0070666_10032237 | 3300005335 | Bacteria | 3460 |
| 54 | Ga0070666_10057602 | 3300005335 | Bacteria | 2626 |
| 55 | Ga0070666_10579915 | 3300005335 | Unclassified | 817 |
| 56 | Ga0070666_10853249 | 3300005335 | Unclassified | 672 |
| 57 | Ga0070680_100253020 | 3300005336 | Bacteria | 1489 |
| 58 | Ga0068868_100038485 | 3300005338 | Bacteria | 3713 |
| 59 | Ga0068868_100270613 | 3300005338 | Bacteria | 1435 |
| 60 | Ga0068868_100425072 | 3300005338 | Unclassified | 1151 |
| 61 | Ga0070660_100111146 | 3300005339 | Bacteria | 2180 |
| 62 | Ga0070660_100159888 | 3300005339 | Bacteria | 1815 |
| 63 | Ga0070660_100213011 | 3300005339 | Bacteria | 1569 |
| 64 | Ga0070660_100216537 | 3300005339 | Bacteria | 1556 |
| 65 | Ga0070689_100059551 | 3300005340 | Bacteria | 2968 |
| 66 | Ga0070689_100146518 | 3300005340 | Bacteria | 1902 |
| 67 | Ga0070689_100148889 | 3300005340 | Bacteria | 1887 |
| 68 | Ga0070689_100180997 | 3300005340 | Bacteria | 1712 |
| 69 | Ga0070689_100534120 | 3300005340 | Bacteria | 1009 |
| 70 | Ga0070689_100651499 | 3300005340 | Bacteria | 916 |
| 71 | Ga0070689_100766747 | 3300005340 | Bacteria | 846 |
| 72 | Ga0070691_10629918 | 3300005341 | Bacteria | 636 |
| 73 | Ga0070687_100010470 | 3300005343 | Bacteria | 4011 |
| 74 | Ga0070661_100000928 | 3300005344 | Bacteria | 20998 |
| 75 | Ga0070661_100033628 | 3300005344 | Bacteria | 3715 |
| 76 | Ga0070692_10764407 | 3300005345 | Unclassified | 656 |
| 77 | Ga0070668_100001187 | 3300005347 | Bacteria | 18465 |
| 78 | Ga0070668_100020811 | 3300005347 | Bacteria | 4955 |
| 79 | Ga0070668_100541083 | 3300005347 | Bacteria | 1013 |
| 80 | Ga0070669_100009942 | 3300005353 | Bacteria | 6770 |
| 81 | Ga0070669_100024318 | 3300005353 | Unclassified | 4343 |
| 82 | Ga0070669_100026331 | 3300005353 | Bacteria | 4184 |
| 83 | Ga0070669_100038737 | 3300005353 | Bacteria | 3461 |
| 84 | Ga0070669_100044533 | 3300005353 | Bacteria | 3233 |
| 85 | Ga0070669_100384763 | 3300005353 | Bacteria | 1145 |
| 86 | Ga0070675_100017585 | 3300005354 | Bacteria | 5684 |
| 87 | Ga0070675_100026530 | 3300005354 | Bacteria | 4650 |
| 88 | Ga0070675_100058782 | 3300005354 | Bacteria | 3171 |
| 89 | Ga0070675_100408305 | 3300005354 | Bacteria | 1213 |
| 90 | Ga0070675_100993338 | 3300005354 | Unclassified | 770 |
| 91 | Ga0070671_100004727 | 3300005355 | Bacteria | 10814 |
| 92 | Ga0070671_100031701 | 3300005355 | Bacteria | 4368 |
| 93 | Ga0070671_100057031 | 3300005355 | Bacteria | 3249 |
| 94 | Ga0070671_100083936 | 3300005355 | Bacteria | 2664 |
| 95 | Ga0070671_100183394 | 3300005355 | Bacteria | 1772 |
| 96 | Ga0070671_100235100 | 3300005355 | Unclassified | 1555 |
| 97 | Ga0070671_100295208 | 3300005355 | Bacteria | 1379 |
| 98 | Ga0070671_100456859 | 3300005355 | Bacteria | 1096 |
| 99 | Ga0070671_100822240 | 3300005355 | Unclassified | 809 |
| 100 | Ga0070674_100083441 | 3300005356 | Bacteria | 2288 |
| 101 | Ga0070674_100112238 | 3300005356 | Bacteria | 2003 |
| 102 | Ga0070674_100340393 | 3300005356 | Unclassified | 1208 |
| 103 | Ga0070673_100000316 | 3300005364 | Bacteria | 25432 |
| 104 | Ga0070673_100043216 | 3300005364 | Bacteria | 3480 |
| 105 | Ga0070673_100250431 | 3300005364 | Bacteria | 1544 |
| 106 | Ga0070673_100490132 | 3300005364 | Bacteria | 1110 |
| 107 | Ga0070688_100002376 | 3300005365 | Bacteria | 9504 |
| 108 | Ga0070659_100016569 | 3300005366 | Bacteria | 5534 |
| 109 | Ga0070659_100397248 | 3300005366 | Bacteria | 1163 |
| 110 | Ga0070659_100718203 | 3300005366 | Bacteria | 865 |
| 111 | Ga0070667_100016077 | 3300005367 | Bacteria | 6190 |
| 112 | Ga0070667_100044655 | 3300005367 | Bacteria | 3722 |
| 113 | Ga0070667_100065751 | 3300005367 | Bacteria | 3079 |
| 114 | Ga0070667_100511178 | 3300005367 | Bacteria | 1102 |
| 115 | Ga0070709_10038486 | 3300005434 | Bacteria | 2929 |
| 116 | Ga0070709_10177478 | 3300005434 | Bacteria | 1493 |
| 117 | Ga0070714_100114550 | 3300005435 | Bacteria | 2392 |
| 118 | Ga0070714_100120875 | 3300005435 | Bacteria | 2330 |
| 119 | Ga0070714_100151164 | 3300005435 | Bacteria | 2092 |
| 120 | Ga0070714_100243297 | 3300005435 | Bacteria | 1661 |
| 121 | Ga0070714_100426429 | 3300005435 | Bacteria | 1257 |
| 122 | Ga0070713_100060238 | 3300005436 | Bacteria | 3173 |
| 123 | Ga0070713_100067318 | 3300005436 | Bacteria | 3015 |
| 124 | Ga0070710_10037266 | 3300005437 | Bacteria | 2663 |
| 125 | Ga0070710_10145657 | 3300005437 | Bacteria | 1456 |
| 126 | Ga0070710_10264400 | 3300005437 | Bacteria | 1110 |
| 127 | Ga0070710_10456660 | 3300005437 | Unclassified | 867 |
| 128 | Ga0070701_10025210 | 3300005438 | Bacteria | 2885 |
| 129 | Ga0070711_100103916 | 3300005439 | Bacteria | 2071 |
| 130 | Ga0070711_100539447 | 3300005439 | Unclassified | 966 |
| 131 | Ga0070705_100051376 | 3300005440 | Bacteria | 2403 |
| 132 | Ga0070705_100072744 | 3300005440 | Bacteria | 2084 |
| 133 | Ga0070705_100146513 | 3300005440 | Bacteria | 1561 |
| 134 | Ga0070705_100193124 | 3300005440 | Bacteria | 1389 |
| 135 | Ga0070700_100377880 | 3300005441 | Unclassified | 1059 |
| 136 | Ga0070708_100002881 | 3300005445 | Bacteria | 13354 |
| 137 | Ga0070708_100034509 | 3300005445 | Bacteria | 4402 |
| 138 | Ga0070708_100308412 | 3300005445 | Bacteria | 1490 |
| 139 | Ga0070708_100321376 | 3300005445 | Bacteria | 1458 |
| 140 | Ga0070708_100323065 | 3300005445 | Unclassified | 1454 |
| 141 | Ga0070708_100506505 | 3300005445 | Bacteria | 1139 |
| 142 | Ga0070708_100663453 | 3300005445 | Bacteria | 982 |
| 143 | Ga0070708_101091157 | 3300005445 | Unclassified | 748 |
| 144 | Ga0070663_100530487 | 3300005455 | Unclassified | 981 |
| 145 | Ga0070678_100002256 | 3300005456 | Bacteria | 10493 |
| 146 | Ga0070678_100027681 | 3300005456 | Bacteria | 3853 |
| 147 | Ga0070678_100112912 | 3300005456 | Bacteria | 2129 |
| 148 | Ga0070678_100188641 | 3300005456 | Unclassified | 1693 |
| 149 | Ga0070678_100197197 | 3300005456 | Bacteria | 1659 |
| 150 | Ga0070662_100003800 | 3300005457 | Bacteria | 9445 |
| 151 | Ga0070662_100049564 | 3300005457 | Bacteria | 3028 |
| 152 | Ga0070662_100153923 | 3300005457 | Bacteria | 1793 |
| 153 | Ga0070662_100254936 | 3300005457 | Bacteria | 1412 |
| 154 | Ga0070662_100612500 | 3300005457 | Bacteria | 916 |
| 155 | Ga0070662_100821004 | 3300005457 | Unclassified | 791 |
| 156 | Ga0070681_10202591 | 3300005458 | Bacteria | 1902 |
| 157 | Ga0070681_10392772 | 3300005458 | Bacteria | 1298 |
| 158 | Ga0070681_10593799 | 3300005458 | Bacteria | 1021 |
| 159 | Ga0068867_100027407 | 3300005459 | Bacteria | 4094 |
| 160 | Ga0068867_100267495 | 3300005459 | Bacteria | 1396 |
| 161 | Ga0070706_100011390 | 3300005467 | Bacteria | 8264 |
| 162 | Ga0070706_100025876 | 3300005467 | Bacteria | 5400 |
| 163 | Ga0070706_100058823 | 3300005467 | Bacteria | 3547 |
| 164 | Ga0070706_100064467 | 3300005467 | Unclassified | 3386 |
| 165 | Ga0070706_100073042 | 3300005467 | Bacteria | 3174 |
| 166 | Ga0070706_100082512 | 3300005467 | Bacteria | 2978 |
| 167 | Ga0070706_100141498 | 3300005467 | Bacteria | 2246 |
| 168 | Ga0070706_100183792 | 3300005467 | Bacteria | 1953 |
| 169 | Ga0070706_100272519 | 3300005467 | Bacteria | 1579 |
| 170 | Ga0070706_100471042 | 3300005467 | Bacteria | 1168 |
| 171 | Ga0070706_101133481 | 3300005467 | Unclassified | 720 |
| 172 | Ga0070707_100000846 | 3300005468 | Bacteria | 30361 |
| 173 | Ga0070707_100022154 | 3300005468 | Bacteria | 6007 |
| 174 | Ga0070707_100023714 | 3300005468 | Bacteria | 5803 |
| 175 | Ga0070707_100026907 | 3300005468 | Bacteria | 5467 |
| 176 | Ga0070707_100046972 | 3300005468 | Bacteria | 4132 |
| 177 | Ga0070707_100048200 | 3300005468 | Unclassified | 4081 |
| 178 | Ga0070707_100101971 | 3300005468 | Bacteria | 2781 |
| 179 | Ga0070707_100127502 | 3300005468 | Bacteria | 2473 |
| 180 | Ga0070707_100143773 | 3300005468 | Unclassified | 2321 |
| 181 | Ga0070707_100198275 | 3300005468 | Bacteria | 1957 |
| 182 | Ga0070707_100220861 | 3300005468 | Bacteria | 1846 |
| 183 | Ga0070707_100268683 | 3300005468 | Bacteria | 1658 |
| 184 | Ga0070707_100274267 | 3300005468 | Unclassified | 1640 |
| 185 | Ga0070707_100489557 | 3300005468 | Bacteria | 1191 |
| 186 | Ga0070698_100002074 | 3300005471 | Bacteria | 22276 |
| 187 | Ga0070698_100005905 | 3300005471 | Bacteria | 13355 |
| 188 | Ga0070698_100007983 | 3300005471 | Bacteria | 11444 |
| 189 | Ga0070698_100085652 | 3300005471 | Bacteria | 3138 |
| 190 | Ga0070698_100672467 | 3300005471 | Unclassified | 977 |
| 191 | Ga0070699_100029144 | 3300005518 | Bacteria | 4760 |
| 192 | Ga0070699_100044262 | 3300005518 | Unclassified | 3855 |
| 193 | Ga0070699_100052006 | 3300005518 | Bacteria | 3547 |
| 194 | Ga0070699_100091835 | 3300005518 | Bacteria | 2655 |
| 195 | Ga0070699_100165982 | 3300005518 | Bacteria | 1956 |
| 196 | Ga0070699_100465337 | 3300005518 | Bacteria | 1147 |
| 197 | Ga0070699_100668664 | 3300005518 | Bacteria | 948 |
| 198 | Ga0070684_100057045 | 3300005535 | Bacteria | 3409 |
| 199 | Ga0070684_100139124 | 3300005535 | Bacteria | 2194 |
| 200 | Ga0070684_100280404 | 3300005535 | Bacteria | 1527 |
| 201 | Ga0070697_100000863 | 3300005536 | Bacteria | 22791 |
| 202 | Ga0070697_100004776 | 3300005536 | Bacteria | 10389 |
| 203 | Ga0070697_100006005 | 3300005536 | Bacteria | 9392 |
| 204 | Ga0070697_100007445 | 3300005536 | Bacteria | 8523 |
| 205 | Ga0070697_100010048 | 3300005536 | Bacteria | 7387 |
| 206 | Ga0070697_100017077 | 3300005536 | Bacteria | 5707 |
| 207 | Ga0070697_100018213 | 3300005536 | Bacteria | 5536 |
| 208 | Ga0070697_100028977 | 3300005536 | Bacteria | 4437 |
| 209 | Ga0070697_100031306 | 3300005536 | Bacteria | 4278 |
| 210 | Ga0070697_100102221 | 3300005536 | Bacteria | 2381 |
| 211 | Ga0070697_100157961 | 3300005536 | Unclassified | 1915 |
| 212 | Ga0070697_100365983 | 3300005536 | Bacteria | 1247 |
| 213 | Ga0070697_100507634 | 3300005536 | Unclassified | 1055 |
| 214 | Ga0068853_100000577 | 3300005539 | Bacteria | 25066 |
| 215 | Ga0070672_100000553 | 3300005543 | Bacteria | 22012 |
| 216 | Ga0070672_100097565 | 3300005543 | Bacteria | 2379 |
| 217 | Ga0070672_100136641 | 3300005543 | Bacteria | 2019 |
| 218 | Ga0070672_100198421 | 3300005543 | Bacteria | 1677 |
| 219 | Ga0070672_100559834 | 3300005543 | Bacteria | 993 |
| 220 | Ga0070672_100683683 | 3300005543 | Bacteria | 898 |
| 221 | Ga0070686_100404841 | 3300005544 | Bacteria | 1039 |
| 222 | Ga0070695_100088692 | 3300005545 | Bacteria | 2060 |
| 223 | Ga0070696_100044534 | 3300005546 | Bacteria | 3073 |
| 224 | Ga0070665_100000201 | 3300005548 | Bacteria | 105051 |
| 225 | Ga0070665_100010897 | 3300005548 | Bacteria | 9196 |
| 226 | Ga0070665_100126750 | 3300005548 | Bacteria | 2555 |
| 227 | Ga0070665_100293469 | 3300005548 | Viruses | 1628 |
| 228 | Ga0070665_100322640 | 3300005548 | Unclassified | 1549 |
| 229 | Ga0070665_100443310 | 3300005548 | Bacteria | 1308 |
| 230 | Ga0070665_100535738 | 3300005548 | Bacteria | 1183 |
| 231 | Ga0070665_100670647 | 3300005548 | Bacteria | 1050 |
| 232 | Ga0070704_100138815 | 3300005549 | Bacteria | 1895 |
| 233 | Ga0070704_100454021 | 3300005549 | Bacteria | 1104 |
| 234 | Ga0068855_100006309 | 3300005563 | Bacteria | 14454 |
| 235 | Ga0070664_100220538 | 3300005564 | Bacteria | 1697 |
| 236 | Ga0070664_100254847 | 3300005564 | Bacteria | 1578 |
| 237 | Ga0068854_100313910 | 3300005578 | Unclassified | 1272 |
| 238 | Ga0068856_100000888 | 3300005614 | Bacteria | 32024 |
| 239 | Ga0068856_100123051 | 3300005614 | Bacteria | 2597 |
| 240 | Ga0068856_100760819 | 3300005614 | Bacteria | 989 |
| 241 | Ga0068852_100365623 | 3300005616 | Bacteria | 1412 |
| 242 | Ga0068852_101050069 | 3300005616 | Bacteria | 834 |
| 243 | Ga0068859_100311139 | 3300005617 | Bacteria | 1669 |
| 244 | Ga0068859_100416287 | 3300005617 | Bacteria | 1440 |
| 245 | Ga0068859_101319318 | 3300005617 | Unclassified | 795 |
| 246 | Ga0068864_100268133 | 3300005618 | Bacteria | 1590 |
| 247 | Ga0068866_10042674 | 3300005718 | Bacteria | 2259 |
| 248 | Ga0068861_100362827 | 3300005719 | Unclassified | 1274 |
| 249 | Ga0068861_100382281 | 3300005719 | Bacteria | 1244 |
| 250 | Ga0068861_100583674 | 3300005719 | Bacteria | 1023 |
| 251 | Ga0068863_100002168 | 3300005841 | Bacteria | 19455 |
| 252 | Ga0068863_100015784 | 3300005841 | Bacteria | 7249 |
| 253 | Ga0068863_100048665 | 3300005841 | Bacteria | 4020 |
| 254 | Ga0068863_100165555 | 3300005841 | Unclassified | 2120 |
| 255 | Ga0068863_100174956 | 3300005841 | Bacteria | 2060 |
| 256 | Ga0068863_100231907 | 3300005841 | Bacteria | 1781 |
| 257 | Ga0068863_100319812 | 3300005841 | Bacteria | 1507 |
| 258 | Ga0068858_100010147 | 3300005842 | Bacteria | 8942 |
| 259 | Ga0068858_100031177 | 3300005842 | Bacteria | 4950 |
| 260 | Ga0068858_100162920 | 3300005842 | Bacteria | 2100 |
| 261 | Ga0068858_100322371 | 3300005842 | Unclassified | 1477 |
| 262 | Ga0068858_100371539 | 3300005842 | Bacteria | 1371 |
| 263 | Ga0068858_100400383 | 3300005842 | Bacteria | 1319 |
| 264 | Ga0068858_100532686 | 3300005842 | Bacteria | 1136 |
| 265 | Ga0068860_100000390 | 3300005843 | Bacteria | 57357 |
| 266 | Ga0068860_100076998 | 3300005843 | Bacteria | 3172 |
| 267 | Ga0068860_100135297 | 3300005843 | Bacteria | 2366 |
| 268 | Ga0068860_100229106 | 3300005843 | Unclassified | 1805 |
| 269 | Ga0068860_100433099 | 3300005843 | Bacteria | 1305 |
| 270 | Ga0068862_100004440 | 3300005844 | Bacteria | 11840 |
| 271 | Ga0068862_100154751 | 3300005844 | Bacteria | 2043 |
| 272 | Ga0068862_100293363 | 3300005844 | Bacteria | 1494 |
| 273 | Ga0068862_100714262 | 3300005844 | Unclassified | 972 |
| 274 | Ga0068862_100848090 | 3300005844 | Unclassified | 895 |
| 275 | Ga0068862_100921085 | 3300005844 | Unclassified | 860 |
| 276 | Ga0081455_10000725 | 3300005937 | Bacteria | 42784 |
| 277 | Ga0081455_10001494 | 3300005937 | Bacteria | 28914 |
| 278 | Ga0081455_10002780 | 3300005937 | Bacteria | 20611 |
| 279 | Ga0081455_10022426 | 3300005937 | Bacteria | 5901 |
| 280 | Ga0081455_10053897 | 3300005937 | Bacteria | 3433 |
| 281 | Ga0081455_10120991 | 3300005937 | Bacteria | 2063 |
| 282 | Ga0081455_10185162 | 3300005937 | Bacteria | 1573 |
| 283 | Ga0081455_10474558 | 3300005937 | Bacteria | 848 |
| 284 | Ga0081540_1000380 | 3300005983 | Bacteria | 44546 |
| 285 | Ga0081540_1007770 | 3300005983 | Bacteria | 7590 |
| 286 | Ga0081540_1049035 | 3300005983 | Bacteria | 2110 |
| 287 | Ga0081539_10000139 | 3300005985 | Bacteria | 170623 |
| 288 | Ga0081539_10000965 | 3300005985 | Bacteria | 53746 |
| 289 | Ga0081539_10012962 | 3300005985 | Bacteria | 6338 |
| 290 | Ga0081539_10024547 | 3300005985 | Bacteria | 3907 |
| 291 | Ga0070717_10000276 | 3300006028 | Bacteria | 35106 |
| 292 | Ga0070717_10010066 | 3300006028 | Bacteria | 7121 |
| 293 | Ga0070717_10025006 | 3300006028 | Bacteria | 4743 |
| 294 | Ga0070717_10034700 | 3300006028 | Bacteria | 4080 |
| 295 | Ga0070717_10063645 | 3300006028 | Bacteria | 3062 |
| 296 | Ga0070717_10519047 | 3300006028 | Bacteria | 1077 |
| 297 | Ga0070717_10807140 | 3300006028 | Bacteria | 854 |
| 298 | Ga0075363_100062862 | 3300006048 | Bacteria | 2002 |
| 299 | Ga0070715_10074332 | 3300006163 | Bacteria | 1526 |
| 300 | Ga0070715_10080698 | 3300006163 | Bacteria | 1476 |
| 301 | Ga0070715_10544484 | 3300006163 | Bacteria | 672 |
| 302 | Ga0070716_100037868 | 3300006173 | Bacteria | 2667 |
| 303 | Ga0070716_100123085 | 3300006173 | Bacteria | 1627 |
| 304 | Ga0070716_100313692 | 3300006173 | Unclassified | 1096 |
| 305 | Ga0070716_100516655 | 3300006173 | Bacteria | 884 |
| 306 | Ga0070712_100002163 | 3300006175 | Bacteria | 12095 |
| 307 | Ga0070712_100027136 | 3300006175 | Bacteria | 3821 |
| 308 | Ga0070712_100065776 | 3300006175 | Bacteria | 2574 |
| 309 | Ga0070712_100114020 | 3300006175 | Bacteria | 2023 |
| 310 | Ga0070712_100120617 | 3300006175 | Bacteria | 1972 |
| 311 | Ga0070712_100219088 | 3300006175 | Bacteria | 1506 |
| 312 | Ga0070712_100236896 | 3300006175 | Bacteria | 1452 |
| 313 | Ga0070712_100438468 | 3300006175 | Bacteria | 1086 |
| 314 | Ga0070712_100557173 | 3300006175 | Bacteria | 966 |
| 315 | Ga0070712_100886924 | 3300006175 | Bacteria | 768 |
| 316 | Ga0070712_101074478 | 3300006175 | Unclassified | 698 |
| 317 | Ga0075362_10000924 | 3300006177 | Bacteria | 8932 |
| 318 | Ga0075362_10052231 | 3300006177 | Bacteria | 1831 |
| 319 | Ga0075366_10113582 | 3300006195 | Bacteria | 1630 |
| 320 | Ga0097621_100112535 | 3300006237 | Bacteria | 2301 |
| 321 | Ga0097621_100370920 | 3300006237 | Unclassified | 1277 |
| 322 | Ga0097621_100638237 | 3300006237 | Bacteria | 976 |
| 323 | Ga0068871_100040017 | 3300006358 | Bacteria | 3753 |
| 324 | Ga0068871_100040202 | 3300006358 | Bacteria | 3745 |
| 325 | Ga0068871_100611275 | 3300006358 | Bacteria | 992 |
| 326 | Ga0068871_100802294 | 3300006358 | Unclassified | 868 |
| 327 | Ga0075428_100592782 | 3300006844 | Bacteria | 1184 |
| 328 | Ga0075428_100674325 | 3300006844 | Bacteria | 1102 |
| 329 | Ga0075433_10393007 | 3300006852 | Bacteria | 1224 |
| 330 | Ga0075433_10580011 | 3300006852 | Bacteria | 985 |
| 331 | Ga0075434_100496625 | 3300006871 | Bacteria | 1241 |
| 332 | Ga0068865_100264128 | 3300006881 | Bacteria | 1364 |
| 333 | Ga0075436_100024009 | 3300006914 | Bacteria | 4191 |
| 334 | Ga0075436_100038456 | 3300006914 | Bacteria | 3303 |
| 335 | Ga0075436_100088864 | 3300006914 | Bacteria | 2147 |
| 336 | Ga0075436_100600255 | 3300006914 | Bacteria | 811 |
| 337 | Ga0097620_100311114 | 3300006931 | Bacteria | 1669 |
| 338 | Ga0097620_100416276 | 3300006931 | Bacteria | 1440 |
| 339 | Ga0097620_101319394 | 3300006931 | Unclassified | 795 |
| 340 | Ga0097620_101727795 | 3300006931 | Unclassified | 691 |
| 341 | Ga0075435_100144434 | 3300007076 | Bacteria | 1998 |
| 342 | Ga0075435_100692382 | 3300007076 | Bacteria | 886 |
| 343 | Ga0075435_100816644 | 3300007076 | Bacteria | 812 |
| 344 | Ga0099795_10067688 | 3300007788 | Bacteria | 1341 |
| 345 | Ga0099795_10127480 | 3300007788 | Bacteria | 1024 |
| 346 | Ga0105240_10071134 | 3300009093 | Bacteria | 4303 |
| 347 | Ga0105240_10095127 | 3300009093 | Bacteria | 3633 |
| 348 | Ga0105240_11055164 | 3300009093 | Unclassified | 867 |
| 349 | Ga0111539_10260557 | 3300009094 | Bacteria | 2018 |
| 350 | Ga0111539_10702902 | 3300009094 | Unclassified | 1177 |
| 351 | Ga0111539_10751131 | 3300009094 | Bacteria | 1135 |
| 352 | Ga0111539_11198028 | 3300009094 | Bacteria | 882 |
| 353 | Ga0111539_11938755 | 3300009094 | Bacteria | 683 |
| 354 | Ga0105245_10051429 | 3300009098 | Bacteria | 3694 |
| 355 | Ga0105245_10114923 | 3300009098 | Unclassified | 2507 |
| 356 | Ga0105247_10124210 | 3300009101 | Bacteria | 1676 |
| 357 | Ga0105247_10208372 | 3300009101 | Bacteria | 1317 |
| 358 | Ga0105247_10464220 | 3300009101 | Bacteria | 915 |
| 359 | Ga0105247_10695238 | 3300009101 | Unclassified | 765 |
| 360 | Ga0114129_10010111 | 3300009147 | Bacteria | 13449 |
| 361 | Ga0114129_10281362 | 3300009147 | Bacteria | 2222 |
| 362 | Ga0114129_10392395 | 3300009147 | Bacteria | 1830 |
| 363 | Ga0105243_10185655 | 3300009148 | Bacteria | 1812 |
| 364 | Ga0105243_11038760 | 3300009148 | Bacteria | 824 |
| 365 | Ga0105243_11717485 | 3300009148 | Unclassified | 657 |
| 366 | Ga0105241_10339536 | 3300009174 | Bacteria | 1301 |
| 367 | Ga0105241_10447474 | 3300009174 | Unclassified | 1142 |
| 368 | Ga0105241_10904324 | 3300009174 | Bacteria | 820 |
| 369 | Ga0105242_10019943 | 3300009176 | Bacteria | 5252 |
| 370 | Ga0105242_10164649 | 3300009176 | Bacteria | 1944 |
| 371 | Ga0105242_10182184 | 3300009176 | Bacteria | 1854 |
| 372 | Ga0105242_11200148 | 3300009176 | Bacteria | 778 |
| 373 | Ga0105248_10286065 | 3300009177 | Bacteria | 1856 |
| 374 | Ga0105248_10496147 | 3300009177 | Bacteria | 1376 |
| 375 | Ga0105237_10018816 | 3300009545 | Bacteria | 7144 |
| 376 | Ga0105237_10110572 | 3300009545 | Bacteria | 2740 |
| 377 | Ga0105238_10137720 | 3300009551 | Unclassified | 2419 |
| 378 | Ga0105238_10998419 | 3300009551 | Bacteria | 858 |
| 379 | Ga0105249_10016016 | 3300009553 | Bacteria | 6645 |
| 380 | Ga0105249_10029932 | 3300009553 | Bacteria | 4918 |
| 381 | Ga0105249_10482098 | 3300009553 | Bacteria | 1283 |
| 382 | Ga0099796_10002329 | 3300010159 | Bacteria | 4144 |
| 383 | Ga0099796_10007686 | 3300010159 | Bacteria | 2830 |
| 384 | Ga0105239_10018427 | 3300010375 | Bacteria | 7712 |
| 385 | Ga0105239_10165978 | 3300010375 | Bacteria | 2469 |
| 386 | Ga0105239_10295621 | 3300010375 | Bacteria | 1824 |
| 387 | Ga0105239_10317509 | 3300010375 | Unclassified | 1756 |
| 388 | Ga0105239_10504864 | 3300010375 | Bacteria | 1375 |
| 389 | Ga0105239_10968756 | 3300010375 | Bacteria | 977 |
| 390 | Ga0105239_11665478 | 3300010375 | Unclassified | 738 |
| 391 | Ga0105246_10104235 | 3300011119 | Bacteria | 2071 |
| 392 | Ga0105246_10235860 | 3300011119 | Bacteria | 1443 |
| 393 | Ga0157341_1025973 | 3300012494 | Bacteria | 607 |
| 394 | Ga0157373_10573312 | 3300013100 | Bacteria | 820 |
| 395 | Ga0157373_10590937 | 3300013100 | Unclassified | 808 |
| 396 | Ga0157371_10168968 | 3300013102 | Bacteria | 1562 |
| 397 | Ga0157371_10343434 | 3300013102 | Bacteria | 1086 |
| 398 | Ga0157369_10326698 | 3300013105 | Bacteria | 1594 |
| 399 | Ga0157374_10000036 | 3300013296 | Bacteria | 176499 |
| 400 | Ga0157374_10002060 | 3300013296 | Bacteria | 16898 |
| 401 | Ga0157374_10023552 | 3300013296 | Bacteria | 5509 |
| 402 | Ga0157374_10087495 | 3300013296 | Bacteria | 2966 |
| 403 | Ga0157374_10108489 | 3300013296 | Bacteria | 2668 |
| 404 | Ga0157374_10138095 | 3300013296 | Bacteria | 2364 |
| 405 | Ga0157374_10171288 | 3300013296 | Bacteria | 2118 |
| 406 | Ga0157374_10190945 | 3300013296 | Unclassified | 2004 |
| 407 | Ga0157374_10249196 | 3300013296 | Bacteria | 1747 |
| 408 | Ga0157374_10324636 | 3300013296 | Bacteria | 1526 |
| 409 | Ga0157374_10389571 | 3300013296 | Bacteria | 1389 |
| 410 | Ga0157374_10459301 | 3300013296 | Bacteria | 1275 |
| 411 | Ga0157374_10528501 | 3300013296 | Bacteria | 1186 |
| 412 | Ga0157374_10535060 | 3300013296 | Bacteria | 1179 |
| 413 | Ga0157374_10701692 | 3300013296 | Bacteria | 1025 |
| 414 | Ga0157378_10016255 | 3300013297 | Bacteria | 6516 |
| 415 | Ga0157378_10055609 | 3300013297 | Bacteria | 3526 |
| 416 | Ga0157378_10121944 | 3300013297 | Bacteria | 2404 |
| 417 | Ga0157378_10144246 | 3300013297 | Bacteria | 2213 |
| 418 | Ga0157378_10217479 | 3300013297 | Bacteria | 1815 |
| 419 | Ga0157378_10343520 | 3300013297 | Bacteria | 1456 |
| 420 | Ga0157378_10375481 | 3300013297 | Unclassified | 1395 |
| 421 | Ga0157378_10532800 | 3300013297 | Bacteria | 1177 |
| 422 | Ga0157378_10578055 | 3300013297 | Bacteria | 1132 |
| 423 | Ga0157378_10579114 | 3300013297 | Unclassified | 1131 |
| 424 | Ga0157378_10836597 | 3300013297 | Bacteria | 948 |
| 425 | Ga0157378_10856317 | 3300013297 | Bacteria | 938 |
| 426 | Ga0157378_11013341 | 3300013297 | Bacteria | 865 |
| 427 | Ga0157378_11195409 | 3300013297 | Bacteria | 800 |
| 428 | Ga0163162_10012238 | 3300013306 | Bacteria | 8373 |
| 429 | Ga0163162_10028980 | 3300013306 | Bacteria | 5479 |
| 430 | Ga0163162_10033387 | 3300013306 | Bacteria | 5114 |
| 431 | Ga0163162_10037100 | 3300013306 | Bacteria | 4861 |
| 432 | Ga0163162_10058128 | 3300013306 | Bacteria | 3895 |
| 433 | Ga0163162_10071548 | 3300013306 | Bacteria | 3522 |
| 434 | Ga0163162_10371410 | 3300013306 | Bacteria | 1563 |
| 435 | Ga0157372_10035116 | 3300013307 | Bacteria | 5517 |
| 436 | Ga0157372_10047250 | 3300013307 | Bacteria | 4782 |
| 437 | Ga0157372_10121487 | 3300013307 | Bacteria | 3001 |
| 438 | Ga0157372_10166313 | 3300013307 | Bacteria | 2551 |
| 439 | Ga0157372_10207336 | 3300013307 | Bacteria | 2271 |
| 440 | Ga0157372_10845908 | 3300013307 | Bacteria | 1062 |
| 441 | Ga0157375_10002351 | 3300013308 | Bacteria | 16339 |
| 442 | Ga0157375_10012538 | 3300013308 | Bacteria | 7523 |
| 443 | Ga0157375_10033130 | 3300013308 | Bacteria | 4906 |
| 444 | Ga0157375_10176945 | 3300013308 | Bacteria | 2284 |
| 445 | Ga0157375_10261482 | 3300013308 | Bacteria | 1892 |
| 446 | Ga0157375_10654968 | 3300013308 | Bacteria | 1206 |
| 447 | Ga0157375_10811863 | 3300013308 | Bacteria | 1084 |
| 448 | Ga0157375_11064352 | 3300013308 | Unclassified | 946 |
| 449 | Ga0163163_10020210 | 3300014325 | Bacteria | 6267 |
| 450 | Ga0163163_10517203 | 3300014325 | Bacteria | 1256 |
| 451 | Ga0182008_10084132 | 3300014497 | Unclassified | 1567 |
| 452 | Ga0182008_10251634 | 3300014497 | Bacteria | 911 |
| 453 | Ga0157377_10070240 | 3300014745 | Bacteria | 2022 |
| 454 | Ga0157377_10371671 | 3300014745 | Bacteria | 965 |
| 455 | Ga0157377_10447460 | 3300014745 | Bacteria | 891 |
| 456 | Ga0157379_10044580 | 3300014968 | Bacteria | 3959 |
| 457 | Ga0157379_10358012 | 3300014968 | Bacteria | 1337 |
| 458 | Ga0157379_10360391 | 3300014968 | Bacteria | 1332 |
| 459 | Ga0157379_10498232 | 3300014968 | Bacteria | 1129 |
| 460 | Ga0157376_10001772 | 3300014969 | Bacteria | 14365 |
| 461 | Ga0157376_10033828 | 3300014969 | Bacteria | 4120 |
| 462 | Ga0157376_10062585 | 3300014969 | Bacteria | 3131 |
| 463 | Ga0157376_10133534 | 3300014969 | Bacteria | 2218 |
| 464 | Ga0157376_10195571 | 3300014969 | Bacteria | 1857 |
| 465 | Ga0157376_10218191 | 3300014969 | Bacteria | 1765 |
| 466 | Ga0157376_10454669 | 3300014969 | Bacteria | 1250 |
| 467 | Ga0157376_11009990 | 3300014969 | Unclassified | 855 |
| 468 | Ga0163161_10039209 | 3300017792 | Bacteria | 3400 |
| 469 | Ga0163161_10707240 | 3300017792 | Bacteria | 839 |
| 470 | Ga0213876_10052819 | 3300021384 | Bacteria | 2147 |
| 471 | Ga0213876_10087300 | 3300021384 | Bacteria | 1651 |
| 472 | Ga0213876_10178599 | 3300021384 | Unclassified | 1129 |
| 473 | Ga0207666_1000965 | 3300025271 | Bacteria | 3420 |
| 474 | Ga0207666_1008904 | 3300025271 | Bacteria | 1347 |
| 475 | Ga0207666_1029194 | 3300025271 | Bacteria | 840 |
| 476 | Ga0207673_1003904 | 3300025290 | Bacteria | 1759 |
| 477 | Ga0207673_1018626 | 3300025290 | Unclassified | 930 |
| 478 | Ga0207697_10000352 | 3300025315 | Bacteria | 25702 |
| 479 | Ga0207697_10001557 | 3300025315 | Bacteria | 12380 |
| 480 | Ga0207697_10002696 | 3300025315 | Bacteria | 9076 |
| 481 | Ga0207697_10013712 | 3300025315 | Unclassified | 3377 |
| 482 | Ga0207697_10017954 | 3300025315 | Bacteria | 2904 |
| 483 | Ga0207697_10017990 | 3300025315 | Bacteria | 2901 |
| 484 | Ga0207697_10018085 | 3300025315 | Bacteria | 2893 |
| 485 | Ga0207697_10038226 | 3300025315 | Bacteria | 1967 |
| 486 | Ga0207697_10051807 | 3300025315 | Bacteria | 1697 |
| 487 | Ga0207697_10070193 | 3300025315 | Bacteria | 1467 |
| 488 | Ga0207653_10255115 | 3300025885 | Unclassified | 673 |
| 489 | Ga0207688_10003192 | 3300025901 | Bacteria | 8945 |
| 490 | Ga0207688_10008291 | 3300025901 | Bacteria | 5648 |
| 491 | Ga0207688_10093005 | 3300025901 | Bacteria | 1733 |
| 492 | Ga0207688_10139122 | 3300025901 | Bacteria | 1428 |
| 493 | Ga0207688_10689957 | 3300025901 | Unclassified | 645 |
| 494 | Ga0207680_10017844 | 3300025903 | Bacteria | 3758 |
| 495 | Ga0207680_10065698 | 3300025903 | Bacteria | 2228 |
| 496 | Ga0207680_10595288 | 3300025903 | Unclassified | 791 |
| 497 | Ga0207647_10043454 | 3300025904 | Bacteria | 2813 |
| 498 | Ga0207685_10017846 | 3300025905 | Bacteria | 2305 |
| 499 | Ga0207699_10188061 | 3300025906 | Bacteria | 1392 |
| 500 | Ga0207645_10000574 | 3300025907 | Bacteria | 30472 |
| 501 | Ga0207645_10002352 | 3300025907 | Bacteria | 14913 |
| 502 | Ga0207645_10010256 | 3300025907 | Bacteria | 6437 |
| 503 | Ga0207645_10027542 | 3300025907 | Bacteria | 3669 |
| 504 | Ga0207645_10221176 | 3300025907 | Bacteria | 1248 |
| 505 | Ga0207645_10263213 | 3300025907 | Unclassified | 1143 |
| 506 | Ga0207705_10072124 | 3300025909 | Bacteria | 2504 |
| 507 | Ga0207684_10000292 | 3300025910 | Bacteria | 71954 |
| 508 | Ga0207684_10007486 | 3300025910 | Bacteria | 9826 |
| 509 | Ga0207684_10009504 | 3300025910 | Bacteria | 8584 |
| 510 | Ga0207684_10013103 | 3300025910 | Bacteria | 7177 |
| 511 | Ga0207684_10045965 | 3300025910 | Bacteria | 3704 |
| 512 | Ga0207684_10051530 | 3300025910 | Bacteria | 3492 |
| 513 | Ga0207684_10113168 | 3300025910 | Bacteria | 2323 |
| 514 | Ga0207684_10117939 | 3300025910 | Bacteria | 2274 |
| 515 | Ga0207684_10262777 | 3300025910 | Bacteria | 1489 |
| 516 | Ga0207684_10286901 | 3300025910 | Bacteria | 1419 |
| 517 | Ga0207684_10727006 | 3300025910 | Bacteria | 842 |
| 518 | Ga0207684_10742794 | 3300025910 | Bacteria | 832 |
| 519 | Ga0207684_10872979 | 3300025910 | Unclassified | 757 |
| 520 | Ga0207707_10132079 | 3300025912 | Bacteria | 2183 |
| 521 | Ga0207671_10010633 | 3300025914 | Bacteria | 7572 |
| 522 | Ga0207671_10037132 | 3300025914 | Bacteria | 3613 |
| 523 | Ga0207671_10111929 | 3300025914 | Bacteria | 2078 |
| 524 | Ga0207671_10164844 | 3300025914 | Bacteria | 1718 |
| 525 | Ga0207693_10002199 | 3300025915 | Bacteria | 17000 |
| 526 | Ga0207693_10005933 | 3300025915 | Bacteria | 10134 |
| 527 | Ga0207693_10028709 | 3300025915 | Bacteria | 4396 |
| 528 | Ga0207693_10031847 | 3300025915 | Bacteria | 4166 |
| 529 | Ga0207693_10038179 | 3300025915 | Bacteria | 3782 |
| 530 | Ga0207693_10046002 | 3300025915 | Bacteria | 3429 |
| 531 | Ga0207693_10086457 | 3300025915 | Bacteria | 2457 |
| 532 | Ga0207663_10082942 | 3300025916 | Bacteria | 2104 |
| 533 | Ga0207663_10171523 | 3300025916 | Bacteria | 1541 |
| 534 | Ga0207663_10490354 | 3300025916 | Unclassified | 953 |
| 535 | Ga0207662_10000559 | 3300025918 | Bacteria | 16548 |
| 536 | Ga0207662_10038587 | 3300025918 | Bacteria | 2799 |
| 537 | Ga0207657_10079476 | 3300025919 | Bacteria | 2759 |
| 538 | Ga0207657_10214476 | 3300025919 | Bacteria | 1544 |
| 539 | Ga0207657_10255089 | 3300025919 | Bacteria | 1397 |
| 540 | Ga0207657_10831922 | 3300025919 | Bacteria | 713 |
| 541 | Ga0207649_10000744 | 3300025920 | Bacteria | 21400 |
| 542 | Ga0207649_10012194 | 3300025920 | Bacteria | 4760 |
| 543 | Ga0207646_10000386 | 3300025922 | Bacteria | 59216 |
| 544 | Ga0207646_10000411 | 3300025922 | Bacteria | 57429 |
| 545 | Ga0207646_10025706 | 3300025922 | Bacteria | 5384 |
| 546 | Ga0207646_10031901 | 3300025922 | Bacteria | 4769 |
| 547 | Ga0207646_10040419 | 3300025922 | Bacteria | 4193 |
| 548 | Ga0207646_10065961 | 3300025922 | Bacteria | 3231 |
| 549 | Ga0207646_10086093 | 3300025922 | Bacteria | 2811 |
| 550 | Ga0207646_10092609 | 3300025922 | Bacteria | 2706 |
| 551 | Ga0207646_10137382 | 3300025922 | Bacteria | 2201 |
| 552 | Ga0207646_10293662 | 3300025922 | Bacteria | 1469 |
| 553 | Ga0207646_10396428 | 3300025922 | Unclassified | 1247 |
| 554 | Ga0207646_10487301 | 3300025922 | Bacteria | 1111 |
| 555 | Ga0207646_10620502 | 3300025922 | Unclassified | 970 |
| 556 | Ga0207681_10008691 | 3300025923 | Bacteria | 6201 |
| 557 | Ga0207681_10021651 | 3300025923 | Bacteria | 4090 |
| 558 | Ga0207681_10164798 | 3300025923 | Bacteria | 1674 |
| 559 | Ga0207681_10173678 | 3300025923 | Bacteria | 1635 |
| 560 | Ga0207681_10187995 | 3300025923 | Bacteria | 1578 |
| 561 | Ga0207681_10355670 | 3300025923 | Bacteria | 1173 |
| 562 | Ga0207694_10168976 | 3300025924 | Unclassified | 1770 |
| 563 | Ga0207650_10027110 | 3300025925 | Bacteria | 4097 |
| 564 | Ga0207650_10609973 | 3300025925 | Bacteria | 918 |
| 565 | Ga0207659_10024917 | 3300025926 | Bacteria | 4015 |
| 566 | Ga0207659_10070936 | 3300025926 | Bacteria | 2542 |
| 567 | Ga0207659_10330431 | 3300025926 | Bacteria | 1260 |
| 568 | Ga0207659_10867113 | 3300025926 | Unclassified | 776 |
| 569 | Ga0207659_11086301 | 3300025926 | Unclassified | 688 |
| 570 | Ga0207659_11169076 | 3300025926 | Bacteria | 661 |
| 571 | Ga0207700_10023918 | 3300025928 | Bacteria | 4222 |
| 572 | Ga0207700_10096728 | 3300025928 | Bacteria | 2345 |
| 573 | Ga0207700_10163843 | 3300025928 | Bacteria | 1849 |
| 574 | Ga0207700_10261353 | 3300025928 | Bacteria | 1482 |
| 575 | Ga0207700_11312300 | 3300025928 | Unclassified | 645 |
| 576 | Ga0207664_10032182 | 3300025929 | Bacteria | 4018 |
| 577 | Ga0207664_10198198 | 3300025929 | Bacteria | 1732 |
| 578 | Ga0207664_10212787 | 3300025929 | Bacteria | 1673 |
| 579 | Ga0207664_10229334 | 3300025929 | Bacteria | 1614 |
| 580 | Ga0207664_10326497 | 3300025929 | Bacteria | 1355 |
| 581 | Ga0207664_10348347 | 3300025929 | Bacteria | 1311 |
| 582 | Ga0207664_10580264 | 3300025929 | Bacteria | 1007 |
| 583 | Ga0207644_10049006 | 3300025931 | Bacteria | 3022 |
| 584 | Ga0207644_10056144 | 3300025931 | Bacteria | 2841 |
| 585 | Ga0207644_10069419 | 3300025931 | Bacteria | 2573 |
| 586 | Ga0207644_10088113 | 3300025931 | Bacteria | 2308 |
| 587 | Ga0207644_10092943 | 3300025931 | Bacteria | 2251 |
| 588 | Ga0207644_10431217 | 3300025931 | Bacteria | 1081 |
| 589 | Ga0207690_10022326 | 3300025932 | Bacteria | 3935 |
| 590 | Ga0207690_10045762 | 3300025932 | Bacteria | 2893 |
| 591 | Ga0207690_10141566 | 3300025932 | Bacteria | 1773 |
| 592 | Ga0207690_11078842 | 3300025932 | Bacteria | 669 |
| 593 | Ga0207706_10003684 | 3300025933 | Bacteria | 14623 |
| 594 | Ga0207706_10020606 | 3300025933 | Bacteria | 5925 |
| 595 | Ga0207706_10208517 | 3300025933 | Bacteria | 1713 |
| 596 | Ga0207706_10212759 | 3300025933 | Bacteria | 1694 |
| 597 | Ga0207706_10378465 | 3300025933 | Bacteria | 1228 |
| 598 | Ga0207706_10812614 | 3300025933 | Unclassified | 794 |
| 599 | Ga0207706_10950770 | 3300025933 | Unclassified | 724 |
| 600 | Ga0207686_10062018 | 3300025934 | Bacteria | 2372 |
| 601 | Ga0207686_10515206 | 3300025934 | Unclassified | 930 |
| 602 | Ga0207709_10674066 | 3300025935 | Bacteria | 825 |
| 603 | Ga0207670_10052677 | 3300025936 | Bacteria | 2737 |
| 604 | Ga0207670_10103452 | 3300025936 | Bacteria | 2038 |
| 605 | Ga0207670_10140489 | 3300025936 | Bacteria | 1781 |
| 606 | Ga0207670_10474620 | 3300025936 | Bacteria | 1012 |
| 607 | Ga0207669_10003562 | 3300025937 | Bacteria | 6747 |
| 608 | Ga0207669_10105937 | 3300025937 | Bacteria | 1871 |
| 609 | Ga0207669_10297533 | 3300025937 | Bacteria | 1225 |
| 610 | Ga0207669_10912238 | 3300025937 | Bacteria | 734 |
| 611 | Ga0207665_10006694 | 3300025939 | Bacteria | 7648 |
| 612 | Ga0207665_10015683 | 3300025939 | Bacteria | 4973 |
| 613 | Ga0207665_10026197 | 3300025939 | Bacteria | 3848 |
| 614 | Ga0207665_10045327 | 3300025939 | Bacteria | 2944 |
| 615 | Ga0207665_10113592 | 3300025939 | Bacteria | 1906 |
| 616 | Ga0207665_10152353 | 3300025939 | Bacteria | 1657 |
| 617 | Ga0207665_10265790 | 3300025939 | Bacteria | 1272 |
| 618 | Ga0207665_10907769 | 3300025939 | Unclassified | 699 |
| 619 | Ga0207691_10003715 | 3300025940 | Bacteria | 14809 |
| 620 | Ga0207691_10004494 | 3300025940 | Bacteria | 13501 |
| 621 | Ga0207691_10075598 | 3300025940 | Bacteria | 3037 |
| 622 | Ga0207691_10135861 | 3300025940 | Bacteria | 2168 |
| 623 | Ga0207691_10164829 | 3300025940 | Bacteria | 1943 |
| 624 | Ga0207691_10488918 | 3300025940 | Bacteria | 1046 |
| 625 | Ga0207691_10532430 | 3300025940 | Bacteria | 997 |
| 626 | Ga0207711_10448858 | 3300025941 | Bacteria | 1200 |
| 627 | Ga0207711_11189047 | 3300025941 | Bacteria | 704 |
| 628 | Ga0207689_10027373 | 3300025942 | Bacteria | 4773 |
| 629 | Ga0207661_10154368 | 3300025944 | Bacteria | 1987 |
| 630 | Ga0207679_10020501 | 3300025945 | Bacteria | 4462 |
| 631 | Ga0207679_10185110 | 3300025945 | Bacteria | 1726 |
| 632 | Ga0207679_10663262 | 3300025945 | Bacteria | 944 |
| 633 | Ga0207667_10001014 | 3300025949 | Bacteria | 35767 |
| 634 | Ga0207651_10025449 | 3300025960 | Bacteria | 3678 |
| 635 | Ga0207651_10097110 | 3300025960 | Bacteria | 2175 |
| 636 | Ga0207651_10233593 | 3300025960 | Bacteria | 1494 |
| 637 | Ga0207651_10258094 | 3300025960 | Bacteria | 1429 |
| 638 | Ga0207712_10032945 | 3300025961 | Bacteria | 3500 |
| 639 | Ga0207668_10012259 | 3300025972 | Bacteria | 5241 |
| 640 | Ga0207668_10016783 | 3300025972 | Bacteria | 4578 |
| 641 | Ga0207668_10017669 | 3300025972 | Bacteria | 4474 |
| 642 | Ga0207668_10088504 | 3300025972 | Bacteria | 2268 |
| 643 | Ga0207658_10010561 | 3300025986 | Bacteria | 6273 |
| 644 | Ga0207658_10089256 | 3300025986 | Bacteria | 2386 |
| 645 | Ga0207658_10275290 | 3300025986 | Unclassified | 1440 |
| 646 | Ga0207658_10370583 | 3300025986 | Bacteria | 1252 |
| 647 | Ga0207677_10056854 | 3300026023 | Bacteria | 2683 |
| 648 | Ga0207677_10129275 | 3300026023 | Bacteria | 1914 |
| 649 | Ga0207677_10327359 | 3300026023 | Bacteria | 1276 |
| 650 | Ga0207677_10579027 | 3300026023 | Bacteria | 982 |
| 651 | Ga0207703_10010258 | 3300026035 | Bacteria | 7337 |
| 652 | Ga0207703_10039645 | 3300026035 | Bacteria | 3765 |
| 653 | Ga0207703_10120051 | 3300026035 | Bacteria | 2256 |
| 654 | Ga0207703_10364796 | 3300026035 | Unclassified | 1333 |
| 655 | Ga0207703_10565938 | 3300026035 | Bacteria | 1073 |
| 656 | Ga0207639_10000582 | 3300026041 | Bacteria | 25109 |
| 657 | Ga0207678_10022513 | 3300026067 | Bacteria | 5518 |
| 658 | Ga0207678_10173267 | 3300026067 | Unclassified | 1842 |
| 659 | Ga0207678_10295600 | 3300026067 | Bacteria | 1391 |
| 660 | Ga0207708_10189875 | 3300026075 | Bacteria | 1635 |
| 661 | Ga0207702_10025662 | 3300026078 | Bacteria | 4891 |
| 662 | Ga0207702_10403033 | 3300026078 | Bacteria | 1319 |
| 663 | Ga0207641_10045684 | 3300026088 | Bacteria | 3689 |
| 664 | Ga0207641_10054972 | 3300026088 | Bacteria | 3380 |
| 665 | Ga0207641_10055335 | 3300026088 | Bacteria | 3368 |
| 666 | Ga0207641_10155856 | 3300026088 | Bacteria | 2072 |
| 667 | Ga0207641_10211252 | 3300026088 | Bacteria | 1795 |
| 668 | Ga0207641_10443888 | 3300026088 | Bacteria | 1253 |
| 669 | Ga0207648_10220187 | 3300026089 | Bacteria | 1687 |
| 670 | Ga0207648_10287070 | 3300026089 | Unclassified | 1472 |
| 671 | Ga0207676_10249933 | 3300026095 | Bacteria | 1596 |
| 672 | Ga0207676_10941628 | 3300026095 | Bacteria | 849 |
| 673 | Ga0207675_100095869 | 3300026118 | Bacteria | 2792 |
| 674 | Ga0207675_101490259 | 3300026118 | Unclassified | 697 |
| 675 | Ga0207675_101602324 | 3300026118 | Bacteria | 671 |
| 676 | Ga0207683_10008548 | 3300026121 | Bacteria | 8763 |
| 677 | Ga0207683_10026404 | 3300026121 | Bacteria | 5012 |
| 678 | Ga0207683_10130361 | 3300026121 | Bacteria | 2261 |
| 679 | Ga0207683_10272290 | 3300026121 | Bacteria | 1547 |
| 680 | Ga0207683_10336210 | 3300026121 | Bacteria | 1384 |
| 681 | Ga0207698_10579700 | 3300026142 | Bacteria | 1103 |
| 682 | Ga0209971_1099613 | 3300027682 | Unclassified | 711 |
| 683 | Ga0209974_10030866 | 3300027876 | Bacteria | 1775 |
| 684 | Ga0209974_10112622 | 3300027876 | Bacteria | 959 |
| 685 | Ga0268266_10000197 | 3300028379 | Bacteria | 105077 |
| 686 | Ga0268266_10002434 | 3300028379 | Bacteria | 19993 |
| 687 | Ga0268266_10012778 | 3300028379 | Bacteria | 7255 |
| 688 | Ga0268266_10013406 | 3300028379 | Bacteria | 7060 |
| 689 | Ga0268266_10075111 | 3300028379 | Bacteria | 2935 |
| 690 | Ga0268266_10286554 | 3300028379 | Unclassified | 1533 |
| 691 | Ga0268266_10477502 | 3300028379 | Bacteria | 1188 |
| 692 | Ga0268266_10677511 | 3300028379 | Bacteria | 993 |
| 693 | Ga0268265_10044621 | 3300028380 | Bacteria | 3302 |
| 694 | Ga0268265_10096538 | 3300028380 | Bacteria | 2376 |
| 695 | Ga0268265_10499190 | 3300028380 | Bacteria | 1146 |
| 696 | Ga0268265_11060816 | 3300028380 | Unclassified | 803 |
| 697 | Ga0268264_10000800 | 3300028381 | Bacteria | 33994 |
| 698 | Ga0268264_10254913 | 3300028381 | Bacteria | 1632 |
| 699 | Ga0268264_10374614 | 3300028381 | Bacteria | 1362 |
| 700 | Ga0268264_10606452 | 3300028381 | Bacteria | 1079 |
| 701 | Ga0307511_10000128 | 3300030521 | Bacteria | 69098 |
| 702 | Ga0373944_0038430 | 3300035089 | Bacteria | 1470 |
| 703 | Ga0373944_0274833 | 3300035089 | Unclassified | 627 |
| 704 | Ga0373923_0083000 | 3300035111 | Unclassified | 1392 |
| 705 | Ga0373923_0137669 | 3300035111 | Bacteria | 1102 |
| 706 | Ga0373939_0039936 | 3300035114 | Bacteria | 1407 |
| 707 | Ga0373945_0087316 | 3300035116 | Bacteria | 1203 |
| 708 | Ga0373953_0091928 | 3300035117 | Bacteria | 1270 |
| 709 | Ga0373954_0492117 | 3300035118 | Unclassified | 607 |
| 710 | Ga0373956_0309188 | 3300035119 | Unclassified | 753 |
| 711 | Ga0373943_0016752 | 3300035170 | Bacteria | 3347 |
| 712 | Ga0373943_0024378 | 3300035170 | Unclassified | 2820 |
| 713 | Ga0373943_0035717 | 3300035170 | Bacteria | 2377 |
| 714 | Ga0373943_0055648 | 3300035170 | Bacteria | 1960 |
| 715 | Ga0373943_0371917 | 3300035170 | Unclassified | 822 |
| 716 | Ga0373931_0547570 | 3300035691 | Bacteria | 751 |
| 717 | Ga0373935_0112443 | 3300035692 | Bacteria | 1809 |
| 718 | Ga0373935_0200565 | 3300035692 | Bacteria | 1378 |
| 719 | Ga0373935_0200707 | 3300035692 | Unclassified | 1378 |
| 720 | Ga0373935_0203073 | 3300035692 | Bacteria | 1370 |
| 721 | Ga0373935_0421558 | 3300035692 | Bacteria | 961 |
| 722 | Ga0373927_0100804 | 3300035695 | Bacteria | 1877 |
| 723 | Ga0373933_0070022 | 3300035724 | Bacteria | 2133 |
| 724 | Ga0373947_0008617 | 3300035725 | Bacteria | 5871 |
| 725 | Ga0373947_0104687 | 3300035725 | Bacteria | 1782 |
| 726 | Ga0373947_0642884 | 3300035725 | Bacteria | 723 |
| 727 | Ga0373937_0017352 | 3300036401 | Bacteria | 6412 |
| 728 | Ga0373937_0360283 | 3300036401 | Bacteria | 1378 |
| 729 | Ga0373937_0469403 | 3300036401 | Bacteria | 1195 |
| 730 | Ga0373937_0923950 | 3300036401 | Bacteria | 821 |
| 731 | Ga0373925_0163863 | 3300037068 | Unclassified | 1752 |
| 732 | Ga0373925_0273176 | 3300037068 | Bacteria | 1360 |
| 733 | Ga0373925_0631197 | 3300037068 | Unclassified | 883 |
| 734 | Ga0395899_0022448 | 3300037312 | Bacteria | 4786 |
| 735 | Ga0395900_0003229 | 3300037418 | Bacteria | 17656 |
| 736 | Ga0395900_0081553 | 3300037418 | Bacteria | 3323 |
| 737 | Ga0395900_0423417 | 3300037418 | Bacteria | 1292 |
| 738 | Ga0395900_0646072 | 3300037418 | Unclassified | 995 |
| 739 | Ga0395898_0000067 | 3300037466 | Bacteria | 255955 |
| 740 | Ga0395898_0013011 | 3300037466 | Bacteria | 8577 |
| 741 | Ga0395898_0275473 | 3300037466 | Bacteria | 1605 |
| 742 | Ga0395905_0013270 | 3300037471 | Bacteria | 7904 |
| 743 | Ga0395905_0691593 | 3300037471 | Unclassified | 922 |
| 744 | Ga0395905_1186637 | 3300037471 | Bacteria | 667 |
| 745 | Ga0395905_1270881 | 3300037471 | Bacteria | 640 |
| 746 | Ga0436364_0633325 | 3300037853 | Bacteria | 1550 |
| 747 | Ga0395901_0009691 | 3300038443 | Bacteria | 9769 |
| 748 | Ga0395901_0018727 | 3300038443 | Bacteria | 7074 |
| 749 | Ga0395901_0240837 | 3300038443 | Bacteria | 1887 |
| 750 | Ga0436365_0561697 | 3300039437 | Bacteria | 12593 |
| 751 | Ga0436365_1218062 | 3300039437 | Unclassified | 882 |
| 752 | Ga0436365_1366941 | 3300039437 | Bacteria | 6906 |
| 753 | Ga0436365_1440966 | 3300039437 | Bacteria | 13512 |
| 754 | Ga0451807_2518792 | 3300041486 | Bacteria | 704 |
| 755 | Ga0451839_1498401 | 3300041496 | Bacteria | 872 |
| 756 | Ga0451853_2598742 | 3300041512 | Bacteria | 701 |
| 757 | Ga0451853_2845883 | 3300041512 | Unclassified | 1379 |
| 758 | Ga0439450_035088 | 3300042008 | Bacteria | 1143 |
| 759 | Ga0439451_013983 | 3300042009 | Bacteria | 1619 |
| 760 | Ga0439454_047137 | 3300042011 | Unclassified | 719 |
| 761 | Ga0439455_0000990 | 3300042012 | Bacteria | 4455 |
| 762 | Ga0439464_0039742 | 3300042439 | Bacteria | 1338 |
| 763 | Ga0439440_0055893 | 3300042993 | Bacteria | 997 |
| 764 | Ga0466957_0008871 | 3300044842 | Bacteria | 5728 |
| 765 | Ga0451576_0081187 | 3300045051 | Bacteria | 3372 |
| 766 | Ga0495592_0015795 | 3300046454 | Bacteria | 5728 |
| 767 | Ga0495592_0235248 | 3300046454 | Bacteria | 1218 |
| 768 | Ga0495590_0195566 | 3300046457 | Bacteria | 742 |
| 769 | Ga0495641_0102353 | 3300046461 | Bacteria | 1278 |
| 770 | Ga0495651_0332021 | 3300046462 | Bacteria | 1010 |
| 771 | Ga0495653_0285943 | 3300046463 | Unclassified | 1080 |
| 772 | Ga0495653_0424291 | 3300046463 | Bacteria | 841 |
| 773 | Ga0495580_0067910 | 3300046472 | Bacteria | 2494 |
| 774 | Ga0495580_0093599 | 3300046472 | Bacteria | 2091 |
| 775 | Ga0495580_0620878 | 3300046472 | Unclassified | 713 |
| 776 | Ga0495584_0383249 | 3300046491 | Unclassified | 714 |
| 777 | Ga0495585_0063921 | 3300046492 | Bacteria | 2019 |
| 778 | Ga0495608_0461492 | 3300046511 | Unclassified | 772 |
| 779 | Ga0495618_0387797 | 3300046514 | Bacteria | 856 |
| 780 | Ga0495628_0017947 | 3300046516 | Bacteria | 5872 |
| 781 | Ga0495628_0254705 | 3300046516 | Bacteria | 1309 |
| 782 | Ga0495630_0203828 | 3300046517 | Bacteria | 1509 |
| 783 | Ga0495642_0382726 | 3300046528 | Unclassified | 620 |
| 784 | Ga0495640_0619142 | 3300046533 | Bacteria | 653 |
| 785 | Ga0495586_0081448 | 3300046535 | Bacteria | 1779 |
| 786 | Ga0495587_0085278 | 3300046536 | Bacteria | 1829 |
| 787 | Ga0495598_0008807 | 3300046537 | Bacteria | 2362 |
| 788 | Ga0495598_0144494 | 3300046537 | Unclassified | 826 |
| 789 | Ga0495621_0094286 | 3300046539 | Bacteria | 1132 |
| 790 | Ga0495645_0069614 | 3300046543 | Bacteria | 2540 |
| 791 | Ga0495667_0078427 | 3300046559 | Bacteria | 2148 |
| 792 | Ga0495634_0120042 | 3300046642 | Bacteria | 1684 |
| 793 | Ga0495635_0061356 | 3300046663 | Bacteria | 2583 |
| 794 | Ga0495635_0110478 | 3300046663 | Bacteria | 1878 |
| 795 | Ga0495659_0007308 | 3300046664 | Bacteria | 3502 |
| 796 | Ga0495659_0079302 | 3300046664 | Bacteria | 1244 |
| 797 | Ga0495659_0105230 | 3300046664 | Unclassified | 1097 |
| 798 | Ga0495657_0151078 | 3300046675 | Bacteria | 1442 |
| 799 | Ga0495599_0050381 | 3300046678 | Bacteria | 2609 |
| 800 | Ga0495599_0096786 | 3300046678 | Bacteria | 1840 |
| 801 | Ga0495646_0137047 | 3300046680 | Bacteria | 1372 |
| 802 | Ga0495669_0043499 | 3300046684 | Bacteria | 1999 |
| 803 | Ga0495669_0111669 | 3300046684 | Bacteria | 1277 |
| 804 | Ga0495669_0259155 | 3300046684 | Bacteria | 835 |
| 805 | Ga0495669_0366326 | 3300046684 | Unclassified | 697 |
| 806 | Ga0495613_0251919 | 3300046689 | Bacteria | 1232 |
| 807 | Ga0495600_0608706 | 3300046809 | Unclassified | 663 |
| 808 | Ga0495604_0701632 | 3300047317 | Bacteria | 642 |
| 809 | Ga0495674_0156853 | 3300047319 | Bacteria | 1906 |
| 810 | Ga0495674_0276404 | 3300047319 | Bacteria | 1377 |
| 811 | Ga0495675_0334770 | 3300047444 | Bacteria | 893 |
| 812 | Ga0495679_070148 | 3300047446 | Unclassified | 1011 |
| 813 | Ga0495684_0011055 | 3300047471 | Bacteria | 6978 |
| 814 | Ga0495684_0246955 | 3300047471 | Unclassified | 1300 |
| 815 | Ga0495602_0048024 | 3300048088 | Bacteria | 3841 |
| 816 | Ga0495602_0152176 | 3300048088 | Bacteria | 1817 |
| 817 | Ga0495614_0228905 | 3300048089 | Bacteria | 847 |
| 818 | Ga0496100_0162311 | 3300048903 | Bacteria | 1603 |
| 819 | Ga0496101_0002348 | 3300048904 | Bacteria | 11613 |
| 820 | Ga0496101_0208763 | 3300048904 | Bacteria | 1512 |
| 821 | Ga0496101_0367845 | 3300048904 | Unclassified | 1131 |
| 822 | Ga0496102_0058769 | 3300048905 | Bacteria | 3514 |
| 823 | Ga0496102_0191535 | 3300048905 | Bacteria | 1927 |
| 824 | Ga0496103_0031648 | 3300048906 | Bacteria | 3225 |
| 825 | Ga0496103_0383358 | 3300048906 | Bacteria | 903 |
| 826 | Ga0496103_0545255 | 3300048906 | Bacteria | 741 |
| 827 | Ga0496104_0041736 | 3300048907 | Bacteria | 4303 |
| 828 | Ga0496104_0101814 | 3300048907 | Bacteria | 2750 |
| 829 | Ga0496104_0519694 | 3300048907 | Bacteria | 1102 |
| 830 | Ga0496104_1367337 | 3300048907 | Unclassified | 611 |
| 831 | Ga0496105_0027127 | 3300048908 | Bacteria | 4676 |
| 832 | Ga0496105_0045415 | 3300048908 | Bacteria | 3624 |
| 833 | Ga0496105_0555296 | 3300048908 | Unclassified | 896 |
| 834 | Ga0496105_0633932 | 3300048908 | Bacteria | 826 |
| 835 | Ga0496107_0015028 | 3300048910 | Bacteria | 5423 |
| 836 | Ga0496107_0185541 | 3300048910 | Bacteria | 1545 |
| 837 | Ga0496108_0013695 | 3300048911 | Bacteria | 6619 |
| 838 | Ga0496108_0024559 | 3300048911 | Bacteria | 4964 |
| 839 | Ga0496108_0174056 | 3300048911 | Bacteria | 1863 |
| 840 | Ga0496108_0255638 | 3300048911 | Unclassified | 1524 |
| 841 | Ga0496108_1050666 | 3300048911 | Bacteria | 694 |
| 842 | Ga0496109_0006405 | 3300048912 | Bacteria | 9910 |
| 843 | Ga0496109_0020560 | 3300048912 | Bacteria | 5830 |
| 844 | Ga0496109_0103310 | 3300048912 | Bacteria | 2645 |
| 845 | Ga0496109_0145667 | 3300048912 | Unclassified | 2216 |
| 846 | Ga0496109_0212548 | 3300048912 | Bacteria | 1819 |
| 847 | Ga0496109_0215034 | 3300048912 | Bacteria | 1808 |
| 848 | Ga0496110_0000261 | 3300048913 | Bacteria | 34222 |
| 849 | Ga0496111_0000086 | 3300048914 | Bacteria | 39141 |
| 850 | Ga0496111_0425633 | 3300048914 | Bacteria | 981 |
| 851 | Ga0496111_0585882 | 3300048914 | Unclassified | 817 |
| 852 | Ga0496112_0001268 | 3300048915 | Bacteria | 19164 |
| 853 | Ga0496112_0007980 | 3300048915 | Bacteria | 9440 |
| 854 | Ga0496112_0262373 | 3300048915 | Bacteria | 1677 |
| 855 | Ga0496112_0269690 | 3300048915 | Bacteria | 1650 |
| 856 | Ga0496112_0275236 | 3300048915 | Unclassified | 1631 |
| 857 | Ga0496112_0540839 | 3300048915 | Unclassified | 1099 |
| 858 | Ga0496113_0011618 | 3300048916 | Bacteria | 5885 |
| 859 | Ga0496113_0015364 | 3300048916 | Bacteria | 5260 |
| 860 | Ga0496113_0140688 | 3300048916 | Bacteria | 1899 |
| 861 | Ga0496113_0362641 | 3300048916 | Bacteria | 1163 |
| 862 | Ga0496114_0034784 | 3300048917 | Bacteria | 4159 |
| 863 | Ga0496114_0156296 | 3300048917 | Bacteria | 1980 |
| 864 | Ga0496114_0240962 | 3300048917 | Bacteria | 1590 |
| 865 | Ga0496114_1011394 | 3300048917 | Bacteria | 715 |
| 866 | Ga0496115_0005081 | 3300048918 | Bacteria | 9565 |
| 867 | Ga0496115_0088251 | 3300048918 | Bacteria | 2532 |
| 868 | Ga0496115_0504942 | 3300048918 | Bacteria | 971 |
| 869 | Ga0496115_0543295 | 3300048918 | Bacteria | 929 |
| 870 | Ga0496125_0000187 | 3300048928 | Bacteria | 134976 |
| 871 | Ga0501031_0001565 | 3300049568 | Bacteria | 14245 |
| 872 | Ga0501032_0039863 | 3300049569 | Bacteria | 3194 |
| 873 | Ga0501032_0084887 | 3300049569 | Bacteria | 2105 |
| 874 | Ga0501033_0000024 | 3300049570 | Bacteria | 175859 |
| 875 | Ga0501037_0000020 | 3300049573 | Bacteria | 155468 |
| 876 | Ga0501038_0000212 | 3300049574 | Bacteria | 49792 |
| 877 | Ga0501039_0010969 | 3300049575 | Bacteria | 6907 |
| 878 | Ga0501043_0010380 | 3300049579 | Bacteria | 7298 |
| 879 | Ga0501043_0018694 | 3300049579 | Bacteria | 5438 |
| 880 | Ga0501047_0015893 | 3300049581 | Bacteria | 7174 |
| 881 | Ga0501067_0015189 | 3300049583 | Bacteria | 4263 |
| 882 | Ga0501068_0579966 | 3300049584 | Bacteria | 730 |
| 883 | Ga0501070_0012473 | 3300049586 | Bacteria | 7169 |
| 884 | Ga0501070_0140616 | 3300049586 | Bacteria | 1993 |
| 885 | Ga0501035_0000216 | 3300049822 | Bacteria | 69506 |
| 886 | Ga0501044_0000510 | 3300049823 | Bacteria | 47224 |
| 887 | nmdc:mga03683_12012_c1 | 3300050489 | Bacteria | 3150 |
| 888 | nmdc:mga03683_298_c1 | 3300050489 | Bacteria | 14687 |
| 889 | nmdc:mga03n38_103243_c1 | 3300050490 | Bacteria | 1378 |
| 890 | nmdc:mga0k408_2179_c1 | 3300050493 | Bacteria | 10511 |
| 891 | nmdc:mga0k408_369_c1 | 3300050493 | Bacteria | 24668 |
| 892 | nmdc:mga05p37_17694_c1 | 3300050507 | Bacteria | 8599 |
| 893 | nmdc:mga05p37_60816_c1 | 3300050507 | Bacteria | 4650 |
| 894 | nmdc:mga05p37_636652_c1 | 3300050507 | Bacteria | 1197 |
| 895 | nmdc:mga08y16_1224870_c1 | 3300050511 | Unclassified | 720 |
| 896 | nmdc:mga0n895_640514_c1 | 3300050512 | Bacteria | 1062 |
| 897 | nmdc:mga0n895_78624_c1 | 3300050512 | Bacteria | 3283 |
| 898 | nmdc:mga0rr50_183303_c1 | 3300050513 | Bacteria | 1712 |
| 899 | nmdc:mga0rr50_234423_c1 | 3300050513 | Bacteria | 1519 |
| 900 | nmdc:mga08x19_113622_c1 | 3300050514 | Bacteria | 1808 |
| 901 | nmdc:mga08x19_323226_c1 | 3300050514 | Bacteria | 1074 |
| 902 | nmdc:mga08x19_7027_c1 | 3300050514 | Bacteria | 6681 |
| 903 | nmdc:mga0a205_779767_c1 | 3300050515 | Bacteria | 804 |
| 904 | Ga0495601_0006303 | 3300053077 | Bacteria | 6929 |
| 905 | Ga0495601_0065813 | 3300053077 | Bacteria | 2307 |
| 906 | Ga0495655_0025664 | 3300053083 | Bacteria | 1381 |
| 907 | Ga0495595_0248717 | 3300053084 | Bacteria | 890 |
| 908 | Ga0495619_0800010 | 3300053085 | Bacteria | 638 |
| 909 | Ga0500644_0063868 | 3300053088 | Bacteria | 1306 |
| 910 | Ga0500555_000003 | 3300053103 | Bacteria | 392994 |
| 911 | Ga0500555_000377 | 3300053103 | Bacteria | 18802 |
| 912 | Ga0500556_0000539 | 3300053104 | Bacteria | 25733 |
| 913 | Ga0500595_036670 | 3300053119 | Unclassified | 1605 |
| 914 | Ga0500642_0155040 | 3300053130 | Bacteria | 1074 |
| 915 | Ga0500616_0080786 | 3300053153 | Bacteria | 1634 |
| 916 | Ga0500616_0192024 | 3300053153 | Bacteria | 911 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026118 | Ga0207675_101490259 | Ga0207675_1014902591 | 170 |
| 2 | 3300035170 | Ga0373943_0371917 | Ga0373943_0371917_101_661 | 170 |
| 3 | 3300046491 | Ga0495584_0383249 | Ga0495584_0383249_42_602 | 170 |
| 4 | 3300046528 | Ga0495642_0382726 | Ga0495642_0382726_48_608 | 170 |
| 5 | 3300046664 | Ga0495659_0105230 | Ga0495659_0105230_189_749 | 170 |
| 6 | 3300046684 | Ga0495669_0366326 | Ga0495669_0366326_85_645 | 170 |
| 7 | 3300046689 | Ga0495613_0251919 | Ga0495613_0251919_652_1212 | 170 |
| 8 | 3300005843 | Ga0068860_100000390 | Ga0068860_1000003906 | 171 |
| 9 | 3300009094 | Ga0111539_11198028 | Ga0111539_111980282 | 171 |
| 10 | 3300028381 | Ga0268264_10000800 | Ga0268264_1000080024 | 171 |
| 11 | 3300025926 | Ga0207659_11169076 | Ga0207659_111690762 | 172 |
| 12 | 3300037466 | Ga0395898_0000067 | Ga0395898_0000067_147572_148132 | 172 |
| 13 | 3300001991 | JGI24743J22301_10001703 | JGI24743J22301_100017033 | 173 |
| 14 | 3300005295 | Ga0065707_10034795 | Ga0065707_100347952 | 173 |
| 15 | 3300005327 | Ga0070658_10005444 | Ga0070658_100054445 | 173 |
| 16 | 3300005331 | Ga0070670_100799610 | Ga0070670_1007996101 | 173 |
| 17 | 3300005435 | Ga0070714_100151164 | Ga0070714_1001511641 | 173 |
| 18 | 3300005435 | Ga0070714_100243297 | Ga0070714_1002432972 | 173 |
| 19 | 3300005445 | Ga0070708_100506505 | Ga0070708_1005065052 | 173 |
| 20 | 3300005467 | Ga0070706_100058823 | Ga0070706_1000588233 | 173 |
| 21 | 3300005536 | Ga0070697_100102221 | Ga0070697_1001022213 | 173 |
| 22 | 3300005548 | Ga0070665_100443310 | Ga0070665_1004433102 | 173 |
| 23 | 3300005841 | Ga0068863_100165555 | Ga0068863_1001655554 | 173 |
| 24 | 3300005842 | Ga0068858_100532686 | Ga0068858_1005326862 | 173 |
| 25 | 3300005937 | Ga0081455_10022426 | Ga0081455_100224267 | 173 |
| 26 | 3300005937 | Ga0081455_10185162 | Ga0081455_101851622 | 173 |
| 27 | 3300006028 | Ga0070717_10025006 | Ga0070717_100250062 | 173 |
| 28 | 3300006175 | Ga0070712_100886924 | Ga0070712_1008869242 | 173 |
| 29 | 3300006177 | Ga0075362_10052231 | Ga0075362_100522313 | 173 |
| 30 | 3300025939 | Ga0207665_10015683 | Ga0207665_100156833 | 173 |
| 31 | 3300025939 | Ga0207665_10045327 | Ga0207665_100453273 | 173 |
| 32 | 3300025944 | Ga0207661_10154368 | Ga0207661_101543681 | 173 |
| 33 | 3300025945 | Ga0207679_10663262 | Ga0207679_106632622 | 173 |
| 34 | 3300026035 | Ga0207703_10010258 | Ga0207703_100102586 | 173 |
| 35 | 3300026035 | Ga0207703_10565938 | Ga0207703_105659382 | 173 |
| 36 | 3300026067 | Ga0207678_10022513 | Ga0207678_100225137 | 173 |
| 37 | 3300027876 | Ga0209974_10112622 | Ga0209974_101126221 | 173 |
| 38 | 3300028379 | Ga0268266_10677511 | Ga0268266_106775111 | 173 |
| 39 | 3300041486 | Ga0451807_2518792 | Ga0451807_2518792_17_538 | 173 |
| 40 | 3300046472 | Ga0495580_0620878 | Ga0495580_0620878_25_546 | 173 |
| 41 | 3300048904 | Ga0496101_0208763 | Ga0496101_0208763_716_1237 | 173 |
| 42 | 3300048907 | Ga0496104_1367337 | Ga0496104_1367337_19_540 | 173 |
| 43 | 3300026078 | Ga0207702_10025662 | Ga0207702_100256623 | 174 |
| 44 | 3300003659 | JGI25404J52841_10017478 | JGI25404J52841_100174782 | 175 |
| 45 | 3300003911 | JGI25405J52794_10006869 | JGI25405J52794_100068693 | 175 |
| 46 | 3300005289 | Ga0065704_10003343 | Ga0065704_100033436 | 175 |
| 47 | 3300005289 | Ga0065704_10124462 | Ga0065704_101244622 | 175 |
| 48 | 3300005290 | Ga0065712_10074696 | Ga0065712_100746962 | 175 |
| 49 | 3300005293 | Ga0065715_10331278 | Ga0065715_103312782 | 175 |
| 50 | 3300005293 | Ga0065715_10411910 | Ga0065715_104119101 | 175 |
| 51 | 3300005293 | Ga0065715_10454564 | Ga0065715_104545641 | 175 |
| 52 | 3300005329 | Ga0070683_100166174 | Ga0070683_1001661743 | 175 |
| 53 | 3300005334 | Ga0068869_100110552 | Ga0068869_1001105523 | 175 |
| 54 | 3300005335 | Ga0070666_10853249 | Ga0070666_108532491 | 175 |
| 55 | 3300005336 | Ga0070680_100253020 | Ga0070680_1002530202 | 175 |
| 56 | 3300005339 | Ga0070660_100111146 | Ga0070660_1001111463 | 175 |
| 57 | 3300005340 | Ga0070689_100651499 | Ga0070689_1006514991 | 175 |
| 58 | 3300005343 | Ga0070687_100010470 | Ga0070687_1000104703 | 175 |
| 59 | 3300005354 | Ga0070675_100408305 | Ga0070675_1004083052 | 175 |
| 60 | 3300005355 | Ga0070671_100057031 | Ga0070671_1000570312 | 175 |
| 61 | 3300005364 | Ga0070673_100250431 | Ga0070673_1002504312 | 175 |
| 62 | 3300005434 | Ga0070709_10038486 | Ga0070709_100384863 | 175 |
| 63 | 3300005435 | Ga0070714_100426429 | Ga0070714_1004264292 | 175 |
| 64 | 3300005438 | Ga0070701_10025210 | Ga0070701_100252102 | 175 |
| 65 | 3300005445 | Ga0070708_100308412 | Ga0070708_1003084121 | 175 |
| 66 | 3300005455 | Ga0070663_100530487 | Ga0070663_1005304872 | 175 |
| 67 | 3300005457 | Ga0070662_100153923 | Ga0070662_1001539232 | 175 |
| 68 | 3300005457 | Ga0070662_100821004 | Ga0070662_1008210041 | 175 |
| 69 | 3300005468 | Ga0070707_100268683 | Ga0070707_1002686833 | 175 |
| 70 | 3300005471 | Ga0070698_100085652 | Ga0070698_1000856522 | 175 |
| 71 | 3300005543 | Ga0070672_100136641 | Ga0070672_1001366413 | 175 |
| 72 | 3300005548 | Ga0070665_100293469 | Ga0070665_1002934692 | 175 |
| 73 | 3300005614 | Ga0068856_100760819 | Ga0068856_1007608192 | 175 |
| 74 | 3300005616 | Ga0068852_100365623 | Ga0068852_1003656232 | 175 |
| 75 | 3300005841 | Ga0068863_100015784 | Ga0068863_1000157844 | 175 |
| 76 | 3300005841 | Ga0068863_100174956 | Ga0068863_1001749561 | 175 |
| 77 | 3300005843 | Ga0068860_100076998 | Ga0068860_1000769984 | 175 |
| 78 | 3300005844 | Ga0068862_100004440 | Ga0068862_10000444013 | 175 |
| 79 | 3300005983 | Ga0081540_1049035 | Ga0081540_10490353 | 175 |
| 80 | 3300006028 | Ga0070717_10063645 | Ga0070717_100636454 | 175 |
| 81 | 3300006163 | Ga0070715_10544484 | Ga0070715_105444842 | 175 |
| 82 | 3300006175 | Ga0070712_100065776 | Ga0070712_1000657763 | 175 |
| 83 | 3300006175 | Ga0070712_101074478 | Ga0070712_1010744782 | 175 |
| 84 | 3300006914 | Ga0075436_100088864 | Ga0075436_1000888642 | 175 |
| 85 | 3300007076 | Ga0075435_100144434 | Ga0075435_1001444342 | 175 |
| 86 | 3300014325 | Ga0163163_10517203 | Ga0163163_105172032 | 175 |
| 87 | 3300014969 | Ga0157376_10195571 | Ga0157376_101955713 | 175 |
| 88 | 3300025271 | Ga0207666_1008904 | Ga0207666_10089041 | 175 |
| 89 | 3300025290 | Ga0207673_1018626 | Ga0207673_10186262 | 175 |
| 90 | 3300025315 | Ga0207697_10000352 | Ga0207697_1000035216 | 175 |
| 91 | 3300025315 | Ga0207697_10013712 | Ga0207697_100137122 | 175 |
| 92 | 3300025315 | Ga0207697_10051807 | Ga0207697_100518072 | 175 |
| 93 | 3300025885 | Ga0207653_10255115 | Ga0207653_102551151 | 175 |
| 94 | 3300025907 | Ga0207645_10002352 | Ga0207645_1000235217 | 175 |
| 95 | 3300025910 | Ga0207684_10051530 | Ga0207684_100515305 | 175 |
| 96 | 3300025910 | Ga0207684_10117939 | Ga0207684_101179393 | 175 |
| 97 | 3300025910 | Ga0207684_10262777 | Ga0207684_102627771 | 175 |
| 98 | 3300025910 | Ga0207684_10727006 | Ga0207684_107270061 | 175 |
| 99 | 3300025910 | Ga0207684_10872979 | Ga0207684_108729791 | 175 |
| 100 | 3300025915 | Ga0207693_10002199 | Ga0207693_100021993 | 175 |
| 101 | 3300025915 | Ga0207693_10038179 | Ga0207693_100381794 | 175 |
| 102 | 3300025915 | Ga0207693_10086457 | Ga0207693_100864572 | 175 |
| 103 | 3300025916 | Ga0207663_10082942 | Ga0207663_100829422 | 175 |
| 104 | 3300025918 | Ga0207662_10000559 | Ga0207662_100005596 | 175 |
| 105 | 3300025918 | Ga0207662_10038587 | Ga0207662_100385874 | 175 |
| 106 | 3300025919 | Ga0207657_10079476 | Ga0207657_100794762 | 175 |
| 107 | 3300025919 | Ga0207657_10255089 | Ga0207657_102550892 | 175 |
| 108 | 3300025922 | Ga0207646_10000411 | Ga0207646_1000041152 | 175 |
| 109 | 3300025922 | Ga0207646_10065961 | Ga0207646_100659614 | 175 |
| 110 | 3300025926 | Ga0207659_10024917 | Ga0207659_100249173 | 175 |
| 111 | 3300025926 | Ga0207659_10867113 | Ga0207659_108671131 | 175 |
| 112 | 3300025926 | Ga0207659_11086301 | Ga0207659_110863011 | 175 |
| 113 | 3300025929 | Ga0207664_10212787 | Ga0207664_102127872 | 175 |
| 114 | 3300025929 | Ga0207664_10348347 | Ga0207664_103483472 | 175 |
| 115 | 3300025932 | Ga0207690_10141566 | Ga0207690_101415662 | 175 |
| 116 | 3300025933 | Ga0207706_10812614 | Ga0207706_108126141 | 175 |
| 117 | 3300025936 | Ga0207670_10103452 | Ga0207670_101034523 | 175 |
| 118 | 3300025936 | Ga0207670_10474620 | Ga0207670_104746201 | 175 |
| 119 | 3300025939 | Ga0207665_10113592 | Ga0207665_101135922 | 175 |
| 120 | 3300025940 | Ga0207691_10075598 | Ga0207691_100755983 | 175 |
| 121 | 3300025941 | Ga0207711_11189047 | Ga0207711_111890472 | 175 |
| 122 | 3300025945 | Ga0207679_10185110 | Ga0207679_101851103 | 175 |
| 123 | 3300025961 | Ga0207712_10032945 | Ga0207712_100329455 | 175 |
| 124 | 3300025986 | Ga0207658_10370583 | Ga0207658_103705832 | 175 |
| 125 | 3300026023 | Ga0207677_10129275 | Ga0207677_101292752 | 175 |
| 126 | 3300026023 | Ga0207677_10579027 | Ga0207677_105790272 | 175 |
| 127 | 3300026035 | Ga0207703_10039645 | Ga0207703_100396451 | 175 |
| 128 | 3300026075 | Ga0207708_10189875 | Ga0207708_101898751 | 175 |
| 129 | 3300026088 | Ga0207641_10045684 | Ga0207641_100456842 | 175 |
| 130 | 3300026142 | Ga0207698_10579700 | Ga0207698_105797002 | 175 |
| 131 | 3300027682 | Ga0209971_1099613 | Ga0209971_10996131 | 175 |
| 132 | 3300027876 | Ga0209974_10030866 | Ga0209974_100308661 | 175 |
| 133 | 3300028380 | Ga0268265_10044621 | Ga0268265_100446212 | 175 |
| 134 | 3300028381 | Ga0268264_10254913 | Ga0268264_102549131 | 175 |
| 135 | 3300035111 | Ga0373923_0083000 | Ga0373923_0083000_20_547 | 175 |
| 136 | 3300037068 | Ga0373925_0631197 | Ga0373925_0631197_119_679 | 175 |
| 137 | 3300042439 | Ga0439464_0039742 | Ga0439464_0039742_781_1308 | 175 |
| 138 | 3300046457 | Ga0495590_0195566 | Ga0495590_0195566_197_724 | 175 |
| 139 | 3300048903 | Ga0496100_0162311 | Ga0496100_0162311_915_1442 | 175 |
| 140 | 3300048908 | Ga0496105_0027127 | Ga0496105_0027127_4060_4587 | 175 |
| 141 | 3300048911 | Ga0496108_1050666 | Ga0496108_1050666_21_548 | 175 |
| 142 | 3300048917 | Ga0496114_0240962 | Ga0496114_0240962_44_571 | 175 |
| 143 | 3300048917 | Ga0496114_1011394 | Ga0496114_1011394_162_689 | 175 |
| 144 | 3300048918 | Ga0496115_0543295 | Ga0496115_0543295_190_717 | 175 |
| 145 | 3300053085 | Ga0495619_0800010 | Ga0495619_0800010_24_551 | 175 |
| 146 | 3300007788 | Ga0099795_10127480 | Ga0099795_101274802 | 176 |
| 147 | 3300025910 | Ga0207684_10013103 | Ga0207684_100131039 | 176 |
| 148 | 3300025941 | Ga0207711_10448858 | Ga0207711_104488582 | 177 |
| 149 | 3300037068 | Ga0373925_0273176 | Ga0373925_0273176_271_831 | 177 |
| 150 | 3300053119 | Ga0500595_036670 | Ga0500595_036670_743_1303 | 177 |
| 151 | 3300039437 | Ga0436365_0561697 | Ga0436365_0561697_6385_6948 | 178 |
| 152 | 3300005435 | Ga0070714_100114550 | Ga0070714_1001145502 | 179 |
| 153 | 3300005457 | Ga0070662_100254936 | Ga0070662_1002549362 | 179 |
| 154 | 3300005842 | Ga0068858_100031177 | Ga0068858_1000311772 | 179 |
| 155 | 3300025929 | Ga0207664_10580264 | Ga0207664_105802641 | 179 |
| 156 | 3300048905 | Ga0496102_0191535 | Ga0496102_0191535_1343_1903 | 179 |
| 157 | 3300049579 | Ga0501043_0010380 | Ga0501043_0010380_12_551 | 179 |
| 158 | 3300003323 | rootH1_10066215 | rootH1_100662152 | 180 |
| 159 | 3300005329 | Ga0070683_101494603 | Ga0070683_1014946031 | 180 |
| 160 | 3300005366 | Ga0070659_100016569 | Ga0070659_1000165692 | 180 |
| 161 | 3300005435 | Ga0070714_100120875 | Ga0070714_1001208752 | 180 |
| 162 | 3300005468 | Ga0070707_100127502 | Ga0070707_1001275022 | 180 |
| 163 | 3300005614 | Ga0068856_100000888 | Ga0068856_10000088828 | 180 |
| 164 | 3300013307 | Ga0157372_10166313 | Ga0157372_101663132 | 180 |
| 165 | 3300025920 | Ga0207649_10000744 | Ga0207649_1000074417 | 180 |
| 166 | 3300025929 | Ga0207664_10032182 | Ga0207664_100321822 | 180 |
| 167 | 3300005536 | Ga0070697_100010048 | Ga0070697_1000100486 | 181 |
| 168 | 3300009094 | Ga0111539_10260557 | Ga0111539_102605572 | 185 |
| 169 | 2162886007 | SwRhRL2b_contig_153793 | SwRhRL2b_0540.00001070 | 186 |
| 170 | 2162886007 | SwRhRL2b_contig_2058463 | SwRhRL2b_0083.00000960 | 186 |
| 171 | 3300003316 | rootH1_10136363 | rootH1_101363632 | 186 |
| 172 | 3300003320 | rootH2_10026271 | rootH2_100262713 | 186 |
| 173 | 3300003320 | rootH2_10100182 | rootH2_101001822 | 186 |
| 174 | 3300003320 | rootH2_10182195 | rootH2_101821952 | 186 |
| 175 | 3300003322 | rootL2_10011143 | rootL2_100111437 | 186 |
| 176 | 3300003322 | rootL2_10127896 | rootL2_101278962 | 186 |
| 177 | 3300005272 | Ga0065703_1021956 | Ga0065703_10219562 | 186 |
| 178 | 3300005289 | Ga0065704_10003014 | Ga0065704_100030141 | 186 |
| 179 | 3300005289 | Ga0065704_10486822 | Ga0065704_104868221 | 186 |
| 180 | 3300005290 | Ga0065712_10004789 | Ga0065712_100047895 | 186 |
| 181 | 3300005290 | Ga0065712_10273811 | Ga0065712_102738112 | 186 |
| 182 | 3300005293 | Ga0065715_10000865 | Ga0065715_100008653 | 186 |
| 183 | 3300005293 | Ga0065715_10001562 | Ga0065715_100015623 | 186 |
| 184 | 3300005293 | Ga0065715_10140608 | Ga0065715_101406082 | 186 |
| 185 | 3300005293 | Ga0065715_10161820 | Ga0065715_101618202 | 186 |
| 186 | 3300005293 | Ga0065715_10177454 | Ga0065715_101774541 | 186 |
| 187 | 3300005293 | Ga0065715_10240274 | Ga0065715_102402741 | 186 |
| 188 | 3300005295 | Ga0065707_10085928 | Ga0065707_100859285 | 186 |
| 189 | 3300005295 | Ga0065707_10129080 | Ga0065707_101290802 | 186 |
| 190 | 3300005295 | Ga0065707_10748292 | Ga0065707_107482921 | 186 |
| 191 | 3300005328 | Ga0070676_10014630 | Ga0070676_100146305 | 186 |
| 192 | 3300005328 | Ga0070676_10015006 | Ga0070676_100150063 | 186 |
| 193 | 3300005328 | Ga0070676_10024414 | Ga0070676_100244145 | 186 |
| 194 | 3300005328 | Ga0070676_10352177 | Ga0070676_103521772 | 186 |
| 195 | 3300005329 | Ga0070683_100714659 | Ga0070683_1007146591 | 186 |
| 196 | 3300005329 | Ga0070683_100756990 | Ga0070683_1007569901 | 186 |
| 197 | 3300005330 | Ga0070690_100012701 | Ga0070690_1000127015 | 186 |
| 198 | 3300005330 | Ga0070690_100212839 | Ga0070690_1002128392 | 186 |
| 199 | 3300005330 | Ga0070690_100321390 | Ga0070690_1003213902 | 186 |
| 200 | 3300005330 | Ga0070690_100327623 | Ga0070690_1003276232 | 186 |
| 201 | 3300005331 | Ga0070670_100012458 | Ga0070670_1000124583 | 186 |
| 202 | 3300005331 | Ga0070670_100212146 | Ga0070670_1002121462 | 186 |
| 203 | 3300005333 | Ga0070677_10068670 | Ga0070677_100686702 | 186 |
| 204 | 3300005335 | Ga0070666_10014664 | Ga0070666_100146642 | 186 |
| 205 | 3300005335 | Ga0070666_10032237 | Ga0070666_100322372 | 186 |
| 206 | 3300005335 | Ga0070666_10057602 | Ga0070666_100576023 | 186 |
| 207 | 3300005335 | Ga0070666_10579915 | Ga0070666_105799151 | 186 |
| 208 | 3300005338 | Ga0068868_100038485 | Ga0068868_1000384853 | 186 |
| 209 | 3300005338 | Ga0068868_100270613 | Ga0068868_1002706132 | 186 |
| 210 | 3300005338 | Ga0068868_100425072 | Ga0068868_1004250722 | 186 |
| 211 | 3300005339 | Ga0070660_100159888 | Ga0070660_1001598883 | 186 |
| 212 | 3300005339 | Ga0070660_100213011 | Ga0070660_1002130112 | 186 |
| 213 | 3300005339 | Ga0070660_100216537 | Ga0070660_1002165373 | 186 |
| 214 | 3300005340 | Ga0070689_100059551 | Ga0070689_1000595514 | 186 |
| 215 | 3300005340 | Ga0070689_100146518 | Ga0070689_1001465182 | 186 |
| 216 | 3300005340 | Ga0070689_100148889 | Ga0070689_1001488892 | 186 |
| 217 | 3300005340 | Ga0070689_100180997 | Ga0070689_1001809972 | 186 |
| 218 | 3300005340 | Ga0070689_100534120 | Ga0070689_1005341201 | 186 |
| 219 | 3300005340 | Ga0070689_100766747 | Ga0070689_1007667472 | 186 |
| 220 | 3300005341 | Ga0070691_10629918 | Ga0070691_106299181 | 186 |
| 221 | 3300005344 | Ga0070661_100000928 | Ga0070661_10000092816 | 186 |
| 222 | 3300005344 | Ga0070661_100033628 | Ga0070661_1000336281 | 186 |
| 223 | 3300005345 | Ga0070692_10764407 | Ga0070692_107644071 | 186 |
| 224 | 3300005347 | Ga0070668_100001187 | Ga0070668_1000011873 | 186 |
| 225 | 3300005347 | Ga0070668_100020811 | Ga0070668_1000208114 | 186 |
| 226 | 3300005347 | Ga0070668_100541083 | Ga0070668_1005410832 | 186 |
| 227 | 3300005353 | Ga0070669_100009942 | Ga0070669_1000099428 | 186 |
| 228 | 3300005353 | Ga0070669_100024318 | Ga0070669_1000243182 | 186 |
| 229 | 3300005353 | Ga0070669_100026331 | Ga0070669_1000263313 | 186 |
| 230 | 3300005353 | Ga0070669_100038737 | Ga0070669_1000387374 | 186 |
| 231 | 3300005353 | Ga0070669_100044533 | Ga0070669_1000445332 | 186 |
| 232 | 3300005353 | Ga0070669_100384763 | Ga0070669_1003847632 | 186 |
| 233 | 3300005354 | Ga0070675_100017585 | Ga0070675_1000175856 | 186 |
| 234 | 3300005354 | Ga0070675_100026530 | Ga0070675_1000265303 | 186 |
| 235 | 3300005354 | Ga0070675_100058782 | Ga0070675_1000587824 | 186 |
| 236 | 3300005354 | Ga0070675_100993338 | Ga0070675_1009933381 | 186 |
| 237 | 3300005355 | Ga0070671_100004727 | Ga0070671_1000047272 | 186 |
| 238 | 3300005355 | Ga0070671_100031701 | Ga0070671_1000317012 | 186 |
| 239 | 3300005355 | Ga0070671_100083936 | Ga0070671_1000839362 | 186 |
| 240 | 3300005355 | Ga0070671_100183394 | Ga0070671_1001833942 | 186 |
| 241 | 3300005355 | Ga0070671_100235100 | Ga0070671_1002351002 | 186 |
| 242 | 3300005355 | Ga0070671_100295208 | Ga0070671_1002952083 | 186 |
| 243 | 3300005355 | Ga0070671_100456859 | Ga0070671_1004568591 | 186 |
| 244 | 3300005355 | Ga0070671_100822240 | Ga0070671_1008222401 | 186 |
| 245 | 3300005356 | Ga0070674_100083441 | Ga0070674_1000834412 | 186 |
| 246 | 3300005356 | Ga0070674_100112238 | Ga0070674_1001122382 | 186 |
| 247 | 3300005356 | Ga0070674_100340393 | Ga0070674_1003403931 | 186 |
| 248 | 3300005364 | Ga0070673_100000316 | Ga0070673_10000031611 | 186 |
| 249 | 3300005364 | Ga0070673_100043216 | Ga0070673_1000432162 | 186 |
| 250 | 3300005364 | Ga0070673_100490132 | Ga0070673_1004901321 | 186 |
| 251 | 3300005365 | Ga0070688_100002376 | Ga0070688_1000023764 | 186 |
| 252 | 3300005366 | Ga0070659_100397248 | Ga0070659_1003972482 | 186 |
| 253 | 3300005366 | Ga0070659_100718203 | Ga0070659_1007182031 | 186 |
| 254 | 3300005367 | Ga0070667_100016077 | Ga0070667_1000160772 | 186 |
| 255 | 3300005367 | Ga0070667_100044655 | Ga0070667_1000446554 | 186 |
| 256 | 3300005367 | Ga0070667_100065751 | Ga0070667_1000657512 | 186 |
| 257 | 3300005367 | Ga0070667_100511178 | Ga0070667_1005111781 | 186 |
| 258 | 3300005434 | Ga0070709_10177478 | Ga0070709_101774782 | 186 |
| 259 | 3300005436 | Ga0070713_100060238 | Ga0070713_1000602383 | 186 |
| 260 | 3300005436 | Ga0070713_100067318 | Ga0070713_1000673184 | 186 |
| 261 | 3300005437 | Ga0070710_10037266 | Ga0070710_100372663 | 186 |
| 262 | 3300005437 | Ga0070710_10145657 | Ga0070710_101456572 | 186 |
| 263 | 3300005437 | Ga0070710_10264400 | Ga0070710_102644001 | 186 |
| 264 | 3300005437 | Ga0070710_10456660 | Ga0070710_104566602 | 186 |
| 265 | 3300005439 | Ga0070711_100103916 | Ga0070711_1001039163 | 186 |
| 266 | 3300005439 | Ga0070711_100539447 | Ga0070711_1005394472 | 186 |
| 267 | 3300005440 | Ga0070705_100051376 | Ga0070705_1000513764 | 186 |
| 268 | 3300005440 | Ga0070705_100072744 | Ga0070705_1000727444 | 186 |
| 269 | 3300005440 | Ga0070705_100146513 | Ga0070705_1001465132 | 186 |
| 270 | 3300005440 | Ga0070705_100193124 | Ga0070705_1001931242 | 186 |
| 271 | 3300005441 | Ga0070700_100377880 | Ga0070700_1003778802 | 186 |
| 272 | 3300005445 | Ga0070708_100002881 | Ga0070708_10000288114 | 186 |
| 273 | 3300005445 | Ga0070708_100034509 | Ga0070708_1000345097 | 186 |
| 274 | 3300005445 | Ga0070708_100321376 | Ga0070708_1003213762 | 186 |
| 275 | 3300005445 | Ga0070708_100323065 | Ga0070708_1003230652 | 186 |
| 276 | 3300005445 | Ga0070708_100663453 | Ga0070708_1006634532 | 186 |
| 277 | 3300005445 | Ga0070708_101091157 | Ga0070708_1010911571 | 186 |
| 278 | 3300005456 | Ga0070678_100002256 | Ga0070678_10000225615 | 186 |
| 279 | 3300005456 | Ga0070678_100027681 | Ga0070678_1000276812 | 186 |
| 280 | 3300005456 | Ga0070678_100112912 | Ga0070678_1001129122 | 186 |
| 281 | 3300005456 | Ga0070678_100188641 | Ga0070678_1001886412 | 186 |
| 282 | 3300005456 | Ga0070678_100197197 | Ga0070678_1001971972 | 186 |
| 283 | 3300005457 | Ga0070662_100003800 | Ga0070662_1000038008 | 186 |
| 284 | 3300005457 | Ga0070662_100049564 | Ga0070662_1000495642 | 186 |
| 285 | 3300005457 | Ga0070662_100612500 | Ga0070662_1006125002 | 186 |
| 286 | 3300005458 | Ga0070681_10202591 | Ga0070681_102025912 | 186 |
| 287 | 3300005458 | Ga0070681_10392772 | Ga0070681_103927722 | 186 |
| 288 | 3300005458 | Ga0070681_10593799 | Ga0070681_105937992 | 186 |
| 289 | 3300005459 | Ga0068867_100027407 | Ga0068867_1000274071 | 186 |
| 290 | 3300005459 | Ga0068867_100267495 | Ga0068867_1002674952 | 186 |
| 291 | 3300005467 | Ga0070706_100011390 | Ga0070706_10001139011 | 186 |
| 292 | 3300005467 | Ga0070706_100025876 | Ga0070706_1000258761 | 186 |
| 293 | 3300005467 | Ga0070706_100064467 | Ga0070706_1000644672 | 186 |
| 294 | 3300005467 | Ga0070706_100073042 | Ga0070706_1000730424 | 186 |
| 295 | 3300005467 | Ga0070706_100082512 | Ga0070706_1000825123 | 186 |
| 296 | 3300005467 | Ga0070706_100141498 | Ga0070706_1001414984 | 186 |
| 297 | 3300005467 | Ga0070706_100183792 | Ga0070706_1001837923 | 186 |
| 298 | 3300005467 | Ga0070706_100272519 | Ga0070706_1002725192 | 186 |
| 299 | 3300005467 | Ga0070706_100471042 | Ga0070706_1004710422 | 186 |
| 300 | 3300005467 | Ga0070706_101133481 | Ga0070706_1011334811 | 186 |
| 301 | 3300005468 | Ga0070707_100000846 | Ga0070707_10000084617 | 186 |
| 302 | 3300005468 | Ga0070707_100022154 | Ga0070707_1000221542 | 186 |
| 303 | 3300005468 | Ga0070707_100023714 | Ga0070707_1000237145 | 186 |
| 304 | 3300005468 | Ga0070707_100026907 | Ga0070707_1000269076 | 186 |
| 305 | 3300005468 | Ga0070707_100046972 | Ga0070707_1000469722 | 186 |
| 306 | 3300005468 | Ga0070707_100048200 | Ga0070707_1000482006 | 186 |
| 307 | 3300005468 | Ga0070707_100101971 | Ga0070707_1001019713 | 186 |
| 308 | 3300005468 | Ga0070707_100143773 | Ga0070707_1001437732 | 186 |
| 309 | 3300005468 | Ga0070707_100198275 | Ga0070707_1001982752 | 186 |
| 310 | 3300005468 | Ga0070707_100220861 | Ga0070707_1002208612 | 186 |
| 311 | 3300005468 | Ga0070707_100274267 | Ga0070707_1002742672 | 186 |
| 312 | 3300005468 | Ga0070707_100489557 | Ga0070707_1004895572 | 186 |
| 313 | 3300005471 | Ga0070698_100002074 | Ga0070698_1000020744 | 186 |
| 314 | 3300005471 | Ga0070698_100005905 | Ga0070698_1000059053 | 186 |
| 315 | 3300005471 | Ga0070698_100007983 | Ga0070698_1000079839 | 186 |
| 316 | 3300005471 | Ga0070698_100672467 | Ga0070698_1006724671 | 186 |
| 317 | 3300005518 | Ga0070699_100029144 | Ga0070699_1000291447 | 186 |
| 318 | 3300005518 | Ga0070699_100044262 | Ga0070699_1000442623 | 186 |
| 319 | 3300005518 | Ga0070699_100052006 | Ga0070699_1000520064 | 186 |
| 320 | 3300005518 | Ga0070699_100091835 | Ga0070699_1000918352 | 186 |
| 321 | 3300005518 | Ga0070699_100165982 | Ga0070699_1001659822 | 186 |
| 322 | 3300005518 | Ga0070699_100465337 | Ga0070699_1004653372 | 186 |
| 323 | 3300005518 | Ga0070699_100668664 | Ga0070699_1006686641 | 186 |
| 324 | 3300005535 | Ga0070684_100057045 | Ga0070684_1000570454 | 186 |
| 325 | 3300005535 | Ga0070684_100139124 | Ga0070684_1001391242 | 186 |
| 326 | 3300005535 | Ga0070684_100280404 | Ga0070684_1002804041 | 186 |
| 327 | 3300005536 | Ga0070697_100000863 | Ga0070697_10000086313 | 186 |
| 328 | 3300005536 | Ga0070697_100004776 | Ga0070697_10000477611 | 186 |
| 329 | 3300005536 | Ga0070697_100006005 | Ga0070697_1000060056 | 186 |
| 330 | 3300005536 | Ga0070697_100007445 | Ga0070697_1000074451 | 186 |
| 331 | 3300005536 | Ga0070697_100017077 | Ga0070697_1000170774 | 186 |
| 332 | 3300005536 | Ga0070697_100018213 | Ga0070697_1000182133 | 186 |
| 333 | 3300005536 | Ga0070697_100028977 | Ga0070697_1000289774 | 186 |
| 334 | 3300005536 | Ga0070697_100031306 | Ga0070697_1000313064 | 186 |
| 335 | 3300005536 | Ga0070697_100157961 | Ga0070697_1001579611 | 186 |
| 336 | 3300005536 | Ga0070697_100365983 | Ga0070697_1003659832 | 186 |
| 337 | 3300005536 | Ga0070697_100507634 | Ga0070697_1005076342 | 186 |
| 338 | 3300005539 | Ga0068853_100000577 | Ga0068853_1000005778 | 186 |
| 339 | 3300005543 | Ga0070672_100000553 | Ga0070672_10000055310 | 186 |
| 340 | 3300005543 | Ga0070672_100097565 | Ga0070672_1000975651 | 186 |
| 341 | 3300005543 | Ga0070672_100198421 | Ga0070672_1001984212 | 186 |
| 342 | 3300005543 | Ga0070672_100559834 | Ga0070672_1005598342 | 186 |
| 343 | 3300005543 | Ga0070672_100683683 | Ga0070672_1006836831 | 186 |
| 344 | 3300005544 | Ga0070686_100404841 | Ga0070686_1004048412 | 186 |
| 345 | 3300005545 | Ga0070695_100088692 | Ga0070695_1000886922 | 186 |
| 346 | 3300005546 | Ga0070696_100044534 | Ga0070696_1000445342 | 186 |
| 347 | 3300005548 | Ga0070665_100000201 | Ga0070665_10000020192 | 186 |
| 348 | 3300005548 | Ga0070665_100010897 | Ga0070665_1000108977 | 186 |
| 349 | 3300005548 | Ga0070665_100126750 | Ga0070665_1001267502 | 186 |
| 350 | 3300005548 | Ga0070665_100322640 | Ga0070665_1003226402 | 186 |
| 351 | 3300005548 | Ga0070665_100535738 | Ga0070665_1005357381 | 186 |
| 352 | 3300005548 | Ga0070665_100670647 | Ga0070665_1006706472 | 186 |
| 353 | 3300005549 | Ga0070704_100138815 | Ga0070704_1001388152 | 186 |
| 354 | 3300005549 | Ga0070704_100454021 | Ga0070704_1004540212 | 186 |
| 355 | 3300005563 | Ga0068855_100006309 | Ga0068855_1000063094 | 186 |
| 356 | 3300005564 | Ga0070664_100220538 | Ga0070664_1002205382 | 186 |
| 357 | 3300005564 | Ga0070664_100254847 | Ga0070664_1002548472 | 186 |
| 358 | 3300005578 | Ga0068854_100313910 | Ga0068854_1003139102 | 186 |
| 359 | 3300005614 | Ga0068856_100123051 | Ga0068856_1001230513 | 186 |
| 360 | 3300005616 | Ga0068852_101050069 | Ga0068852_1010500692 | 186 |
| 361 | 3300005617 | Ga0068859_100311139 | Ga0068859_1003111392 | 186 |
| 362 | 3300005617 | Ga0068859_100416287 | Ga0068859_1004162872 | 186 |
| 363 | 3300005617 | Ga0068859_101319318 | Ga0068859_1013193182 | 186 |
| 364 | 3300005618 | Ga0068864_100268133 | Ga0068864_1002681331 | 186 |
| 365 | 3300005718 | Ga0068866_10042674 | Ga0068866_100426743 | 186 |
| 366 | 3300005719 | Ga0068861_100362827 | Ga0068861_1003628272 | 186 |
| 367 | 3300005719 | Ga0068861_100382281 | Ga0068861_1003822812 | 186 |
| 368 | 3300005719 | Ga0068861_100583674 | Ga0068861_1005836741 | 186 |
| 369 | 3300005841 | Ga0068863_100002168 | Ga0068863_1000021683 | 186 |
| 370 | 3300005841 | Ga0068863_100048665 | Ga0068863_1000486654 | 186 |
| 371 | 3300005841 | Ga0068863_100231907 | Ga0068863_1002319072 | 186 |
| 372 | 3300005841 | Ga0068863_100319812 | Ga0068863_1003198122 | 186 |
| 373 | 3300005842 | Ga0068858_100010147 | Ga0068858_1000101477 | 186 |
| 374 | 3300005842 | Ga0068858_100162920 | Ga0068858_1001629202 | 186 |
| 375 | 3300005842 | Ga0068858_100322371 | Ga0068858_1003223712 | 186 |
| 376 | 3300005842 | Ga0068858_100371539 | Ga0068858_1003715392 | 186 |
| 377 | 3300005842 | Ga0068858_100400383 | Ga0068858_1004003832 | 186 |
| 378 | 3300005843 | Ga0068860_100135297 | Ga0068860_1001352972 | 186 |
| 379 | 3300005843 | Ga0068860_100229106 | Ga0068860_1002291062 | 186 |
| 380 | 3300005843 | Ga0068860_100433099 | Ga0068860_1004330992 | 186 |
| 381 | 3300005844 | Ga0068862_100154751 | Ga0068862_1001547512 | 186 |
| 382 | 3300005844 | Ga0068862_100293363 | Ga0068862_1002933632 | 186 |
| 383 | 3300005844 | Ga0068862_100714262 | Ga0068862_1007142622 | 186 |
| 384 | 3300005844 | Ga0068862_100848090 | Ga0068862_1008480902 | 186 |
| 385 | 3300005844 | Ga0068862_100921085 | Ga0068862_1009210852 | 186 |
| 386 | 3300005937 | Ga0081455_10000725 | Ga0081455_1000072522 | 186 |
| 387 | 3300005937 | Ga0081455_10001494 | Ga0081455_1000149415 | 186 |
| 388 | 3300005937 | Ga0081455_10002780 | Ga0081455_1000278014 | 186 |
| 389 | 3300005937 | Ga0081455_10053897 | Ga0081455_100538972 | 186 |
| 390 | 3300005937 | Ga0081455_10120991 | Ga0081455_101209913 | 186 |
| 391 | 3300005937 | Ga0081455_10474558 | Ga0081455_104745581 | 186 |
| 392 | 3300005983 | Ga0081540_1000380 | Ga0081540_100038017 | 186 |
| 393 | 3300005983 | Ga0081540_1007770 | Ga0081540_10077707 | 186 |
| 394 | 3300005985 | Ga0081539_10000139 | Ga0081539_10000139132 | 186 |
| 395 | 3300005985 | Ga0081539_10000965 | Ga0081539_1000096552 | 186 |
| 396 | 3300005985 | Ga0081539_10012962 | Ga0081539_100129623 | 186 |
| 397 | 3300005985 | Ga0081539_10024547 | Ga0081539_100245473 | 186 |
| 398 | 3300006028 | Ga0070717_10000276 | Ga0070717_1000027617 | 186 |
| 399 | 3300006028 | Ga0070717_10010066 | Ga0070717_100100667 | 186 |
| 400 | 3300006028 | Ga0070717_10034700 | Ga0070717_100347005 | 186 |
| 401 | 3300006028 | Ga0070717_10519047 | Ga0070717_105190472 | 186 |
| 402 | 3300006028 | Ga0070717_10807140 | Ga0070717_108071402 | 186 |
| 403 | 3300006048 | Ga0075363_100062862 | Ga0075363_1000628622 | 186 |
| 404 | 3300006163 | Ga0070715_10074332 | Ga0070715_100743322 | 186 |
| 405 | 3300006163 | Ga0070715_10080698 | Ga0070715_100806982 | 186 |
| 406 | 3300006173 | Ga0070716_100037868 | Ga0070716_1000378683 | 186 |
| 407 | 3300006173 | Ga0070716_100123085 | Ga0070716_1001230852 | 186 |
| 408 | 3300006173 | Ga0070716_100313692 | Ga0070716_1003136922 | 186 |
| 409 | 3300006173 | Ga0070716_100516655 | Ga0070716_1005166552 | 186 |
| 410 | 3300006175 | Ga0070712_100002163 | Ga0070712_1000021637 | 186 |
| 411 | 3300006175 | Ga0070712_100027136 | Ga0070712_1000271362 | 186 |
| 412 | 3300006175 | Ga0070712_100114020 | Ga0070712_1001140203 | 186 |
| 413 | 3300006175 | Ga0070712_100120617 | Ga0070712_1001206174 | 186 |
| 414 | 3300006175 | Ga0070712_100219088 | Ga0070712_1002190882 | 186 |
| 415 | 3300006175 | Ga0070712_100236896 | Ga0070712_1002368962 | 186 |
| 416 | 3300006175 | Ga0070712_100438468 | Ga0070712_1004384681 | 186 |
| 417 | 3300006175 | Ga0070712_100557173 | Ga0070712_1005571732 | 186 |
| 418 | 3300006177 | Ga0075362_10000924 | Ga0075362_100009246 | 186 |
| 419 | 3300006195 | Ga0075366_10113582 | Ga0075366_101135821 | 186 |
| 420 | 3300006237 | Ga0097621_100112535 | Ga0097621_1001125353 | 186 |
| 421 | 3300006237 | Ga0097621_100370920 | Ga0097621_1003709202 | 186 |
| 422 | 3300006237 | Ga0097621_100638237 | Ga0097621_1006382372 | 186 |
| 423 | 3300006358 | Ga0068871_100040017 | Ga0068871_1000400172 | 186 |
| 424 | 3300006358 | Ga0068871_100040202 | Ga0068871_1000402022 | 186 |
| 425 | 3300006358 | Ga0068871_100611275 | Ga0068871_1006112752 | 186 |
| 426 | 3300006358 | Ga0068871_100802294 | Ga0068871_1008022941 | 186 |
| 427 | 3300006844 | Ga0075428_100592782 | Ga0075428_1005927822 | 186 |
| 428 | 3300006844 | Ga0075428_100674325 | Ga0075428_1006743252 | 186 |
| 429 | 3300006852 | Ga0075433_10393007 | Ga0075433_103930071 | 186 |
| 430 | 3300006852 | Ga0075433_10580011 | Ga0075433_105800111 | 186 |
| 431 | 3300006871 | Ga0075434_100496625 | Ga0075434_1004966252 | 186 |
| 432 | 3300006881 | Ga0068865_100264128 | Ga0068865_1002641282 | 186 |
| 433 | 3300006914 | Ga0075436_100024009 | Ga0075436_1000240093 | 186 |
| 434 | 3300006914 | Ga0075436_100038456 | Ga0075436_1000384563 | 186 |
| 435 | 3300006914 | Ga0075436_100600255 | Ga0075436_1006002552 | 186 |
| 436 | 3300006931 | Ga0097620_100311114 | Ga0097620_1003111142 | 186 |
| 437 | 3300006931 | Ga0097620_100416276 | Ga0097620_1004162762 | 186 |
| 438 | 3300006931 | Ga0097620_101319394 | Ga0097620_1013193942 | 186 |
| 439 | 3300006931 | Ga0097620_101727795 | Ga0097620_1017277951 | 186 |
| 440 | 3300007076 | Ga0075435_100692382 | Ga0075435_1006923822 | 186 |
| 441 | 3300007076 | Ga0075435_100816644 | Ga0075435_1008166442 | 186 |
| 442 | 3300007788 | Ga0099795_10067688 | Ga0099795_100676881 | 186 |
| 443 | 3300009093 | Ga0105240_10071134 | Ga0105240_100711345 | 186 |
| 444 | 3300009093 | Ga0105240_10095127 | Ga0105240_100951272 | 186 |
| 445 | 3300009093 | Ga0105240_11055164 | Ga0105240_110551642 | 186 |
| 446 | 3300009094 | Ga0111539_10702902 | Ga0111539_107029021 | 186 |
| 447 | 3300009094 | Ga0111539_10751131 | Ga0111539_107511312 | 186 |
| 448 | 3300009094 | Ga0111539_11938755 | Ga0111539_119387551 | 186 |
| 449 | 3300009098 | Ga0105245_10051429 | Ga0105245_100514293 | 186 |
| 450 | 3300009098 | Ga0105245_10114923 | Ga0105245_101149232 | 186 |
| 451 | 3300009101 | Ga0105247_10124210 | Ga0105247_101242102 | 186 |
| 452 | 3300009101 | Ga0105247_10208372 | Ga0105247_102083722 | 186 |
| 453 | 3300009101 | Ga0105247_10464220 | Ga0105247_104642202 | 186 |
| 454 | 3300009101 | Ga0105247_10695238 | Ga0105247_106952381 | 186 |
| 455 | 3300009147 | Ga0114129_10010111 | Ga0114129_100101118 | 186 |
| 456 | 3300009147 | Ga0114129_10281362 | Ga0114129_102813622 | 186 |
| 457 | 3300009147 | Ga0114129_10392395 | Ga0114129_103923951 | 186 |
| 458 | 3300009148 | Ga0105243_10185655 | Ga0105243_101856552 | 186 |
| 459 | 3300009148 | Ga0105243_11038760 | Ga0105243_110387602 | 186 |
| 460 | 3300009148 | Ga0105243_11717485 | Ga0105243_117174851 | 186 |
| 461 | 3300009174 | Ga0105241_10339536 | Ga0105241_103395362 | 186 |
| 462 | 3300009174 | Ga0105241_10447474 | Ga0105241_104474742 | 186 |
| 463 | 3300009174 | Ga0105241_10904324 | Ga0105241_109043241 | 186 |
| 464 | 3300009176 | Ga0105242_10019943 | Ga0105242_100199438 | 186 |
| 465 | 3300009176 | Ga0105242_10164649 | Ga0105242_101646493 | 186 |
| 466 | 3300009176 | Ga0105242_10182184 | Ga0105242_101821842 | 186 |
| 467 | 3300009176 | Ga0105242_11200148 | Ga0105242_112001481 | 186 |
| 468 | 3300009177 | Ga0105248_10286065 | Ga0105248_102860653 | 186 |
| 469 | 3300009177 | Ga0105248_10496147 | Ga0105248_104961472 | 186 |
| 470 | 3300009545 | Ga0105237_10018816 | Ga0105237_100188167 | 186 |
| 471 | 3300009545 | Ga0105237_10110572 | Ga0105237_101105724 | 186 |
| 472 | 3300009551 | Ga0105238_10137720 | Ga0105238_101377203 | 186 |
| 473 | 3300009551 | Ga0105238_10998419 | Ga0105238_109984192 | 186 |
| 474 | 3300009553 | Ga0105249_10016016 | Ga0105249_100160166 | 186 |
| 475 | 3300009553 | Ga0105249_10029932 | Ga0105249_100299324 | 186 |
| 476 | 3300009553 | Ga0105249_10482098 | Ga0105249_104820982 | 186 |
| 477 | 3300010159 | Ga0099796_10002329 | Ga0099796_100023293 | 186 |
| 478 | 3300010159 | Ga0099796_10007686 | Ga0099796_100076863 | 186 |
| 479 | 3300010375 | Ga0105239_10018427 | Ga0105239_100184274 | 186 |
| 480 | 3300010375 | Ga0105239_10165978 | Ga0105239_101659782 | 186 |
| 481 | 3300010375 | Ga0105239_10295621 | Ga0105239_102956212 | 186 |
| 482 | 3300010375 | Ga0105239_10317509 | Ga0105239_103175092 | 186 |
| 483 | 3300010375 | Ga0105239_10504864 | Ga0105239_105048642 | 186 |
| 484 | 3300010375 | Ga0105239_10968756 | Ga0105239_109687562 | 186 |
| 485 | 3300010375 | Ga0105239_11665478 | Ga0105239_116654782 | 186 |
| 486 | 3300011119 | Ga0105246_10104235 | Ga0105246_101042352 | 186 |
| 487 | 3300011119 | Ga0105246_10235860 | Ga0105246_102358602 | 186 |
| 488 | 3300012494 | Ga0157341_1025973 | Ga0157341_10259731 | 186 |
| 489 | 3300013100 | Ga0157373_10573312 | Ga0157373_105733122 | 186 |
| 490 | 3300013100 | Ga0157373_10590937 | Ga0157373_105909372 | 186 |
| 491 | 3300013102 | Ga0157371_10168968 | Ga0157371_101689682 | 186 |
| 492 | 3300013102 | Ga0157371_10343434 | Ga0157371_103434342 | 186 |
| 493 | 3300013105 | Ga0157369_10326698 | Ga0157369_103266981 | 186 |
| 494 | 3300013296 | Ga0157374_10000036 | Ga0157374_100000368 | 186 |
| 495 | 3300013296 | Ga0157374_10002060 | Ga0157374_1000206011 | 186 |
| 496 | 3300013296 | Ga0157374_10023552 | Ga0157374_100235528 | 186 |
| 497 | 3300013296 | Ga0157374_10087495 | Ga0157374_100874951 | 186 |
| 498 | 3300013296 | Ga0157374_10108489 | Ga0157374_101084893 | 186 |
| 499 | 3300013296 | Ga0157374_10138095 | Ga0157374_101380953 | 186 |
| 500 | 3300013296 | Ga0157374_10171288 | Ga0157374_101712884 | 186 |
| 501 | 3300013296 | Ga0157374_10190945 | Ga0157374_101909452 | 186 |
| 502 | 3300013296 | Ga0157374_10249196 | Ga0157374_102491962 | 186 |
| 503 | 3300013296 | Ga0157374_10324636 | Ga0157374_103246362 | 186 |
| 504 | 3300013296 | Ga0157374_10389571 | Ga0157374_103895712 | 186 |
| 505 | 3300013296 | Ga0157374_10459301 | Ga0157374_104593012 | 186 |
| 506 | 3300013296 | Ga0157374_10528501 | Ga0157374_105285012 | 186 |
| 507 | 3300013296 | Ga0157374_10535060 | Ga0157374_105350602 | 186 |
| 508 | 3300013296 | Ga0157374_10701692 | Ga0157374_107016922 | 186 |
| 509 | 3300013297 | Ga0157378_10016255 | Ga0157378_100162555 | 186 |
| 510 | 3300013297 | Ga0157378_10055609 | Ga0157378_100556093 | 186 |
| 511 | 3300013297 | Ga0157378_10121944 | Ga0157378_101219442 | 186 |
| 512 | 3300013297 | Ga0157378_10144246 | Ga0157378_101442462 | 186 |
| 513 | 3300013297 | Ga0157378_10217479 | Ga0157378_102174793 | 186 |
| 514 | 3300013297 | Ga0157378_10343520 | Ga0157378_103435202 | 186 |
| 515 | 3300013297 | Ga0157378_10375481 | Ga0157378_103754812 | 186 |
| 516 | 3300013297 | Ga0157378_10532800 | Ga0157378_105328001 | 186 |
| 517 | 3300013297 | Ga0157378_10578055 | Ga0157378_105780552 | 186 |
| 518 | 3300013297 | Ga0157378_10579114 | Ga0157378_105791142 | 186 |
| 519 | 3300013297 | Ga0157378_10836597 | Ga0157378_108365971 | 186 |
| 520 | 3300013297 | Ga0157378_10856317 | Ga0157378_108563172 | 186 |
| 521 | 3300013297 | Ga0157378_11013341 | Ga0157378_110133412 | 186 |
| 522 | 3300013297 | Ga0157378_11195409 | Ga0157378_111954092 | 186 |
| 523 | 3300013306 | Ga0163162_10012238 | Ga0163162_100122382 | 186 |
| 524 | 3300013306 | Ga0163162_10028980 | Ga0163162_100289802 | 186 |
| 525 | 3300013306 | Ga0163162_10033387 | Ga0163162_100333872 | 186 |
| 526 | 3300013306 | Ga0163162_10037100 | Ga0163162_100371005 | 186 |
| 527 | 3300013306 | Ga0163162_10058128 | Ga0163162_100581285 | 186 |
| 528 | 3300013306 | Ga0163162_10071548 | Ga0163162_100715484 | 186 |
| 529 | 3300013306 | Ga0163162_10371410 | Ga0163162_103714102 | 186 |
| 530 | 3300013307 | Ga0157372_10035116 | Ga0157372_100351164 | 186 |
| 531 | 3300013307 | Ga0157372_10047250 | Ga0157372_100472507 | 186 |
| 532 | 3300013307 | Ga0157372_10121487 | Ga0157372_101214873 | 186 |
| 533 | 3300013307 | Ga0157372_10207336 | Ga0157372_102073362 | 186 |
| 534 | 3300013307 | Ga0157372_10845908 | Ga0157372_108459082 | 186 |
| 535 | 3300013308 | Ga0157375_10002351 | Ga0157375_100023518 | 186 |
| 536 | 3300013308 | Ga0157375_10012538 | Ga0157375_100125382 | 186 |
| 537 | 3300013308 | Ga0157375_10033130 | Ga0157375_100331303 | 186 |
| 538 | 3300013308 | Ga0157375_10176945 | Ga0157375_101769452 | 186 |
| 539 | 3300013308 | Ga0157375_10261482 | Ga0157375_102614822 | 186 |
| 540 | 3300013308 | Ga0157375_10654968 | Ga0157375_106549682 | 186 |
| 541 | 3300013308 | Ga0157375_10811863 | Ga0157375_108118632 | 186 |
| 542 | 3300013308 | Ga0157375_11064352 | Ga0157375_110643521 | 186 |
| 543 | 3300014325 | Ga0163163_10020210 | Ga0163163_100202106 | 186 |
| 544 | 3300014497 | Ga0182008_10084132 | Ga0182008_100841323 | 186 |
| 545 | 3300014497 | Ga0182008_10251634 | Ga0182008_102516341 | 186 |
| 546 | 3300014745 | Ga0157377_10070240 | Ga0157377_100702402 | 186 |
| 547 | 3300014745 | Ga0157377_10371671 | Ga0157377_103716711 | 186 |
| 548 | 3300014745 | Ga0157377_10447460 | Ga0157377_104474601 | 186 |
| 549 | 3300014968 | Ga0157379_10044580 | Ga0157379_100445804 | 186 |
| 550 | 3300014968 | Ga0157379_10358012 | Ga0157379_103580122 | 186 |
| 551 | 3300014968 | Ga0157379_10360391 | Ga0157379_103603912 | 186 |
| 552 | 3300014968 | Ga0157379_10498232 | Ga0157379_104982322 | 186 |
| 553 | 3300014969 | Ga0157376_10001772 | Ga0157376_100017724 | 186 |
| 554 | 3300014969 | Ga0157376_10033828 | Ga0157376_100338282 | 186 |
| 555 | 3300014969 | Ga0157376_10062585 | Ga0157376_100625852 | 186 |
| 556 | 3300014969 | Ga0157376_10133534 | Ga0157376_101335343 | 186 |
| 557 | 3300014969 | Ga0157376_10218191 | Ga0157376_102181912 | 186 |
| 558 | 3300014969 | Ga0157376_10454669 | Ga0157376_104546692 | 186 |
| 559 | 3300014969 | Ga0157376_11009990 | Ga0157376_110099902 | 186 |
| 560 | 3300017792 | Ga0163161_10039209 | Ga0163161_100392092 | 186 |
| 561 | 3300017792 | Ga0163161_10707240 | Ga0163161_107072401 | 186 |
| 562 | 3300021384 | Ga0213876_10052819 | Ga0213876_100528193 | 186 |
| 563 | 3300021384 | Ga0213876_10087300 | Ga0213876_100873002 | 186 |
| 564 | 3300021384 | Ga0213876_10178599 | Ga0213876_101785992 | 186 |
| 565 | 3300025271 | Ga0207666_1000965 | Ga0207666_10009656 | 186 |
| 566 | 3300025271 | Ga0207666_1029194 | Ga0207666_10291942 | 186 |
| 567 | 3300025290 | Ga0207673_1003904 | Ga0207673_10039041 | 186 |
| 568 | 3300025315 | Ga0207697_10001557 | Ga0207697_1000155710 | 186 |
| 569 | 3300025315 | Ga0207697_10002696 | Ga0207697_100026965 | 186 |
| 570 | 3300025315 | Ga0207697_10017954 | Ga0207697_100179542 | 186 |
| 571 | 3300025315 | Ga0207697_10017990 | Ga0207697_100179902 | 186 |
| 572 | 3300025315 | Ga0207697_10018085 | Ga0207697_100180852 | 186 |
| 573 | 3300025315 | Ga0207697_10038226 | Ga0207697_100382261 | 186 |
| 574 | 3300025315 | Ga0207697_10070193 | Ga0207697_100701932 | 186 |
| 575 | 3300025901 | Ga0207688_10003192 | Ga0207688_1000319211 | 186 |
| 576 | 3300025901 | Ga0207688_10008291 | Ga0207688_100082912 | 186 |
| 577 | 3300025901 | Ga0207688_10093005 | Ga0207688_100930052 | 186 |
| 578 | 3300025901 | Ga0207688_10139122 | Ga0207688_101391222 | 186 |
| 579 | 3300025901 | Ga0207688_10689957 | Ga0207688_106899571 | 186 |
| 580 | 3300025903 | Ga0207680_10017844 | Ga0207680_100178445 | 186 |
| 581 | 3300025903 | Ga0207680_10065698 | Ga0207680_100656983 | 186 |
| 582 | 3300025903 | Ga0207680_10595288 | Ga0207680_105952881 | 186 |
| 583 | 3300025904 | Ga0207647_10043454 | Ga0207647_100434543 | 186 |
| 584 | 3300025905 | Ga0207685_10017846 | Ga0207685_100178463 | 186 |
| 585 | 3300025906 | Ga0207699_10188061 | Ga0207699_101880612 | 186 |
| 586 | 3300025907 | Ga0207645_10000574 | Ga0207645_1000057422 | 186 |
| 587 | 3300025907 | Ga0207645_10010256 | Ga0207645_1001025610 | 186 |
| 588 | 3300025907 | Ga0207645_10027542 | Ga0207645_100275425 | 186 |
| 589 | 3300025907 | Ga0207645_10221176 | Ga0207645_102211761 | 186 |
| 590 | 3300025907 | Ga0207645_10263213 | Ga0207645_102632132 | 186 |
| 591 | 3300025909 | Ga0207705_10072124 | Ga0207705_100721241 | 186 |
| 592 | 3300025910 | Ga0207684_10000292 | Ga0207684_1000029269 | 186 |
| 593 | 3300025910 | Ga0207684_10007486 | Ga0207684_1000748612 | 186 |
| 594 | 3300025910 | Ga0207684_10009504 | Ga0207684_100095044 | 186 |
| 595 | 3300025910 | Ga0207684_10045965 | Ga0207684_100459652 | 186 |
| 596 | 3300025910 | Ga0207684_10113168 | Ga0207684_101131682 | 186 |
| 597 | 3300025910 | Ga0207684_10286901 | Ga0207684_102869012 | 186 |
| 598 | 3300025910 | Ga0207684_10742794 | Ga0207684_107427942 | 186 |
| 599 | 3300025912 | Ga0207707_10132079 | Ga0207707_101320792 | 186 |
| 600 | 3300025914 | Ga0207671_10010633 | Ga0207671_100106333 | 186 |
| 601 | 3300025914 | Ga0207671_10037132 | Ga0207671_100371324 | 186 |
| 602 | 3300025914 | Ga0207671_10111929 | Ga0207671_101119293 | 186 |
| 603 | 3300025914 | Ga0207671_10164844 | Ga0207671_101648441 | 186 |
| 604 | 3300025915 | Ga0207693_10005933 | Ga0207693_1000593310 | 186 |
| 605 | 3300025915 | Ga0207693_10028709 | Ga0207693_100287092 | 186 |
| 606 | 3300025915 | Ga0207693_10031847 | Ga0207693_100318474 | 186 |
| 607 | 3300025915 | Ga0207693_10046002 | Ga0207693_100460024 | 186 |
| 608 | 3300025916 | Ga0207663_10171523 | Ga0207663_101715232 | 186 |
| 609 | 3300025916 | Ga0207663_10490354 | Ga0207663_104903542 | 186 |
| 610 | 3300025919 | Ga0207657_10214476 | Ga0207657_102144763 | 186 |
| 611 | 3300025919 | Ga0207657_10831922 | Ga0207657_108319222 | 186 |
| 612 | 3300025920 | Ga0207649_10012194 | Ga0207649_100121945 | 186 |
| 613 | 3300025922 | Ga0207646_10000386 | Ga0207646_1000038621 | 186 |
| 614 | 3300025922 | Ga0207646_10025706 | Ga0207646_100257065 | 186 |
| 615 | 3300025922 | Ga0207646_10031901 | Ga0207646_100319013 | 186 |
| 616 | 3300025922 | Ga0207646_10040419 | Ga0207646_100404192 | 186 |
| 617 | 3300025922 | Ga0207646_10086093 | Ga0207646_100860933 | 186 |
| 618 | 3300025922 | Ga0207646_10092609 | Ga0207646_100926092 | 186 |
| 619 | 3300025922 | Ga0207646_10137382 | Ga0207646_101373822 | 186 |
| 620 | 3300025922 | Ga0207646_10293662 | Ga0207646_102936622 | 186 |
| 621 | 3300025922 | Ga0207646_10396428 | Ga0207646_103964282 | 186 |
| 622 | 3300025922 | Ga0207646_10487301 | Ga0207646_104873011 | 186 |
| 623 | 3300025922 | Ga0207646_10620502 | Ga0207646_106205021 | 186 |
| 624 | 3300025923 | Ga0207681_10008691 | Ga0207681_100086918 | 186 |
| 625 | 3300025923 | Ga0207681_10021651 | Ga0207681_100216514 | 186 |
| 626 | 3300025923 | Ga0207681_10164798 | Ga0207681_101647982 | 186 |
| 627 | 3300025923 | Ga0207681_10173678 | Ga0207681_101736782 | 186 |
| 628 | 3300025923 | Ga0207681_10187995 | Ga0207681_101879952 | 186 |
| 629 | 3300025923 | Ga0207681_10355670 | Ga0207681_103556702 | 186 |
| 630 | 3300025924 | Ga0207694_10168976 | Ga0207694_101689763 | 186 |
| 631 | 3300025925 | Ga0207650_10027110 | Ga0207650_100271104 | 186 |
| 632 | 3300025925 | Ga0207650_10609973 | Ga0207650_106099732 | 186 |
| 633 | 3300025926 | Ga0207659_10070936 | Ga0207659_100709361 | 186 |
| 634 | 3300025926 | Ga0207659_10330431 | Ga0207659_103304311 | 186 |
| 635 | 3300025928 | Ga0207700_10023918 | Ga0207700_100239184 | 186 |
| 636 | 3300025928 | Ga0207700_10096728 | Ga0207700_100967283 | 186 |
| 637 | 3300025928 | Ga0207700_10163843 | Ga0207700_101638431 | 186 |
| 638 | 3300025928 | Ga0207700_10261353 | Ga0207700_102613532 | 186 |
| 639 | 3300025928 | Ga0207700_11312300 | Ga0207700_113123001 | 186 |
| 640 | 3300025929 | Ga0207664_10198198 | Ga0207664_101981982 | 186 |
| 641 | 3300025929 | Ga0207664_10229334 | Ga0207664_102293343 | 186 |
| 642 | 3300025929 | Ga0207664_10326497 | Ga0207664_103264972 | 186 |
| 643 | 3300025931 | Ga0207644_10049006 | Ga0207644_100490062 | 186 |
| 644 | 3300025931 | Ga0207644_10056144 | Ga0207644_100561444 | 186 |
| 645 | 3300025931 | Ga0207644_10069419 | Ga0207644_100694193 | 186 |
| 646 | 3300025931 | Ga0207644_10088113 | Ga0207644_100881133 | 186 |
| 647 | 3300025931 | Ga0207644_10092943 | Ga0207644_100929432 | 186 |
| 648 | 3300025931 | Ga0207644_10431217 | Ga0207644_104312172 | 186 |
| 649 | 3300025932 | Ga0207690_10022326 | Ga0207690_100223264 | 186 |
| 650 | 3300025932 | Ga0207690_10045762 | Ga0207690_100457622 | 186 |
| 651 | 3300025932 | Ga0207690_11078842 | Ga0207690_110788421 | 186 |
| 652 | 3300025933 | Ga0207706_10003684 | Ga0207706_100036848 | 186 |
| 653 | 3300025933 | Ga0207706_10020606 | Ga0207706_100206067 | 186 |
| 654 | 3300025933 | Ga0207706_10208517 | Ga0207706_102085172 | 186 |
| 655 | 3300025933 | Ga0207706_10212759 | Ga0207706_102127592 | 186 |
| 656 | 3300025933 | Ga0207706_10378465 | Ga0207706_103784652 | 186 |
| 657 | 3300025933 | Ga0207706_10950770 | Ga0207706_109507702 | 186 |
| 658 | 3300025934 | Ga0207686_10062018 | Ga0207686_100620182 | 186 |
| 659 | 3300025934 | Ga0207686_10515206 | Ga0207686_105152062 | 186 |
| 660 | 3300025935 | Ga0207709_10674066 | Ga0207709_106740662 | 186 |
| 661 | 3300025936 | Ga0207670_10052677 | Ga0207670_100526772 | 186 |
| 662 | 3300025936 | Ga0207670_10140489 | Ga0207670_101404891 | 186 |
| 663 | 3300025937 | Ga0207669_10003562 | Ga0207669_100035622 | 186 |
| 664 | 3300025937 | Ga0207669_10105937 | Ga0207669_101059373 | 186 |
| 665 | 3300025937 | Ga0207669_10297533 | Ga0207669_102975331 | 186 |
| 666 | 3300025937 | Ga0207669_10912238 | Ga0207669_109122382 | 186 |
| 667 | 3300025939 | Ga0207665_10006694 | Ga0207665_1000669410 | 186 |
| 668 | 3300025939 | Ga0207665_10026197 | Ga0207665_100261974 | 186 |
| 669 | 3300025939 | Ga0207665_10152353 | Ga0207665_101523532 | 186 |
| 670 | 3300025939 | Ga0207665_10265790 | Ga0207665_102657901 | 186 |
| 671 | 3300025939 | Ga0207665_10907769 | Ga0207665_109077692 | 186 |
| 672 | 3300025940 | Ga0207691_10003715 | Ga0207691_1000371515 | 186 |
| 673 | 3300025940 | Ga0207691_10004494 | Ga0207691_1000449416 | 186 |
| 674 | 3300025940 | Ga0207691_10135861 | Ga0207691_101358612 | 186 |
| 675 | 3300025940 | Ga0207691_10164829 | Ga0207691_101648292 | 186 |
| 676 | 3300025940 | Ga0207691_10488918 | Ga0207691_104889182 | 186 |
| 677 | 3300025940 | Ga0207691_10532430 | Ga0207691_105324302 | 186 |
| 678 | 3300025942 | Ga0207689_10027373 | Ga0207689_100273734 | 186 |
| 679 | 3300025945 | Ga0207679_10020501 | Ga0207679_100205012 | 186 |
| 680 | 3300025949 | Ga0207667_10001014 | Ga0207667_100010147 | 186 |
| 681 | 3300025960 | Ga0207651_10025449 | Ga0207651_100254492 | 186 |
| 682 | 3300025960 | Ga0207651_10097110 | Ga0207651_100971102 | 186 |
| 683 | 3300025960 | Ga0207651_10233593 | Ga0207651_102335932 | 186 |
| 684 | 3300025960 | Ga0207651_10258094 | Ga0207651_102580942 | 186 |
| 685 | 3300025972 | Ga0207668_10012259 | Ga0207668_100122596 | 186 |
| 686 | 3300025972 | Ga0207668_10016783 | Ga0207668_100167833 | 186 |
| 687 | 3300025972 | Ga0207668_10017669 | Ga0207668_100176693 | 186 |
| 688 | 3300025972 | Ga0207668_10088504 | Ga0207668_100885042 | 186 |
| 689 | 3300025986 | Ga0207658_10010561 | Ga0207658_100105617 | 186 |
| 690 | 3300025986 | Ga0207658_10089256 | Ga0207658_100892563 | 186 |
| 691 | 3300025986 | Ga0207658_10275290 | Ga0207658_102752902 | 186 |
| 692 | 3300026023 | Ga0207677_10056854 | Ga0207677_100568543 | 186 |
| 693 | 3300026023 | Ga0207677_10327359 | Ga0207677_103273592 | 186 |
| 694 | 3300026035 | Ga0207703_10120051 | Ga0207703_101200512 | 186 |
| 695 | 3300026035 | Ga0207703_10364796 | Ga0207703_103647961 | 186 |
| 696 | 3300026041 | Ga0207639_10000582 | Ga0207639_1000058214 | 186 |
| 697 | 3300026067 | Ga0207678_10173267 | Ga0207678_101732672 | 186 |
| 698 | 3300026067 | Ga0207678_10295600 | Ga0207678_102956003 | 186 |
| 699 | 3300026078 | Ga0207702_10403033 | Ga0207702_104030332 | 186 |
| 700 | 3300026088 | Ga0207641_10054972 | Ga0207641_100549723 | 186 |
| 701 | 3300026088 | Ga0207641_10055335 | Ga0207641_100553352 | 186 |
| 702 | 3300026088 | Ga0207641_10155856 | Ga0207641_101558561 | 186 |
| 703 | 3300026088 | Ga0207641_10211252 | Ga0207641_102112523 | 186 |
| 704 | 3300026088 | Ga0207641_10443888 | Ga0207641_104438882 | 186 |
| 705 | 3300026089 | Ga0207648_10220187 | Ga0207648_102201872 | 186 |
| 706 | 3300026089 | Ga0207648_10287070 | Ga0207648_102870702 | 186 |
| 707 | 3300026095 | Ga0207676_10249933 | Ga0207676_102499332 | 186 |
| 708 | 3300026095 | Ga0207676_10941628 | Ga0207676_109416282 | 186 |
| 709 | 3300026118 | Ga0207675_100095869 | Ga0207675_1000958691 | 186 |
| 710 | 3300026118 | Ga0207675_101602324 | Ga0207675_1016023241 | 186 |
| 711 | 3300026121 | Ga0207683_10008548 | Ga0207683_1000854811 | 186 |
| 712 | 3300026121 | Ga0207683_10026404 | Ga0207683_100264044 | 186 |
| 713 | 3300026121 | Ga0207683_10130361 | Ga0207683_101303611 | 186 |
| 714 | 3300026121 | Ga0207683_10272290 | Ga0207683_102722902 | 186 |
| 715 | 3300026121 | Ga0207683_10336210 | Ga0207683_103362102 | 186 |
| 716 | 3300028379 | Ga0268266_10000197 | Ga0268266_100001978 | 186 |
| 717 | 3300028379 | Ga0268266_10002434 | Ga0268266_1000243417 | 186 |
| 718 | 3300028379 | Ga0268266_10012778 | Ga0268266_100127782 | 186 |
| 719 | 3300028379 | Ga0268266_10013406 | Ga0268266_100134066 | 186 |
| 720 | 3300028379 | Ga0268266_10075111 | Ga0268266_100751112 | 186 |
| 721 | 3300028379 | Ga0268266_10286554 | Ga0268266_102865542 | 186 |
| 722 | 3300028379 | Ga0268266_10477502 | Ga0268266_104775021 | 186 |
| 723 | 3300028380 | Ga0268265_10096538 | Ga0268265_100965382 | 186 |
| 724 | 3300028380 | Ga0268265_10499190 | Ga0268265_104991902 | 186 |
| 725 | 3300028380 | Ga0268265_11060816 | Ga0268265_110608162 | 186 |
| 726 | 3300028381 | Ga0268264_10374614 | Ga0268264_103746142 | 186 |
| 727 | 3300028381 | Ga0268264_10606452 | Ga0268264_106064521 | 186 |
| 728 | 3300030521 | Ga0307511_10000128 | Ga0307511_100001282 | 186 |
| 729 | 3300035089 | Ga0373944_0038430 | Ga0373944_0038430_888_1448 | 186 |
| 730 | 3300035089 | Ga0373944_0274833 | Ga0373944_0274833_22_582 | 186 |
| 731 | 3300035111 | Ga0373923_0137669 | Ga0373923_0137669_200_760 | 186 |
| 732 | 3300035114 | Ga0373939_0039936 | Ga0373939_0039936_318_878 | 186 |
| 733 | 3300035116 | Ga0373945_0087316 | Ga0373945_0087316_36_596 | 186 |
| 734 | 3300035117 | Ga0373953_0091928 | Ga0373953_0091928_82_642 | 186 |
| 735 | 3300035118 | Ga0373954_0492117 | Ga0373954_0492117_17_577 | 186 |
| 736 | 3300035119 | Ga0373956_0309188 | Ga0373956_0309188_149_709 | 186 |
| 737 | 3300035170 | Ga0373943_0016752 | Ga0373943_0016752_2268_2828 | 186 |
| 738 | 3300035170 | Ga0373943_0024378 | Ga0373943_0024378_484_1044 | 186 |
| 739 | 3300035170 | Ga0373943_0035717 | Ga0373943_0035717_1403_1963 | 186 |
| 740 | 3300035170 | Ga0373943_0055648 | Ga0373943_0055648_649_1209 | 186 |
| 741 | 3300035691 | Ga0373931_0547570 | Ga0373931_0547570_70_630 | 186 |
| 742 | 3300035692 | Ga0373935_0112443 | Ga0373935_0112443_338_898 | 186 |
| 743 | 3300035692 | Ga0373935_0200565 | Ga0373935_0200565_801_1361 | 186 |
| 744 | 3300035692 | Ga0373935_0200707 | Ga0373935_0200707_737_1297 | 186 |
| 745 | 3300035692 | Ga0373935_0203073 | Ga0373935_0203073_84_644 | 186 |
| 746 | 3300035692 | Ga0373935_0421558 | Ga0373935_0421558_14_574 | 186 |
| 747 | 3300035695 | Ga0373927_0100804 | Ga0373927_0100804_1024_1584 | 186 |
| 748 | 3300035724 | Ga0373933_0070022 | Ga0373933_0070022_549_1109 | 186 |
| 749 | 3300035725 | Ga0373947_0008617 | Ga0373947_0008617_1136_1696 | 186 |
| 750 | 3300035725 | Ga0373947_0104687 | Ga0373947_0104687_281_841 | 186 |
| 751 | 3300035725 | Ga0373947_0642884 | Ga0373947_0642884_16_576 | 186 |
| 752 | 3300036401 | Ga0373937_0017352 | Ga0373937_0017352_4917_5477 | 186 |
| 753 | 3300036401 | Ga0373937_0360283 | Ga0373937_0360283_628_1188 | 186 |
| 754 | 3300036401 | Ga0373937_0469403 | Ga0373937_0469403_77_637 | 186 |
| 755 | 3300036401 | Ga0373937_0923950 | Ga0373937_0923950_22_582 | 186 |
| 756 | 3300037068 | Ga0373925_0163863 | Ga0373925_0163863_1087_1647 | 186 |
| 757 | 3300037312 | Ga0395899_0022448 | Ga0395899_0022448_4027_4587 | 186 |
| 758 | 3300037418 | Ga0395900_0003229 | Ga0395900_0003229_9870_10430 | 186 |
| 759 | 3300037418 | Ga0395900_0081553 | Ga0395900_0081553_1420_1980 | 186 |
| 760 | 3300037418 | Ga0395900_0423417 | Ga0395900_0423417_266_826 | 186 |
| 761 | 3300037418 | Ga0395900_0646072 | Ga0395900_0646072_321_881 | 186 |
| 762 | 3300037466 | Ga0395898_0013011 | Ga0395898_0013011_201_761 | 186 |
| 763 | 3300037466 | Ga0395898_0275473 | Ga0395898_0275473_386_946 | 186 |
| 764 | 3300037471 | Ga0395905_0013270 | Ga0395905_0013270_6135_6695 | 186 |
| 765 | 3300037471 | Ga0395905_0691593 | Ga0395905_0691593_121_681 | 186 |
| 766 | 3300037471 | Ga0395905_1186637 | Ga0395905_1186637_62_622 | 186 |
| 767 | 3300037471 | Ga0395905_1270881 | Ga0395905_1270881_18_578 | 186 |
| 768 | 3300037853 | Ga0436364_0633325 | Ga0436364_0633325_589_1149 | 186 |
| 769 | 3300038443 | Ga0395901_0009691 | Ga0395901_0009691_3825_4385 | 186 |
| 770 | 3300038443 | Ga0395901_0018727 | Ga0395901_0018727_2350_2910 | 186 |
| 771 | 3300038443 | Ga0395901_0240837 | Ga0395901_0240837_480_1040 | 186 |
| 772 | 3300039437 | Ga0436365_1218062 | Ga0436365_1218062_160_720 | 186 |
| 773 | 3300039437 | Ga0436365_1366941 | Ga0436365_1366941_2524_3084 | 186 |
| 774 | 3300039437 | Ga0436365_1440966 | Ga0436365_1440966_12477_13037 | 186 |
| 775 | 3300041496 | Ga0451839_1498401 | Ga0451839_1498401_240_800 | 186 |
| 776 | 3300041512 | Ga0451853_2598742 | Ga0451853_2598742_66_626 | 186 |
| 777 | 3300041512 | Ga0451853_2845883 | Ga0451853_2845883_747_1307 | 186 |
| 778 | 3300042008 | Ga0439450_035088 | Ga0439450_035088_407_967 | 186 |
| 779 | 3300042009 | Ga0439451_013983 | Ga0439451_013983_567_1127 | 186 |
| 780 | 3300042011 | Ga0439454_047137 | Ga0439454_047137_95_655 | 186 |
| 781 | 3300042012 | Ga0439455_0000990 | Ga0439455_0000990_2125_2685 | 186 |
| 782 | 3300042993 | Ga0439440_0055893 | Ga0439440_0055893_51_611 | 186 |
| 783 | 3300044842 | Ga0466957_0008871 | Ga0466957_0008871_760_1320 | 186 |
| 784 | 3300045051 | Ga0451576_0081187 | Ga0451576_0081187_2705_3265 | 186 |
| 785 | 3300046454 | Ga0495592_0015795 | Ga0495592_0015795_1561_2121 | 186 |
| 786 | 3300046454 | Ga0495592_0235248 | Ga0495592_0235248_413_973 | 186 |
| 787 | 3300046461 | Ga0495641_0102353 | Ga0495641_0102353_515_1075 | 186 |
| 788 | 3300046462 | Ga0495651_0332021 | Ga0495651_0332021_104_664 | 186 |
| 789 | 3300046463 | Ga0495653_0285943 | Ga0495653_0285943_154_714 | 186 |
| 790 | 3300046463 | Ga0495653_0424291 | Ga0495653_0424291_240_800 | 186 |
| 791 | 3300046472 | Ga0495580_0067910 | Ga0495580_0067910_1157_1717 | 186 |
| 792 | 3300046472 | Ga0495580_0093599 | Ga0495580_0093599_688_1248 | 186 |
| 793 | 3300046492 | Ga0495585_0063921 | Ga0495585_0063921_902_1462 | 186 |
| 794 | 3300046511 | Ga0495608_0461492 | Ga0495608_0461492_67_627 | 186 |
| 795 | 3300046514 | Ga0495618_0387797 | Ga0495618_0387797_285_845 | 186 |
| 796 | 3300046516 | Ga0495628_0017947 | Ga0495628_0017947_545_1105 | 186 |
| 797 | 3300046516 | Ga0495628_0254705 | Ga0495628_0254705_497_1057 | 186 |
| 798 | 3300046517 | Ga0495630_0203828 | Ga0495630_0203828_139_699 | 186 |
| 799 | 3300046533 | Ga0495640_0619142 | Ga0495640_0619142_83_643 | 186 |
| 800 | 3300046535 | Ga0495586_0081448 | Ga0495586_0081448_939_1499 | 186 |
| 801 | 3300046536 | Ga0495587_0085278 | Ga0495587_0085278_573_1133 | 186 |
| 802 | 3300046537 | Ga0495598_0008807 | Ga0495598_0008807_507_1067 | 186 |
| 803 | 3300046537 | Ga0495598_0144494 | Ga0495598_0144494_79_639 | 186 |
| 804 | 3300046539 | Ga0495621_0094286 | Ga0495621_0094286_40_600 | 186 |
| 805 | 3300046543 | Ga0495645_0069614 | Ga0495645_0069614_1730_2290 | 186 |
| 806 | 3300046559 | Ga0495667_0078427 | Ga0495667_0078427_1458_2018 | 186 |
| 807 | 3300046642 | Ga0495634_0120042 | Ga0495634_0120042_34_594 | 186 |
| 808 | 3300046663 | Ga0495635_0061356 | Ga0495635_0061356_344_904 | 186 |
| 809 | 3300046663 | Ga0495635_0110478 | Ga0495635_0110478_11_571 | 186 |
| 810 | 3300046664 | Ga0495659_0007308 | Ga0495659_0007308_345_905 | 186 |
| 811 | 3300046664 | Ga0495659_0079302 | Ga0495659_0079302_536_1096 | 186 |
| 812 | 3300046675 | Ga0495657_0151078 | Ga0495657_0151078_159_719 | 186 |
| 813 | 3300046678 | Ga0495599_0050381 | Ga0495599_0050381_1561_2121 | 186 |
| 814 | 3300046678 | Ga0495599_0096786 | Ga0495599_0096786_1200_1760 | 186 |
| 815 | 3300046680 | Ga0495646_0137047 | Ga0495646_0137047_777_1337 | 186 |
| 816 | 3300046684 | Ga0495669_0043499 | Ga0495669_0043499_1292_1852 | 186 |
| 817 | 3300046684 | Ga0495669_0111669 | Ga0495669_0111669_239_799 | 186 |
| 818 | 3300046684 | Ga0495669_0259155 | Ga0495669_0259155_25_585 | 186 |
| 819 | 3300046809 | Ga0495600_0608706 | Ga0495600_0608706_49_609 | 186 |
| 820 | 3300047317 | Ga0495604_0701632 | Ga0495604_0701632_50_610 | 186 |
| 821 | 3300047319 | Ga0495674_0156853 | Ga0495674_0156853_1026_1586 | 186 |
| 822 | 3300047319 | Ga0495674_0276404 | Ga0495674_0276404_171_731 | 186 |
| 823 | 3300047444 | Ga0495675_0334770 | Ga0495675_0334770_34_594 | 186 |
| 824 | 3300047446 | Ga0495679_070148 | Ga0495679_070148_293_853 | 186 |
| 825 | 3300047471 | Ga0495684_0011055 | Ga0495684_0011055_2922_3482 | 186 |
| 826 | 3300047471 | Ga0495684_0246955 | Ga0495684_0246955_311_871 | 186 |
| 827 | 3300048088 | Ga0495602_0048024 | Ga0495602_0048024_3104_3664 | 186 |
| 828 | 3300048088 | Ga0495602_0152176 | Ga0495602_0152176_410_970 | 186 |
| 829 | 3300048089 | Ga0495614_0228905 | Ga0495614_0228905_121_681 | 186 |
| 830 | 3300048904 | Ga0496101_0002348 | Ga0496101_0002348_1948_2508 | 186 |
| 831 | 3300048904 | Ga0496101_0367845 | Ga0496101_0367845_449_1009 | 186 |
| 832 | 3300048905 | Ga0496102_0058769 | Ga0496102_0058769_901_1461 | 186 |
| 833 | 3300048906 | Ga0496103_0031648 | Ga0496103_0031648_1553_2113 | 186 |
| 834 | 3300048906 | Ga0496103_0383358 | Ga0496103_0383358_45_605 | 186 |
| 835 | 3300048906 | Ga0496103_0545255 | Ga0496103_0545255_163_723 | 186 |
| 836 | 3300048907 | Ga0496104_0041736 | Ga0496104_0041736_2166_2726 | 186 |
| 837 | 3300048907 | Ga0496104_0101814 | Ga0496104_0101814_1008_1568 | 186 |
| 838 | 3300048907 | Ga0496104_0519694 | Ga0496104_0519694_483_1043 | 186 |
| 839 | 3300048908 | Ga0496105_0045415 | Ga0496105_0045415_2097_2660 | 186 |
| 840 | 3300048908 | Ga0496105_0555296 | Ga0496105_0555296_150_710 | 186 |
| 841 | 3300048908 | Ga0496105_0633932 | Ga0496105_0633932_215_775 | 186 |
| 842 | 3300048910 | Ga0496107_0015028 | Ga0496107_0015028_3645_4205 | 186 |
| 843 | 3300048910 | Ga0496107_0185541 | Ga0496107_0185541_235_795 | 186 |
| 844 | 3300048911 | Ga0496108_0013695 | Ga0496108_0013695_563_1123 | 186 |
| 845 | 3300048911 | Ga0496108_0024559 | Ga0496108_0024559_4310_4870 | 186 |
| 846 | 3300048911 | Ga0496108_0174056 | Ga0496108_0174056_86_646 | 186 |
| 847 | 3300048911 | Ga0496108_0255638 | Ga0496108_0255638_802_1362 | 186 |
| 848 | 3300048912 | Ga0496109_0006405 | Ga0496109_0006405_703_1263 | 186 |
| 849 | 3300048912 | Ga0496109_0020560 | Ga0496109_0020560_311_871 | 186 |
| 850 | 3300048912 | Ga0496109_0103310 | Ga0496109_0103310_1495_2055 | 186 |
| 851 | 3300048912 | Ga0496109_0145667 | Ga0496109_0145667_276_836 | 186 |
| 852 | 3300048912 | Ga0496109_0212548 | Ga0496109_0212548_893_1453 | 186 |
| 853 | 3300048912 | Ga0496109_0215034 | Ga0496109_0215034_971_1531 | 186 |
| 854 | 3300048913 | Ga0496110_0000261 | Ga0496110_0000261_25974_26537 | 186 |
| 855 | 3300048914 | Ga0496111_0000086 | Ga0496111_0000086_25269_25832 | 186 |
| 856 | 3300048914 | Ga0496111_0425633 | Ga0496111_0425633_84_644 | 186 |
| 857 | 3300048914 | Ga0496111_0585882 | Ga0496111_0585882_217_777 | 186 |
| 858 | 3300048915 | Ga0496112_0001268 | Ga0496112_0001268_16446_17006 | 186 |
| 859 | 3300048915 | Ga0496112_0007980 | Ga0496112_0007980_4844_5404 | 186 |
| 860 | 3300048915 | Ga0496112_0262373 | Ga0496112_0262373_214_774 | 186 |
| 861 | 3300048915 | Ga0496112_0269690 | Ga0496112_0269690_296_856 | 186 |
| 862 | 3300048915 | Ga0496112_0275236 | Ga0496112_0275236_452_1012 | 186 |
| 863 | 3300048915 | Ga0496112_0540839 | Ga0496112_0540839_71_631 | 186 |
| 864 | 3300048916 | Ga0496113_0011618 | Ga0496113_0011618_892_1452 | 186 |
| 865 | 3300048916 | Ga0496113_0015364 | Ga0496113_0015364_4682_5245 | 186 |
| 866 | 3300048916 | Ga0496113_0140688 | Ga0496113_0140688_479_1039 | 186 |
| 867 | 3300048916 | Ga0496113_0362641 | Ga0496113_0362641_591_1151 | 186 |
| 868 | 3300048917 | Ga0496114_0034784 | Ga0496114_0034784_3451_4011 | 186 |
| 869 | 3300048917 | Ga0496114_0156296 | Ga0496114_0156296_1140_1700 | 186 |
| 870 | 3300048918 | Ga0496115_0005081 | Ga0496115_0005081_4487_5047 | 186 |
| 871 | 3300048918 | Ga0496115_0088251 | Ga0496115_0088251_680_1240 | 186 |
| 872 | 3300048918 | Ga0496115_0504942 | Ga0496115_0504942_348_908 | 186 |
| 873 | 3300048928 | Ga0496125_0000187 | Ga0496125_0000187_119584_120144 | 186 |
| 874 | 3300049568 | Ga0501031_0001565 | Ga0501031_0001565_4575_5135 | 186 |
| 875 | 3300049569 | Ga0501032_0039863 | Ga0501032_0039863_389_949 | 186 |
| 876 | 3300049569 | Ga0501032_0084887 | Ga0501032_0084887_1122_1682 | 186 |
| 877 | 3300049570 | Ga0501033_0000024 | Ga0501033_0000024_115413_115973 | 186 |
| 878 | 3300049573 | Ga0501037_0000020 | Ga0501037_0000020_27761_28321 | 186 |
| 879 | 3300049574 | Ga0501038_0000212 | Ga0501038_0000212_40464_41024 | 186 |
| 880 | 3300049575 | Ga0501039_0010969 | Ga0501039_0010969_1304_1864 | 186 |
| 881 | 3300049579 | Ga0501043_0018694 | Ga0501043_0018694_3154_3714 | 186 |
| 882 | 3300049581 | Ga0501047_0015893 | Ga0501047_0015893_4841_5401 | 186 |
| 883 | 3300049583 | Ga0501067_0015189 | Ga0501067_0015189_529_1089 | 186 |
| 884 | 3300049584 | Ga0501068_0579966 | Ga0501068_0579966_134_694 | 186 |
| 885 | 3300049586 | Ga0501070_0012473 | Ga0501070_0012473_3343_3903 | 186 |
| 886 | 3300049586 | Ga0501070_0140616 | Ga0501070_0140616_26_586 | 186 |
| 887 | 3300049822 | Ga0501035_0000216 | Ga0501035_0000216_50955_51515 | 186 |
| 888 | 3300049823 | Ga0501044_0000510 | Ga0501044_0000510_26363_26923 | 186 |
| 889 | 3300050489 | nmdc:mga03683_12012_c1 | nmdc:mga03683_12012_c1_1721_2281 | 186 |
| 890 | 3300050489 | nmdc:mga03683_298_c1 | nmdc:mga03683_298_c1_4615_5175 | 186 |
| 891 | 3300050490 | nmdc:mga03n38_103243_c1 | nmdc:mga03n38_103243_c1_786_1346 | 186 |
| 892 | 3300050493 | nmdc:mga0k408_2179_c1 | nmdc:mga0k408_2179_c1_7517_8077 | 186 |
| 893 | 3300050493 | nmdc:mga0k408_369_c1 | nmdc:mga0k408_369_c1_21664_22224 | 186 |
| 894 | 3300050507 | nmdc:mga05p37_17694_c1 | nmdc:mga05p37_17694_c1_4321_4881 | 186 |
| 895 | 3300050507 | nmdc:mga05p37_60816_c1 | nmdc:mga05p37_60816_c1_3011_3571 | 186 |
| 896 | 3300050507 | nmdc:mga05p37_636652_c1 | nmdc:mga05p37_636652_c1_152_712 | 186 |
| 897 | 3300050511 | nmdc:mga08y16_1224870_c1 | nmdc:mga08y16_1224870_c1_51_611 | 186 |
| 898 | 3300050512 | nmdc:mga0n895_640514_c1 | nmdc:mga0n895_640514_c1_176_736 | 186 |
| 899 | 3300050512 | nmdc:mga0n895_78624_c1 | nmdc:mga0n895_78624_c1_184_744 | 186 |
| 900 | 3300050513 | nmdc:mga0rr50_183303_c1 | nmdc:mga0rr50_183303_c1_679_1239 | 186 |
| 901 | 3300050513 | nmdc:mga0rr50_234423_c1 | nmdc:mga0rr50_234423_c1_867_1427 | 186 |
| 902 | 3300050514 | nmdc:mga08x19_113622_c1 | nmdc:mga08x19_113622_c1_1179_1739 | 186 |
| 903 | 3300050514 | nmdc:mga08x19_323226_c1 | nmdc:mga08x19_323226_c1_267_827 | 186 |
| 904 | 3300050514 | nmdc:mga08x19_7027_c1 | nmdc:mga08x19_7027_c1_1484_2044 | 186 |
| 905 | 3300050515 | nmdc:mga0a205_779767_c1 | nmdc:mga0a205_779767_c1_195_755 | 186 |
| 906 | 3300053077 | Ga0495601_0006303 | Ga0495601_0006303_539_1099 | 186 |
| 907 | 3300053077 | Ga0495601_0065813 | Ga0495601_0065813_229_789 | 186 |
| 908 | 3300053083 | Ga0495655_0025664 | Ga0495655_0025664_520_1080 | 186 |
| 909 | 3300053084 | Ga0495595_0248717 | Ga0495595_0248717_63_623 | 186 |
| 910 | 3300053088 | Ga0500644_0063868 | Ga0500644_0063868_676_1236 | 186 |
| 911 | 3300053103 | Ga0500555_000003 | Ga0500555_000003_154535_155095 | 186 |
| 912 | 3300053103 | Ga0500555_000377 | Ga0500555_000377_11648_12208 | 186 |
| 913 | 3300053104 | Ga0500556_0000539 | Ga0500556_0000539_10718_11278 | 186 |
| 914 | 3300053130 | Ga0500642_0155040 | Ga0500642_0155040_233_793 | 186 |
| 915 | 3300053153 | Ga0500616_0080786 | Ga0500616_0080786_186_746 | 186 |
| 916 | 3300053153 | Ga0500616_0192024 | Ga0500616_0192024_232_792 | 186 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lf9-assembly1.cif.gz_A | crystal structure of hiv epitope-scaffold 4e10_d0_1is1a_001_c | 0.9541 | 2 | 186 |
| 6xxv-assembly1.cif.gz_C | crystal structure of a computationally designed immunogen s2_1.2 in complex with its elicited antibody c57 | 0.9311 | 106 | 180 |
| 2fe1-assembly1.cif.gz_A-2 | crystal structure of pae0151 from pyrobaculum aerophilum | 0.922 | 132 | 163 |
| 1y69-assembly1.cif.gz_8 | rrf domain i in complex with the 50s ribosomal subunit from deinococcus radiodurans | 0.9171 | 2 | 186 |
| 1y69-assembly1.cif.gz_8 | rrf domain i in complex with the 50s ribosomal subunit from deinococcus radiodurans | 0.9095 | 2 | 186 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1iseA01 | Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor | 0.9872 | 4 | 186 | 1.10.132.20 |
| 1dd5A01 | Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor | 0.9832 | 106 | 186 | 1.10.132.20 |
| 1is1A01 | Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor | 0.983 | 4 | 186 | 1.10.132.20 |
| 1ek8A01 | Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor | 0.973 | 4 | 186 | 1.10.132.20 |
| af_P9WGY1_31_105_3.30.1360.40 | Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; | 0.9707 | 32 | 106 | 3.30.1360.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-F2LTT9-F1-model_v4 | Ribosome-recycling factor (RRF) (Ribosome-releasing factor) | 0.9867 | 1 | 186 |
GO:0005737
GO:0006415 GO:0043023 |
| AF-A0A5E6M581-F1-model_v4 | Ribosome-recycling factor (RRF) (Ribosome-releasing factor) | 0.9829 | 1 | 186 |
GO:0005737
GO:0006415 GO:0043023 |
| AF-A0A6B3N8D8-F1-model_v4 | Ribosome-recycling factor (RRF) (Ribosome-releasing factor) | 0.9825 | 6 | 186 |
GO:0005737
GO:0006415 GO:0043023 |
| AF-A0A6I1ZTX7-F1-model_v4 | Ribosome-recycling factor (RRF) (Ribosome-releasing factor) | 0.9816 | 2 | 186 |
GO:0005737
GO:0006415 GO:0043023 |
| AF-F2LTT9-F1-model_v4 | Ribosome-recycling factor (RRF) (Ribosome-releasing factor) | 0.9814 | 1 | 186 |
GO:0005737
GO:0006415 GO:0043023 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar