F485616

General Info

Members Datasets Scaffolds Average Seq Length
916 308 916 184

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10071134|Ga0105240_100711345
Length 187
Sequence MALDDILLEAEEKMMKSTEVIQAEFAGVRTGKASPDLVTNIMVDAYGGTHMRLKELAAITTPDSRLIQIQPWDATTVEPIRKALEESKLGIMPQVDGKIIRLPIPPLSEERRQDLVKAVRKMAEEGRVSIRANRRHAIDELKKIQKSGEITEDQLADSEKEIQKLTDQYVAEIEKAVEAKEAELLKV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
130 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
192 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
193 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
195 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
196 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
197 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
198 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
199 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
203 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
215 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
216 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
217 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
218 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
219 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
220 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
221 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
222 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
223 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
226 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
227 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
228 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
229 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
232 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
233 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
234 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
235 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
236 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
237 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
238 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
239 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
240 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
241 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
242 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
243 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
244 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
245 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
246 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
247 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
248 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
249 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
250 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
251 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
252 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
253 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
257 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
258 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
259 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
260 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
268 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
269 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
270 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
271 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
272 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
273 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
274 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
275 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
276 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
277 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
286 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
287 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
288 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
290 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
291 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
292 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
293 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
294 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
295 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
296 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
297 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
298 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
299 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
300 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
301 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
302 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
303 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
304 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
305 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
306 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
307 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
308 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.86
Nodule 0
Rhizoplane 5.79
Rhizosphere 90.17
Stem 0
Stem Tuber 0
Unclassified 2.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_153793 2162886007 Bacteria 2840
2 SwRhRL2b_contig_2058463 2162886007 Bacteria 2479
3 JGI24743J22301_10001703 3300001991 Bacteria 3134
4 rootH1_10136363 3300003316 Bacteria 1639
5 rootH2_10026271 3300003320 Bacteria 12933
6 rootH2_10100182 3300003320 Bacteria 2084
7 rootH2_10182195 3300003320 Bacteria 3263
8 rootL2_10011143 3300003322 Bacteria 9070
9 rootL2_10127896 3300003322 Bacteria 1259
10 rootH1_10066215 3300003323 Bacteria 25527
11 JGI25404J52841_10017478 3300003659 Bacteria 1555
12 JGI25405J52794_10006869 3300003911 Bacteria 2085
13 Ga0065703_1021956 3300005272 Bacteria 1045
14 Ga0065704_10003014 3300005289 Bacteria 6862
15 Ga0065704_10003343 3300005289 Bacteria 4266
16 Ga0065704_10124462 3300005289 Bacteria 1717
17 Ga0065704_10486822 3300005289 Unclassified 667
18 Ga0065712_10004789 3300005290 Bacteria 5445
19 Ga0065712_10074696 3300005290 Bacteria 3980
20 Ga0065712_10273811 3300005290 Bacteria 899
21 Ga0065715_10000865 3300005293 Bacteria 8469
22 Ga0065715_10001562 3300005293 Bacteria 6983
23 Ga0065715_10140608 3300005293 Bacteria 1860
24 Ga0065715_10161820 3300005293 Unclassified 1622
25 Ga0065715_10177454 3300005293 Bacteria 1501
26 Ga0065715_10240274 3300005293 Bacteria 1202
27 Ga0065715_10331278 3300005293 Bacteria 977
28 Ga0065715_10411910 3300005293 Unclassified 868
29 Ga0065715_10454564 3300005293 Bacteria 822
30 Ga0065707_10034795 3300005295 Bacteria 1170
31 Ga0065707_10085928 3300005295 Bacteria 5785
32 Ga0065707_10129080 3300005295 Bacteria 1954
33 Ga0065707_10748292 3300005295 Unclassified 619
34 Ga0070658_10005444 3300005327 Bacteria 10323
35 Ga0070676_10014630 3300005328 Bacteria 4316
36 Ga0070676_10015006 3300005328 Bacteria 4266
37 Ga0070676_10024414 3300005328 Bacteria 3405
38 Ga0070676_10352177 3300005328 Bacteria 1013
39 Ga0070683_100166174 3300005329 Bacteria 2093
40 Ga0070683_100714659 3300005329 Bacteria 960
41 Ga0070683_100756990 3300005329 Bacteria 931
42 Ga0070683_101494603 3300005329 Bacteria 649
43 Ga0070690_100012701 3300005330 Bacteria 4960
44 Ga0070690_100212839 3300005330 Bacteria 1350
45 Ga0070690_100321390 3300005330 Bacteria 1115
46 Ga0070690_100327623 3300005330 Bacteria 1105
47 Ga0070670_100012458 3300005331 Bacteria 7277
48 Ga0070670_100212146 3300005331 Bacteria 1683
49 Ga0070670_100799610 3300005331 Bacteria 852
50 Ga0070677_10068670 3300005333 Unclassified 1484
51 Ga0068869_100110552 3300005334 Bacteria 2090
52 Ga0070666_10014664 3300005335 Bacteria 4991
53 Ga0070666_10032237 3300005335 Bacteria 3460
54 Ga0070666_10057602 3300005335 Bacteria 2626
55 Ga0070666_10579915 3300005335 Unclassified 817
56 Ga0070666_10853249 3300005335 Unclassified 672
57 Ga0070680_100253020 3300005336 Bacteria 1489
58 Ga0068868_100038485 3300005338 Bacteria 3713
59 Ga0068868_100270613 3300005338 Bacteria 1435
60 Ga0068868_100425072 3300005338 Unclassified 1151
61 Ga0070660_100111146 3300005339 Bacteria 2180
62 Ga0070660_100159888 3300005339 Bacteria 1815
63 Ga0070660_100213011 3300005339 Bacteria 1569
64 Ga0070660_100216537 3300005339 Bacteria 1556
65 Ga0070689_100059551 3300005340 Bacteria 2968
66 Ga0070689_100146518 3300005340 Bacteria 1902
67 Ga0070689_100148889 3300005340 Bacteria 1887
68 Ga0070689_100180997 3300005340 Bacteria 1712
69 Ga0070689_100534120 3300005340 Bacteria 1009
70 Ga0070689_100651499 3300005340 Bacteria 916
71 Ga0070689_100766747 3300005340 Bacteria 846
72 Ga0070691_10629918 3300005341 Bacteria 636
73 Ga0070687_100010470 3300005343 Bacteria 4011
74 Ga0070661_100000928 3300005344 Bacteria 20998
75 Ga0070661_100033628 3300005344 Bacteria 3715
76 Ga0070692_10764407 3300005345 Unclassified 656
77 Ga0070668_100001187 3300005347 Bacteria 18465
78 Ga0070668_100020811 3300005347 Bacteria 4955
79 Ga0070668_100541083 3300005347 Bacteria 1013
80 Ga0070669_100009942 3300005353 Bacteria 6770
81 Ga0070669_100024318 3300005353 Unclassified 4343
82 Ga0070669_100026331 3300005353 Bacteria 4184
83 Ga0070669_100038737 3300005353 Bacteria 3461
84 Ga0070669_100044533 3300005353 Bacteria 3233
85 Ga0070669_100384763 3300005353 Bacteria 1145
86 Ga0070675_100017585 3300005354 Bacteria 5684
87 Ga0070675_100026530 3300005354 Bacteria 4650
88 Ga0070675_100058782 3300005354 Bacteria 3171
89 Ga0070675_100408305 3300005354 Bacteria 1213
90 Ga0070675_100993338 3300005354 Unclassified 770
91 Ga0070671_100004727 3300005355 Bacteria 10814
92 Ga0070671_100031701 3300005355 Bacteria 4368
93 Ga0070671_100057031 3300005355 Bacteria 3249
94 Ga0070671_100083936 3300005355 Bacteria 2664
95 Ga0070671_100183394 3300005355 Bacteria 1772
96 Ga0070671_100235100 3300005355 Unclassified 1555
97 Ga0070671_100295208 3300005355 Bacteria 1379
98 Ga0070671_100456859 3300005355 Bacteria 1096
99 Ga0070671_100822240 3300005355 Unclassified 809
100 Ga0070674_100083441 3300005356 Bacteria 2288
101 Ga0070674_100112238 3300005356 Bacteria 2003
102 Ga0070674_100340393 3300005356 Unclassified 1208
103 Ga0070673_100000316 3300005364 Bacteria 25432
104 Ga0070673_100043216 3300005364 Bacteria 3480
105 Ga0070673_100250431 3300005364 Bacteria 1544
106 Ga0070673_100490132 3300005364 Bacteria 1110
107 Ga0070688_100002376 3300005365 Bacteria 9504
108 Ga0070659_100016569 3300005366 Bacteria 5534
109 Ga0070659_100397248 3300005366 Bacteria 1163
110 Ga0070659_100718203 3300005366 Bacteria 865
111 Ga0070667_100016077 3300005367 Bacteria 6190
112 Ga0070667_100044655 3300005367 Bacteria 3722
113 Ga0070667_100065751 3300005367 Bacteria 3079
114 Ga0070667_100511178 3300005367 Bacteria 1102
115 Ga0070709_10038486 3300005434 Bacteria 2929
116 Ga0070709_10177478 3300005434 Bacteria 1493
117 Ga0070714_100114550 3300005435 Bacteria 2392
118 Ga0070714_100120875 3300005435 Bacteria 2330
119 Ga0070714_100151164 3300005435 Bacteria 2092
120 Ga0070714_100243297 3300005435 Bacteria 1661
121 Ga0070714_100426429 3300005435 Bacteria 1257
122 Ga0070713_100060238 3300005436 Bacteria 3173
123 Ga0070713_100067318 3300005436 Bacteria 3015
124 Ga0070710_10037266 3300005437 Bacteria 2663
125 Ga0070710_10145657 3300005437 Bacteria 1456
126 Ga0070710_10264400 3300005437 Bacteria 1110
127 Ga0070710_10456660 3300005437 Unclassified 867
128 Ga0070701_10025210 3300005438 Bacteria 2885
129 Ga0070711_100103916 3300005439 Bacteria 2071
130 Ga0070711_100539447 3300005439 Unclassified 966
131 Ga0070705_100051376 3300005440 Bacteria 2403
132 Ga0070705_100072744 3300005440 Bacteria 2084
133 Ga0070705_100146513 3300005440 Bacteria 1561
134 Ga0070705_100193124 3300005440 Bacteria 1389
135 Ga0070700_100377880 3300005441 Unclassified 1059
136 Ga0070708_100002881 3300005445 Bacteria 13354
137 Ga0070708_100034509 3300005445 Bacteria 4402
138 Ga0070708_100308412 3300005445 Bacteria 1490
139 Ga0070708_100321376 3300005445 Bacteria 1458
140 Ga0070708_100323065 3300005445 Unclassified 1454
141 Ga0070708_100506505 3300005445 Bacteria 1139
142 Ga0070708_100663453 3300005445 Bacteria 982
143 Ga0070708_101091157 3300005445 Unclassified 748
144 Ga0070663_100530487 3300005455 Unclassified 981
145 Ga0070678_100002256 3300005456 Bacteria 10493
146 Ga0070678_100027681 3300005456 Bacteria 3853
147 Ga0070678_100112912 3300005456 Bacteria 2129
148 Ga0070678_100188641 3300005456 Unclassified 1693
149 Ga0070678_100197197 3300005456 Bacteria 1659
150 Ga0070662_100003800 3300005457 Bacteria 9445
151 Ga0070662_100049564 3300005457 Bacteria 3028
152 Ga0070662_100153923 3300005457 Bacteria 1793
153 Ga0070662_100254936 3300005457 Bacteria 1412
154 Ga0070662_100612500 3300005457 Bacteria 916
155 Ga0070662_100821004 3300005457 Unclassified 791
156 Ga0070681_10202591 3300005458 Bacteria 1902
157 Ga0070681_10392772 3300005458 Bacteria 1298
158 Ga0070681_10593799 3300005458 Bacteria 1021
159 Ga0068867_100027407 3300005459 Bacteria 4094
160 Ga0068867_100267495 3300005459 Bacteria 1396
161 Ga0070706_100011390 3300005467 Bacteria 8264
162 Ga0070706_100025876 3300005467 Bacteria 5400
163 Ga0070706_100058823 3300005467 Bacteria 3547
164 Ga0070706_100064467 3300005467 Unclassified 3386
165 Ga0070706_100073042 3300005467 Bacteria 3174
166 Ga0070706_100082512 3300005467 Bacteria 2978
167 Ga0070706_100141498 3300005467 Bacteria 2246
168 Ga0070706_100183792 3300005467 Bacteria 1953
169 Ga0070706_100272519 3300005467 Bacteria 1579
170 Ga0070706_100471042 3300005467 Bacteria 1168
171 Ga0070706_101133481 3300005467 Unclassified 720
172 Ga0070707_100000846 3300005468 Bacteria 30361
173 Ga0070707_100022154 3300005468 Bacteria 6007
174 Ga0070707_100023714 3300005468 Bacteria 5803
175 Ga0070707_100026907 3300005468 Bacteria 5467
176 Ga0070707_100046972 3300005468 Bacteria 4132
177 Ga0070707_100048200 3300005468 Unclassified 4081
178 Ga0070707_100101971 3300005468 Bacteria 2781
179 Ga0070707_100127502 3300005468 Bacteria 2473
180 Ga0070707_100143773 3300005468 Unclassified 2321
181 Ga0070707_100198275 3300005468 Bacteria 1957
182 Ga0070707_100220861 3300005468 Bacteria 1846
183 Ga0070707_100268683 3300005468 Bacteria 1658
184 Ga0070707_100274267 3300005468 Unclassified 1640
185 Ga0070707_100489557 3300005468 Bacteria 1191
186 Ga0070698_100002074 3300005471 Bacteria 22276
187 Ga0070698_100005905 3300005471 Bacteria 13355
188 Ga0070698_100007983 3300005471 Bacteria 11444
189 Ga0070698_100085652 3300005471 Bacteria 3138
190 Ga0070698_100672467 3300005471 Unclassified 977
191 Ga0070699_100029144 3300005518 Bacteria 4760
192 Ga0070699_100044262 3300005518 Unclassified 3855
193 Ga0070699_100052006 3300005518 Bacteria 3547
194 Ga0070699_100091835 3300005518 Bacteria 2655
195 Ga0070699_100165982 3300005518 Bacteria 1956
196 Ga0070699_100465337 3300005518 Bacteria 1147
197 Ga0070699_100668664 3300005518 Bacteria 948
198 Ga0070684_100057045 3300005535 Bacteria 3409
199 Ga0070684_100139124 3300005535 Bacteria 2194
200 Ga0070684_100280404 3300005535 Bacteria 1527
201 Ga0070697_100000863 3300005536 Bacteria 22791
202 Ga0070697_100004776 3300005536 Bacteria 10389
203 Ga0070697_100006005 3300005536 Bacteria 9392
204 Ga0070697_100007445 3300005536 Bacteria 8523
205 Ga0070697_100010048 3300005536 Bacteria 7387
206 Ga0070697_100017077 3300005536 Bacteria 5707
207 Ga0070697_100018213 3300005536 Bacteria 5536
208 Ga0070697_100028977 3300005536 Bacteria 4437
209 Ga0070697_100031306 3300005536 Bacteria 4278
210 Ga0070697_100102221 3300005536 Bacteria 2381
211 Ga0070697_100157961 3300005536 Unclassified 1915
212 Ga0070697_100365983 3300005536 Bacteria 1247
213 Ga0070697_100507634 3300005536 Unclassified 1055
214 Ga0068853_100000577 3300005539 Bacteria 25066
215 Ga0070672_100000553 3300005543 Bacteria 22012
216 Ga0070672_100097565 3300005543 Bacteria 2379
217 Ga0070672_100136641 3300005543 Bacteria 2019
218 Ga0070672_100198421 3300005543 Bacteria 1677
219 Ga0070672_100559834 3300005543 Bacteria 993
220 Ga0070672_100683683 3300005543 Bacteria 898
221 Ga0070686_100404841 3300005544 Bacteria 1039
222 Ga0070695_100088692 3300005545 Bacteria 2060
223 Ga0070696_100044534 3300005546 Bacteria 3073
224 Ga0070665_100000201 3300005548 Bacteria 105051
225 Ga0070665_100010897 3300005548 Bacteria 9196
226 Ga0070665_100126750 3300005548 Bacteria 2555
227 Ga0070665_100293469 3300005548 Viruses 1628
228 Ga0070665_100322640 3300005548 Unclassified 1549
229 Ga0070665_100443310 3300005548 Bacteria 1308
230 Ga0070665_100535738 3300005548 Bacteria 1183
231 Ga0070665_100670647 3300005548 Bacteria 1050
232 Ga0070704_100138815 3300005549 Bacteria 1895
233 Ga0070704_100454021 3300005549 Bacteria 1104
234 Ga0068855_100006309 3300005563 Bacteria 14454
235 Ga0070664_100220538 3300005564 Bacteria 1697
236 Ga0070664_100254847 3300005564 Bacteria 1578
237 Ga0068854_100313910 3300005578 Unclassified 1272
238 Ga0068856_100000888 3300005614 Bacteria 32024
239 Ga0068856_100123051 3300005614 Bacteria 2597
240 Ga0068856_100760819 3300005614 Bacteria 989
241 Ga0068852_100365623 3300005616 Bacteria 1412
242 Ga0068852_101050069 3300005616 Bacteria 834
243 Ga0068859_100311139 3300005617 Bacteria 1669
244 Ga0068859_100416287 3300005617 Bacteria 1440
245 Ga0068859_101319318 3300005617 Unclassified 795
246 Ga0068864_100268133 3300005618 Bacteria 1590
247 Ga0068866_10042674 3300005718 Bacteria 2259
248 Ga0068861_100362827 3300005719 Unclassified 1274
249 Ga0068861_100382281 3300005719 Bacteria 1244
250 Ga0068861_100583674 3300005719 Bacteria 1023
251 Ga0068863_100002168 3300005841 Bacteria 19455
252 Ga0068863_100015784 3300005841 Bacteria 7249
253 Ga0068863_100048665 3300005841 Bacteria 4020
254 Ga0068863_100165555 3300005841 Unclassified 2120
255 Ga0068863_100174956 3300005841 Bacteria 2060
256 Ga0068863_100231907 3300005841 Bacteria 1781
257 Ga0068863_100319812 3300005841 Bacteria 1507
258 Ga0068858_100010147 3300005842 Bacteria 8942
259 Ga0068858_100031177 3300005842 Bacteria 4950
260 Ga0068858_100162920 3300005842 Bacteria 2100
261 Ga0068858_100322371 3300005842 Unclassified 1477
262 Ga0068858_100371539 3300005842 Bacteria 1371
263 Ga0068858_100400383 3300005842 Bacteria 1319
264 Ga0068858_100532686 3300005842 Bacteria 1136
265 Ga0068860_100000390 3300005843 Bacteria 57357
266 Ga0068860_100076998 3300005843 Bacteria 3172
267 Ga0068860_100135297 3300005843 Bacteria 2366
268 Ga0068860_100229106 3300005843 Unclassified 1805
269 Ga0068860_100433099 3300005843 Bacteria 1305
270 Ga0068862_100004440 3300005844 Bacteria 11840
271 Ga0068862_100154751 3300005844 Bacteria 2043
272 Ga0068862_100293363 3300005844 Bacteria 1494
273 Ga0068862_100714262 3300005844 Unclassified 972
274 Ga0068862_100848090 3300005844 Unclassified 895
275 Ga0068862_100921085 3300005844 Unclassified 860
276 Ga0081455_10000725 3300005937 Bacteria 42784
277 Ga0081455_10001494 3300005937 Bacteria 28914
278 Ga0081455_10002780 3300005937 Bacteria 20611
279 Ga0081455_10022426 3300005937 Bacteria 5901
280 Ga0081455_10053897 3300005937 Bacteria 3433
281 Ga0081455_10120991 3300005937 Bacteria 2063
282 Ga0081455_10185162 3300005937 Bacteria 1573
283 Ga0081455_10474558 3300005937 Bacteria 848
284 Ga0081540_1000380 3300005983 Bacteria 44546
285 Ga0081540_1007770 3300005983 Bacteria 7590
286 Ga0081540_1049035 3300005983 Bacteria 2110
287 Ga0081539_10000139 3300005985 Bacteria 170623
288 Ga0081539_10000965 3300005985 Bacteria 53746
289 Ga0081539_10012962 3300005985 Bacteria 6338
290 Ga0081539_10024547 3300005985 Bacteria 3907
291 Ga0070717_10000276 3300006028 Bacteria 35106
292 Ga0070717_10010066 3300006028 Bacteria 7121
293 Ga0070717_10025006 3300006028 Bacteria 4743
294 Ga0070717_10034700 3300006028 Bacteria 4080
295 Ga0070717_10063645 3300006028 Bacteria 3062
296 Ga0070717_10519047 3300006028 Bacteria 1077
297 Ga0070717_10807140 3300006028 Bacteria 854
298 Ga0075363_100062862 3300006048 Bacteria 2002
299 Ga0070715_10074332 3300006163 Bacteria 1526
300 Ga0070715_10080698 3300006163 Bacteria 1476
301 Ga0070715_10544484 3300006163 Bacteria 672
302 Ga0070716_100037868 3300006173 Bacteria 2667
303 Ga0070716_100123085 3300006173 Bacteria 1627
304 Ga0070716_100313692 3300006173 Unclassified 1096
305 Ga0070716_100516655 3300006173 Bacteria 884
306 Ga0070712_100002163 3300006175 Bacteria 12095
307 Ga0070712_100027136 3300006175 Bacteria 3821
308 Ga0070712_100065776 3300006175 Bacteria 2574
309 Ga0070712_100114020 3300006175 Bacteria 2023
310 Ga0070712_100120617 3300006175 Bacteria 1972
311 Ga0070712_100219088 3300006175 Bacteria 1506
312 Ga0070712_100236896 3300006175 Bacteria 1452
313 Ga0070712_100438468 3300006175 Bacteria 1086
314 Ga0070712_100557173 3300006175 Bacteria 966
315 Ga0070712_100886924 3300006175 Bacteria 768
316 Ga0070712_101074478 3300006175 Unclassified 698
317 Ga0075362_10000924 3300006177 Bacteria 8932
318 Ga0075362_10052231 3300006177 Bacteria 1831
319 Ga0075366_10113582 3300006195 Bacteria 1630
320 Ga0097621_100112535 3300006237 Bacteria 2301
321 Ga0097621_100370920 3300006237 Unclassified 1277
322 Ga0097621_100638237 3300006237 Bacteria 976
323 Ga0068871_100040017 3300006358 Bacteria 3753
324 Ga0068871_100040202 3300006358 Bacteria 3745
325 Ga0068871_100611275 3300006358 Bacteria 992
326 Ga0068871_100802294 3300006358 Unclassified 868
327 Ga0075428_100592782 3300006844 Bacteria 1184
328 Ga0075428_100674325 3300006844 Bacteria 1102
329 Ga0075433_10393007 3300006852 Bacteria 1224
330 Ga0075433_10580011 3300006852 Bacteria 985
331 Ga0075434_100496625 3300006871 Bacteria 1241
332 Ga0068865_100264128 3300006881 Bacteria 1364
333 Ga0075436_100024009 3300006914 Bacteria 4191
334 Ga0075436_100038456 3300006914 Bacteria 3303
335 Ga0075436_100088864 3300006914 Bacteria 2147
336 Ga0075436_100600255 3300006914 Bacteria 811
337 Ga0097620_100311114 3300006931 Bacteria 1669
338 Ga0097620_100416276 3300006931 Bacteria 1440
339 Ga0097620_101319394 3300006931 Unclassified 795
340 Ga0097620_101727795 3300006931 Unclassified 691
341 Ga0075435_100144434 3300007076 Bacteria 1998
342 Ga0075435_100692382 3300007076 Bacteria 886
343 Ga0075435_100816644 3300007076 Bacteria 812
344 Ga0099795_10067688 3300007788 Bacteria 1341
345 Ga0099795_10127480 3300007788 Bacteria 1024
346 Ga0105240_10071134 3300009093 Bacteria 4303
347 Ga0105240_10095127 3300009093 Bacteria 3633
348 Ga0105240_11055164 3300009093 Unclassified 867
349 Ga0111539_10260557 3300009094 Bacteria 2018
350 Ga0111539_10702902 3300009094 Unclassified 1177
351 Ga0111539_10751131 3300009094 Bacteria 1135
352 Ga0111539_11198028 3300009094 Bacteria 882
353 Ga0111539_11938755 3300009094 Bacteria 683
354 Ga0105245_10051429 3300009098 Bacteria 3694
355 Ga0105245_10114923 3300009098 Unclassified 2507
356 Ga0105247_10124210 3300009101 Bacteria 1676
357 Ga0105247_10208372 3300009101 Bacteria 1317
358 Ga0105247_10464220 3300009101 Bacteria 915
359 Ga0105247_10695238 3300009101 Unclassified 765
360 Ga0114129_10010111 3300009147 Bacteria 13449
361 Ga0114129_10281362 3300009147 Bacteria 2222
362 Ga0114129_10392395 3300009147 Bacteria 1830
363 Ga0105243_10185655 3300009148 Bacteria 1812
364 Ga0105243_11038760 3300009148 Bacteria 824
365 Ga0105243_11717485 3300009148 Unclassified 657
366 Ga0105241_10339536 3300009174 Bacteria 1301
367 Ga0105241_10447474 3300009174 Unclassified 1142
368 Ga0105241_10904324 3300009174 Bacteria 820
369 Ga0105242_10019943 3300009176 Bacteria 5252
370 Ga0105242_10164649 3300009176 Bacteria 1944
371 Ga0105242_10182184 3300009176 Bacteria 1854
372 Ga0105242_11200148 3300009176 Bacteria 778
373 Ga0105248_10286065 3300009177 Bacteria 1856
374 Ga0105248_10496147 3300009177 Bacteria 1376
375 Ga0105237_10018816 3300009545 Bacteria 7144
376 Ga0105237_10110572 3300009545 Bacteria 2740
377 Ga0105238_10137720 3300009551 Unclassified 2419
378 Ga0105238_10998419 3300009551 Bacteria 858
379 Ga0105249_10016016 3300009553 Bacteria 6645
380 Ga0105249_10029932 3300009553 Bacteria 4918
381 Ga0105249_10482098 3300009553 Bacteria 1283
382 Ga0099796_10002329 3300010159 Bacteria 4144
383 Ga0099796_10007686 3300010159 Bacteria 2830
384 Ga0105239_10018427 3300010375 Bacteria 7712
385 Ga0105239_10165978 3300010375 Bacteria 2469
386 Ga0105239_10295621 3300010375 Bacteria 1824
387 Ga0105239_10317509 3300010375 Unclassified 1756
388 Ga0105239_10504864 3300010375 Bacteria 1375
389 Ga0105239_10968756 3300010375 Bacteria 977
390 Ga0105239_11665478 3300010375 Unclassified 738
391 Ga0105246_10104235 3300011119 Bacteria 2071
392 Ga0105246_10235860 3300011119 Bacteria 1443
393 Ga0157341_1025973 3300012494 Bacteria 607
394 Ga0157373_10573312 3300013100 Bacteria 820
395 Ga0157373_10590937 3300013100 Unclassified 808
396 Ga0157371_10168968 3300013102 Bacteria 1562
397 Ga0157371_10343434 3300013102 Bacteria 1086
398 Ga0157369_10326698 3300013105 Bacteria 1594
399 Ga0157374_10000036 3300013296 Bacteria 176499
400 Ga0157374_10002060 3300013296 Bacteria 16898
401 Ga0157374_10023552 3300013296 Bacteria 5509
402 Ga0157374_10087495 3300013296 Bacteria 2966
403 Ga0157374_10108489 3300013296 Bacteria 2668
404 Ga0157374_10138095 3300013296 Bacteria 2364
405 Ga0157374_10171288 3300013296 Bacteria 2118
406 Ga0157374_10190945 3300013296 Unclassified 2004
407 Ga0157374_10249196 3300013296 Bacteria 1747
408 Ga0157374_10324636 3300013296 Bacteria 1526
409 Ga0157374_10389571 3300013296 Bacteria 1389
410 Ga0157374_10459301 3300013296 Bacteria 1275
411 Ga0157374_10528501 3300013296 Bacteria 1186
412 Ga0157374_10535060 3300013296 Bacteria 1179
413 Ga0157374_10701692 3300013296 Bacteria 1025
414 Ga0157378_10016255 3300013297 Bacteria 6516
415 Ga0157378_10055609 3300013297 Bacteria 3526
416 Ga0157378_10121944 3300013297 Bacteria 2404
417 Ga0157378_10144246 3300013297 Bacteria 2213
418 Ga0157378_10217479 3300013297 Bacteria 1815
419 Ga0157378_10343520 3300013297 Bacteria 1456
420 Ga0157378_10375481 3300013297 Unclassified 1395
421 Ga0157378_10532800 3300013297 Bacteria 1177
422 Ga0157378_10578055 3300013297 Bacteria 1132
423 Ga0157378_10579114 3300013297 Unclassified 1131
424 Ga0157378_10836597 3300013297 Bacteria 948
425 Ga0157378_10856317 3300013297 Bacteria 938
426 Ga0157378_11013341 3300013297 Bacteria 865
427 Ga0157378_11195409 3300013297 Bacteria 800
428 Ga0163162_10012238 3300013306 Bacteria 8373
429 Ga0163162_10028980 3300013306 Bacteria 5479
430 Ga0163162_10033387 3300013306 Bacteria 5114
431 Ga0163162_10037100 3300013306 Bacteria 4861
432 Ga0163162_10058128 3300013306 Bacteria 3895
433 Ga0163162_10071548 3300013306 Bacteria 3522
434 Ga0163162_10371410 3300013306 Bacteria 1563
435 Ga0157372_10035116 3300013307 Bacteria 5517
436 Ga0157372_10047250 3300013307 Bacteria 4782
437 Ga0157372_10121487 3300013307 Bacteria 3001
438 Ga0157372_10166313 3300013307 Bacteria 2551
439 Ga0157372_10207336 3300013307 Bacteria 2271
440 Ga0157372_10845908 3300013307 Bacteria 1062
441 Ga0157375_10002351 3300013308 Bacteria 16339
442 Ga0157375_10012538 3300013308 Bacteria 7523
443 Ga0157375_10033130 3300013308 Bacteria 4906
444 Ga0157375_10176945 3300013308 Bacteria 2284
445 Ga0157375_10261482 3300013308 Bacteria 1892
446 Ga0157375_10654968 3300013308 Bacteria 1206
447 Ga0157375_10811863 3300013308 Bacteria 1084
448 Ga0157375_11064352 3300013308 Unclassified 946
449 Ga0163163_10020210 3300014325 Bacteria 6267
450 Ga0163163_10517203 3300014325 Bacteria 1256
451 Ga0182008_10084132 3300014497 Unclassified 1567
452 Ga0182008_10251634 3300014497 Bacteria 911
453 Ga0157377_10070240 3300014745 Bacteria 2022
454 Ga0157377_10371671 3300014745 Bacteria 965
455 Ga0157377_10447460 3300014745 Bacteria 891
456 Ga0157379_10044580 3300014968 Bacteria 3959
457 Ga0157379_10358012 3300014968 Bacteria 1337
458 Ga0157379_10360391 3300014968 Bacteria 1332
459 Ga0157379_10498232 3300014968 Bacteria 1129
460 Ga0157376_10001772 3300014969 Bacteria 14365
461 Ga0157376_10033828 3300014969 Bacteria 4120
462 Ga0157376_10062585 3300014969 Bacteria 3131
463 Ga0157376_10133534 3300014969 Bacteria 2218
464 Ga0157376_10195571 3300014969 Bacteria 1857
465 Ga0157376_10218191 3300014969 Bacteria 1765
466 Ga0157376_10454669 3300014969 Bacteria 1250
467 Ga0157376_11009990 3300014969 Unclassified 855
468 Ga0163161_10039209 3300017792 Bacteria 3400
469 Ga0163161_10707240 3300017792 Bacteria 839
470 Ga0213876_10052819 3300021384 Bacteria 2147
471 Ga0213876_10087300 3300021384 Bacteria 1651
472 Ga0213876_10178599 3300021384 Unclassified 1129
473 Ga0207666_1000965 3300025271 Bacteria 3420
474 Ga0207666_1008904 3300025271 Bacteria 1347
475 Ga0207666_1029194 3300025271 Bacteria 840
476 Ga0207673_1003904 3300025290 Bacteria 1759
477 Ga0207673_1018626 3300025290 Unclassified 930
478 Ga0207697_10000352 3300025315 Bacteria 25702
479 Ga0207697_10001557 3300025315 Bacteria 12380
480 Ga0207697_10002696 3300025315 Bacteria 9076
481 Ga0207697_10013712 3300025315 Unclassified 3377
482 Ga0207697_10017954 3300025315 Bacteria 2904
483 Ga0207697_10017990 3300025315 Bacteria 2901
484 Ga0207697_10018085 3300025315 Bacteria 2893
485 Ga0207697_10038226 3300025315 Bacteria 1967
486 Ga0207697_10051807 3300025315 Bacteria 1697
487 Ga0207697_10070193 3300025315 Bacteria 1467
488 Ga0207653_10255115 3300025885 Unclassified 673
489 Ga0207688_10003192 3300025901 Bacteria 8945
490 Ga0207688_10008291 3300025901 Bacteria 5648
491 Ga0207688_10093005 3300025901 Bacteria 1733
492 Ga0207688_10139122 3300025901 Bacteria 1428
493 Ga0207688_10689957 3300025901 Unclassified 645
494 Ga0207680_10017844 3300025903 Bacteria 3758
495 Ga0207680_10065698 3300025903 Bacteria 2228
496 Ga0207680_10595288 3300025903 Unclassified 791
497 Ga0207647_10043454 3300025904 Bacteria 2813
498 Ga0207685_10017846 3300025905 Bacteria 2305
499 Ga0207699_10188061 3300025906 Bacteria 1392
500 Ga0207645_10000574 3300025907 Bacteria 30472
501 Ga0207645_10002352 3300025907 Bacteria 14913
502 Ga0207645_10010256 3300025907 Bacteria 6437
503 Ga0207645_10027542 3300025907 Bacteria 3669
504 Ga0207645_10221176 3300025907 Bacteria 1248
505 Ga0207645_10263213 3300025907 Unclassified 1143
506 Ga0207705_10072124 3300025909 Bacteria 2504
507 Ga0207684_10000292 3300025910 Bacteria 71954
508 Ga0207684_10007486 3300025910 Bacteria 9826
509 Ga0207684_10009504 3300025910 Bacteria 8584
510 Ga0207684_10013103 3300025910 Bacteria 7177
511 Ga0207684_10045965 3300025910 Bacteria 3704
512 Ga0207684_10051530 3300025910 Bacteria 3492
513 Ga0207684_10113168 3300025910 Bacteria 2323
514 Ga0207684_10117939 3300025910 Bacteria 2274
515 Ga0207684_10262777 3300025910 Bacteria 1489
516 Ga0207684_10286901 3300025910 Bacteria 1419
517 Ga0207684_10727006 3300025910 Bacteria 842
518 Ga0207684_10742794 3300025910 Bacteria 832
519 Ga0207684_10872979 3300025910 Unclassified 757
520 Ga0207707_10132079 3300025912 Bacteria 2183
521 Ga0207671_10010633 3300025914 Bacteria 7572
522 Ga0207671_10037132 3300025914 Bacteria 3613
523 Ga0207671_10111929 3300025914 Bacteria 2078
524 Ga0207671_10164844 3300025914 Bacteria 1718
525 Ga0207693_10002199 3300025915 Bacteria 17000
526 Ga0207693_10005933 3300025915 Bacteria 10134
527 Ga0207693_10028709 3300025915 Bacteria 4396
528 Ga0207693_10031847 3300025915 Bacteria 4166
529 Ga0207693_10038179 3300025915 Bacteria 3782
530 Ga0207693_10046002 3300025915 Bacteria 3429
531 Ga0207693_10086457 3300025915 Bacteria 2457
532 Ga0207663_10082942 3300025916 Bacteria 2104
533 Ga0207663_10171523 3300025916 Bacteria 1541
534 Ga0207663_10490354 3300025916 Unclassified 953
535 Ga0207662_10000559 3300025918 Bacteria 16548
536 Ga0207662_10038587 3300025918 Bacteria 2799
537 Ga0207657_10079476 3300025919 Bacteria 2759
538 Ga0207657_10214476 3300025919 Bacteria 1544
539 Ga0207657_10255089 3300025919 Bacteria 1397
540 Ga0207657_10831922 3300025919 Bacteria 713
541 Ga0207649_10000744 3300025920 Bacteria 21400
542 Ga0207649_10012194 3300025920 Bacteria 4760
543 Ga0207646_10000386 3300025922 Bacteria 59216
544 Ga0207646_10000411 3300025922 Bacteria 57429
545 Ga0207646_10025706 3300025922 Bacteria 5384
546 Ga0207646_10031901 3300025922 Bacteria 4769
547 Ga0207646_10040419 3300025922 Bacteria 4193
548 Ga0207646_10065961 3300025922 Bacteria 3231
549 Ga0207646_10086093 3300025922 Bacteria 2811
550 Ga0207646_10092609 3300025922 Bacteria 2706
551 Ga0207646_10137382 3300025922 Bacteria 2201
552 Ga0207646_10293662 3300025922 Bacteria 1469
553 Ga0207646_10396428 3300025922 Unclassified 1247
554 Ga0207646_10487301 3300025922 Bacteria 1111
555 Ga0207646_10620502 3300025922 Unclassified 970
556 Ga0207681_10008691 3300025923 Bacteria 6201
557 Ga0207681_10021651 3300025923 Bacteria 4090
558 Ga0207681_10164798 3300025923 Bacteria 1674
559 Ga0207681_10173678 3300025923 Bacteria 1635
560 Ga0207681_10187995 3300025923 Bacteria 1578
561 Ga0207681_10355670 3300025923 Bacteria 1173
562 Ga0207694_10168976 3300025924 Unclassified 1770
563 Ga0207650_10027110 3300025925 Bacteria 4097
564 Ga0207650_10609973 3300025925 Bacteria 918
565 Ga0207659_10024917 3300025926 Bacteria 4015
566 Ga0207659_10070936 3300025926 Bacteria 2542
567 Ga0207659_10330431 3300025926 Bacteria 1260
568 Ga0207659_10867113 3300025926 Unclassified 776
569 Ga0207659_11086301 3300025926 Unclassified 688
570 Ga0207659_11169076 3300025926 Bacteria 661
571 Ga0207700_10023918 3300025928 Bacteria 4222
572 Ga0207700_10096728 3300025928 Bacteria 2345
573 Ga0207700_10163843 3300025928 Bacteria 1849
574 Ga0207700_10261353 3300025928 Bacteria 1482
575 Ga0207700_11312300 3300025928 Unclassified 645
576 Ga0207664_10032182 3300025929 Bacteria 4018
577 Ga0207664_10198198 3300025929 Bacteria 1732
578 Ga0207664_10212787 3300025929 Bacteria 1673
579 Ga0207664_10229334 3300025929 Bacteria 1614
580 Ga0207664_10326497 3300025929 Bacteria 1355
581 Ga0207664_10348347 3300025929 Bacteria 1311
582 Ga0207664_10580264 3300025929 Bacteria 1007
583 Ga0207644_10049006 3300025931 Bacteria 3022
584 Ga0207644_10056144 3300025931 Bacteria 2841
585 Ga0207644_10069419 3300025931 Bacteria 2573
586 Ga0207644_10088113 3300025931 Bacteria 2308
587 Ga0207644_10092943 3300025931 Bacteria 2251
588 Ga0207644_10431217 3300025931 Bacteria 1081
589 Ga0207690_10022326 3300025932 Bacteria 3935
590 Ga0207690_10045762 3300025932 Bacteria 2893
591 Ga0207690_10141566 3300025932 Bacteria 1773
592 Ga0207690_11078842 3300025932 Bacteria 669
593 Ga0207706_10003684 3300025933 Bacteria 14623
594 Ga0207706_10020606 3300025933 Bacteria 5925
595 Ga0207706_10208517 3300025933 Bacteria 1713
596 Ga0207706_10212759 3300025933 Bacteria 1694
597 Ga0207706_10378465 3300025933 Bacteria 1228
598 Ga0207706_10812614 3300025933 Unclassified 794
599 Ga0207706_10950770 3300025933 Unclassified 724
600 Ga0207686_10062018 3300025934 Bacteria 2372
601 Ga0207686_10515206 3300025934 Unclassified 930
602 Ga0207709_10674066 3300025935 Bacteria 825
603 Ga0207670_10052677 3300025936 Bacteria 2737
604 Ga0207670_10103452 3300025936 Bacteria 2038
605 Ga0207670_10140489 3300025936 Bacteria 1781
606 Ga0207670_10474620 3300025936 Bacteria 1012
607 Ga0207669_10003562 3300025937 Bacteria 6747
608 Ga0207669_10105937 3300025937 Bacteria 1871
609 Ga0207669_10297533 3300025937 Bacteria 1225
610 Ga0207669_10912238 3300025937 Bacteria 734
611 Ga0207665_10006694 3300025939 Bacteria 7648
612 Ga0207665_10015683 3300025939 Bacteria 4973
613 Ga0207665_10026197 3300025939 Bacteria 3848
614 Ga0207665_10045327 3300025939 Bacteria 2944
615 Ga0207665_10113592 3300025939 Bacteria 1906
616 Ga0207665_10152353 3300025939 Bacteria 1657
617 Ga0207665_10265790 3300025939 Bacteria 1272
618 Ga0207665_10907769 3300025939 Unclassified 699
619 Ga0207691_10003715 3300025940 Bacteria 14809
620 Ga0207691_10004494 3300025940 Bacteria 13501
621 Ga0207691_10075598 3300025940 Bacteria 3037
622 Ga0207691_10135861 3300025940 Bacteria 2168
623 Ga0207691_10164829 3300025940 Bacteria 1943
624 Ga0207691_10488918 3300025940 Bacteria 1046
625 Ga0207691_10532430 3300025940 Bacteria 997
626 Ga0207711_10448858 3300025941 Bacteria 1200
627 Ga0207711_11189047 3300025941 Bacteria 704
628 Ga0207689_10027373 3300025942 Bacteria 4773
629 Ga0207661_10154368 3300025944 Bacteria 1987
630 Ga0207679_10020501 3300025945 Bacteria 4462
631 Ga0207679_10185110 3300025945 Bacteria 1726
632 Ga0207679_10663262 3300025945 Bacteria 944
633 Ga0207667_10001014 3300025949 Bacteria 35767
634 Ga0207651_10025449 3300025960 Bacteria 3678
635 Ga0207651_10097110 3300025960 Bacteria 2175
636 Ga0207651_10233593 3300025960 Bacteria 1494
637 Ga0207651_10258094 3300025960 Bacteria 1429
638 Ga0207712_10032945 3300025961 Bacteria 3500
639 Ga0207668_10012259 3300025972 Bacteria 5241
640 Ga0207668_10016783 3300025972 Bacteria 4578
641 Ga0207668_10017669 3300025972 Bacteria 4474
642 Ga0207668_10088504 3300025972 Bacteria 2268
643 Ga0207658_10010561 3300025986 Bacteria 6273
644 Ga0207658_10089256 3300025986 Bacteria 2386
645 Ga0207658_10275290 3300025986 Unclassified 1440
646 Ga0207658_10370583 3300025986 Bacteria 1252
647 Ga0207677_10056854 3300026023 Bacteria 2683
648 Ga0207677_10129275 3300026023 Bacteria 1914
649 Ga0207677_10327359 3300026023 Bacteria 1276
650 Ga0207677_10579027 3300026023 Bacteria 982
651 Ga0207703_10010258 3300026035 Bacteria 7337
652 Ga0207703_10039645 3300026035 Bacteria 3765
653 Ga0207703_10120051 3300026035 Bacteria 2256
654 Ga0207703_10364796 3300026035 Unclassified 1333
655 Ga0207703_10565938 3300026035 Bacteria 1073
656 Ga0207639_10000582 3300026041 Bacteria 25109
657 Ga0207678_10022513 3300026067 Bacteria 5518
658 Ga0207678_10173267 3300026067 Unclassified 1842
659 Ga0207678_10295600 3300026067 Bacteria 1391
660 Ga0207708_10189875 3300026075 Bacteria 1635
661 Ga0207702_10025662 3300026078 Bacteria 4891
662 Ga0207702_10403033 3300026078 Bacteria 1319
663 Ga0207641_10045684 3300026088 Bacteria 3689
664 Ga0207641_10054972 3300026088 Bacteria 3380
665 Ga0207641_10055335 3300026088 Bacteria 3368
666 Ga0207641_10155856 3300026088 Bacteria 2072
667 Ga0207641_10211252 3300026088 Bacteria 1795
668 Ga0207641_10443888 3300026088 Bacteria 1253
669 Ga0207648_10220187 3300026089 Bacteria 1687
670 Ga0207648_10287070 3300026089 Unclassified 1472
671 Ga0207676_10249933 3300026095 Bacteria 1596
672 Ga0207676_10941628 3300026095 Bacteria 849
673 Ga0207675_100095869 3300026118 Bacteria 2792
674 Ga0207675_101490259 3300026118 Unclassified 697
675 Ga0207675_101602324 3300026118 Bacteria 671
676 Ga0207683_10008548 3300026121 Bacteria 8763
677 Ga0207683_10026404 3300026121 Bacteria 5012
678 Ga0207683_10130361 3300026121 Bacteria 2261
679 Ga0207683_10272290 3300026121 Bacteria 1547
680 Ga0207683_10336210 3300026121 Bacteria 1384
681 Ga0207698_10579700 3300026142 Bacteria 1103
682 Ga0209971_1099613 3300027682 Unclassified 711
683 Ga0209974_10030866 3300027876 Bacteria 1775
684 Ga0209974_10112622 3300027876 Bacteria 959
685 Ga0268266_10000197 3300028379 Bacteria 105077
686 Ga0268266_10002434 3300028379 Bacteria 19993
687 Ga0268266_10012778 3300028379 Bacteria 7255
688 Ga0268266_10013406 3300028379 Bacteria 7060
689 Ga0268266_10075111 3300028379 Bacteria 2935
690 Ga0268266_10286554 3300028379 Unclassified 1533
691 Ga0268266_10477502 3300028379 Bacteria 1188
692 Ga0268266_10677511 3300028379 Bacteria 993
693 Ga0268265_10044621 3300028380 Bacteria 3302
694 Ga0268265_10096538 3300028380 Bacteria 2376
695 Ga0268265_10499190 3300028380 Bacteria 1146
696 Ga0268265_11060816 3300028380 Unclassified 803
697 Ga0268264_10000800 3300028381 Bacteria 33994
698 Ga0268264_10254913 3300028381 Bacteria 1632
699 Ga0268264_10374614 3300028381 Bacteria 1362
700 Ga0268264_10606452 3300028381 Bacteria 1079
701 Ga0307511_10000128 3300030521 Bacteria 69098
702 Ga0373944_0038430 3300035089 Bacteria 1470
703 Ga0373944_0274833 3300035089 Unclassified 627
704 Ga0373923_0083000 3300035111 Unclassified 1392
705 Ga0373923_0137669 3300035111 Bacteria 1102
706 Ga0373939_0039936 3300035114 Bacteria 1407
707 Ga0373945_0087316 3300035116 Bacteria 1203
708 Ga0373953_0091928 3300035117 Bacteria 1270
709 Ga0373954_0492117 3300035118 Unclassified 607
710 Ga0373956_0309188 3300035119 Unclassified 753
711 Ga0373943_0016752 3300035170 Bacteria 3347
712 Ga0373943_0024378 3300035170 Unclassified 2820
713 Ga0373943_0035717 3300035170 Bacteria 2377
714 Ga0373943_0055648 3300035170 Bacteria 1960
715 Ga0373943_0371917 3300035170 Unclassified 822
716 Ga0373931_0547570 3300035691 Bacteria 751
717 Ga0373935_0112443 3300035692 Bacteria 1809
718 Ga0373935_0200565 3300035692 Bacteria 1378
719 Ga0373935_0200707 3300035692 Unclassified 1378
720 Ga0373935_0203073 3300035692 Bacteria 1370
721 Ga0373935_0421558 3300035692 Bacteria 961
722 Ga0373927_0100804 3300035695 Bacteria 1877
723 Ga0373933_0070022 3300035724 Bacteria 2133
724 Ga0373947_0008617 3300035725 Bacteria 5871
725 Ga0373947_0104687 3300035725 Bacteria 1782
726 Ga0373947_0642884 3300035725 Bacteria 723
727 Ga0373937_0017352 3300036401 Bacteria 6412
728 Ga0373937_0360283 3300036401 Bacteria 1378
729 Ga0373937_0469403 3300036401 Bacteria 1195
730 Ga0373937_0923950 3300036401 Bacteria 821
731 Ga0373925_0163863 3300037068 Unclassified 1752
732 Ga0373925_0273176 3300037068 Bacteria 1360
733 Ga0373925_0631197 3300037068 Unclassified 883
734 Ga0395899_0022448 3300037312 Bacteria 4786
735 Ga0395900_0003229 3300037418 Bacteria 17656
736 Ga0395900_0081553 3300037418 Bacteria 3323
737 Ga0395900_0423417 3300037418 Bacteria 1292
738 Ga0395900_0646072 3300037418 Unclassified 995
739 Ga0395898_0000067 3300037466 Bacteria 255955
740 Ga0395898_0013011 3300037466 Bacteria 8577
741 Ga0395898_0275473 3300037466 Bacteria 1605
742 Ga0395905_0013270 3300037471 Bacteria 7904
743 Ga0395905_0691593 3300037471 Unclassified 922
744 Ga0395905_1186637 3300037471 Bacteria 667
745 Ga0395905_1270881 3300037471 Bacteria 640
746 Ga0436364_0633325 3300037853 Bacteria 1550
747 Ga0395901_0009691 3300038443 Bacteria 9769
748 Ga0395901_0018727 3300038443 Bacteria 7074
749 Ga0395901_0240837 3300038443 Bacteria 1887
750 Ga0436365_0561697 3300039437 Bacteria 12593
751 Ga0436365_1218062 3300039437 Unclassified 882
752 Ga0436365_1366941 3300039437 Bacteria 6906
753 Ga0436365_1440966 3300039437 Bacteria 13512
754 Ga0451807_2518792 3300041486 Bacteria 704
755 Ga0451839_1498401 3300041496 Bacteria 872
756 Ga0451853_2598742 3300041512 Bacteria 701
757 Ga0451853_2845883 3300041512 Unclassified 1379
758 Ga0439450_035088 3300042008 Bacteria 1143
759 Ga0439451_013983 3300042009 Bacteria 1619
760 Ga0439454_047137 3300042011 Unclassified 719
761 Ga0439455_0000990 3300042012 Bacteria 4455
762 Ga0439464_0039742 3300042439 Bacteria 1338
763 Ga0439440_0055893 3300042993 Bacteria 997
764 Ga0466957_0008871 3300044842 Bacteria 5728
765 Ga0451576_0081187 3300045051 Bacteria 3372
766 Ga0495592_0015795 3300046454 Bacteria 5728
767 Ga0495592_0235248 3300046454 Bacteria 1218
768 Ga0495590_0195566 3300046457 Bacteria 742
769 Ga0495641_0102353 3300046461 Bacteria 1278
770 Ga0495651_0332021 3300046462 Bacteria 1010
771 Ga0495653_0285943 3300046463 Unclassified 1080
772 Ga0495653_0424291 3300046463 Bacteria 841
773 Ga0495580_0067910 3300046472 Bacteria 2494
774 Ga0495580_0093599 3300046472 Bacteria 2091
775 Ga0495580_0620878 3300046472 Unclassified 713
776 Ga0495584_0383249 3300046491 Unclassified 714
777 Ga0495585_0063921 3300046492 Bacteria 2019
778 Ga0495608_0461492 3300046511 Unclassified 772
779 Ga0495618_0387797 3300046514 Bacteria 856
780 Ga0495628_0017947 3300046516 Bacteria 5872
781 Ga0495628_0254705 3300046516 Bacteria 1309
782 Ga0495630_0203828 3300046517 Bacteria 1509
783 Ga0495642_0382726 3300046528 Unclassified 620
784 Ga0495640_0619142 3300046533 Bacteria 653
785 Ga0495586_0081448 3300046535 Bacteria 1779
786 Ga0495587_0085278 3300046536 Bacteria 1829
787 Ga0495598_0008807 3300046537 Bacteria 2362
788 Ga0495598_0144494 3300046537 Unclassified 826
789 Ga0495621_0094286 3300046539 Bacteria 1132
790 Ga0495645_0069614 3300046543 Bacteria 2540
791 Ga0495667_0078427 3300046559 Bacteria 2148
792 Ga0495634_0120042 3300046642 Bacteria 1684
793 Ga0495635_0061356 3300046663 Bacteria 2583
794 Ga0495635_0110478 3300046663 Bacteria 1878
795 Ga0495659_0007308 3300046664 Bacteria 3502
796 Ga0495659_0079302 3300046664 Bacteria 1244
797 Ga0495659_0105230 3300046664 Unclassified 1097
798 Ga0495657_0151078 3300046675 Bacteria 1442
799 Ga0495599_0050381 3300046678 Bacteria 2609
800 Ga0495599_0096786 3300046678 Bacteria 1840
801 Ga0495646_0137047 3300046680 Bacteria 1372
802 Ga0495669_0043499 3300046684 Bacteria 1999
803 Ga0495669_0111669 3300046684 Bacteria 1277
804 Ga0495669_0259155 3300046684 Bacteria 835
805 Ga0495669_0366326 3300046684 Unclassified 697
806 Ga0495613_0251919 3300046689 Bacteria 1232
807 Ga0495600_0608706 3300046809 Unclassified 663
808 Ga0495604_0701632 3300047317 Bacteria 642
809 Ga0495674_0156853 3300047319 Bacteria 1906
810 Ga0495674_0276404 3300047319 Bacteria 1377
811 Ga0495675_0334770 3300047444 Bacteria 893
812 Ga0495679_070148 3300047446 Unclassified 1011
813 Ga0495684_0011055 3300047471 Bacteria 6978
814 Ga0495684_0246955 3300047471 Unclassified 1300
815 Ga0495602_0048024 3300048088 Bacteria 3841
816 Ga0495602_0152176 3300048088 Bacteria 1817
817 Ga0495614_0228905 3300048089 Bacteria 847
818 Ga0496100_0162311 3300048903 Bacteria 1603
819 Ga0496101_0002348 3300048904 Bacteria 11613
820 Ga0496101_0208763 3300048904 Bacteria 1512
821 Ga0496101_0367845 3300048904 Unclassified 1131
822 Ga0496102_0058769 3300048905 Bacteria 3514
823 Ga0496102_0191535 3300048905 Bacteria 1927
824 Ga0496103_0031648 3300048906 Bacteria 3225
825 Ga0496103_0383358 3300048906 Bacteria 903
826 Ga0496103_0545255 3300048906 Bacteria 741
827 Ga0496104_0041736 3300048907 Bacteria 4303
828 Ga0496104_0101814 3300048907 Bacteria 2750
829 Ga0496104_0519694 3300048907 Bacteria 1102
830 Ga0496104_1367337 3300048907 Unclassified 611
831 Ga0496105_0027127 3300048908 Bacteria 4676
832 Ga0496105_0045415 3300048908 Bacteria 3624
833 Ga0496105_0555296 3300048908 Unclassified 896
834 Ga0496105_0633932 3300048908 Bacteria 826
835 Ga0496107_0015028 3300048910 Bacteria 5423
836 Ga0496107_0185541 3300048910 Bacteria 1545
837 Ga0496108_0013695 3300048911 Bacteria 6619
838 Ga0496108_0024559 3300048911 Bacteria 4964
839 Ga0496108_0174056 3300048911 Bacteria 1863
840 Ga0496108_0255638 3300048911 Unclassified 1524
841 Ga0496108_1050666 3300048911 Bacteria 694
842 Ga0496109_0006405 3300048912 Bacteria 9910
843 Ga0496109_0020560 3300048912 Bacteria 5830
844 Ga0496109_0103310 3300048912 Bacteria 2645
845 Ga0496109_0145667 3300048912 Unclassified 2216
846 Ga0496109_0212548 3300048912 Bacteria 1819
847 Ga0496109_0215034 3300048912 Bacteria 1808
848 Ga0496110_0000261 3300048913 Bacteria 34222
849 Ga0496111_0000086 3300048914 Bacteria 39141
850 Ga0496111_0425633 3300048914 Bacteria 981
851 Ga0496111_0585882 3300048914 Unclassified 817
852 Ga0496112_0001268 3300048915 Bacteria 19164
853 Ga0496112_0007980 3300048915 Bacteria 9440
854 Ga0496112_0262373 3300048915 Bacteria 1677
855 Ga0496112_0269690 3300048915 Bacteria 1650
856 Ga0496112_0275236 3300048915 Unclassified 1631
857 Ga0496112_0540839 3300048915 Unclassified 1099
858 Ga0496113_0011618 3300048916 Bacteria 5885
859 Ga0496113_0015364 3300048916 Bacteria 5260
860 Ga0496113_0140688 3300048916 Bacteria 1899
861 Ga0496113_0362641 3300048916 Bacteria 1163
862 Ga0496114_0034784 3300048917 Bacteria 4159
863 Ga0496114_0156296 3300048917 Bacteria 1980
864 Ga0496114_0240962 3300048917 Bacteria 1590
865 Ga0496114_1011394 3300048917 Bacteria 715
866 Ga0496115_0005081 3300048918 Bacteria 9565
867 Ga0496115_0088251 3300048918 Bacteria 2532
868 Ga0496115_0504942 3300048918 Bacteria 971
869 Ga0496115_0543295 3300048918 Bacteria 929
870 Ga0496125_0000187 3300048928 Bacteria 134976
871 Ga0501031_0001565 3300049568 Bacteria 14245
872 Ga0501032_0039863 3300049569 Bacteria 3194
873 Ga0501032_0084887 3300049569 Bacteria 2105
874 Ga0501033_0000024 3300049570 Bacteria 175859
875 Ga0501037_0000020 3300049573 Bacteria 155468
876 Ga0501038_0000212 3300049574 Bacteria 49792
877 Ga0501039_0010969 3300049575 Bacteria 6907
878 Ga0501043_0010380 3300049579 Bacteria 7298
879 Ga0501043_0018694 3300049579 Bacteria 5438
880 Ga0501047_0015893 3300049581 Bacteria 7174
881 Ga0501067_0015189 3300049583 Bacteria 4263
882 Ga0501068_0579966 3300049584 Bacteria 730
883 Ga0501070_0012473 3300049586 Bacteria 7169
884 Ga0501070_0140616 3300049586 Bacteria 1993
885 Ga0501035_0000216 3300049822 Bacteria 69506
886 Ga0501044_0000510 3300049823 Bacteria 47224
887 nmdc:mga03683_12012_c1 3300050489 Bacteria 3150
888 nmdc:mga03683_298_c1 3300050489 Bacteria 14687
889 nmdc:mga03n38_103243_c1 3300050490 Bacteria 1378
890 nmdc:mga0k408_2179_c1 3300050493 Bacteria 10511
891 nmdc:mga0k408_369_c1 3300050493 Bacteria 24668
892 nmdc:mga05p37_17694_c1 3300050507 Bacteria 8599
893 nmdc:mga05p37_60816_c1 3300050507 Bacteria 4650
894 nmdc:mga05p37_636652_c1 3300050507 Bacteria 1197
895 nmdc:mga08y16_1224870_c1 3300050511 Unclassified 720
896 nmdc:mga0n895_640514_c1 3300050512 Bacteria 1062
897 nmdc:mga0n895_78624_c1 3300050512 Bacteria 3283
898 nmdc:mga0rr50_183303_c1 3300050513 Bacteria 1712
899 nmdc:mga0rr50_234423_c1 3300050513 Bacteria 1519
900 nmdc:mga08x19_113622_c1 3300050514 Bacteria 1808
901 nmdc:mga08x19_323226_c1 3300050514 Bacteria 1074
902 nmdc:mga08x19_7027_c1 3300050514 Bacteria 6681
903 nmdc:mga0a205_779767_c1 3300050515 Bacteria 804
904 Ga0495601_0006303 3300053077 Bacteria 6929
905 Ga0495601_0065813 3300053077 Bacteria 2307
906 Ga0495655_0025664 3300053083 Bacteria 1381
907 Ga0495595_0248717 3300053084 Bacteria 890
908 Ga0495619_0800010 3300053085 Bacteria 638
909 Ga0500644_0063868 3300053088 Bacteria 1306
910 Ga0500555_000003 3300053103 Bacteria 392994
911 Ga0500555_000377 3300053103 Bacteria 18802
912 Ga0500556_0000539 3300053104 Bacteria 25733
913 Ga0500595_036670 3300053119 Unclassified 1605
914 Ga0500642_0155040 3300053130 Bacteria 1074
915 Ga0500616_0080786 3300053153 Bacteria 1634
916 Ga0500616_0192024 3300053153 Bacteria 911

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026118 Ga0207675_101490259 Ga0207675_1014902591 170
2 3300035170 Ga0373943_0371917 Ga0373943_0371917_101_661 170
3 3300046491 Ga0495584_0383249 Ga0495584_0383249_42_602 170
4 3300046528 Ga0495642_0382726 Ga0495642_0382726_48_608 170
5 3300046664 Ga0495659_0105230 Ga0495659_0105230_189_749 170
6 3300046684 Ga0495669_0366326 Ga0495669_0366326_85_645 170
7 3300046689 Ga0495613_0251919 Ga0495613_0251919_652_1212 170
8 3300005843 Ga0068860_100000390 Ga0068860_1000003906 171
9 3300009094 Ga0111539_11198028 Ga0111539_111980282 171
10 3300028381 Ga0268264_10000800 Ga0268264_1000080024 171
11 3300025926 Ga0207659_11169076 Ga0207659_111690762 172
12 3300037466 Ga0395898_0000067 Ga0395898_0000067_147572_148132 172
13 3300001991 JGI24743J22301_10001703 JGI24743J22301_100017033 173
14 3300005295 Ga0065707_10034795 Ga0065707_100347952 173
15 3300005327 Ga0070658_10005444 Ga0070658_100054445 173
16 3300005331 Ga0070670_100799610 Ga0070670_1007996101 173
17 3300005435 Ga0070714_100151164 Ga0070714_1001511641 173
18 3300005435 Ga0070714_100243297 Ga0070714_1002432972 173
19 3300005445 Ga0070708_100506505 Ga0070708_1005065052 173
20 3300005467 Ga0070706_100058823 Ga0070706_1000588233 173
21 3300005536 Ga0070697_100102221 Ga0070697_1001022213 173
22 3300005548 Ga0070665_100443310 Ga0070665_1004433102 173
23 3300005841 Ga0068863_100165555 Ga0068863_1001655554 173
24 3300005842 Ga0068858_100532686 Ga0068858_1005326862 173
25 3300005937 Ga0081455_10022426 Ga0081455_100224267 173
26 3300005937 Ga0081455_10185162 Ga0081455_101851622 173
27 3300006028 Ga0070717_10025006 Ga0070717_100250062 173
28 3300006175 Ga0070712_100886924 Ga0070712_1008869242 173
29 3300006177 Ga0075362_10052231 Ga0075362_100522313 173
30 3300025939 Ga0207665_10015683 Ga0207665_100156833 173
31 3300025939 Ga0207665_10045327 Ga0207665_100453273 173
32 3300025944 Ga0207661_10154368 Ga0207661_101543681 173
33 3300025945 Ga0207679_10663262 Ga0207679_106632622 173
34 3300026035 Ga0207703_10010258 Ga0207703_100102586 173
35 3300026035 Ga0207703_10565938 Ga0207703_105659382 173
36 3300026067 Ga0207678_10022513 Ga0207678_100225137 173
37 3300027876 Ga0209974_10112622 Ga0209974_101126221 173
38 3300028379 Ga0268266_10677511 Ga0268266_106775111 173
39 3300041486 Ga0451807_2518792 Ga0451807_2518792_17_538 173
40 3300046472 Ga0495580_0620878 Ga0495580_0620878_25_546 173
41 3300048904 Ga0496101_0208763 Ga0496101_0208763_716_1237 173
42 3300048907 Ga0496104_1367337 Ga0496104_1367337_19_540 173
43 3300026078 Ga0207702_10025662 Ga0207702_100256623 174
44 3300003659 JGI25404J52841_10017478 JGI25404J52841_100174782 175
45 3300003911 JGI25405J52794_10006869 JGI25405J52794_100068693 175
46 3300005289 Ga0065704_10003343 Ga0065704_100033436 175
47 3300005289 Ga0065704_10124462 Ga0065704_101244622 175
48 3300005290 Ga0065712_10074696 Ga0065712_100746962 175
49 3300005293 Ga0065715_10331278 Ga0065715_103312782 175
50 3300005293 Ga0065715_10411910 Ga0065715_104119101 175
51 3300005293 Ga0065715_10454564 Ga0065715_104545641 175
52 3300005329 Ga0070683_100166174 Ga0070683_1001661743 175
53 3300005334 Ga0068869_100110552 Ga0068869_1001105523 175
54 3300005335 Ga0070666_10853249 Ga0070666_108532491 175
55 3300005336 Ga0070680_100253020 Ga0070680_1002530202 175
56 3300005339 Ga0070660_100111146 Ga0070660_1001111463 175
57 3300005340 Ga0070689_100651499 Ga0070689_1006514991 175
58 3300005343 Ga0070687_100010470 Ga0070687_1000104703 175
59 3300005354 Ga0070675_100408305 Ga0070675_1004083052 175
60 3300005355 Ga0070671_100057031 Ga0070671_1000570312 175
61 3300005364 Ga0070673_100250431 Ga0070673_1002504312 175
62 3300005434 Ga0070709_10038486 Ga0070709_100384863 175
63 3300005435 Ga0070714_100426429 Ga0070714_1004264292 175
64 3300005438 Ga0070701_10025210 Ga0070701_100252102 175
65 3300005445 Ga0070708_100308412 Ga0070708_1003084121 175
66 3300005455 Ga0070663_100530487 Ga0070663_1005304872 175
67 3300005457 Ga0070662_100153923 Ga0070662_1001539232 175
68 3300005457 Ga0070662_100821004 Ga0070662_1008210041 175
69 3300005468 Ga0070707_100268683 Ga0070707_1002686833 175
70 3300005471 Ga0070698_100085652 Ga0070698_1000856522 175
71 3300005543 Ga0070672_100136641 Ga0070672_1001366413 175
72 3300005548 Ga0070665_100293469 Ga0070665_1002934692 175
73 3300005614 Ga0068856_100760819 Ga0068856_1007608192 175
74 3300005616 Ga0068852_100365623 Ga0068852_1003656232 175
75 3300005841 Ga0068863_100015784 Ga0068863_1000157844 175
76 3300005841 Ga0068863_100174956 Ga0068863_1001749561 175
77 3300005843 Ga0068860_100076998 Ga0068860_1000769984 175
78 3300005844 Ga0068862_100004440 Ga0068862_10000444013 175
79 3300005983 Ga0081540_1049035 Ga0081540_10490353 175
80 3300006028 Ga0070717_10063645 Ga0070717_100636454 175
81 3300006163 Ga0070715_10544484 Ga0070715_105444842 175
82 3300006175 Ga0070712_100065776 Ga0070712_1000657763 175
83 3300006175 Ga0070712_101074478 Ga0070712_1010744782 175
84 3300006914 Ga0075436_100088864 Ga0075436_1000888642 175
85 3300007076 Ga0075435_100144434 Ga0075435_1001444342 175
86 3300014325 Ga0163163_10517203 Ga0163163_105172032 175
87 3300014969 Ga0157376_10195571 Ga0157376_101955713 175
88 3300025271 Ga0207666_1008904 Ga0207666_10089041 175
89 3300025290 Ga0207673_1018626 Ga0207673_10186262 175
90 3300025315 Ga0207697_10000352 Ga0207697_1000035216 175
91 3300025315 Ga0207697_10013712 Ga0207697_100137122 175
92 3300025315 Ga0207697_10051807 Ga0207697_100518072 175
93 3300025885 Ga0207653_10255115 Ga0207653_102551151 175
94 3300025907 Ga0207645_10002352 Ga0207645_1000235217 175
95 3300025910 Ga0207684_10051530 Ga0207684_100515305 175
96 3300025910 Ga0207684_10117939 Ga0207684_101179393 175
97 3300025910 Ga0207684_10262777 Ga0207684_102627771 175
98 3300025910 Ga0207684_10727006 Ga0207684_107270061 175
99 3300025910 Ga0207684_10872979 Ga0207684_108729791 175
100 3300025915 Ga0207693_10002199 Ga0207693_100021993 175
101 3300025915 Ga0207693_10038179 Ga0207693_100381794 175
102 3300025915 Ga0207693_10086457 Ga0207693_100864572 175
103 3300025916 Ga0207663_10082942 Ga0207663_100829422 175
104 3300025918 Ga0207662_10000559 Ga0207662_100005596 175
105 3300025918 Ga0207662_10038587 Ga0207662_100385874 175
106 3300025919 Ga0207657_10079476 Ga0207657_100794762 175
107 3300025919 Ga0207657_10255089 Ga0207657_102550892 175
108 3300025922 Ga0207646_10000411 Ga0207646_1000041152 175
109 3300025922 Ga0207646_10065961 Ga0207646_100659614 175
110 3300025926 Ga0207659_10024917 Ga0207659_100249173 175
111 3300025926 Ga0207659_10867113 Ga0207659_108671131 175
112 3300025926 Ga0207659_11086301 Ga0207659_110863011 175
113 3300025929 Ga0207664_10212787 Ga0207664_102127872 175
114 3300025929 Ga0207664_10348347 Ga0207664_103483472 175
115 3300025932 Ga0207690_10141566 Ga0207690_101415662 175
116 3300025933 Ga0207706_10812614 Ga0207706_108126141 175
117 3300025936 Ga0207670_10103452 Ga0207670_101034523 175
118 3300025936 Ga0207670_10474620 Ga0207670_104746201 175
119 3300025939 Ga0207665_10113592 Ga0207665_101135922 175
120 3300025940 Ga0207691_10075598 Ga0207691_100755983 175
121 3300025941 Ga0207711_11189047 Ga0207711_111890472 175
122 3300025945 Ga0207679_10185110 Ga0207679_101851103 175
123 3300025961 Ga0207712_10032945 Ga0207712_100329455 175
124 3300025986 Ga0207658_10370583 Ga0207658_103705832 175
125 3300026023 Ga0207677_10129275 Ga0207677_101292752 175
126 3300026023 Ga0207677_10579027 Ga0207677_105790272 175
127 3300026035 Ga0207703_10039645 Ga0207703_100396451 175
128 3300026075 Ga0207708_10189875 Ga0207708_101898751 175
129 3300026088 Ga0207641_10045684 Ga0207641_100456842 175
130 3300026142 Ga0207698_10579700 Ga0207698_105797002 175
131 3300027682 Ga0209971_1099613 Ga0209971_10996131 175
132 3300027876 Ga0209974_10030866 Ga0209974_100308661 175
133 3300028380 Ga0268265_10044621 Ga0268265_100446212 175
134 3300028381 Ga0268264_10254913 Ga0268264_102549131 175
135 3300035111 Ga0373923_0083000 Ga0373923_0083000_20_547 175
136 3300037068 Ga0373925_0631197 Ga0373925_0631197_119_679 175
137 3300042439 Ga0439464_0039742 Ga0439464_0039742_781_1308 175
138 3300046457 Ga0495590_0195566 Ga0495590_0195566_197_724 175
139 3300048903 Ga0496100_0162311 Ga0496100_0162311_915_1442 175
140 3300048908 Ga0496105_0027127 Ga0496105_0027127_4060_4587 175
141 3300048911 Ga0496108_1050666 Ga0496108_1050666_21_548 175
142 3300048917 Ga0496114_0240962 Ga0496114_0240962_44_571 175
143 3300048917 Ga0496114_1011394 Ga0496114_1011394_162_689 175
144 3300048918 Ga0496115_0543295 Ga0496115_0543295_190_717 175
145 3300053085 Ga0495619_0800010 Ga0495619_0800010_24_551 175
146 3300007788 Ga0099795_10127480 Ga0099795_101274802 176
147 3300025910 Ga0207684_10013103 Ga0207684_100131039 176
148 3300025941 Ga0207711_10448858 Ga0207711_104488582 177
149 3300037068 Ga0373925_0273176 Ga0373925_0273176_271_831 177
150 3300053119 Ga0500595_036670 Ga0500595_036670_743_1303 177
151 3300039437 Ga0436365_0561697 Ga0436365_0561697_6385_6948 178
152 3300005435 Ga0070714_100114550 Ga0070714_1001145502 179
153 3300005457 Ga0070662_100254936 Ga0070662_1002549362 179
154 3300005842 Ga0068858_100031177 Ga0068858_1000311772 179
155 3300025929 Ga0207664_10580264 Ga0207664_105802641 179
156 3300048905 Ga0496102_0191535 Ga0496102_0191535_1343_1903 179
157 3300049579 Ga0501043_0010380 Ga0501043_0010380_12_551 179
158 3300003323 rootH1_10066215 rootH1_100662152 180
159 3300005329 Ga0070683_101494603 Ga0070683_1014946031 180
160 3300005366 Ga0070659_100016569 Ga0070659_1000165692 180
161 3300005435 Ga0070714_100120875 Ga0070714_1001208752 180
162 3300005468 Ga0070707_100127502 Ga0070707_1001275022 180
163 3300005614 Ga0068856_100000888 Ga0068856_10000088828 180
164 3300013307 Ga0157372_10166313 Ga0157372_101663132 180
165 3300025920 Ga0207649_10000744 Ga0207649_1000074417 180
166 3300025929 Ga0207664_10032182 Ga0207664_100321822 180
167 3300005536 Ga0070697_100010048 Ga0070697_1000100486 181
168 3300009094 Ga0111539_10260557 Ga0111539_102605572 185
169 2162886007 SwRhRL2b_contig_153793 SwRhRL2b_0540.00001070 186
170 2162886007 SwRhRL2b_contig_2058463 SwRhRL2b_0083.00000960 186
171 3300003316 rootH1_10136363 rootH1_101363632 186
172 3300003320 rootH2_10026271 rootH2_100262713 186
173 3300003320 rootH2_10100182 rootH2_101001822 186
174 3300003320 rootH2_10182195 rootH2_101821952 186
175 3300003322 rootL2_10011143 rootL2_100111437 186
176 3300003322 rootL2_10127896 rootL2_101278962 186
177 3300005272 Ga0065703_1021956 Ga0065703_10219562 186
178 3300005289 Ga0065704_10003014 Ga0065704_100030141 186
179 3300005289 Ga0065704_10486822 Ga0065704_104868221 186
180 3300005290 Ga0065712_10004789 Ga0065712_100047895 186
181 3300005290 Ga0065712_10273811 Ga0065712_102738112 186
182 3300005293 Ga0065715_10000865 Ga0065715_100008653 186
183 3300005293 Ga0065715_10001562 Ga0065715_100015623 186
184 3300005293 Ga0065715_10140608 Ga0065715_101406082 186
185 3300005293 Ga0065715_10161820 Ga0065715_101618202 186
186 3300005293 Ga0065715_10177454 Ga0065715_101774541 186
187 3300005293 Ga0065715_10240274 Ga0065715_102402741 186
188 3300005295 Ga0065707_10085928 Ga0065707_100859285 186
189 3300005295 Ga0065707_10129080 Ga0065707_101290802 186
190 3300005295 Ga0065707_10748292 Ga0065707_107482921 186
191 3300005328 Ga0070676_10014630 Ga0070676_100146305 186
192 3300005328 Ga0070676_10015006 Ga0070676_100150063 186
193 3300005328 Ga0070676_10024414 Ga0070676_100244145 186
194 3300005328 Ga0070676_10352177 Ga0070676_103521772 186
195 3300005329 Ga0070683_100714659 Ga0070683_1007146591 186
196 3300005329 Ga0070683_100756990 Ga0070683_1007569901 186
197 3300005330 Ga0070690_100012701 Ga0070690_1000127015 186
198 3300005330 Ga0070690_100212839 Ga0070690_1002128392 186
199 3300005330 Ga0070690_100321390 Ga0070690_1003213902 186
200 3300005330 Ga0070690_100327623 Ga0070690_1003276232 186
201 3300005331 Ga0070670_100012458 Ga0070670_1000124583 186
202 3300005331 Ga0070670_100212146 Ga0070670_1002121462 186
203 3300005333 Ga0070677_10068670 Ga0070677_100686702 186
204 3300005335 Ga0070666_10014664 Ga0070666_100146642 186
205 3300005335 Ga0070666_10032237 Ga0070666_100322372 186
206 3300005335 Ga0070666_10057602 Ga0070666_100576023 186
207 3300005335 Ga0070666_10579915 Ga0070666_105799151 186
208 3300005338 Ga0068868_100038485 Ga0068868_1000384853 186
209 3300005338 Ga0068868_100270613 Ga0068868_1002706132 186
210 3300005338 Ga0068868_100425072 Ga0068868_1004250722 186
211 3300005339 Ga0070660_100159888 Ga0070660_1001598883 186
212 3300005339 Ga0070660_100213011 Ga0070660_1002130112 186
213 3300005339 Ga0070660_100216537 Ga0070660_1002165373 186
214 3300005340 Ga0070689_100059551 Ga0070689_1000595514 186
215 3300005340 Ga0070689_100146518 Ga0070689_1001465182 186
216 3300005340 Ga0070689_100148889 Ga0070689_1001488892 186
217 3300005340 Ga0070689_100180997 Ga0070689_1001809972 186
218 3300005340 Ga0070689_100534120 Ga0070689_1005341201 186
219 3300005340 Ga0070689_100766747 Ga0070689_1007667472 186
220 3300005341 Ga0070691_10629918 Ga0070691_106299181 186
221 3300005344 Ga0070661_100000928 Ga0070661_10000092816 186
222 3300005344 Ga0070661_100033628 Ga0070661_1000336281 186
223 3300005345 Ga0070692_10764407 Ga0070692_107644071 186
224 3300005347 Ga0070668_100001187 Ga0070668_1000011873 186
225 3300005347 Ga0070668_100020811 Ga0070668_1000208114 186
226 3300005347 Ga0070668_100541083 Ga0070668_1005410832 186
227 3300005353 Ga0070669_100009942 Ga0070669_1000099428 186
228 3300005353 Ga0070669_100024318 Ga0070669_1000243182 186
229 3300005353 Ga0070669_100026331 Ga0070669_1000263313 186
230 3300005353 Ga0070669_100038737 Ga0070669_1000387374 186
231 3300005353 Ga0070669_100044533 Ga0070669_1000445332 186
232 3300005353 Ga0070669_100384763 Ga0070669_1003847632 186
233 3300005354 Ga0070675_100017585 Ga0070675_1000175856 186
234 3300005354 Ga0070675_100026530 Ga0070675_1000265303 186
235 3300005354 Ga0070675_100058782 Ga0070675_1000587824 186
236 3300005354 Ga0070675_100993338 Ga0070675_1009933381 186
237 3300005355 Ga0070671_100004727 Ga0070671_1000047272 186
238 3300005355 Ga0070671_100031701 Ga0070671_1000317012 186
239 3300005355 Ga0070671_100083936 Ga0070671_1000839362 186
240 3300005355 Ga0070671_100183394 Ga0070671_1001833942 186
241 3300005355 Ga0070671_100235100 Ga0070671_1002351002 186
242 3300005355 Ga0070671_100295208 Ga0070671_1002952083 186
243 3300005355 Ga0070671_100456859 Ga0070671_1004568591 186
244 3300005355 Ga0070671_100822240 Ga0070671_1008222401 186
245 3300005356 Ga0070674_100083441 Ga0070674_1000834412 186
246 3300005356 Ga0070674_100112238 Ga0070674_1001122382 186
247 3300005356 Ga0070674_100340393 Ga0070674_1003403931 186
248 3300005364 Ga0070673_100000316 Ga0070673_10000031611 186
249 3300005364 Ga0070673_100043216 Ga0070673_1000432162 186
250 3300005364 Ga0070673_100490132 Ga0070673_1004901321 186
251 3300005365 Ga0070688_100002376 Ga0070688_1000023764 186
252 3300005366 Ga0070659_100397248 Ga0070659_1003972482 186
253 3300005366 Ga0070659_100718203 Ga0070659_1007182031 186
254 3300005367 Ga0070667_100016077 Ga0070667_1000160772 186
255 3300005367 Ga0070667_100044655 Ga0070667_1000446554 186
256 3300005367 Ga0070667_100065751 Ga0070667_1000657512 186
257 3300005367 Ga0070667_100511178 Ga0070667_1005111781 186
258 3300005434 Ga0070709_10177478 Ga0070709_101774782 186
259 3300005436 Ga0070713_100060238 Ga0070713_1000602383 186
260 3300005436 Ga0070713_100067318 Ga0070713_1000673184 186
261 3300005437 Ga0070710_10037266 Ga0070710_100372663 186
262 3300005437 Ga0070710_10145657 Ga0070710_101456572 186
263 3300005437 Ga0070710_10264400 Ga0070710_102644001 186
264 3300005437 Ga0070710_10456660 Ga0070710_104566602 186
265 3300005439 Ga0070711_100103916 Ga0070711_1001039163 186
266 3300005439 Ga0070711_100539447 Ga0070711_1005394472 186
267 3300005440 Ga0070705_100051376 Ga0070705_1000513764 186
268 3300005440 Ga0070705_100072744 Ga0070705_1000727444 186
269 3300005440 Ga0070705_100146513 Ga0070705_1001465132 186
270 3300005440 Ga0070705_100193124 Ga0070705_1001931242 186
271 3300005441 Ga0070700_100377880 Ga0070700_1003778802 186
272 3300005445 Ga0070708_100002881 Ga0070708_10000288114 186
273 3300005445 Ga0070708_100034509 Ga0070708_1000345097 186
274 3300005445 Ga0070708_100321376 Ga0070708_1003213762 186
275 3300005445 Ga0070708_100323065 Ga0070708_1003230652 186
276 3300005445 Ga0070708_100663453 Ga0070708_1006634532 186
277 3300005445 Ga0070708_101091157 Ga0070708_1010911571 186
278 3300005456 Ga0070678_100002256 Ga0070678_10000225615 186
279 3300005456 Ga0070678_100027681 Ga0070678_1000276812 186
280 3300005456 Ga0070678_100112912 Ga0070678_1001129122 186
281 3300005456 Ga0070678_100188641 Ga0070678_1001886412 186
282 3300005456 Ga0070678_100197197 Ga0070678_1001971972 186
283 3300005457 Ga0070662_100003800 Ga0070662_1000038008 186
284 3300005457 Ga0070662_100049564 Ga0070662_1000495642 186
285 3300005457 Ga0070662_100612500 Ga0070662_1006125002 186
286 3300005458 Ga0070681_10202591 Ga0070681_102025912 186
287 3300005458 Ga0070681_10392772 Ga0070681_103927722 186
288 3300005458 Ga0070681_10593799 Ga0070681_105937992 186
289 3300005459 Ga0068867_100027407 Ga0068867_1000274071 186
290 3300005459 Ga0068867_100267495 Ga0068867_1002674952 186
291 3300005467 Ga0070706_100011390 Ga0070706_10001139011 186
292 3300005467 Ga0070706_100025876 Ga0070706_1000258761 186
293 3300005467 Ga0070706_100064467 Ga0070706_1000644672 186
294 3300005467 Ga0070706_100073042 Ga0070706_1000730424 186
295 3300005467 Ga0070706_100082512 Ga0070706_1000825123 186
296 3300005467 Ga0070706_100141498 Ga0070706_1001414984 186
297 3300005467 Ga0070706_100183792 Ga0070706_1001837923 186
298 3300005467 Ga0070706_100272519 Ga0070706_1002725192 186
299 3300005467 Ga0070706_100471042 Ga0070706_1004710422 186
300 3300005467 Ga0070706_101133481 Ga0070706_1011334811 186
301 3300005468 Ga0070707_100000846 Ga0070707_10000084617 186
302 3300005468 Ga0070707_100022154 Ga0070707_1000221542 186
303 3300005468 Ga0070707_100023714 Ga0070707_1000237145 186
304 3300005468 Ga0070707_100026907 Ga0070707_1000269076 186
305 3300005468 Ga0070707_100046972 Ga0070707_1000469722 186
306 3300005468 Ga0070707_100048200 Ga0070707_1000482006 186
307 3300005468 Ga0070707_100101971 Ga0070707_1001019713 186
308 3300005468 Ga0070707_100143773 Ga0070707_1001437732 186
309 3300005468 Ga0070707_100198275 Ga0070707_1001982752 186
310 3300005468 Ga0070707_100220861 Ga0070707_1002208612 186
311 3300005468 Ga0070707_100274267 Ga0070707_1002742672 186
312 3300005468 Ga0070707_100489557 Ga0070707_1004895572 186
313 3300005471 Ga0070698_100002074 Ga0070698_1000020744 186
314 3300005471 Ga0070698_100005905 Ga0070698_1000059053 186
315 3300005471 Ga0070698_100007983 Ga0070698_1000079839 186
316 3300005471 Ga0070698_100672467 Ga0070698_1006724671 186
317 3300005518 Ga0070699_100029144 Ga0070699_1000291447 186
318 3300005518 Ga0070699_100044262 Ga0070699_1000442623 186
319 3300005518 Ga0070699_100052006 Ga0070699_1000520064 186
320 3300005518 Ga0070699_100091835 Ga0070699_1000918352 186
321 3300005518 Ga0070699_100165982 Ga0070699_1001659822 186
322 3300005518 Ga0070699_100465337 Ga0070699_1004653372 186
323 3300005518 Ga0070699_100668664 Ga0070699_1006686641 186
324 3300005535 Ga0070684_100057045 Ga0070684_1000570454 186
325 3300005535 Ga0070684_100139124 Ga0070684_1001391242 186
326 3300005535 Ga0070684_100280404 Ga0070684_1002804041 186
327 3300005536 Ga0070697_100000863 Ga0070697_10000086313 186
328 3300005536 Ga0070697_100004776 Ga0070697_10000477611 186
329 3300005536 Ga0070697_100006005 Ga0070697_1000060056 186
330 3300005536 Ga0070697_100007445 Ga0070697_1000074451 186
331 3300005536 Ga0070697_100017077 Ga0070697_1000170774 186
332 3300005536 Ga0070697_100018213 Ga0070697_1000182133 186
333 3300005536 Ga0070697_100028977 Ga0070697_1000289774 186
334 3300005536 Ga0070697_100031306 Ga0070697_1000313064 186
335 3300005536 Ga0070697_100157961 Ga0070697_1001579611 186
336 3300005536 Ga0070697_100365983 Ga0070697_1003659832 186
337 3300005536 Ga0070697_100507634 Ga0070697_1005076342 186
338 3300005539 Ga0068853_100000577 Ga0068853_1000005778 186
339 3300005543 Ga0070672_100000553 Ga0070672_10000055310 186
340 3300005543 Ga0070672_100097565 Ga0070672_1000975651 186
341 3300005543 Ga0070672_100198421 Ga0070672_1001984212 186
342 3300005543 Ga0070672_100559834 Ga0070672_1005598342 186
343 3300005543 Ga0070672_100683683 Ga0070672_1006836831 186
344 3300005544 Ga0070686_100404841 Ga0070686_1004048412 186
345 3300005545 Ga0070695_100088692 Ga0070695_1000886922 186
346 3300005546 Ga0070696_100044534 Ga0070696_1000445342 186
347 3300005548 Ga0070665_100000201 Ga0070665_10000020192 186
348 3300005548 Ga0070665_100010897 Ga0070665_1000108977 186
349 3300005548 Ga0070665_100126750 Ga0070665_1001267502 186
350 3300005548 Ga0070665_100322640 Ga0070665_1003226402 186
351 3300005548 Ga0070665_100535738 Ga0070665_1005357381 186
352 3300005548 Ga0070665_100670647 Ga0070665_1006706472 186
353 3300005549 Ga0070704_100138815 Ga0070704_1001388152 186
354 3300005549 Ga0070704_100454021 Ga0070704_1004540212 186
355 3300005563 Ga0068855_100006309 Ga0068855_1000063094 186
356 3300005564 Ga0070664_100220538 Ga0070664_1002205382 186
357 3300005564 Ga0070664_100254847 Ga0070664_1002548472 186
358 3300005578 Ga0068854_100313910 Ga0068854_1003139102 186
359 3300005614 Ga0068856_100123051 Ga0068856_1001230513 186
360 3300005616 Ga0068852_101050069 Ga0068852_1010500692 186
361 3300005617 Ga0068859_100311139 Ga0068859_1003111392 186
362 3300005617 Ga0068859_100416287 Ga0068859_1004162872 186
363 3300005617 Ga0068859_101319318 Ga0068859_1013193182 186
364 3300005618 Ga0068864_100268133 Ga0068864_1002681331 186
365 3300005718 Ga0068866_10042674 Ga0068866_100426743 186
366 3300005719 Ga0068861_100362827 Ga0068861_1003628272 186
367 3300005719 Ga0068861_100382281 Ga0068861_1003822812 186
368 3300005719 Ga0068861_100583674 Ga0068861_1005836741 186
369 3300005841 Ga0068863_100002168 Ga0068863_1000021683 186
370 3300005841 Ga0068863_100048665 Ga0068863_1000486654 186
371 3300005841 Ga0068863_100231907 Ga0068863_1002319072 186
372 3300005841 Ga0068863_100319812 Ga0068863_1003198122 186
373 3300005842 Ga0068858_100010147 Ga0068858_1000101477 186
374 3300005842 Ga0068858_100162920 Ga0068858_1001629202 186
375 3300005842 Ga0068858_100322371 Ga0068858_1003223712 186
376 3300005842 Ga0068858_100371539 Ga0068858_1003715392 186
377 3300005842 Ga0068858_100400383 Ga0068858_1004003832 186
378 3300005843 Ga0068860_100135297 Ga0068860_1001352972 186
379 3300005843 Ga0068860_100229106 Ga0068860_1002291062 186
380 3300005843 Ga0068860_100433099 Ga0068860_1004330992 186
381 3300005844 Ga0068862_100154751 Ga0068862_1001547512 186
382 3300005844 Ga0068862_100293363 Ga0068862_1002933632 186
383 3300005844 Ga0068862_100714262 Ga0068862_1007142622 186
384 3300005844 Ga0068862_100848090 Ga0068862_1008480902 186
385 3300005844 Ga0068862_100921085 Ga0068862_1009210852 186
386 3300005937 Ga0081455_10000725 Ga0081455_1000072522 186
387 3300005937 Ga0081455_10001494 Ga0081455_1000149415 186
388 3300005937 Ga0081455_10002780 Ga0081455_1000278014 186
389 3300005937 Ga0081455_10053897 Ga0081455_100538972 186
390 3300005937 Ga0081455_10120991 Ga0081455_101209913 186
391 3300005937 Ga0081455_10474558 Ga0081455_104745581 186
392 3300005983 Ga0081540_1000380 Ga0081540_100038017 186
393 3300005983 Ga0081540_1007770 Ga0081540_10077707 186
394 3300005985 Ga0081539_10000139 Ga0081539_10000139132 186
395 3300005985 Ga0081539_10000965 Ga0081539_1000096552 186
396 3300005985 Ga0081539_10012962 Ga0081539_100129623 186
397 3300005985 Ga0081539_10024547 Ga0081539_100245473 186
398 3300006028 Ga0070717_10000276 Ga0070717_1000027617 186
399 3300006028 Ga0070717_10010066 Ga0070717_100100667 186
400 3300006028 Ga0070717_10034700 Ga0070717_100347005 186
401 3300006028 Ga0070717_10519047 Ga0070717_105190472 186
402 3300006028 Ga0070717_10807140 Ga0070717_108071402 186
403 3300006048 Ga0075363_100062862 Ga0075363_1000628622 186
404 3300006163 Ga0070715_10074332 Ga0070715_100743322 186
405 3300006163 Ga0070715_10080698 Ga0070715_100806982 186
406 3300006173 Ga0070716_100037868 Ga0070716_1000378683 186
407 3300006173 Ga0070716_100123085 Ga0070716_1001230852 186
408 3300006173 Ga0070716_100313692 Ga0070716_1003136922 186
409 3300006173 Ga0070716_100516655 Ga0070716_1005166552 186
410 3300006175 Ga0070712_100002163 Ga0070712_1000021637 186
411 3300006175 Ga0070712_100027136 Ga0070712_1000271362 186
412 3300006175 Ga0070712_100114020 Ga0070712_1001140203 186
413 3300006175 Ga0070712_100120617 Ga0070712_1001206174 186
414 3300006175 Ga0070712_100219088 Ga0070712_1002190882 186
415 3300006175 Ga0070712_100236896 Ga0070712_1002368962 186
416 3300006175 Ga0070712_100438468 Ga0070712_1004384681 186
417 3300006175 Ga0070712_100557173 Ga0070712_1005571732 186
418 3300006177 Ga0075362_10000924 Ga0075362_100009246 186
419 3300006195 Ga0075366_10113582 Ga0075366_101135821 186
420 3300006237 Ga0097621_100112535 Ga0097621_1001125353 186
421 3300006237 Ga0097621_100370920 Ga0097621_1003709202 186
422 3300006237 Ga0097621_100638237 Ga0097621_1006382372 186
423 3300006358 Ga0068871_100040017 Ga0068871_1000400172 186
424 3300006358 Ga0068871_100040202 Ga0068871_1000402022 186
425 3300006358 Ga0068871_100611275 Ga0068871_1006112752 186
426 3300006358 Ga0068871_100802294 Ga0068871_1008022941 186
427 3300006844 Ga0075428_100592782 Ga0075428_1005927822 186
428 3300006844 Ga0075428_100674325 Ga0075428_1006743252 186
429 3300006852 Ga0075433_10393007 Ga0075433_103930071 186
430 3300006852 Ga0075433_10580011 Ga0075433_105800111 186
431 3300006871 Ga0075434_100496625 Ga0075434_1004966252 186
432 3300006881 Ga0068865_100264128 Ga0068865_1002641282 186
433 3300006914 Ga0075436_100024009 Ga0075436_1000240093 186
434 3300006914 Ga0075436_100038456 Ga0075436_1000384563 186
435 3300006914 Ga0075436_100600255 Ga0075436_1006002552 186
436 3300006931 Ga0097620_100311114 Ga0097620_1003111142 186
437 3300006931 Ga0097620_100416276 Ga0097620_1004162762 186
438 3300006931 Ga0097620_101319394 Ga0097620_1013193942 186
439 3300006931 Ga0097620_101727795 Ga0097620_1017277951 186
440 3300007076 Ga0075435_100692382 Ga0075435_1006923822 186
441 3300007076 Ga0075435_100816644 Ga0075435_1008166442 186
442 3300007788 Ga0099795_10067688 Ga0099795_100676881 186
443 3300009093 Ga0105240_10071134 Ga0105240_100711345 186
444 3300009093 Ga0105240_10095127 Ga0105240_100951272 186
445 3300009093 Ga0105240_11055164 Ga0105240_110551642 186
446 3300009094 Ga0111539_10702902 Ga0111539_107029021 186
447 3300009094 Ga0111539_10751131 Ga0111539_107511312 186
448 3300009094 Ga0111539_11938755 Ga0111539_119387551 186
449 3300009098 Ga0105245_10051429 Ga0105245_100514293 186
450 3300009098 Ga0105245_10114923 Ga0105245_101149232 186
451 3300009101 Ga0105247_10124210 Ga0105247_101242102 186
452 3300009101 Ga0105247_10208372 Ga0105247_102083722 186
453 3300009101 Ga0105247_10464220 Ga0105247_104642202 186
454 3300009101 Ga0105247_10695238 Ga0105247_106952381 186
455 3300009147 Ga0114129_10010111 Ga0114129_100101118 186
456 3300009147 Ga0114129_10281362 Ga0114129_102813622 186
457 3300009147 Ga0114129_10392395 Ga0114129_103923951 186
458 3300009148 Ga0105243_10185655 Ga0105243_101856552 186
459 3300009148 Ga0105243_11038760 Ga0105243_110387602 186
460 3300009148 Ga0105243_11717485 Ga0105243_117174851 186
461 3300009174 Ga0105241_10339536 Ga0105241_103395362 186
462 3300009174 Ga0105241_10447474 Ga0105241_104474742 186
463 3300009174 Ga0105241_10904324 Ga0105241_109043241 186
464 3300009176 Ga0105242_10019943 Ga0105242_100199438 186
465 3300009176 Ga0105242_10164649 Ga0105242_101646493 186
466 3300009176 Ga0105242_10182184 Ga0105242_101821842 186
467 3300009176 Ga0105242_11200148 Ga0105242_112001481 186
468 3300009177 Ga0105248_10286065 Ga0105248_102860653 186
469 3300009177 Ga0105248_10496147 Ga0105248_104961472 186
470 3300009545 Ga0105237_10018816 Ga0105237_100188167 186
471 3300009545 Ga0105237_10110572 Ga0105237_101105724 186
472 3300009551 Ga0105238_10137720 Ga0105238_101377203 186
473 3300009551 Ga0105238_10998419 Ga0105238_109984192 186
474 3300009553 Ga0105249_10016016 Ga0105249_100160166 186
475 3300009553 Ga0105249_10029932 Ga0105249_100299324 186
476 3300009553 Ga0105249_10482098 Ga0105249_104820982 186
477 3300010159 Ga0099796_10002329 Ga0099796_100023293 186
478 3300010159 Ga0099796_10007686 Ga0099796_100076863 186
479 3300010375 Ga0105239_10018427 Ga0105239_100184274 186
480 3300010375 Ga0105239_10165978 Ga0105239_101659782 186
481 3300010375 Ga0105239_10295621 Ga0105239_102956212 186
482 3300010375 Ga0105239_10317509 Ga0105239_103175092 186
483 3300010375 Ga0105239_10504864 Ga0105239_105048642 186
484 3300010375 Ga0105239_10968756 Ga0105239_109687562 186
485 3300010375 Ga0105239_11665478 Ga0105239_116654782 186
486 3300011119 Ga0105246_10104235 Ga0105246_101042352 186
487 3300011119 Ga0105246_10235860 Ga0105246_102358602 186
488 3300012494 Ga0157341_1025973 Ga0157341_10259731 186
489 3300013100 Ga0157373_10573312 Ga0157373_105733122 186
490 3300013100 Ga0157373_10590937 Ga0157373_105909372 186
491 3300013102 Ga0157371_10168968 Ga0157371_101689682 186
492 3300013102 Ga0157371_10343434 Ga0157371_103434342 186
493 3300013105 Ga0157369_10326698 Ga0157369_103266981 186
494 3300013296 Ga0157374_10000036 Ga0157374_100000368 186
495 3300013296 Ga0157374_10002060 Ga0157374_1000206011 186
496 3300013296 Ga0157374_10023552 Ga0157374_100235528 186
497 3300013296 Ga0157374_10087495 Ga0157374_100874951 186
498 3300013296 Ga0157374_10108489 Ga0157374_101084893 186
499 3300013296 Ga0157374_10138095 Ga0157374_101380953 186
500 3300013296 Ga0157374_10171288 Ga0157374_101712884 186
501 3300013296 Ga0157374_10190945 Ga0157374_101909452 186
502 3300013296 Ga0157374_10249196 Ga0157374_102491962 186
503 3300013296 Ga0157374_10324636 Ga0157374_103246362 186
504 3300013296 Ga0157374_10389571 Ga0157374_103895712 186
505 3300013296 Ga0157374_10459301 Ga0157374_104593012 186
506 3300013296 Ga0157374_10528501 Ga0157374_105285012 186
507 3300013296 Ga0157374_10535060 Ga0157374_105350602 186
508 3300013296 Ga0157374_10701692 Ga0157374_107016922 186
509 3300013297 Ga0157378_10016255 Ga0157378_100162555 186
510 3300013297 Ga0157378_10055609 Ga0157378_100556093 186
511 3300013297 Ga0157378_10121944 Ga0157378_101219442 186
512 3300013297 Ga0157378_10144246 Ga0157378_101442462 186
513 3300013297 Ga0157378_10217479 Ga0157378_102174793 186
514 3300013297 Ga0157378_10343520 Ga0157378_103435202 186
515 3300013297 Ga0157378_10375481 Ga0157378_103754812 186
516 3300013297 Ga0157378_10532800 Ga0157378_105328001 186
517 3300013297 Ga0157378_10578055 Ga0157378_105780552 186
518 3300013297 Ga0157378_10579114 Ga0157378_105791142 186
519 3300013297 Ga0157378_10836597 Ga0157378_108365971 186
520 3300013297 Ga0157378_10856317 Ga0157378_108563172 186
521 3300013297 Ga0157378_11013341 Ga0157378_110133412 186
522 3300013297 Ga0157378_11195409 Ga0157378_111954092 186
523 3300013306 Ga0163162_10012238 Ga0163162_100122382 186
524 3300013306 Ga0163162_10028980 Ga0163162_100289802 186
525 3300013306 Ga0163162_10033387 Ga0163162_100333872 186
526 3300013306 Ga0163162_10037100 Ga0163162_100371005 186
527 3300013306 Ga0163162_10058128 Ga0163162_100581285 186
528 3300013306 Ga0163162_10071548 Ga0163162_100715484 186
529 3300013306 Ga0163162_10371410 Ga0163162_103714102 186
530 3300013307 Ga0157372_10035116 Ga0157372_100351164 186
531 3300013307 Ga0157372_10047250 Ga0157372_100472507 186
532 3300013307 Ga0157372_10121487 Ga0157372_101214873 186
533 3300013307 Ga0157372_10207336 Ga0157372_102073362 186
534 3300013307 Ga0157372_10845908 Ga0157372_108459082 186
535 3300013308 Ga0157375_10002351 Ga0157375_100023518 186
536 3300013308 Ga0157375_10012538 Ga0157375_100125382 186
537 3300013308 Ga0157375_10033130 Ga0157375_100331303 186
538 3300013308 Ga0157375_10176945 Ga0157375_101769452 186
539 3300013308 Ga0157375_10261482 Ga0157375_102614822 186
540 3300013308 Ga0157375_10654968 Ga0157375_106549682 186
541 3300013308 Ga0157375_10811863 Ga0157375_108118632 186
542 3300013308 Ga0157375_11064352 Ga0157375_110643521 186
543 3300014325 Ga0163163_10020210 Ga0163163_100202106 186
544 3300014497 Ga0182008_10084132 Ga0182008_100841323 186
545 3300014497 Ga0182008_10251634 Ga0182008_102516341 186
546 3300014745 Ga0157377_10070240 Ga0157377_100702402 186
547 3300014745 Ga0157377_10371671 Ga0157377_103716711 186
548 3300014745 Ga0157377_10447460 Ga0157377_104474601 186
549 3300014968 Ga0157379_10044580 Ga0157379_100445804 186
550 3300014968 Ga0157379_10358012 Ga0157379_103580122 186
551 3300014968 Ga0157379_10360391 Ga0157379_103603912 186
552 3300014968 Ga0157379_10498232 Ga0157379_104982322 186
553 3300014969 Ga0157376_10001772 Ga0157376_100017724 186
554 3300014969 Ga0157376_10033828 Ga0157376_100338282 186
555 3300014969 Ga0157376_10062585 Ga0157376_100625852 186
556 3300014969 Ga0157376_10133534 Ga0157376_101335343 186
557 3300014969 Ga0157376_10218191 Ga0157376_102181912 186
558 3300014969 Ga0157376_10454669 Ga0157376_104546692 186
559 3300014969 Ga0157376_11009990 Ga0157376_110099902 186
560 3300017792 Ga0163161_10039209 Ga0163161_100392092 186
561 3300017792 Ga0163161_10707240 Ga0163161_107072401 186
562 3300021384 Ga0213876_10052819 Ga0213876_100528193 186
563 3300021384 Ga0213876_10087300 Ga0213876_100873002 186
564 3300021384 Ga0213876_10178599 Ga0213876_101785992 186
565 3300025271 Ga0207666_1000965 Ga0207666_10009656 186
566 3300025271 Ga0207666_1029194 Ga0207666_10291942 186
567 3300025290 Ga0207673_1003904 Ga0207673_10039041 186
568 3300025315 Ga0207697_10001557 Ga0207697_1000155710 186
569 3300025315 Ga0207697_10002696 Ga0207697_100026965 186
570 3300025315 Ga0207697_10017954 Ga0207697_100179542 186
571 3300025315 Ga0207697_10017990 Ga0207697_100179902 186
572 3300025315 Ga0207697_10018085 Ga0207697_100180852 186
573 3300025315 Ga0207697_10038226 Ga0207697_100382261 186
574 3300025315 Ga0207697_10070193 Ga0207697_100701932 186
575 3300025901 Ga0207688_10003192 Ga0207688_1000319211 186
576 3300025901 Ga0207688_10008291 Ga0207688_100082912 186
577 3300025901 Ga0207688_10093005 Ga0207688_100930052 186
578 3300025901 Ga0207688_10139122 Ga0207688_101391222 186
579 3300025901 Ga0207688_10689957 Ga0207688_106899571 186
580 3300025903 Ga0207680_10017844 Ga0207680_100178445 186
581 3300025903 Ga0207680_10065698 Ga0207680_100656983 186
582 3300025903 Ga0207680_10595288 Ga0207680_105952881 186
583 3300025904 Ga0207647_10043454 Ga0207647_100434543 186
584 3300025905 Ga0207685_10017846 Ga0207685_100178463 186
585 3300025906 Ga0207699_10188061 Ga0207699_101880612 186
586 3300025907 Ga0207645_10000574 Ga0207645_1000057422 186
587 3300025907 Ga0207645_10010256 Ga0207645_1001025610 186
588 3300025907 Ga0207645_10027542 Ga0207645_100275425 186
589 3300025907 Ga0207645_10221176 Ga0207645_102211761 186
590 3300025907 Ga0207645_10263213 Ga0207645_102632132 186
591 3300025909 Ga0207705_10072124 Ga0207705_100721241 186
592 3300025910 Ga0207684_10000292 Ga0207684_1000029269 186
593 3300025910 Ga0207684_10007486 Ga0207684_1000748612 186
594 3300025910 Ga0207684_10009504 Ga0207684_100095044 186
595 3300025910 Ga0207684_10045965 Ga0207684_100459652 186
596 3300025910 Ga0207684_10113168 Ga0207684_101131682 186
597 3300025910 Ga0207684_10286901 Ga0207684_102869012 186
598 3300025910 Ga0207684_10742794 Ga0207684_107427942 186
599 3300025912 Ga0207707_10132079 Ga0207707_101320792 186
600 3300025914 Ga0207671_10010633 Ga0207671_100106333 186
601 3300025914 Ga0207671_10037132 Ga0207671_100371324 186
602 3300025914 Ga0207671_10111929 Ga0207671_101119293 186
603 3300025914 Ga0207671_10164844 Ga0207671_101648441 186
604 3300025915 Ga0207693_10005933 Ga0207693_1000593310 186
605 3300025915 Ga0207693_10028709 Ga0207693_100287092 186
606 3300025915 Ga0207693_10031847 Ga0207693_100318474 186
607 3300025915 Ga0207693_10046002 Ga0207693_100460024 186
608 3300025916 Ga0207663_10171523 Ga0207663_101715232 186
609 3300025916 Ga0207663_10490354 Ga0207663_104903542 186
610 3300025919 Ga0207657_10214476 Ga0207657_102144763 186
611 3300025919 Ga0207657_10831922 Ga0207657_108319222 186
612 3300025920 Ga0207649_10012194 Ga0207649_100121945 186
613 3300025922 Ga0207646_10000386 Ga0207646_1000038621 186
614 3300025922 Ga0207646_10025706 Ga0207646_100257065 186
615 3300025922 Ga0207646_10031901 Ga0207646_100319013 186
616 3300025922 Ga0207646_10040419 Ga0207646_100404192 186
617 3300025922 Ga0207646_10086093 Ga0207646_100860933 186
618 3300025922 Ga0207646_10092609 Ga0207646_100926092 186
619 3300025922 Ga0207646_10137382 Ga0207646_101373822 186
620 3300025922 Ga0207646_10293662 Ga0207646_102936622 186
621 3300025922 Ga0207646_10396428 Ga0207646_103964282 186
622 3300025922 Ga0207646_10487301 Ga0207646_104873011 186
623 3300025922 Ga0207646_10620502 Ga0207646_106205021 186
624 3300025923 Ga0207681_10008691 Ga0207681_100086918 186
625 3300025923 Ga0207681_10021651 Ga0207681_100216514 186
626 3300025923 Ga0207681_10164798 Ga0207681_101647982 186
627 3300025923 Ga0207681_10173678 Ga0207681_101736782 186
628 3300025923 Ga0207681_10187995 Ga0207681_101879952 186
629 3300025923 Ga0207681_10355670 Ga0207681_103556702 186
630 3300025924 Ga0207694_10168976 Ga0207694_101689763 186
631 3300025925 Ga0207650_10027110 Ga0207650_100271104 186
632 3300025925 Ga0207650_10609973 Ga0207650_106099732 186
633 3300025926 Ga0207659_10070936 Ga0207659_100709361 186
634 3300025926 Ga0207659_10330431 Ga0207659_103304311 186
635 3300025928 Ga0207700_10023918 Ga0207700_100239184 186
636 3300025928 Ga0207700_10096728 Ga0207700_100967283 186
637 3300025928 Ga0207700_10163843 Ga0207700_101638431 186
638 3300025928 Ga0207700_10261353 Ga0207700_102613532 186
639 3300025928 Ga0207700_11312300 Ga0207700_113123001 186
640 3300025929 Ga0207664_10198198 Ga0207664_101981982 186
641 3300025929 Ga0207664_10229334 Ga0207664_102293343 186
642 3300025929 Ga0207664_10326497 Ga0207664_103264972 186
643 3300025931 Ga0207644_10049006 Ga0207644_100490062 186
644 3300025931 Ga0207644_10056144 Ga0207644_100561444 186
645 3300025931 Ga0207644_10069419 Ga0207644_100694193 186
646 3300025931 Ga0207644_10088113 Ga0207644_100881133 186
647 3300025931 Ga0207644_10092943 Ga0207644_100929432 186
648 3300025931 Ga0207644_10431217 Ga0207644_104312172 186
649 3300025932 Ga0207690_10022326 Ga0207690_100223264 186
650 3300025932 Ga0207690_10045762 Ga0207690_100457622 186
651 3300025932 Ga0207690_11078842 Ga0207690_110788421 186
652 3300025933 Ga0207706_10003684 Ga0207706_100036848 186
653 3300025933 Ga0207706_10020606 Ga0207706_100206067 186
654 3300025933 Ga0207706_10208517 Ga0207706_102085172 186
655 3300025933 Ga0207706_10212759 Ga0207706_102127592 186
656 3300025933 Ga0207706_10378465 Ga0207706_103784652 186
657 3300025933 Ga0207706_10950770 Ga0207706_109507702 186
658 3300025934 Ga0207686_10062018 Ga0207686_100620182 186
659 3300025934 Ga0207686_10515206 Ga0207686_105152062 186
660 3300025935 Ga0207709_10674066 Ga0207709_106740662 186
661 3300025936 Ga0207670_10052677 Ga0207670_100526772 186
662 3300025936 Ga0207670_10140489 Ga0207670_101404891 186
663 3300025937 Ga0207669_10003562 Ga0207669_100035622 186
664 3300025937 Ga0207669_10105937 Ga0207669_101059373 186
665 3300025937 Ga0207669_10297533 Ga0207669_102975331 186
666 3300025937 Ga0207669_10912238 Ga0207669_109122382 186
667 3300025939 Ga0207665_10006694 Ga0207665_1000669410 186
668 3300025939 Ga0207665_10026197 Ga0207665_100261974 186
669 3300025939 Ga0207665_10152353 Ga0207665_101523532 186
670 3300025939 Ga0207665_10265790 Ga0207665_102657901 186
671 3300025939 Ga0207665_10907769 Ga0207665_109077692 186
672 3300025940 Ga0207691_10003715 Ga0207691_1000371515 186
673 3300025940 Ga0207691_10004494 Ga0207691_1000449416 186
674 3300025940 Ga0207691_10135861 Ga0207691_101358612 186
675 3300025940 Ga0207691_10164829 Ga0207691_101648292 186
676 3300025940 Ga0207691_10488918 Ga0207691_104889182 186
677 3300025940 Ga0207691_10532430 Ga0207691_105324302 186
678 3300025942 Ga0207689_10027373 Ga0207689_100273734 186
679 3300025945 Ga0207679_10020501 Ga0207679_100205012 186
680 3300025949 Ga0207667_10001014 Ga0207667_100010147 186
681 3300025960 Ga0207651_10025449 Ga0207651_100254492 186
682 3300025960 Ga0207651_10097110 Ga0207651_100971102 186
683 3300025960 Ga0207651_10233593 Ga0207651_102335932 186
684 3300025960 Ga0207651_10258094 Ga0207651_102580942 186
685 3300025972 Ga0207668_10012259 Ga0207668_100122596 186
686 3300025972 Ga0207668_10016783 Ga0207668_100167833 186
687 3300025972 Ga0207668_10017669 Ga0207668_100176693 186
688 3300025972 Ga0207668_10088504 Ga0207668_100885042 186
689 3300025986 Ga0207658_10010561 Ga0207658_100105617 186
690 3300025986 Ga0207658_10089256 Ga0207658_100892563 186
691 3300025986 Ga0207658_10275290 Ga0207658_102752902 186
692 3300026023 Ga0207677_10056854 Ga0207677_100568543 186
693 3300026023 Ga0207677_10327359 Ga0207677_103273592 186
694 3300026035 Ga0207703_10120051 Ga0207703_101200512 186
695 3300026035 Ga0207703_10364796 Ga0207703_103647961 186
696 3300026041 Ga0207639_10000582 Ga0207639_1000058214 186
697 3300026067 Ga0207678_10173267 Ga0207678_101732672 186
698 3300026067 Ga0207678_10295600 Ga0207678_102956003 186
699 3300026078 Ga0207702_10403033 Ga0207702_104030332 186
700 3300026088 Ga0207641_10054972 Ga0207641_100549723 186
701 3300026088 Ga0207641_10055335 Ga0207641_100553352 186
702 3300026088 Ga0207641_10155856 Ga0207641_101558561 186
703 3300026088 Ga0207641_10211252 Ga0207641_102112523 186
704 3300026088 Ga0207641_10443888 Ga0207641_104438882 186
705 3300026089 Ga0207648_10220187 Ga0207648_102201872 186
706 3300026089 Ga0207648_10287070 Ga0207648_102870702 186
707 3300026095 Ga0207676_10249933 Ga0207676_102499332 186
708 3300026095 Ga0207676_10941628 Ga0207676_109416282 186
709 3300026118 Ga0207675_100095869 Ga0207675_1000958691 186
710 3300026118 Ga0207675_101602324 Ga0207675_1016023241 186
711 3300026121 Ga0207683_10008548 Ga0207683_1000854811 186
712 3300026121 Ga0207683_10026404 Ga0207683_100264044 186
713 3300026121 Ga0207683_10130361 Ga0207683_101303611 186
714 3300026121 Ga0207683_10272290 Ga0207683_102722902 186
715 3300026121 Ga0207683_10336210 Ga0207683_103362102 186
716 3300028379 Ga0268266_10000197 Ga0268266_100001978 186
717 3300028379 Ga0268266_10002434 Ga0268266_1000243417 186
718 3300028379 Ga0268266_10012778 Ga0268266_100127782 186
719 3300028379 Ga0268266_10013406 Ga0268266_100134066 186
720 3300028379 Ga0268266_10075111 Ga0268266_100751112 186
721 3300028379 Ga0268266_10286554 Ga0268266_102865542 186
722 3300028379 Ga0268266_10477502 Ga0268266_104775021 186
723 3300028380 Ga0268265_10096538 Ga0268265_100965382 186
724 3300028380 Ga0268265_10499190 Ga0268265_104991902 186
725 3300028380 Ga0268265_11060816 Ga0268265_110608162 186
726 3300028381 Ga0268264_10374614 Ga0268264_103746142 186
727 3300028381 Ga0268264_10606452 Ga0268264_106064521 186
728 3300030521 Ga0307511_10000128 Ga0307511_100001282 186
729 3300035089 Ga0373944_0038430 Ga0373944_0038430_888_1448 186
730 3300035089 Ga0373944_0274833 Ga0373944_0274833_22_582 186
731 3300035111 Ga0373923_0137669 Ga0373923_0137669_200_760 186
732 3300035114 Ga0373939_0039936 Ga0373939_0039936_318_878 186
733 3300035116 Ga0373945_0087316 Ga0373945_0087316_36_596 186
734 3300035117 Ga0373953_0091928 Ga0373953_0091928_82_642 186
735 3300035118 Ga0373954_0492117 Ga0373954_0492117_17_577 186
736 3300035119 Ga0373956_0309188 Ga0373956_0309188_149_709 186
737 3300035170 Ga0373943_0016752 Ga0373943_0016752_2268_2828 186
738 3300035170 Ga0373943_0024378 Ga0373943_0024378_484_1044 186
739 3300035170 Ga0373943_0035717 Ga0373943_0035717_1403_1963 186
740 3300035170 Ga0373943_0055648 Ga0373943_0055648_649_1209 186
741 3300035691 Ga0373931_0547570 Ga0373931_0547570_70_630 186
742 3300035692 Ga0373935_0112443 Ga0373935_0112443_338_898 186
743 3300035692 Ga0373935_0200565 Ga0373935_0200565_801_1361 186
744 3300035692 Ga0373935_0200707 Ga0373935_0200707_737_1297 186
745 3300035692 Ga0373935_0203073 Ga0373935_0203073_84_644 186
746 3300035692 Ga0373935_0421558 Ga0373935_0421558_14_574 186
747 3300035695 Ga0373927_0100804 Ga0373927_0100804_1024_1584 186
748 3300035724 Ga0373933_0070022 Ga0373933_0070022_549_1109 186
749 3300035725 Ga0373947_0008617 Ga0373947_0008617_1136_1696 186
750 3300035725 Ga0373947_0104687 Ga0373947_0104687_281_841 186
751 3300035725 Ga0373947_0642884 Ga0373947_0642884_16_576 186
752 3300036401 Ga0373937_0017352 Ga0373937_0017352_4917_5477 186
753 3300036401 Ga0373937_0360283 Ga0373937_0360283_628_1188 186
754 3300036401 Ga0373937_0469403 Ga0373937_0469403_77_637 186
755 3300036401 Ga0373937_0923950 Ga0373937_0923950_22_582 186
756 3300037068 Ga0373925_0163863 Ga0373925_0163863_1087_1647 186
757 3300037312 Ga0395899_0022448 Ga0395899_0022448_4027_4587 186
758 3300037418 Ga0395900_0003229 Ga0395900_0003229_9870_10430 186
759 3300037418 Ga0395900_0081553 Ga0395900_0081553_1420_1980 186
760 3300037418 Ga0395900_0423417 Ga0395900_0423417_266_826 186
761 3300037418 Ga0395900_0646072 Ga0395900_0646072_321_881 186
762 3300037466 Ga0395898_0013011 Ga0395898_0013011_201_761 186
763 3300037466 Ga0395898_0275473 Ga0395898_0275473_386_946 186
764 3300037471 Ga0395905_0013270 Ga0395905_0013270_6135_6695 186
765 3300037471 Ga0395905_0691593 Ga0395905_0691593_121_681 186
766 3300037471 Ga0395905_1186637 Ga0395905_1186637_62_622 186
767 3300037471 Ga0395905_1270881 Ga0395905_1270881_18_578 186
768 3300037853 Ga0436364_0633325 Ga0436364_0633325_589_1149 186
769 3300038443 Ga0395901_0009691 Ga0395901_0009691_3825_4385 186
770 3300038443 Ga0395901_0018727 Ga0395901_0018727_2350_2910 186
771 3300038443 Ga0395901_0240837 Ga0395901_0240837_480_1040 186
772 3300039437 Ga0436365_1218062 Ga0436365_1218062_160_720 186
773 3300039437 Ga0436365_1366941 Ga0436365_1366941_2524_3084 186
774 3300039437 Ga0436365_1440966 Ga0436365_1440966_12477_13037 186
775 3300041496 Ga0451839_1498401 Ga0451839_1498401_240_800 186
776 3300041512 Ga0451853_2598742 Ga0451853_2598742_66_626 186
777 3300041512 Ga0451853_2845883 Ga0451853_2845883_747_1307 186
778 3300042008 Ga0439450_035088 Ga0439450_035088_407_967 186
779 3300042009 Ga0439451_013983 Ga0439451_013983_567_1127 186
780 3300042011 Ga0439454_047137 Ga0439454_047137_95_655 186
781 3300042012 Ga0439455_0000990 Ga0439455_0000990_2125_2685 186
782 3300042993 Ga0439440_0055893 Ga0439440_0055893_51_611 186
783 3300044842 Ga0466957_0008871 Ga0466957_0008871_760_1320 186
784 3300045051 Ga0451576_0081187 Ga0451576_0081187_2705_3265 186
785 3300046454 Ga0495592_0015795 Ga0495592_0015795_1561_2121 186
786 3300046454 Ga0495592_0235248 Ga0495592_0235248_413_973 186
787 3300046461 Ga0495641_0102353 Ga0495641_0102353_515_1075 186
788 3300046462 Ga0495651_0332021 Ga0495651_0332021_104_664 186
789 3300046463 Ga0495653_0285943 Ga0495653_0285943_154_714 186
790 3300046463 Ga0495653_0424291 Ga0495653_0424291_240_800 186
791 3300046472 Ga0495580_0067910 Ga0495580_0067910_1157_1717 186
792 3300046472 Ga0495580_0093599 Ga0495580_0093599_688_1248 186
793 3300046492 Ga0495585_0063921 Ga0495585_0063921_902_1462 186
794 3300046511 Ga0495608_0461492 Ga0495608_0461492_67_627 186
795 3300046514 Ga0495618_0387797 Ga0495618_0387797_285_845 186
796 3300046516 Ga0495628_0017947 Ga0495628_0017947_545_1105 186
797 3300046516 Ga0495628_0254705 Ga0495628_0254705_497_1057 186
798 3300046517 Ga0495630_0203828 Ga0495630_0203828_139_699 186
799 3300046533 Ga0495640_0619142 Ga0495640_0619142_83_643 186
800 3300046535 Ga0495586_0081448 Ga0495586_0081448_939_1499 186
801 3300046536 Ga0495587_0085278 Ga0495587_0085278_573_1133 186
802 3300046537 Ga0495598_0008807 Ga0495598_0008807_507_1067 186
803 3300046537 Ga0495598_0144494 Ga0495598_0144494_79_639 186
804 3300046539 Ga0495621_0094286 Ga0495621_0094286_40_600 186
805 3300046543 Ga0495645_0069614 Ga0495645_0069614_1730_2290 186
806 3300046559 Ga0495667_0078427 Ga0495667_0078427_1458_2018 186
807 3300046642 Ga0495634_0120042 Ga0495634_0120042_34_594 186
808 3300046663 Ga0495635_0061356 Ga0495635_0061356_344_904 186
809 3300046663 Ga0495635_0110478 Ga0495635_0110478_11_571 186
810 3300046664 Ga0495659_0007308 Ga0495659_0007308_345_905 186
811 3300046664 Ga0495659_0079302 Ga0495659_0079302_536_1096 186
812 3300046675 Ga0495657_0151078 Ga0495657_0151078_159_719 186
813 3300046678 Ga0495599_0050381 Ga0495599_0050381_1561_2121 186
814 3300046678 Ga0495599_0096786 Ga0495599_0096786_1200_1760 186
815 3300046680 Ga0495646_0137047 Ga0495646_0137047_777_1337 186
816 3300046684 Ga0495669_0043499 Ga0495669_0043499_1292_1852 186
817 3300046684 Ga0495669_0111669 Ga0495669_0111669_239_799 186
818 3300046684 Ga0495669_0259155 Ga0495669_0259155_25_585 186
819 3300046809 Ga0495600_0608706 Ga0495600_0608706_49_609 186
820 3300047317 Ga0495604_0701632 Ga0495604_0701632_50_610 186
821 3300047319 Ga0495674_0156853 Ga0495674_0156853_1026_1586 186
822 3300047319 Ga0495674_0276404 Ga0495674_0276404_171_731 186
823 3300047444 Ga0495675_0334770 Ga0495675_0334770_34_594 186
824 3300047446 Ga0495679_070148 Ga0495679_070148_293_853 186
825 3300047471 Ga0495684_0011055 Ga0495684_0011055_2922_3482 186
826 3300047471 Ga0495684_0246955 Ga0495684_0246955_311_871 186
827 3300048088 Ga0495602_0048024 Ga0495602_0048024_3104_3664 186
828 3300048088 Ga0495602_0152176 Ga0495602_0152176_410_970 186
829 3300048089 Ga0495614_0228905 Ga0495614_0228905_121_681 186
830 3300048904 Ga0496101_0002348 Ga0496101_0002348_1948_2508 186
831 3300048904 Ga0496101_0367845 Ga0496101_0367845_449_1009 186
832 3300048905 Ga0496102_0058769 Ga0496102_0058769_901_1461 186
833 3300048906 Ga0496103_0031648 Ga0496103_0031648_1553_2113 186
834 3300048906 Ga0496103_0383358 Ga0496103_0383358_45_605 186
835 3300048906 Ga0496103_0545255 Ga0496103_0545255_163_723 186
836 3300048907 Ga0496104_0041736 Ga0496104_0041736_2166_2726 186
837 3300048907 Ga0496104_0101814 Ga0496104_0101814_1008_1568 186
838 3300048907 Ga0496104_0519694 Ga0496104_0519694_483_1043 186
839 3300048908 Ga0496105_0045415 Ga0496105_0045415_2097_2660 186
840 3300048908 Ga0496105_0555296 Ga0496105_0555296_150_710 186
841 3300048908 Ga0496105_0633932 Ga0496105_0633932_215_775 186
842 3300048910 Ga0496107_0015028 Ga0496107_0015028_3645_4205 186
843 3300048910 Ga0496107_0185541 Ga0496107_0185541_235_795 186
844 3300048911 Ga0496108_0013695 Ga0496108_0013695_563_1123 186
845 3300048911 Ga0496108_0024559 Ga0496108_0024559_4310_4870 186
846 3300048911 Ga0496108_0174056 Ga0496108_0174056_86_646 186
847 3300048911 Ga0496108_0255638 Ga0496108_0255638_802_1362 186
848 3300048912 Ga0496109_0006405 Ga0496109_0006405_703_1263 186
849 3300048912 Ga0496109_0020560 Ga0496109_0020560_311_871 186
850 3300048912 Ga0496109_0103310 Ga0496109_0103310_1495_2055 186
851 3300048912 Ga0496109_0145667 Ga0496109_0145667_276_836 186
852 3300048912 Ga0496109_0212548 Ga0496109_0212548_893_1453 186
853 3300048912 Ga0496109_0215034 Ga0496109_0215034_971_1531 186
854 3300048913 Ga0496110_0000261 Ga0496110_0000261_25974_26537 186
855 3300048914 Ga0496111_0000086 Ga0496111_0000086_25269_25832 186
856 3300048914 Ga0496111_0425633 Ga0496111_0425633_84_644 186
857 3300048914 Ga0496111_0585882 Ga0496111_0585882_217_777 186
858 3300048915 Ga0496112_0001268 Ga0496112_0001268_16446_17006 186
859 3300048915 Ga0496112_0007980 Ga0496112_0007980_4844_5404 186
860 3300048915 Ga0496112_0262373 Ga0496112_0262373_214_774 186
861 3300048915 Ga0496112_0269690 Ga0496112_0269690_296_856 186
862 3300048915 Ga0496112_0275236 Ga0496112_0275236_452_1012 186
863 3300048915 Ga0496112_0540839 Ga0496112_0540839_71_631 186
864 3300048916 Ga0496113_0011618 Ga0496113_0011618_892_1452 186
865 3300048916 Ga0496113_0015364 Ga0496113_0015364_4682_5245 186
866 3300048916 Ga0496113_0140688 Ga0496113_0140688_479_1039 186
867 3300048916 Ga0496113_0362641 Ga0496113_0362641_591_1151 186
868 3300048917 Ga0496114_0034784 Ga0496114_0034784_3451_4011 186
869 3300048917 Ga0496114_0156296 Ga0496114_0156296_1140_1700 186
870 3300048918 Ga0496115_0005081 Ga0496115_0005081_4487_5047 186
871 3300048918 Ga0496115_0088251 Ga0496115_0088251_680_1240 186
872 3300048918 Ga0496115_0504942 Ga0496115_0504942_348_908 186
873 3300048928 Ga0496125_0000187 Ga0496125_0000187_119584_120144 186
874 3300049568 Ga0501031_0001565 Ga0501031_0001565_4575_5135 186
875 3300049569 Ga0501032_0039863 Ga0501032_0039863_389_949 186
876 3300049569 Ga0501032_0084887 Ga0501032_0084887_1122_1682 186
877 3300049570 Ga0501033_0000024 Ga0501033_0000024_115413_115973 186
878 3300049573 Ga0501037_0000020 Ga0501037_0000020_27761_28321 186
879 3300049574 Ga0501038_0000212 Ga0501038_0000212_40464_41024 186
880 3300049575 Ga0501039_0010969 Ga0501039_0010969_1304_1864 186
881 3300049579 Ga0501043_0018694 Ga0501043_0018694_3154_3714 186
882 3300049581 Ga0501047_0015893 Ga0501047_0015893_4841_5401 186
883 3300049583 Ga0501067_0015189 Ga0501067_0015189_529_1089 186
884 3300049584 Ga0501068_0579966 Ga0501068_0579966_134_694 186
885 3300049586 Ga0501070_0012473 Ga0501070_0012473_3343_3903 186
886 3300049586 Ga0501070_0140616 Ga0501070_0140616_26_586 186
887 3300049822 Ga0501035_0000216 Ga0501035_0000216_50955_51515 186
888 3300049823 Ga0501044_0000510 Ga0501044_0000510_26363_26923 186
889 3300050489 nmdc:mga03683_12012_c1 nmdc:mga03683_12012_c1_1721_2281 186
890 3300050489 nmdc:mga03683_298_c1 nmdc:mga03683_298_c1_4615_5175 186
891 3300050490 nmdc:mga03n38_103243_c1 nmdc:mga03n38_103243_c1_786_1346 186
892 3300050493 nmdc:mga0k408_2179_c1 nmdc:mga0k408_2179_c1_7517_8077 186
893 3300050493 nmdc:mga0k408_369_c1 nmdc:mga0k408_369_c1_21664_22224 186
894 3300050507 nmdc:mga05p37_17694_c1 nmdc:mga05p37_17694_c1_4321_4881 186
895 3300050507 nmdc:mga05p37_60816_c1 nmdc:mga05p37_60816_c1_3011_3571 186
896 3300050507 nmdc:mga05p37_636652_c1 nmdc:mga05p37_636652_c1_152_712 186
897 3300050511 nmdc:mga08y16_1224870_c1 nmdc:mga08y16_1224870_c1_51_611 186
898 3300050512 nmdc:mga0n895_640514_c1 nmdc:mga0n895_640514_c1_176_736 186
899 3300050512 nmdc:mga0n895_78624_c1 nmdc:mga0n895_78624_c1_184_744 186
900 3300050513 nmdc:mga0rr50_183303_c1 nmdc:mga0rr50_183303_c1_679_1239 186
901 3300050513 nmdc:mga0rr50_234423_c1 nmdc:mga0rr50_234423_c1_867_1427 186
902 3300050514 nmdc:mga08x19_113622_c1 nmdc:mga08x19_113622_c1_1179_1739 186
903 3300050514 nmdc:mga08x19_323226_c1 nmdc:mga08x19_323226_c1_267_827 186
904 3300050514 nmdc:mga08x19_7027_c1 nmdc:mga08x19_7027_c1_1484_2044 186
905 3300050515 nmdc:mga0a205_779767_c1 nmdc:mga0a205_779767_c1_195_755 186
906 3300053077 Ga0495601_0006303 Ga0495601_0006303_539_1099 186
907 3300053077 Ga0495601_0065813 Ga0495601_0065813_229_789 186
908 3300053083 Ga0495655_0025664 Ga0495655_0025664_520_1080 186
909 3300053084 Ga0495595_0248717 Ga0495595_0248717_63_623 186
910 3300053088 Ga0500644_0063868 Ga0500644_0063868_676_1236 186
911 3300053103 Ga0500555_000003 Ga0500555_000003_154535_155095 186
912 3300053103 Ga0500555_000377 Ga0500555_000377_11648_12208 186
913 3300053104 Ga0500556_0000539 Ga0500556_0000539_10718_11278 186
914 3300053130 Ga0500642_0155040 Ga0500642_0155040_233_793 186
915 3300053153 Ga0500616_0080786 Ga0500616_0080786_186_746 186
916 3300053153 Ga0500616_0192024 Ga0500616_0192024_232_792 186

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01765

RRF

Ribosome recycling factor

21

185

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lf9-assembly1.cif.gz_A crystal structure of hiv epitope-scaffold 4e10_d0_1is1a_001_c 0.9541 2 186
6xxv-assembly1.cif.gz_C crystal structure of a computationally designed immunogen s2_1.2 in complex with its elicited antibody c57 0.9311 106 180
2fe1-assembly1.cif.gz_A-2 crystal structure of pae0151 from pyrobaculum aerophilum 0.922 132 163
1y69-assembly1.cif.gz_8 rrf domain i in complex with the 50s ribosomal subunit from deinococcus radiodurans 0.9171 2 186
1y69-assembly1.cif.gz_8 rrf domain i in complex with the 50s ribosomal subunit from deinococcus radiodurans 0.9095 2 186
ID Description Score Start End Superfamily
1iseA01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9872 4 186 1.10.132.20
1dd5A01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.9832 106 186 1.10.132.20
1is1A01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.983 4 186 1.10.132.20
1ek8A01 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;Ribosome-recycling factor 0.973 4 186 1.10.132.20
af_P9WGY1_31_105_3.30.1360.40 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; 0.9707 32 106 3.30.1360.40
ID Description Score Start End GO Terms
AF-F2LTT9-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.9867 1 186 GO:0005737
GO:0006415
GO:0043023
AF-A0A5E6M581-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.9829 1 186 GO:0005737
GO:0006415
GO:0043023
AF-A0A6B3N8D8-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.9825 6 186 GO:0005737
GO:0006415
GO:0043023
AF-A0A6I1ZTX7-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.9816 2 186 GO:0005737
GO:0006415
GO:0043023
AF-F2LTT9-F1-model_v4 Ribosome-recycling factor (RRF) (Ribosome-releasing factor) 0.9814 1 186 GO:0005737
GO:0006415
GO:0043023

Feature Viewer

pLDDT pTM Quality
89.9 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map