F485614
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 916 | 511 | 804 | 103 |
Family's Representative Sequence
| Representative Sequence | 3300006195|Ga0075366_10644579|Ga0075366_106445792 |
| Length | 109 |
| Sequence | MAWGILFVAGLMEIGWAIGLKYTEGFSKLVPSVLTLACMTASVILLGLAVKTLPIGTAYAVWTGIGAVGTAILGMLIFKEPATAMRLVCLALIVAGILGLKLFSPGGGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 4 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 5 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 6 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 7 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 8 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 9 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 10 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 11 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 12 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 13 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 14 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 15 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 16 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 17 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 18 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 19 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 20 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 21 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 22 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 23 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 24 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 25 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 26 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 27 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 28 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 29 | 2791355199 | |||
| 30 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 31 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 32 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 33 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 34 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 35 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 36 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 37 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 38 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 39 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 40 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 41 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 42 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 43 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 44 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 45 | 2904699407 | |||
| 46 | 2906610324 | |||
| 47 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 48 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 49 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 50 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 51 | 2922425934 | |||
| 52 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 53 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 54 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 55 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 56 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 57 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 58 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 59 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 60 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 61 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 62 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 63 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 64 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 65 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 66 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 67 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 68 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 69 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 70 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 71 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 72 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 73 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 74 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 75 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 76 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 77 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 78 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 79 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 80 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 81 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 82 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 83 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 84 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 85 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 86 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 87 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 91 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 92 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 93 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 94 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 96 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 98 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 107 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 117 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 119 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 120 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 122 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 127 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 128 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 130 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 131 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 132 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 133 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 134 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 135 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 136 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 137 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 138 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 139 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 140 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 141 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 142 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 144 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 145 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 146 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 147 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 148 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 149 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 150 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 151 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 152 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 153 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 155 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 156 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 157 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 158 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 159 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 161 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 175 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 176 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 188 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 194 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 195 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 196 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 197 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 199 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 201 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 255 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 256 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 260 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 261 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 262 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 263 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 264 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 265 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 266 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 267 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 268 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 269 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 270 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 271 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 272 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 273 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 274 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 275 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 276 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 277 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 279 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 280 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 281 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 282 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 283 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 284 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 285 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 286 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 287 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 288 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 289 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 290 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 291 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 292 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 293 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 294 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 295 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 296 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 297 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 379 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 380 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 381 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 382 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 383 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 384 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 386 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 387 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 388 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 389 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 390 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 391 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 392 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 393 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 394 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 395 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 396 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 397 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 398 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 428 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 432 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 433 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 434 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 435 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 436 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 437 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 438 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 439 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 440 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 441 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 442 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 443 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 447 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 448 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 449 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 450 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 451 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 452 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 453 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 454 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 455 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 456 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 457 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 458 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 459 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 460 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 461 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 462 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 463 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 464 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 465 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 466 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 467 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 468 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 469 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 470 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 471 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 472 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 473 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 474 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 475 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 476 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 477 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 478 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 479 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 480 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 481 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 482 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 483 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 484 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 485 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 486 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 487 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 488 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 489 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 490 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 491 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 492 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 493 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 494 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 495 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 496 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 497 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 498 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 499 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 500 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 501 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 502 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 503 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 504 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 505 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 506 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 507 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 508 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 509 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 510 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 511 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.16 |
| Metatranscriptomes | 0 |
| Isolates | 11.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.86 |
| Nodule | 9.28 |
| Rhizoplane | 3.93 |
| Rhizosphere | 65.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24742J22300_10056159 | 3300002244 | Bacteria | 719 |
| 2 | JGI25150J39212_1004568 | 3300002774 | Bacteria | 3059 |
| 3 | JGI25151J46595_10032278 | 3300003187 | Bacteria | 2032 |
| 4 | rootH2_10061177 | 3300003320 | Bacteria | 2028 |
| 5 | rootH1_10104268 | 3300003323 | Bacteria | 2358 |
| 6 | Ga0070658_10136463 | 3300005327 | Bacteria | 2047 |
| 7 | Ga0070658_11837011 | 3300005327 | Bacteria | 524 |
| 8 | Ga0070676_11540057 | 3300005328 | Bacteria | 513 |
| 9 | Ga0070670_101010124 | 3300005331 | Bacteria | 757 |
| 10 | Ga0068869_100660198 | 3300005334 | Bacteria | 888 |
| 11 | Ga0070680_100904352 | 3300005336 | Bacteria | 761 |
| 12 | Ga0070682_100395399 | 3300005337 | Bacteria | 1044 |
| 13 | Ga0070682_100510009 | 3300005337 | Bacteria | 934 |
| 14 | Ga0070682_101581953 | 3300005337 | Bacteria | 566 |
| 15 | Ga0068868_101538427 | 3300005338 | Bacteria | 624 |
| 16 | Ga0070660_100063644 | 3300005339 | Bacteria | 2867 |
| 17 | Ga0070660_100119385 | 3300005339 | Bacteria | 2103 |
| 18 | Ga0070660_100681149 | 3300005339 | Bacteria | 862 |
| 19 | Ga0070689_100441180 | 3300005340 | Bacteria | 1106 |
| 20 | Ga0070689_100893347 | 3300005340 | Bacteria | 786 |
| 21 | Ga0070689_101167600 | 3300005340 | Bacteria | 690 |
| 22 | Ga0070691_10260330 | 3300005341 | Bacteria | 934 |
| 23 | Ga0070687_100032178 | 3300005343 | Bacteria | 2578 |
| 24 | Ga0070661_100402284 | 3300005344 | Bacteria | 1083 |
| 25 | Ga0070661_100795548 | 3300005344 | Bacteria | 776 |
| 26 | Ga0070661_101892819 | 3300005344 | Bacteria | 507 |
| 27 | Ga0070692_10198421 | 3300005345 | Bacteria | 1174 |
| 28 | Ga0070668_100085455 | 3300005347 | Bacteria | 2479 |
| 29 | Ga0070668_100159129 | 3300005347 | Bacteria | 1831 |
| 30 | Ga0070668_100445378 | 3300005347 | Bacteria | 1112 |
| 31 | Ga0070668_100493870 | 3300005347 | Bacteria | 1058 |
| 32 | Ga0070669_100410377 | 3300005353 | Bacteria | 1110 |
| 33 | Ga0070669_101177780 | 3300005353 | Bacteria | 661 |
| 34 | Ga0070669_101683811 | 3300005353 | Bacteria | 553 |
| 35 | Ga0070675_100126736 | 3300005354 | Bacteria | 2172 |
| 36 | Ga0070671_100760213 | 3300005355 | Bacteria | 843 |
| 37 | Ga0070674_100229913 | 3300005356 | Bacteria | 1447 |
| 38 | Ga0070674_100239610 | 3300005356 | Bacteria | 1419 |
| 39 | Ga0070674_100618044 | 3300005356 | Bacteria | 918 |
| 40 | Ga0070673_100092112 | 3300005364 | Bacteria | 2479 |
| 41 | Ga0070673_102324819 | 3300005364 | Bacteria | 509 |
| 42 | Ga0070688_100253166 | 3300005365 | Bacteria | 1255 |
| 43 | Ga0070659_100283117 | 3300005366 | Bacteria | 1379 |
| 44 | Ga0070659_101128352 | 3300005366 | Bacteria | 692 |
| 45 | Ga0070667_100138172 | 3300005367 | Bacteria | 2132 |
| 46 | Ga0070667_100538464 | 3300005367 | Bacteria | 1072 |
| 47 | Ga0070714_100215391 | 3300005435 | Bacteria | 1763 |
| 48 | Ga0070701_10529756 | 3300005438 | Bacteria | 769 |
| 49 | Ga0070711_101261078 | 3300005439 | Bacteria | 640 |
| 50 | Ga0070700_101063977 | 3300005441 | Bacteria | 669 |
| 51 | Ga0070663_100141798 | 3300005455 | Bacteria | 1835 |
| 52 | Ga0070663_100412886 | 3300005455 | Bacteria | 1106 |
| 53 | Ga0070663_100631601 | 3300005455 | Bacteria | 904 |
| 54 | Ga0070663_100970268 | 3300005455 | Bacteria | 737 |
| 55 | Ga0070663_101291933 | 3300005455 | Bacteria | 644 |
| 56 | Ga0070678_100412271 | 3300005456 | Bacteria | 1176 |
| 57 | Ga0070678_100895892 | 3300005456 | Bacteria | 811 |
| 58 | Ga0070678_101119005 | 3300005456 | Bacteria | 728 |
| 59 | Ga0070662_100242347 | 3300005457 | Bacteria | 1446 |
| 60 | Ga0068867_100144536 | 3300005459 | Bacteria | 1862 |
| 61 | Ga0068867_100182446 | 3300005459 | Bacteria | 1669 |
| 62 | Ga0068867_100642876 | 3300005459 | Bacteria | 930 |
| 63 | Ga0070699_102118125 | 3300005518 | Bacteria | 514 |
| 64 | Ga0070684_100009651 | 3300005535 | Bacteria | 7610 |
| 65 | Ga0070684_102165089 | 3300005535 | Bacteria | 525 |
| 66 | Ga0068853_100648677 | 3300005539 | Bacteria | 1005 |
| 67 | Ga0068853_100676096 | 3300005539 | Bacteria | 984 |
| 68 | Ga0068853_101276634 | 3300005539 | Bacteria | 709 |
| 69 | Ga0070672_100182223 | 3300005543 | Bacteria | 1750 |
| 70 | Ga0070686_100251596 | 3300005544 | Bacteria | 1291 |
| 71 | Ga0070686_100994014 | 3300005544 | Bacteria | 688 |
| 72 | Ga0070696_101031132 | 3300005546 | Bacteria | 689 |
| 73 | Ga0070693_100098089 | 3300005547 | Bacteria | 1780 |
| 74 | Ga0070693_100241639 | 3300005547 | Bacteria | 1193 |
| 75 | Ga0070665_100054664 | 3300005548 | Bacteria | 4004 |
| 76 | Ga0070665_100430766 | 3300005548 | Bacteria | 1328 |
| 77 | Ga0070665_100449901 | 3300005548 | Bacteria | 1297 |
| 78 | Ga0070665_100637708 | 3300005548 | Bacteria | 1078 |
| 79 | Ga0070665_101042886 | 3300005548 | Bacteria | 830 |
| 80 | Ga0070665_101112075 | 3300005548 | Bacteria | 802 |
| 81 | Ga0070665_101455999 | 3300005548 | Bacteria | 694 |
| 82 | Ga0070664_100160106 | 3300005564 | Bacteria | 1991 |
| 83 | Ga0068857_100094952 | 3300005577 | Bacteria | 2670 |
| 84 | Ga0068857_101155552 | 3300005577 | Bacteria | 749 |
| 85 | Ga0068854_100725574 | 3300005578 | Bacteria | 860 |
| 86 | Ga0068854_100767556 | 3300005578 | Bacteria | 838 |
| 87 | Ga0070702_100133682 | 3300005615 | Bacteria | 1570 |
| 88 | Ga0070702_100424572 | 3300005615 | Bacteria | 958 |
| 89 | Ga0070702_100953772 | 3300005615 | Bacteria | 676 |
| 90 | Ga0068852_100606191 | 3300005616 | Bacteria | 1100 |
| 91 | Ga0068852_101153310 | 3300005616 | Bacteria | 796 |
| 92 | Ga0068859_101877552 | 3300005617 | Bacteria | 661 |
| 93 | Ga0068864_100117769 | 3300005618 | Bacteria | 2371 |
| 94 | Ga0068864_100812271 | 3300005618 | Bacteria | 920 |
| 95 | Ga0068866_10530964 | 3300005718 | Bacteria | 783 |
| 96 | Ga0068866_10587354 | 3300005718 | Bacteria | 750 |
| 97 | Ga0068861_100026842 | 3300005719 | Bacteria | 4190 |
| 98 | Ga0068861_100043262 | 3300005719 | Bacteria | 3379 |
| 99 | Ga0068861_101679600 | 3300005719 | Bacteria | 627 |
| 100 | Ga0068870_10266369 | 3300005840 | Bacteria | 1068 |
| 101 | Ga0068863_100452979 | 3300005841 | Bacteria | 1259 |
| 102 | Ga0068863_101281329 | 3300005841 | Bacteria | 740 |
| 103 | Ga0068863_101405916 | 3300005841 | Bacteria | 705 |
| 104 | Ga0068858_100167543 | 3300005842 | Bacteria | 2071 |
| 105 | Ga0068858_100990254 | 3300005842 | Bacteria | 824 |
| 106 | Ga0068858_101083150 | 3300005842 | Bacteria | 786 |
| 107 | Ga0068860_100097783 | 3300005843 | Bacteria | 2799 |
| 108 | Ga0068860_100712905 | 3300005843 | Bacteria | 1013 |
| 109 | Ga0068860_101843462 | 3300005843 | Bacteria | 626 |
| 110 | Ga0068862_100229211 | 3300005844 | Bacteria | 1685 |
| 111 | Ga0068862_100895960 | 3300005844 | Bacteria | 872 |
| 112 | Ga0081538_10146460 | 3300005981 | Bacteria | 1078 |
| 113 | Ga0081540_1000979 | 3300005983 | Bacteria | 25757 |
| 114 | Ga0081540_1002120 | 3300005983 | Bacteria | 16520 |
| 115 | Ga0081540_1016464 | 3300005983 | Bacteria | 4624 |
| 116 | Ga0081540_1062415 | 3300005983 | Bacteria | 1770 |
| 117 | Ga0081540_1086805 | 3300005983 | Bacteria | 1389 |
| 118 | Ga0081540_1154399 | 3300005983 | Bacteria | 900 |
| 119 | Ga0081539_10355003 | 3300005985 | Bacteria | 615 |
| 120 | Ga0070717_11701812 | 3300006028 | Bacteria | 571 |
| 121 | Ga0075365_10008619 | 3300006038 | Bacteria | 5806 |
| 122 | Ga0075365_10040202 | 3300006038 | Bacteria | 3049 |
| 123 | Ga0075365_10367933 | 3300006038 | Bacteria | 1014 |
| 124 | Ga0075365_10589218 | 3300006038 | Bacteria | 786 |
| 125 | Ga0075365_10654827 | 3300006038 | Bacteria | 742 |
| 126 | Ga0075365_10693248 | 3300006038 | Bacteria | 720 |
| 127 | Ga0075368_10091715 | 3300006042 | Bacteria | 1243 |
| 128 | Ga0075368_10323246 | 3300006042 | Bacteria | 668 |
| 129 | Ga0075363_100206140 | 3300006048 | Bacteria | 1124 |
| 130 | Ga0075363_100346176 | 3300006048 | Bacteria | 867 |
| 131 | Ga0075363_100393687 | 3300006048 | Bacteria | 813 |
| 132 | Ga0075363_100801811 | 3300006048 | Bacteria | 573 |
| 133 | Ga0075364_10051506 | 3300006051 | Bacteria | 2689 |
| 134 | Ga0075364_10670220 | 3300006051 | Bacteria | 708 |
| 135 | Ga0075364_10754760 | 3300006051 | Bacteria | 664 |
| 136 | Ga0070716_100073021 | 3300006173 | Bacteria | 2022 |
| 137 | Ga0070712_100170191 | 3300006175 | Bacteria | 1690 |
| 138 | Ga0075362_10307383 | 3300006177 | Bacteria | 788 |
| 139 | Ga0075367_10118707 | 3300006178 | Bacteria | 1628 |
| 140 | Ga0075367_10421078 | 3300006178 | Bacteria | 845 |
| 141 | Ga0075367_10689867 | 3300006178 | Bacteria | 649 |
| 142 | Ga0075369_10044595 | 3300006186 | Bacteria | 1905 |
| 143 | Ga0075369_10124306 | 3300006186 | Bacteria | 1169 |
| 144 | Ga0075369_10466375 | 3300006186 | Bacteria | 599 |
| 145 | Ga0075366_10117831 | 3300006195 | Bacteria | 1599 |
| 146 | Ga0075366_10261934 | 3300006195 | Bacteria | 1055 |
| 147 | Ga0075366_10267189 | 3300006195 | Bacteria | 1044 |
| 148 | Ga0075366_10459588 | 3300006195 | Bacteria | 786 |
| 149 | Ga0075366_10644579 | 3300006195 | Bacteria | 657 |
| 150 | Ga0075366_10717995 | 3300006195 | Bacteria | 621 |
| 151 | Ga0097621_100135878 | 3300006237 | Bacteria | 2097 |
| 152 | Ga0097621_100738133 | 3300006237 | Bacteria | 909 |
| 153 | Ga0075370_10348549 | 3300006353 | Bacteria | 884 |
| 154 | Ga0068871_100105154 | 3300006358 | Bacteria | 2368 |
| 155 | Ga0068871_100708175 | 3300006358 | Bacteria | 923 |
| 156 | Ga0068871_100821995 | 3300006358 | Bacteria | 857 |
| 157 | Ga0068871_101501112 | 3300006358 | Bacteria | 637 |
| 158 | Ga0068871_101791650 | 3300006358 | Bacteria | 583 |
| 159 | Ga0075428_100195180 | 3300006844 | Bacteria | 2189 |
| 160 | Ga0075428_100811114 | 3300006844 | Bacteria | 994 |
| 161 | Ga0075434_100360265 | 3300006871 | Bacteria | 1475 |
| 162 | Ga0068865_100040566 | 3300006881 | Bacteria | 3164 |
| 163 | Ga0068865_100897288 | 3300006881 | Bacteria | 771 |
| 164 | Ga0097620_101877645 | 3300006931 | Bacteria | 661 |
| 165 | Ga0075435_102056085 | 3300007076 | Bacteria | 502 |
| 166 | Ga0105250_10223894 | 3300009092 | Bacteria | 798 |
| 167 | Ga0111539_10097484 | 3300009094 | Bacteria | 3454 |
| 168 | Ga0111539_11381532 | 3300009094 | Bacteria | 817 |
| 169 | Ga0105245_10188809 | 3300009098 | Bacteria | 1973 |
| 170 | Ga0105245_10910148 | 3300009098 | Bacteria | 921 |
| 171 | Ga0105245_11232222 | 3300009098 | Bacteria | 796 |
| 172 | Ga0105247_10488649 | 3300009101 | Bacteria | 895 |
| 173 | Ga0105247_10794454 | 3300009101 | Bacteria | 721 |
| 174 | Ga0114129_10053995 | 3300009147 | Bacteria | 5635 |
| 175 | Ga0114129_10348949 | 3300009147 | Bacteria | 1961 |
| 176 | Ga0105243_10103459 | 3300009148 | Bacteria | 2368 |
| 177 | Ga0105243_11721683 | 3300009148 | Bacteria | 656 |
| 178 | Ga0105241_10175477 | 3300009174 | Bacteria | 1773 |
| 179 | Ga0105241_11352439 | 3300009174 | Bacteria | 680 |
| 180 | Ga0105242_10385103 | 3300009176 | Bacteria | 1305 |
| 181 | Ga0105242_13027976 | 3300009176 | Bacteria | 520 |
| 182 | Ga0105248_10296766 | 3300009177 | Bacteria | 1820 |
| 183 | Ga0105248_10419139 | 3300009177 | Bacteria | 1508 |
| 184 | Ga0105237_10438266 | 3300009545 | Bacteria | 1312 |
| 185 | Ga0105238_10485112 | 3300009551 | Bacteria | 1236 |
| 186 | Ga0105238_10801412 | 3300009551 | Bacteria | 957 |
| 187 | Ga0105238_10833253 | 3300009551 | Bacteria | 939 |
| 188 | Ga0105238_11128934 | 3300009551 | Bacteria | 807 |
| 189 | Ga0105249_10253063 | 3300009553 | Bacteria | 1747 |
| 190 | Ga0105239_10229598 | 3300010375 | Bacteria | 2082 |
| 191 | Ga0105239_11342977 | 3300010375 | Bacteria | 825 |
| 192 | Ga0105239_12590213 | 3300010375 | Bacteria | 591 |
| 193 | Ga0157314_1009460 | 3300012500 | Bacteria | 824 |
| 194 | Ga0157326_1068441 | 3300012513 | Bacteria | 558 |
| 195 | Ga0157373_10601031 | 3300013100 | Bacteria | 801 |
| 196 | Ga0157371_10303289 | 3300013102 | Bacteria | 1156 |
| 197 | Ga0157370_10223111 | 3300013104 | Bacteria | 1745 |
| 198 | Ga0157370_10632446 | 3300013104 | Bacteria | 979 |
| 199 | Ga0157370_11054509 | 3300013104 | Bacteria | 735 |
| 200 | Ga0157369_10236078 | 3300013105 | Bacteria | 1910 |
| 201 | Ga0157369_10528714 | 3300013105 | Bacteria | 1220 |
| 202 | Ga0157374_10718941 | 3300013296 | Bacteria | 1012 |
| 203 | Ga0157374_12005856 | 3300013296 | Bacteria | 605 |
| 204 | Ga0157374_12380889 | 3300013296 | Bacteria | 557 |
| 205 | Ga0157378_10151967 | 3300013297 | Bacteria | 2158 |
| 206 | Ga0157378_11267419 | 3300013297 | Bacteria | 778 |
| 207 | Ga0163162_10626212 | 3300013306 | Bacteria | 1201 |
| 208 | Ga0163162_10935187 | 3300013306 | Bacteria | 979 |
| 209 | Ga0163162_12937819 | 3300013306 | Bacteria | 548 |
| 210 | Ga0157372_10426876 | 3300013307 | Bacteria | 1545 |
| 211 | Ga0157372_11561266 | 3300013307 | Bacteria | 760 |
| 212 | Ga0157372_11570932 | 3300013307 | Bacteria | 757 |
| 213 | Ga0157375_10134785 | 3300013308 | Bacteria | 2592 |
| 214 | Ga0157375_10425717 | 3300013308 | Bacteria | 1493 |
| 215 | Ga0157375_11085267 | 3300013308 | Bacteria | 937 |
| 216 | Ga0157375_11655899 | 3300013308 | Bacteria | 757 |
| 217 | Ga0157375_12210842 | 3300013308 | Bacteria | 655 |
| 218 | Ga0163163_11335015 | 3300014325 | Bacteria | 779 |
| 219 | Ga0163163_11997197 | 3300014325 | Bacteria | 640 |
| 220 | Ga0163163_12046122 | 3300014325 | Bacteria | 632 |
| 221 | Ga0157380_10095986 | 3300014326 | Bacteria | 2457 |
| 222 | Ga0182008_10224458 | 3300014497 | Bacteria | 962 |
| 223 | Ga0182008_10313625 | 3300014497 | Bacteria | 824 |
| 224 | Ga0157377_10541486 | 3300014745 | Bacteria | 821 |
| 225 | Ga0157379_10855542 | 3300014968 | Bacteria | 861 |
| 226 | Ga0157379_11152761 | 3300014968 | Bacteria | 744 |
| 227 | Ga0157376_10362954 | 3300014969 | Bacteria | 1390 |
| 228 | Ga0163161_10007714 | 3300017792 | Bacteria | 7444 |
| 229 | Ga0163161_10478393 | 3300017792 | Bacteria | 1011 |
| 230 | Ga0163161_12033858 | 3300017792 | Bacteria | 511 |
| 231 | Ga0163161_12102111 | 3300017792 | Bacteria | 502 |
| 232 | Ga0209436_100001 | 3300025208 | Bacteria | 304543 |
| 233 | Ga0207425_1014439 | 3300025245 | Bacteria | 1793 |
| 234 | Ga0209646_1007456 | 3300025246 | Bacteria | 1788 |
| 235 | Ga0209129_1000750 | 3300025258 | Bacteria | 20640 |
| 236 | Ga0209129_1002899 | 3300025258 | Bacteria | 7881 |
| 237 | Ga0209129_1003789 | 3300025258 | Bacteria | 6345 |
| 238 | Ga0209673_1003813 | 3300025273 | Bacteria | 8545 |
| 239 | Ga0209130_1000004 | 3300025284 | Bacteria | 633436 |
| 240 | Ga0209564_1000566 | 3300025295 | Bacteria | 58647 |
| 241 | Ga0209758_1000468 | 3300025297 | Bacteria | 66625 |
| 242 | Ga0209758_1000977 | 3300025297 | Bacteria | 38489 |
| 243 | Ga0209758_1002398 | 3300025297 | Bacteria | 19243 |
| 244 | Ga0209256_1004862 | 3300025299 | Bacteria | 8115 |
| 245 | Ga0207426_1000003 | 3300025302 | Bacteria | 1063212 |
| 246 | Ga0207426_1058031 | 3300025302 | Bacteria | 1125 |
| 247 | Ga0209051_1017453 | 3300025303 | Bacteria | 3206 |
| 248 | Ga0209257_1056832 | 3300025304 | Bacteria | 1079 |
| 249 | Ga0207697_10102845 | 3300025315 | Bacteria | 1219 |
| 250 | Ga0207697_10260049 | 3300025315 | Bacteria | 768 |
| 251 | Ga0207682_10161166 | 3300025893 | Bacteria | 1016 |
| 252 | Ga0207692_10304648 | 3300025898 | Bacteria | 971 |
| 253 | Ga0207642_10063551 | 3300025899 | Bacteria | 1727 |
| 254 | Ga0207642_10259927 | 3300025899 | Bacteria | 989 |
| 255 | Ga0207688_10043066 | 3300025901 | Bacteria | 2513 |
| 256 | Ga0207688_10431903 | 3300025901 | Bacteria | 819 |
| 257 | Ga0207647_10412067 | 3300025904 | Bacteria | 760 |
| 258 | Ga0207685_10444280 | 3300025905 | Bacteria | 673 |
| 259 | Ga0207645_10233471 | 3300025907 | Bacteria | 1214 |
| 260 | Ga0207705_10711821 | 3300025909 | Bacteria | 780 |
| 261 | Ga0207705_11254552 | 3300025909 | Bacteria | 567 |
| 262 | Ga0207654_10076776 | 3300025911 | Bacteria | 2001 |
| 263 | Ga0207654_10788706 | 3300025911 | Bacteria | 686 |
| 264 | Ga0207654_11119893 | 3300025911 | Bacteria | 573 |
| 265 | Ga0207707_10019379 | 3300025912 | Bacteria | 5938 |
| 266 | Ga0207671_10149205 | 3300025914 | Bacteria | 1806 |
| 267 | Ga0207671_10822285 | 3300025914 | Bacteria | 736 |
| 268 | Ga0207693_10032462 | 3300025915 | Bacteria | 4121 |
| 269 | Ga0207660_10416470 | 3300025917 | Bacteria | 1083 |
| 270 | Ga0207662_10306896 | 3300025918 | Bacteria | 1056 |
| 271 | Ga0207657_10051847 | 3300025919 | Bacteria | 3565 |
| 272 | Ga0207657_10326391 | 3300025919 | Bacteria | 1213 |
| 273 | Ga0207657_10362697 | 3300025919 | Bacteria | 1142 |
| 274 | Ga0207649_10162924 | 3300025920 | Bacteria | 1547 |
| 275 | Ga0207649_10177366 | 3300025920 | Bacteria | 1489 |
| 276 | Ga0207652_10210138 | 3300025921 | Bacteria | 1752 |
| 277 | Ga0207694_10372510 | 3300025924 | Bacteria | 1184 |
| 278 | Ga0207694_10504134 | 3300025924 | Bacteria | 1014 |
| 279 | Ga0207694_10534288 | 3300025924 | Bacteria | 983 |
| 280 | Ga0207694_11106399 | 3300025924 | Bacteria | 670 |
| 281 | Ga0207650_10348073 | 3300025925 | Bacteria | 1218 |
| 282 | Ga0207650_10435607 | 3300025925 | Bacteria | 1089 |
| 283 | Ga0207650_11531618 | 3300025925 | Bacteria | 566 |
| 284 | Ga0207687_10116148 | 3300025927 | Bacteria | 1994 |
| 285 | Ga0207687_10768177 | 3300025927 | Bacteria | 821 |
| 286 | Ga0207690_10063181 | 3300025932 | Bacteria | 2524 |
| 287 | Ga0207690_10418464 | 3300025932 | Bacteria | 1072 |
| 288 | Ga0207706_10071719 | 3300025933 | Bacteria | 3047 |
| 289 | Ga0207706_10344325 | 3300025933 | Bacteria | 1296 |
| 290 | Ga0207706_10872649 | 3300025933 | Bacteria | 761 |
| 291 | Ga0207709_10054475 | 3300025935 | Bacteria | 2467 |
| 292 | Ga0207709_11817843 | 3300025935 | Bacteria | 507 |
| 293 | Ga0207709_11824144 | 3300025935 | Bacteria | 506 |
| 294 | Ga0207670_10390914 | 3300025936 | Bacteria | 1110 |
| 295 | Ga0207670_11415565 | 3300025936 | Bacteria | 590 |
| 296 | Ga0207669_10075249 | 3300025937 | Bacteria | 2138 |
| 297 | Ga0207669_10324539 | 3300025937 | Bacteria | 1180 |
| 298 | Ga0207669_11205343 | 3300025937 | Bacteria | 641 |
| 299 | Ga0207704_11733015 | 3300025938 | Bacteria | 537 |
| 300 | Ga0207665_10054296 | 3300025939 | Bacteria | 2701 |
| 301 | Ga0207691_10109172 | 3300025940 | Bacteria | 2461 |
| 302 | Ga0207691_10670634 | 3300025940 | Bacteria | 875 |
| 303 | Ga0207711_10025904 | 3300025941 | Bacteria | 4919 |
| 304 | Ga0207711_10057138 | 3300025941 | Bacteria | 3354 |
| 305 | Ga0207689_10980980 | 3300025942 | Bacteria | 713 |
| 306 | Ga0207661_10036554 | 3300025944 | Bacteria | 3834 |
| 307 | Ga0207679_10714646 | 3300025945 | Bacteria | 910 |
| 308 | Ga0207651_10101766 | 3300025960 | Bacteria | 2134 |
| 309 | Ga0207651_10317379 | 3300025960 | Bacteria | 1301 |
| 310 | Ga0207712_10115895 | 3300025961 | Bacteria | 2018 |
| 311 | Ga0207668_10083578 | 3300025972 | Bacteria | 2323 |
| 312 | Ga0207668_10576758 | 3300025972 | Bacteria | 977 |
| 313 | Ga0207668_10749525 | 3300025972 | Bacteria | 861 |
| 314 | Ga0207668_10952966 | 3300025972 | Bacteria | 765 |
| 315 | Ga0207640_11989356 | 3300025981 | Bacteria | 526 |
| 316 | Ga0207658_10665562 | 3300025986 | Bacteria | 939 |
| 317 | Ga0207658_10815411 | 3300025986 | Bacteria | 848 |
| 318 | Ga0207658_10919048 | 3300025986 | Bacteria | 797 |
| 319 | Ga0207677_10845390 | 3300026023 | Bacteria | 822 |
| 320 | Ga0207677_12003421 | 3300026023 | Bacteria | 538 |
| 321 | Ga0207703_10054622 | 3300026035 | Bacteria | 3249 |
| 322 | Ga0207703_10187420 | 3300026035 | Bacteria | 1830 |
| 323 | Ga0207703_10354760 | 3300026035 | Bacteria | 1351 |
| 324 | Ga0207703_10636086 | 3300026035 | Bacteria | 1011 |
| 325 | Ga0207678_10019138 | 3300026067 | Bacteria | 6011 |
| 326 | Ga0207678_10258769 | 3300026067 | Bacteria | 1491 |
| 327 | Ga0207678_10301805 | 3300026067 | Bacteria | 1376 |
| 328 | Ga0207678_10353675 | 3300026067 | Bacteria | 1267 |
| 329 | Ga0207678_11384972 | 3300026067 | Bacteria | 622 |
| 330 | Ga0207678_11543787 | 3300026067 | Bacteria | 586 |
| 331 | Ga0207708_10242601 | 3300026075 | Bacteria | 1450 |
| 332 | Ga0207708_10245582 | 3300026075 | Bacteria | 1441 |
| 333 | Ga0207708_10578217 | 3300026075 | Bacteria | 950 |
| 334 | Ga0207702_10048792 | 3300026078 | Bacteria | 3571 |
| 335 | Ga0207702_10446278 | 3300026078 | Bacteria | 1254 |
| 336 | Ga0207641_10218805 | 3300026088 | Bacteria | 1765 |
| 337 | Ga0207641_11883783 | 3300026088 | Bacteria | 600 |
| 338 | Ga0207648_10221230 | 3300026089 | Bacteria | 1683 |
| 339 | Ga0207648_10245979 | 3300026089 | Bacteria | 1594 |
| 340 | Ga0207648_10635668 | 3300026089 | Bacteria | 986 |
| 341 | Ga0207676_10101932 | 3300026095 | Bacteria | 2381 |
| 342 | Ga0207674_10562356 | 3300026116 | Bacteria | 1102 |
| 343 | Ga0207674_10612509 | 3300026116 | Bacteria | 1052 |
| 344 | Ga0207675_100016940 | 3300026118 | Bacteria | 6810 |
| 345 | Ga0207675_102261919 | 3300026118 | Bacteria | 558 |
| 346 | Ga0207683_10164919 | 3300026121 | Bacteria | 2004 |
| 347 | Ga0207683_10252968 | 3300026121 | Bacteria | 1608 |
| 348 | Ga0207683_10727754 | 3300026121 | Bacteria | 920 |
| 349 | Ga0207683_10839005 | 3300026121 | Bacteria | 853 |
| 350 | Ga0207683_11952133 | 3300026121 | Bacteria | 535 |
| 351 | Ga0207698_10156543 | 3300026142 | Bacteria | 1986 |
| 352 | Ga0207698_10500187 | 3300026142 | Bacteria | 1183 |
| 353 | Ga0209813_10101472 | 3300027866 | Bacteria | 980 |
| 354 | Ga0209813_10111513 | 3300027866 | Bacteria | 943 |
| 355 | Ga0207428_10387327 | 3300027907 | Bacteria | 1025 |
| 356 | Ga0268266_10003390 | 3300028379 | Bacteria | 15951 |
| 357 | Ga0268266_10074725 | 3300028379 | Bacteria | 2943 |
| 358 | Ga0268266_10121010 | 3300028379 | Bacteria | 2329 |
| 359 | Ga0268266_10374299 | 3300028379 | Bacteria | 1342 |
| 360 | Ga0268266_10514936 | 3300028379 | Bacteria | 1143 |
| 361 | Ga0268266_10764908 | 3300028379 | Bacteria | 932 |
| 362 | Ga0268266_11468938 | 3300028379 | Bacteria | 657 |
| 363 | Ga0268266_11945621 | 3300028379 | Bacteria | 562 |
| 364 | Ga0268265_10044700 | 3300028380 | Bacteria | 3300 |
| 365 | Ga0268265_10662773 | 3300028380 | Bacteria | 1004 |
| 366 | Ga0268265_10724805 | 3300028380 | Bacteria | 963 |
| 367 | Ga0268265_12255301 | 3300028380 | Bacteria | 551 |
| 368 | Ga0268264_10065341 | 3300028381 | Bacteria | 3065 |
| 369 | Ga0268264_10927143 | 3300028381 | Bacteria | 875 |
| 370 | Ga0268264_11107421 | 3300028381 | Bacteria | 800 |
| 371 | Ga0307515_10001393 | 3300028794 | Bacteria | 54715 |
| 372 | Ga0307515_10021427 | 3300028794 | Bacteria | 11463 |
| 373 | Ga0307513_10011737 | 3300031456 | Bacteria | 10864 |
| 374 | Ga0307508_10031547 | 3300031616 | Bacteria | 4790 |
| 375 | Ga0307508_10245074 | 3300031616 | Bacteria | 1389 |
| 376 | Ga0307516_10448431 | 3300031730 | Bacteria | 947 |
| 377 | Ga0307415_100701851 | 3300032126 | Bacteria | 913 |
| 378 | Ga0307510_10078712 | 3300033180 | Bacteria | 3222 |
| 379 | Ga0315911_1000006 | 3300033442 | Bacteria | 414563 |
| 380 | Ga0373950_0133437 | 3300034818 | Bacteria | 557 |
| 381 | Ga0373943_0182569 | 3300035170 | Bacteria | 1154 |
| 382 | Ga0373935_0209912 | 3300035692 | Bacteria | 1349 |
| 383 | Ga0373947_0059831 | 3300035725 | Bacteria | 2311 |
| 384 | Ga0373947_0752927 | 3300035725 | Bacteria | 665 |
| 385 | Ga0373925_0299820 | 3300037068 | Bacteria | 1297 |
| 386 | Ga0373925_1169365 | 3300037068 | Bacteria | 632 |
| 387 | Ga0395899_0056456 | 3300037312 | Bacteria | 2902 |
| 388 | Ga0395900_0012534 | 3300037418 | Bacteria | 8673 |
| 389 | Ga0395900_0076909 | 3300037418 | Bacteria | 3429 |
| 390 | Ga0395898_0025456 | 3300037466 | Bacteria | 5962 |
| 391 | Ga0395898_0030570 | 3300037466 | Bacteria | 5389 |
| 392 | Ga0395905_0002553 | 3300037471 | Bacteria | 20072 |
| 393 | Ga0395901_0028377 | 3300038443 | Bacteria | 5754 |
| 394 | Ga0439465_0079791 | 3300041413 | Bacteria | 1108 |
| 395 | Ga0439465_0208685 | 3300041413 | Bacteria | 713 |
| 396 | Ga0439465_0360995 | 3300041413 | Bacteria | 550 |
| 397 | Ga0451789_0589456 | 3300041443 | Bacteria | 711 |
| 398 | Ga0451791_0313286 | 3300041451 | Bacteria | 1074 |
| 399 | Ga0451797_0174660 | 3300041453 | Bacteria | 673 |
| 400 | Ga0451797_0692193 | 3300041453 | Bacteria | 802 |
| 401 | Ga0451797_1503990 | 3300041453 | Bacteria | 682 |
| 402 | Ga0451798_0348921 | 3300041458 | Bacteria | 651 |
| 403 | Ga0451800_0241826 | 3300041459 | Bacteria | 603 |
| 404 | Ga0451800_0935838 | 3300041459 | Bacteria | 757 |
| 405 | Ga0451804_0084282 | 3300041463 | Bacteria | 581 |
| 406 | Ga0451807_1711485 | 3300041486 | Bacteria | 642 |
| 407 | Ga0451839_0403398 | 3300041496 | Bacteria | 662 |
| 408 | Ga0451845_0035050 | 3300041501 | Bacteria | 707 |
| 409 | Ga0451847_0253765 | 3300041503 | Bacteria | 556 |
| 410 | Ga0451849_1402645 | 3300041505 | Bacteria | 1337 |
| 411 | Ga0451851_0518039 | 3300041507 | Bacteria | 658 |
| 412 | Ga0451853_3398724 | 3300041512 | Bacteria | 578 |
| 413 | Ga0439446_0269951 | 3300042156 | Bacteria | 591 |
| 414 | Ga0466966_0034096 | 3300044684 | Bacteria | 3294 |
| 415 | Ga0466966_0146212 | 3300044684 | Bacteria | 1443 |
| 416 | Ga0466963_0259700 | 3300044694 | Bacteria | 1219 |
| 417 | Ga0466971_0129724 | 3300044719 | Bacteria | 1170 |
| 418 | Ga0466970_0028377 | 3300044765 | Bacteria | 2939 |
| 419 | Ga0466959_0072284 | 3300045049 | Bacteria | 2497 |
| 420 | Ga0466959_1038728 | 3300045049 | Bacteria | 545 |
| 421 | Ga0466967_0259907 | 3300045976 | Bacteria | 1661 |
| 422 | Ga0466967_1361779 | 3300045976 | Bacteria | 707 |
| 423 | Ga0495592_0050253 | 3300046454 | Bacteria | 3098 |
| 424 | Ga0495603_0019982 | 3300046455 | Bacteria | 4058 |
| 425 | Ga0495590_0155640 | 3300046457 | Bacteria | 829 |
| 426 | Ga0495590_0355096 | 3300046457 | Bacteria | 557 |
| 427 | Ga0495638_0001093 | 3300046460 | Bacteria | 26413 |
| 428 | Ga0495638_0004182 | 3300046460 | Bacteria | 10997 |
| 429 | Ga0495638_0029879 | 3300046460 | Bacteria | 3513 |
| 430 | Ga0495638_0514339 | 3300046460 | Bacteria | 601 |
| 431 | Ga0495641_0397548 | 3300046461 | Bacteria | 625 |
| 432 | Ga0495650_0000150 | 3300046471 | Bacteria | 158574 |
| 433 | Ga0495650_0171527 | 3300046471 | Bacteria | 768 |
| 434 | Ga0495580_0310275 | 3300046472 | Bacteria | 1073 |
| 435 | Ga0495605_0000882 | 3300046474 | Bacteria | 20665 |
| 436 | Ga0495639_0010705 | 3300046475 | Bacteria | 3949 |
| 437 | Ga0495639_0524303 | 3300046475 | Bacteria | 606 |
| 438 | Ga0495662_0356199 | 3300046476 | Bacteria | 719 |
| 439 | Ga0495664_0007342 | 3300046477 | Bacteria | 6118 |
| 440 | Ga0495664_0114850 | 3300046477 | Bacteria | 1626 |
| 441 | Ga0495584_0105602 | 3300046491 | Bacteria | 1424 |
| 442 | Ga0495585_0034342 | 3300046492 | Bacteria | 2867 |
| 443 | Ga0495585_0100853 | 3300046492 | Bacteria | 1544 |
| 444 | Ga0495585_0142526 | 3300046492 | Bacteria | 1254 |
| 445 | Ga0495585_0359038 | 3300046492 | Bacteria | 707 |
| 446 | Ga0495594_0158117 | 3300046499 | Bacteria | 1288 |
| 447 | Ga0495596_0090464 | 3300046500 | Bacteria | 1188 |
| 448 | Ga0495596_0243911 | 3300046500 | Bacteria | 697 |
| 449 | Ga0495607_0050852 | 3300046501 | Bacteria | 2410 |
| 450 | Ga0495583_0016358 | 3300046506 | Bacteria | 3991 |
| 451 | Ga0495606_0007239 | 3300046507 | Bacteria | 9999 |
| 452 | Ga0495606_0032075 | 3300046507 | Bacteria | 3644 |
| 453 | Ga0495606_0080822 | 3300046507 | Bacteria | 2022 |
| 454 | Ga0495606_0301535 | 3300046507 | Bacteria | 868 |
| 455 | Ga0495608_0259714 | 3300046511 | Bacteria | 1081 |
| 456 | Ga0495610_0009298 | 3300046512 | Bacteria | 6230 |
| 457 | Ga0495610_0026067 | 3300046512 | Bacteria | 3126 |
| 458 | Ga0495610_0090811 | 3300046512 | Bacteria | 1385 |
| 459 | Ga0495616_0172638 | 3300046513 | Bacteria | 966 |
| 460 | Ga0495620_0042448 | 3300046515 | Bacteria | 1987 |
| 461 | Ga0495628_0114288 | 3300046516 | Bacteria | 2074 |
| 462 | Ga0495628_0661467 | 3300046516 | Bacteria | 741 |
| 463 | Ga0495631_0026994 | 3300046518 | Bacteria | 2631 |
| 464 | Ga0495631_0134718 | 3300046518 | Bacteria | 1061 |
| 465 | Ga0495631_0169944 | 3300046518 | Bacteria | 935 |
| 466 | Ga0495631_0417383 | 3300046518 | Bacteria | 571 |
| 467 | Ga0495632_0066757 | 3300046519 | Bacteria | 1735 |
| 468 | Ga0495643_0030117 | 3300046522 | Bacteria | 3032 |
| 469 | Ga0495643_0107297 | 3300046522 | Bacteria | 1424 |
| 470 | Ga0495644_0040197 | 3300046523 | Bacteria | 1763 |
| 471 | Ga0495648_0104555 | 3300046524 | Bacteria | 1555 |
| 472 | Ga0495648_0164241 | 3300046524 | Bacteria | 1144 |
| 473 | Ga0495648_0280343 | 3300046524 | Bacteria | 790 |
| 474 | Ga0495663_0013581 | 3300046525 | Bacteria | 2278 |
| 475 | Ga0495663_0057601 | 3300046525 | Bacteria | 1216 |
| 476 | Ga0495666_0231368 | 3300046526 | Bacteria | 845 |
| 477 | Ga0495652_0111683 | 3300046529 | Bacteria | 2197 |
| 478 | Ga0495654_0114022 | 3300046530 | Bacteria | 1230 |
| 479 | Ga0495654_0176616 | 3300046530 | Bacteria | 928 |
| 480 | Ga0495587_0219184 | 3300046536 | Bacteria | 1073 |
| 481 | Ga0495598_0040795 | 3300046537 | Bacteria | 1355 |
| 482 | Ga0495598_0106697 | 3300046537 | Bacteria | 934 |
| 483 | Ga0495598_0213037 | 3300046537 | Bacteria | 702 |
| 484 | Ga0495609_0082805 | 3300046538 | Bacteria | 1401 |
| 485 | Ga0495609_0243715 | 3300046538 | Bacteria | 741 |
| 486 | Ga0495609_0347108 | 3300046538 | Bacteria | 599 |
| 487 | Ga0495621_0042629 | 3300046539 | Bacteria | 1598 |
| 488 | Ga0495621_0104389 | 3300046539 | Bacteria | 1081 |
| 489 | Ga0495597_0077349 | 3300046542 | Bacteria | 1426 |
| 490 | Ga0495645_0005428 | 3300046543 | Bacteria | 8746 |
| 491 | Ga0495645_0271759 | 3300046543 | Bacteria | 1118 |
| 492 | Ga0495622_0179375 | 3300046557 | Bacteria | 950 |
| 493 | Ga0495633_0165467 | 3300046558 | Bacteria | 1020 |
| 494 | Ga0495667_0038917 | 3300046559 | Bacteria | 3166 |
| 495 | Ga0495656_0065604 | 3300046615 | Bacteria | 1597 |
| 496 | Ga0495656_0065673 | 3300046615 | Bacteria | 1596 |
| 497 | Ga0495656_0648005 | 3300046615 | Bacteria | 567 |
| 498 | Ga0495668_0010544 | 3300046616 | Bacteria | 5586 |
| 499 | Ga0495668_0162294 | 3300046616 | Bacteria | 1224 |
| 500 | Ga0495668_0198652 | 3300046616 | Bacteria | 1098 |
| 501 | Ga0495668_0322551 | 3300046616 | Bacteria | 847 |
| 502 | Ga0495668_0687770 | 3300046616 | Bacteria | 566 |
| 503 | Ga0495634_0115841 | 3300046642 | Bacteria | 1719 |
| 504 | Ga0495611_0055449 | 3300046648 | Bacteria | 1793 |
| 505 | Ga0495611_0231224 | 3300046648 | Bacteria | 859 |
| 506 | Ga0495611_0245141 | 3300046648 | Bacteria | 831 |
| 507 | Ga0495625_0006043 | 3300046660 | Bacteria | 10872 |
| 508 | Ga0495625_0334995 | 3300046660 | Bacteria | 960 |
| 509 | Ga0495625_0711140 | 3300046660 | Bacteria | 592 |
| 510 | Ga0495635_0019609 | 3300046663 | Bacteria | 4711 |
| 511 | Ga0495659_0000001 | 3300046664 | Bacteria | 325846 |
| 512 | Ga0495659_0200695 | 3300046664 | Bacteria | 818 |
| 513 | Ga0495588_0005074 | 3300046674 | Bacteria | 5849 |
| 514 | Ga0495588_0034992 | 3300046674 | Bacteria | 2543 |
| 515 | Ga0495657_0005171 | 3300046675 | Bacteria | 10333 |
| 516 | Ga0495599_0034262 | 3300046678 | Bacteria | 3190 |
| 517 | Ga0495599_0065984 | 3300046678 | Bacteria | 2261 |
| 518 | Ga0495623_0016633 | 3300046679 | Bacteria | 4750 |
| 519 | Ga0495646_0037433 | 3300046680 | Bacteria | 3001 |
| 520 | Ga0495646_0087925 | 3300046680 | Bacteria | 1800 |
| 521 | Ga0495658_0080762 | 3300046683 | Bacteria | 1908 |
| 522 | Ga0495669_0051414 | 3300046684 | Bacteria | 1849 |
| 523 | Ga0495613_0014966 | 3300046689 | Bacteria | 5758 |
| 524 | Ga0495624_0273011 | 3300046690 | Bacteria | 1021 |
| 525 | Ga0495624_0308663 | 3300046690 | Bacteria | 953 |
| 526 | Ga0495624_0351621 | 3300046690 | Bacteria | 886 |
| 527 | Ga0495670_0024618 | 3300046691 | Bacteria | 2976 |
| 528 | Ga0495670_0056306 | 3300046691 | Bacteria | 1972 |
| 529 | Ga0495671_0000035 | 3300046692 | Bacteria | 188543 |
| 530 | Ga0495671_0198892 | 3300046692 | Bacteria | 972 |
| 531 | Ga0495671_0244940 | 3300046692 | Bacteria | 866 |
| 532 | Ga0495671_0475106 | 3300046692 | Bacteria | 597 |
| 533 | Ga0495649_0024030 | 3300046694 | Bacteria | 3402 |
| 534 | Ga0495589_0441862 | 3300046794 | Bacteria | 595 |
| 535 | Ga0495600_0058255 | 3300046809 | Bacteria | 2523 |
| 536 | Ga0495660_0009064 | 3300046810 | Bacteria | 5810 |
| 537 | Ga0495660_0017169 | 3300046810 | Bacteria | 4168 |
| 538 | Ga0495660_0080596 | 3300046810 | Bacteria | 1708 |
| 539 | Ga0495604_0019135 | 3300047317 | Bacteria | 5483 |
| 540 | Ga0495604_0230915 | 3300047317 | Bacteria | 1269 |
| 541 | Ga0495636_0090785 | 3300047318 | Bacteria | 1326 |
| 542 | Ga0495636_0218643 | 3300047318 | Bacteria | 874 |
| 543 | Ga0495674_0010589 | 3300047319 | Bacteria | 8729 |
| 544 | Ga0495672_0000066 | 3300047320 | Bacteria | 193318 |
| 545 | Ga0495672_0012040 | 3300047320 | Bacteria | 6057 |
| 546 | Ga0495672_0052403 | 3300047320 | Bacteria | 2397 |
| 547 | Ga0495672_0175862 | 3300047320 | Bacteria | 1088 |
| 548 | Ga0495672_0335535 | 3300047320 | Bacteria | 706 |
| 549 | Ga0495676_0293471 | 3300047321 | Bacteria | 1098 |
| 550 | Ga0495680_0008649 | 3300047322 | Bacteria | 9238 |
| 551 | Ga0495683_0391727 | 3300047323 | Bacteria | 579 |
| 552 | Ga0495675_0003429 | 3300047444 | Bacteria | 9549 |
| 553 | Ga0495677_0045869 | 3300047445 | Bacteria | 1604 |
| 554 | Ga0495673_0141652 | 3300047469 | Bacteria | 937 |
| 555 | Ga0495673_0183913 | 3300047469 | Bacteria | 790 |
| 556 | Ga0495673_0198737 | 3300047469 | Bacteria | 751 |
| 557 | Ga0495681_0166983 | 3300047470 | Bacteria | 913 |
| 558 | Ga0495681_0178368 | 3300047470 | Bacteria | 874 |
| 559 | Ga0495684_0087439 | 3300047471 | Bacteria | 2362 |
| 560 | Ga0495686_0084708 | 3300047472 | Bacteria | 1931 |
| 561 | Ga0495686_0179669 | 3300047472 | Bacteria | 1227 |
| 562 | Ga0495686_0216632 | 3300047472 | Bacteria | 1091 |
| 563 | Ga0495602_0009971 | 3300048088 | Bacteria | 9856 |
| 564 | Ga0495615_0056467 | 3300048090 | Bacteria | 1025 |
| 565 | Ga0495615_0238906 | 3300048090 | Bacteria | 572 |
| 566 | Ga0495626_0053772 | 3300048091 | Bacteria | 1852 |
| 567 | Ga0495626_0301367 | 3300048091 | Bacteria | 633 |
| 568 | Ga0496100_0018898 | 3300048903 | Bacteria | 4101 |
| 569 | Ga0496100_0624579 | 3300048903 | Bacteria | 838 |
| 570 | Ga0496100_1139752 | 3300048903 | Bacteria | 615 |
| 571 | Ga0496101_0553999 | 3300048904 | Bacteria | 909 |
| 572 | Ga0496101_0772542 | 3300048904 | Bacteria | 758 |
| 573 | Ga0496102_0264305 | 3300048905 | Bacteria | 1622 |
| 574 | Ga0496102_0843607 | 3300048905 | Bacteria | 838 |
| 575 | Ga0496102_0897480 | 3300048905 | Bacteria | 808 |
| 576 | Ga0496102_1428297 | 3300048905 | Bacteria | 611 |
| 577 | Ga0496103_0082121 | 3300048906 | Bacteria | 2028 |
| 578 | Ga0496104_0254219 | 3300048907 | Bacteria | 1670 |
| 579 | Ga0496104_0414267 | 3300048907 | Bacteria | 1260 |
| 580 | Ga0496104_1030480 | 3300048907 | Bacteria | 727 |
| 581 | Ga0496106_0227948 | 3300048909 | Bacteria | 1487 |
| 582 | Ga0496106_0349388 | 3300048909 | Bacteria | 1188 |
| 583 | Ga0496106_0685787 | 3300048909 | Bacteria | 817 |
| 584 | Ga0496106_1170744 | 3300048909 | Bacteria | 600 |
| 585 | Ga0496107_0022694 | 3300048910 | Bacteria | 4437 |
| 586 | Ga0496108_0287153 | 3300048911 | Bacteria | 1432 |
| 587 | Ga0496109_0074991 | 3300048912 | Bacteria | 3110 |
| 588 | Ga0496112_0759066 | 3300048915 | Bacteria | 896 |
| 589 | Ga0496114_0493902 | 3300048917 | Bacteria | 1083 |
| 590 | Ga0496114_0990009 | 3300048917 | Bacteria | 724 |
| 591 | Ga0496115_0257474 | 3300048918 | Bacteria | 1435 |
| 592 | Ga0496115_0475818 | 3300048918 | Bacteria | 1006 |
| 593 | Ga0496115_1153571 | 3300048918 | Bacteria | 585 |
| 594 | Ga0496116_0042554 | 3300048919 | Bacteria | 3103 |
| 595 | Ga0496117_0076506 | 3300048920 | Bacteria | 2219 |
| 596 | Ga0496117_0590343 | 3300048920 | Bacteria | 521 |
| 597 | Ga0496118_0046965 | 3300048921 | Bacteria | 3353 |
| 598 | Ga0496118_0060931 | 3300048921 | Bacteria | 2798 |
| 599 | Ga0496118_0337355 | 3300048921 | Bacteria | 810 |
| 600 | Ga0496118_0398540 | 3300048921 | Bacteria | 716 |
| 601 | Ga0496120_0114125 | 3300048923 | Bacteria | 1406 |
| 602 | Ga0496121_0007499 | 3300048924 | Bacteria | 13165 |
| 603 | Ga0496121_0042459 | 3300048924 | Bacteria | 3955 |
| 604 | Ga0496121_0048693 | 3300048924 | Bacteria | 3603 |
| 605 | Ga0496121_0090484 | 3300048924 | Bacteria | 2392 |
| 606 | Ga0496121_0165387 | 3300048924 | Bacteria | 1613 |
| 607 | Ga0496121_0197453 | 3300048924 | Bacteria | 1437 |
| 608 | Ga0496121_0325218 | 3300048924 | Bacteria | 1034 |
| 609 | Ga0496121_0381963 | 3300048924 | Bacteria | 928 |
| 610 | Ga0496121_0430740 | 3300048924 | Bacteria | 856 |
| 611 | Ga0496122_0029922 | 3300048925 | Bacteria | 4576 |
| 612 | Ga0496123_0131374 | 3300048926 | Bacteria | 1386 |
| 613 | Ga0496123_0283718 | 3300048926 | Bacteria | 799 |
| 614 | Ga0496124_0455107 | 3300048927 | Bacteria | 871 |
| 615 | Ga0496124_0549259 | 3300048927 | Bacteria | 763 |
| 616 | Ga0496124_0737022 | 3300048927 | Bacteria | 619 |
| 617 | Ga0496125_0000272 | 3300048928 | Bacteria | 105490 |
| 618 | Ga0496125_0003504 | 3300048928 | Bacteria | 18949 |
| 619 | Ga0496125_0242611 | 3300048928 | Bacteria | 1143 |
| 620 | Ga0496125_0396184 | 3300048928 | Bacteria | 808 |
| 621 | Ga0496126_0157364 | 3300048929 | Bacteria | 1944 |
| 622 | Ga0496126_0223066 | 3300048929 | Bacteria | 1582 |
| 623 | Ga0496126_0566258 | 3300048929 | Bacteria | 899 |
| 624 | Ga0496126_0820230 | 3300048929 | Bacteria | 712 |
| 625 | Ga0496126_1310803 | 3300048929 | Bacteria | 527 |
| 626 | Ga0495678_054826 | 3300049459 | Bacteria | 1524 |
| 627 | Ga0495682_0027769 | 3300049460 | Bacteria | 2099 |
| 628 | Ga0495682_0124187 | 3300049460 | Bacteria | 924 |
| 629 | Ga0501031_0080173 | 3300049568 | Bacteria | 2127 |
| 630 | Ga0501031_0275193 | 3300049568 | Bacteria | 1092 |
| 631 | Ga0501031_0278267 | 3300049568 | Bacteria | 1086 |
| 632 | Ga0501032_0000129 | 3300049569 | Bacteria | 62082 |
| 633 | Ga0501033_0001179 | 3300049570 | Bacteria | 23588 |
| 634 | Ga0501033_0073910 | 3300049570 | Bacteria | 2503 |
| 635 | Ga0501033_0116995 | 3300049570 | Bacteria | 1936 |
| 636 | Ga0501033_0133485 | 3300049570 | Bacteria | 1797 |
| 637 | Ga0501033_0652720 | 3300049570 | Bacteria | 719 |
| 638 | Ga0501033_0873357 | 3300049570 | Bacteria | 605 |
| 639 | Ga0501034_0000503 | 3300049571 | Bacteria | 63099 |
| 640 | Ga0501034_0239638 | 3300049571 | Bacteria | 1760 |
| 641 | Ga0501034_0586247 | 3300049571 | Bacteria | 1021 |
| 642 | Ga0501034_0777062 | 3300049571 | Bacteria | 852 |
| 643 | Ga0501036_0001453 | 3300049572 | Bacteria | 18220 |
| 644 | Ga0501036_0171015 | 3300049572 | Bacteria | 1831 |
| 645 | Ga0501036_0213443 | 3300049572 | Bacteria | 1621 |
| 646 | Ga0501037_0000106 | 3300049573 | Bacteria | 79430 |
| 647 | Ga0501037_0108472 | 3300049573 | Bacteria | 2000 |
| 648 | Ga0501037_0143047 | 3300049573 | Bacteria | 1711 |
| 649 | Ga0501037_0254999 | 3300049573 | Bacteria | 1227 |
| 650 | Ga0501038_0001655 | 3300049574 | Bacteria | 20704 |
| 651 | Ga0501038_0095220 | 3300049574 | Bacteria | 2487 |
| 652 | Ga0501038_0576133 | 3300049574 | Bacteria | 854 |
| 653 | Ga0501038_0995126 | 3300049574 | Bacteria | 616 |
| 654 | Ga0501039_0000416 | 3300049575 | Bacteria | 30616 |
| 655 | Ga0501039_0361693 | 3300049575 | Bacteria | 1140 |
| 656 | Ga0501039_0870684 | 3300049575 | Bacteria | 702 |
| 657 | Ga0501039_1082497 | 3300049575 | Bacteria | 622 |
| 658 | Ga0501041_0614810 | 3300049577 | Bacteria | 694 |
| 659 | Ga0501042_0320311 | 3300049578 | Bacteria | 1120 |
| 660 | Ga0501043_0000035 | 3300049579 | Bacteria | 133200 |
| 661 | Ga0501043_0074841 | 3300049579 | Bacteria | 2660 |
| 662 | Ga0501043_0116718 | 3300049579 | Bacteria | 2094 |
| 663 | Ga0501043_0175035 | 3300049579 | Bacteria | 1673 |
| 664 | Ga0501043_0184225 | 3300049579 | Bacteria | 1626 |
| 665 | Ga0501043_0861069 | 3300049579 | Bacteria | 652 |
| 666 | Ga0501046_0000235 | 3300049580 | Bacteria | 57005 |
| 667 | Ga0501046_0069988 | 3300049580 | Bacteria | 2729 |
| 668 | Ga0501046_0219622 | 3300049580 | Bacteria | 1408 |
| 669 | Ga0501047_0000844 | 3300049581 | Bacteria | 31650 |
| 670 | Ga0501047_0011760 | 3300049581 | Bacteria | 8276 |
| 671 | Ga0501047_0014131 | 3300049581 | Bacteria | 7586 |
| 672 | Ga0501047_0187014 | 3300049581 | Bacteria | 1936 |
| 673 | Ga0501047_1114838 | 3300049581 | Bacteria | 602 |
| 674 | Ga0501048_0001444 | 3300049582 | Bacteria | 18038 |
| 675 | Ga0501048_0093360 | 3300049582 | Bacteria | 2123 |
| 676 | Ga0501067_0000160 | 3300049583 | Bacteria | 37883 |
| 677 | Ga0501067_0065736 | 3300049583 | Bacteria | 2008 |
| 678 | Ga0501068_0000014 | 3300049584 | Bacteria | 62762 |
| 679 | Ga0501069_0004593 | 3300049585 | Bacteria | 7142 |
| 680 | Ga0501069_0112465 | 3300049585 | Bacteria | 1551 |
| 681 | Ga0501070_0002059 | 3300049586 | Bacteria | 17669 |
| 682 | Ga0501070_0043404 | 3300049586 | Bacteria | 3741 |
| 683 | Ga0501070_0067819 | 3300049586 | Bacteria | 2955 |
| 684 | Ga0501071_0052208 | 3300049587 | Bacteria | 2948 |
| 685 | Ga0501071_0053226 | 3300049587 | Bacteria | 2919 |
| 686 | Ga0501072_0001159 | 3300049588 | Bacteria | 19618 |
| 687 | Ga0501073_0000417 | 3300049589 | Bacteria | 29149 |
| 688 | Ga0501073_0665876 | 3300049589 | Bacteria | 718 |
| 689 | Ga0501073_0700938 | 3300049589 | Bacteria | 698 |
| 690 | Ga0501074_0001839 | 3300049590 | Bacteria | 14545 |
| 691 | Ga0501076_0991825 | 3300049592 | Bacteria | 692 |
| 692 | Ga0501079_0000261 | 3300049741 | Bacteria | 32317 |
| 693 | Ga0501080_0000917 | 3300049742 | Bacteria | 24141 |
| 694 | Ga0501080_0019039 | 3300049742 | Bacteria | 6357 |
| 695 | Ga0501081_1238644 | 3300049743 | Bacteria | 565 |
| 696 | Ga0501081_1365144 | 3300049743 | Bacteria | 538 |
| 697 | Ga0501083_0000301 | 3300049744 | Bacteria | 31182 |
| 698 | Ga0501083_0334581 | 3300049744 | Bacteria | 984 |
| 699 | Ga0501269_007654 | 3300049766 | Bacteria | 1305 |
| 700 | Ga0501035_0000324 | 3300049822 | Bacteria | 55297 |
| 701 | Ga0501035_0000807 | 3300049822 | Bacteria | 33393 |
| 702 | Ga0501035_0041846 | 3300049822 | Bacteria | 4135 |
| 703 | Ga0501035_0183194 | 3300049822 | Bacteria | 1803 |
| 704 | Ga0501035_0209110 | 3300049822 | Bacteria | 1670 |
| 705 | Ga0501044_0000051 | 3300049823 | Bacteria | 143658 |
| 706 | Ga0501044_0001093 | 3300049823 | Bacteria | 32295 |
| 707 | Ga0501044_0172931 | 3300049823 | Bacteria | 2130 |
| 708 | Ga0501044_0301936 | 3300049823 | Bacteria | 1529 |
| 709 | Ga0501044_1203345 | 3300049823 | Bacteria | 625 |
| 710 | Ga0501045_0040080 | 3300049824 | Bacteria | 3408 |
| 711 | Ga0501045_0563915 | 3300049824 | Bacteria | 844 |
| 712 | nmdc:mga03683_471999_c1 | 3300050489 | Bacteria | 605 |
| 713 | nmdc:mga03683_612453_c1 | 3300050489 | Bacteria | 534 |
| 714 | nmdc:mga03n38_106245_c1 | 3300050490 | Bacteria | 1361 |
| 715 | nmdc:mga03n38_128379_c1 | 3300050490 | Bacteria | 1254 |
| 716 | nmdc:mga03n38_273834_c2 | 3300050490 | Bacteria | 589 |
| 717 | nmdc:mga00v17_263510_c1 | 3300050491 | Bacteria | 1118 |
| 718 | nmdc:mga00v17_289371_c1 | 3300050491 | Bacteria | 1064 |
| 719 | nmdc:mga0yw44_121480_c1 | 3300050492 | Bacteria | 1683 |
| 720 | nmdc:mga0yw44_1241_c1 | 3300050492 | Bacteria | 10009 |
| 721 | nmdc:mga0yw44_152714_c1 | 3300050492 | Bacteria | 1507 |
| 722 | nmdc:mga0yw44_284549_c1 | 3300050492 | Bacteria | 1105 |
| 723 | nmdc:mga0yw44_45937_c1 | 3300050492 | Bacteria | 2621 |
| 724 | nmdc:mga0yw44_547448_c1 | 3300050492 | Bacteria | 786 |
| 725 | nmdc:mga0yw44_793716_c1 | 3300050492 | Bacteria | 643 |
| 726 | nmdc:mga0k408_110552_c1 | 3300050493 | Bacteria | 1624 |
| 727 | nmdc:mga0k408_135884_c1 | 3300050493 | Bacteria | 1461 |
| 728 | nmdc:mga0k408_331466_c1 | 3300050493 | Bacteria | 908 |
| 729 | nmdc:mga0k408_640343_c1 | 3300050493 | Bacteria | 625 |
| 730 | nmdc:mga06z11_636333_c1 | 3300050494 | Bacteria | 649 |
| 731 | nmdc:mga06z11_745189_c1 | 3300050494 | Bacteria | 597 |
| 732 | nmdc:mga04h51_111064_c1 | 3300050495 | Bacteria | 1011 |
| 733 | nmdc:mga04h51_149357_c1 | 3300050495 | Bacteria | 892 |
| 734 | nmdc:mga07m45_118877_c1 | 3300050496 | Bacteria | 1526 |
| 735 | nmdc:mga05p37_1096040_c1 | 3300050507 | Bacteria | 834 |
| 736 | nmdc:mga05p37_91569_c1 | 3300050507 | Bacteria | 3747 |
| 737 | nmdc:mga0n895_437936_c1 | 3300050512 | Bacteria | 1320 |
| 738 | nmdc:mga0rr50_638421_c1 | 3300050513 | Bacteria | 908 |
| 739 | nmdc:mga0sz30_163093_c1 | 3300050516 | Bacteria | 987 |
| 740 | nmdc:mga0sz30_414884_c1 | 3300050516 | Bacteria | 603 |
| 741 | nmdc:mga0sz30_6813_c3 | 3300050516 | Bacteria | 863 |
| 742 | Ga0495601_0387858 | 3300053077 | Bacteria | 906 |
| 743 | Ga0495612_0010268 | 3300053078 | Bacteria | 3789 |
| 744 | Ga0495612_0041356 | 3300053078 | Bacteria | 1880 |
| 745 | Ga0495595_0318258 | 3300053084 | Bacteria | 783 |
| 746 | Ga0500643_000032 | 3300053087 | Bacteria | 200350 |
| 747 | Ga0500644_0304405 | 3300053088 | Bacteria | 683 |
| 748 | Ga0500646_0053575 | 3300053090 | Bacteria | 1170 |
| 749 | Ga0500583_0048511 | 3300053092 | Bacteria | 1960 |
| 750 | Ga0500583_0133509 | 3300053092 | Bacteria | 1232 |
| 751 | Ga0500583_0197464 | 3300053092 | Bacteria | 1000 |
| 752 | Ga0500583_0517724 | 3300053092 | Bacteria | 558 |
| 753 | Ga0500566_0004691 | 3300053094 | Bacteria | 8134 |
| 754 | Ga0500641_0089183 | 3300053096 | Bacteria | 1315 |
| 755 | Ga0500641_0164785 | 3300053096 | Bacteria | 955 |
| 756 | Ga0500641_0415350 | 3300053096 | Bacteria | 526 |
| 757 | Ga0500650_0128609 | 3300053098 | Bacteria | 1178 |
| 758 | Ga0500555_008642 | 3300053103 | Bacteria | 2904 |
| 759 | Ga0500556_0153844 | 3300053104 | Bacteria | 907 |
| 760 | Ga0500556_0244505 | 3300053104 | Bacteria | 707 |
| 761 | Ga0500557_021384 | 3300053105 | Bacteria | 1854 |
| 762 | Ga0500562_027034 | 3300053108 | Bacteria | 1505 |
| 763 | Ga0500569_050034 | 3300053109 | Bacteria | 1257 |
| 764 | Ga0500592_014572 | 3300053116 | Bacteria | 1260 |
| 765 | Ga0500594_0002401 | 3300053118 | Bacteria | 4078 |
| 766 | Ga0500594_0103937 | 3300053118 | Bacteria | 877 |
| 767 | Ga0500595_021164 | 3300053119 | Bacteria | 2326 |
| 768 | Ga0500595_032344 | 3300053119 | Bacteria | 1747 |
| 769 | Ga0500608_204478 | 3300053122 | Bacteria | 813 |
| 770 | Ga0500621_144765 | 3300053126 | Bacteria | 898 |
| 771 | Ga0500626_136979 | 3300053128 | Bacteria | 1032 |
| 772 | Ga0500642_0000173 | 3300053130 | Bacteria | 26732 |
| 773 | Ga0500642_0238158 | 3300053130 | Bacteria | 839 |
| 774 | Ga0500642_0247371 | 3300053130 | Bacteria | 819 |
| 775 | Ga0500652_280158 | 3300053131 | Bacteria | 651 |
| 776 | Ga0500655_015433 | 3300053133 | Bacteria | 1402 |
| 777 | Ga0500655_036468 | 3300053133 | Bacteria | 957 |
| 778 | Ga0500655_083723 | 3300053133 | Bacteria | 658 |
| 779 | Ga0500559_0346537 | 3300053136 | Bacteria | 695 |
| 780 | Ga0500568_0000411 | 3300053139 | Bacteria | 32773 |
| 781 | Ga0500568_0020317 | 3300053139 | Bacteria | 2875 |
| 782 | Ga0500568_0042194 | 3300053139 | Bacteria | 1829 |
| 783 | Ga0500568_0237144 | 3300053139 | Bacteria | 665 |
| 784 | Ga0500588_0067660 | 3300053146 | Bacteria | 1162 |
| 785 | Ga0500588_0225933 | 3300053146 | Bacteria | 699 |
| 786 | Ga0500589_050279 | 3300053147 | Bacteria | 1934 |
| 787 | Ga0500589_110811 | 3300053147 | Bacteria | 1177 |
| 788 | Ga0500604_0086442 | 3300053151 | Bacteria | 1019 |
| 789 | Ga0500604_0097467 | 3300053151 | Bacteria | 966 |
| 790 | Ga0500616_0006355 | 3300053153 | Bacteria | 7753 |
| 791 | Ga0500616_0258737 | 3300053153 | Bacteria | 740 |
| 792 | Ga0500622_0000428 | 3300053156 | Bacteria | 39928 |
| 793 | Ga0500622_0006595 | 3300053156 | Bacteria | 6694 |
| 794 | Ga0500627_0092747 | 3300053158 | Bacteria | 1352 |
| 795 | Ga0500634_0210020 | 3300053161 | Bacteria | 846 |
| 796 | Ga0500609_036270 | 3300053731 | Bacteria | 680 |
| 797 | Ga0500599_003267 | 3300053736 | Bacteria | 1971 |
| 798 | Ga0501084_0429030 | 3300054114 | Bacteria | 1117 |
| 799 | Ga0501084_0903347 | 3300054114 | Bacteria | 743 |
| 800 | Ga0501084_1196225 | 3300054114 | Bacteria | 638 |
| 801 | Ga0501082_0018584 | 3300060353 | Bacteria | 5991 |
| 802 | Ga0501082_0064726 | 3300060353 | Bacteria | 3149 |
| 803 | Ga0501082_0133402 | 3300060353 | Bacteria | 2155 |
| 804 | Ga0466962_0661545 | 3300061719 | Bacteria | 534 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046674 | Ga0495588_0034992 | Ga0495588_0034992_874_1194 | 77 |
| 2 | 3300044684 | Ga0466966_0034096 | Ga0466966_0034096_2378_2698 | 89 |
| 3 | 3300045049 | Ga0466959_1038728 | Ga0466959_1038728_60_380 | 89 |
| 4 | 3300049568 | Ga0501031_0278267 | Ga0501031_0278267_304_621 | 89 |
| 5 | 3300049580 | Ga0501046_0219622 | Ga0501046_0219622_1076_1393 | 89 |
| 6 | 3300049581 | Ga0501047_0011760 | Ga0501047_0011760_2952_3269 | 89 |
| 7 | 3300049583 | Ga0501067_0065736 | Ga0501067_0065736_611_928 | 89 |
| 8 | 3300049585 | Ga0501069_0112465 | Ga0501069_0112465_379_696 | 89 |
| 9 | 3300049586 | Ga0501070_0002059 | Ga0501070_0002059_12675_12992 | 89 |
| 10 | 3300049587 | Ga0501071_0053226 | Ga0501071_0053226_426_743 | 89 |
| 11 | 3300049589 | Ga0501073_0665876 | Ga0501073_0665876_281_598 | 89 |
| 12 | 3300049742 | Ga0501080_0019039 | Ga0501080_0019039_5872_6189 | 89 |
| 13 | 3300049822 | Ga0501035_0000807 | Ga0501035_0000807_32031_32348 | 89 |
| 14 | 3300049823 | Ga0501044_0001093 | Ga0501044_0001093_27304_27621 | 89 |
| 15 | 3300053092 | Ga0500583_0197464 | Ga0500583_0197464_653_973 | 89 |
| 16 | 3300053098 | Ga0500650_0128609 | Ga0500650_0128609_379_699 | 89 |
| 17 | 3300053104 | Ga0500556_0153844 | Ga0500556_0153844_487_807 | 89 |
| 18 | 3300053130 | Ga0500642_0238158 | Ga0500642_0238158_47_367 | 89 |
| 19 | 3300053133 | Ga0500655_015433 | Ga0500655_015433_987_1307 | 89 |
| 20 | 3300060353 | Ga0501082_0064726 | Ga0501082_0064726_1108_1425 | 89 |
| 21 | 3300061719 | Ga0466962_0661545 | Ga0466962_0661545_190_510 | 89 |
| 22 | 3300012513 | Ga0157326_1068441 | Ga0157326_10684411 | 90 |
| 23 | 3300049579 | Ga0501043_0175035 | Ga0501043_0175035_980_1294 | 92 |
| 24 | 3300049570 | Ga0501033_0073910 | Ga0501033_0073910_1580_1894 | 93 |
| 25 | 3300046507 | Ga0495606_0007239 | Ga0495606_0007239_7673_7990 | 94 |
| 26 | 3300046512 | Ga0495610_0009298 | Ga0495610_0009298_4870_5187 | 94 |
| 27 | 3300049823 | Ga0501044_0172931 | Ga0501044_0172931_453_767 | 94 |
| 28 | 3300005548 | Ga0070665_100430766 | Ga0070665_1004307661 | 95 |
| 29 | 3300028379 | Ga0268266_10374299 | Ga0268266_103742991 | 95 |
| 30 | 3300046492 | Ga0495585_0100853 | Ga0495585_0100853_779_1105 | 95 |
| 31 | 3300046523 | Ga0495644_0040197 | Ga0495644_0040197_1025_1351 | 95 |
| 32 | 3300046537 | Ga0495598_0040795 | Ga0495598_0040795_816_1142 | 95 |
| 33 | 3300046539 | Ga0495621_0042629 | Ga0495621_0042629_287_613 | 95 |
| 34 | 3300046648 | Ga0495611_0231224 | Ga0495611_0231224_411_737 | 95 |
| 35 | 3300046691 | Ga0495670_0056306 | Ga0495670_0056306_1425_1751 | 95 |
| 36 | 3300047318 | Ga0495636_0218643 | Ga0495636_0218643_195_521 | 95 |
| 37 | 3300047470 | Ga0495681_0178368 | Ga0495681_0178368_413_739 | 95 |
| 38 | 3300046538 | Ga0495609_0347108 | Ga0495609_0347108_85_399 | 96 |
| 39 | 3300005327 | Ga0070658_11837011 | Ga0070658_118370111 | 98 |
| 40 | 3300005340 | Ga0070689_100441180 | Ga0070689_1004411801 | 98 |
| 41 | 3300005344 | Ga0070661_100795548 | Ga0070661_1007955481 | 98 |
| 42 | 3300005455 | Ga0070663_100631601 | Ga0070663_1006316011 | 98 |
| 43 | 3300005456 | Ga0070678_100412271 | Ga0070678_1004122712 | 98 |
| 44 | 3300005843 | Ga0068860_100097783 | Ga0068860_1000977832 | 98 |
| 45 | 3300005844 | Ga0068862_100229211 | Ga0068862_1002292113 | 98 |
| 46 | 3300013306 | Ga0163162_10626212 | Ga0163162_106262123 | 98 |
| 47 | 3300014325 | Ga0163163_11335015 | Ga0163163_113350152 | 98 |
| 48 | 3300014497 | Ga0182008_10313625 | Ga0182008_103136252 | 98 |
| 49 | 3300025920 | Ga0207649_10177366 | Ga0207649_101773661 | 98 |
| 50 | 3300025924 | Ga0207694_10534288 | Ga0207694_105342882 | 98 |
| 51 | 3300025936 | Ga0207670_10390914 | Ga0207670_103909141 | 98 |
| 52 | 3300026067 | Ga0207678_10258769 | Ga0207678_102587692 | 98 |
| 53 | 3300026121 | Ga0207683_10252968 | Ga0207683_102529682 | 98 |
| 54 | 3300028381 | Ga0268264_10065341 | Ga0268264_100653411 | 98 |
| 55 | 3300048907 | Ga0496104_1030480 | Ga0496104_1030480_13_336 | 98 |
| 56 | 3300048917 | Ga0496114_0493902 | Ga0496114_0493902_750_1073 | 98 |
| 57 | 3300048918 | Ga0496115_0257474 | Ga0496115_0257474_752_1075 | 98 |
| 58 | 3300048924 | Ga0496121_0325218 | Ga0496121_0325218_679_1002 | 98 |
| 59 | 3300041413 | Ga0439465_0360995 | Ga0439465_0360995_188_490 | 99 |
| 60 | 3300042156 | Ga0439446_0269951 | Ga0439446_0269951_59_361 | 99 |
| 61 | 3300046460 | Ga0495638_0001093 | Ga0495638_0001093_25030_25353 | 99 |
| 62 | 3300046471 | Ga0495650_0000150 | Ga0495650_0000150_102763_103086 | 99 |
| 63 | 3300046692 | Ga0495671_0244940 | Ga0495671_0244940_183_482 | 99 |
| 64 | iso_pu_bacteria | 2507262055 | 2507508421 | 100 |
| 65 | iso_pu_bacteria | 2508501009 | 2508542488 | 100 |
| 66 | iso_pu_bacteria | 2510917030 | 2511199992 | 100 |
| 67 | iso_pu_bacteria | 2513237096 | 2513658008 | 100 |
| 68 | iso_pu_bacteria | 2513237101 | 2513692732 | 100 |
| 69 | iso_pu_bacteria | 2513237137 | 2513855710 | 100 |
| 70 | iso_pu_bacteria | 2513237144 | 2513913118 | 100 |
| 71 | iso_pu_bacteria | 2513237145 | 2513919898 | 100 |
| 72 | iso_pu_bacteria | 2515154112 | 2515627086 | 100 |
| 73 | iso_pu_bacteria | 2517572143 | 2517892249 | 100 |
| 74 | iso_pu_bacteria | 2524023205 | 2524437517 | 100 |
| 75 | iso_pu_bacteria | 2524023210 | 2524465677 | 100 |
| 76 | iso_pu_bacteria | 2524023228 | 2524540316 | 100 |
| 77 | iso_pu_bacteria | 2582581298 | 2585224251 | 100 |
| 78 | iso_pu_bacteria | 2585427529 | 2585546372 | 100 |
| 79 | iso_pu_bacteria | 2617270742 | 2617385692 | 100 |
| 80 | iso_pu_bacteria | 2643221634 | 2644192860 | 100 |
| 81 | iso_pu_bacteria | 2643221645 | 2644251530 | 100 |
| 82 | iso_pu_bacteria | 2643221664 | 2644357399 | 100 |
| 83 | iso_pu_bacteria | 2643221733 | 2644728278 | 100 |
| 84 | iso_pu_bacteria | 2728368998 | 2728747396 | 100 |
| 85 | iso_pu_bacteria | 2738541280 | 2738739991 | 100 |
| 86 | iso_pu_bacteria | 2738541300 | 2738844254 | 100 |
| 87 | iso_pu_bacteria | 2738543018 | 2739274186 | 100 |
| 88 | iso_pu_bacteria | 2738543030 | 2739343230 | 100 |
| 89 | iso_pu_bacteria | 2744054633 | 2745076491 | 100 |
| 90 | iso_pu_bacteria | 2775507266 | 2778173928 | 100 |
| 91 | iso_pu_bacteria | 2791355197 | 2793072410 | 100 |
| 92 | iso_pu_bacteria | 2791355199 | 2793082240 | 100 |
| 93 | iso_pu_bacteria | 2818991448 | 2819612896 | 100 |
| 94 | iso_pu_bacteria | 2838029111 | 2838030185 | 100 |
| 95 | iso_pu_bacteria | 2842475841 | 2842476530 | 100 |
| 96 | iso_pu_bacteria | 2842502639 | 2842503713 | 100 |
| 97 | iso_pu_bacteria | 2874590934 | 2874598215 | 100 |
| 98 | iso_pu_bacteria | 2874645413 | 2874652728 | 100 |
| 99 | iso_pu_bacteria | 2876761206 | 2876764686 | 100 |
| 100 | iso_pu_bacteria | 2876771140 | 2876778307 | 100 |
| 101 | iso_pu_bacteria | 2876818435 | 2876825824 | 100 |
| 102 | iso_pu_bacteria | 2879074833 | 2879082101 | 100 |
| 103 | iso_pu_bacteria | 2879127579 | 2879135248 | 100 |
| 104 | iso_pu_bacteria | 2879142872 | 2879145393 | 100 |
| 105 | iso_pu_bacteria | 2885374607 | 2885381922 | 100 |
| 106 | iso_pu_bacteria | 2885409591 | 2885411442 | 100 |
| 107 | iso_pu_bacteria | 2903748898 | 2903749163 | 100 |
| 108 | iso_pu_bacteria | 2904699407 | 2904702408 | 100 |
| 109 | iso_pu_bacteria | 2906610324 | 2906618770 | 100 |
| 110 | iso_pu_bacteria | 2906635258 | 2906643129 | 100 |
| 111 | iso_pu_bacteria | 2906660503 | 2906666221 | 100 |
| 112 | iso_pu_bacteria | 2908739725 | 2908742529 | 100 |
| 113 | iso_pu_bacteria | 2919100787 | 2919106973 | 100 |
| 114 | iso_pu_bacteria | 2922425934 | 2922430449 | 100 |
| 115 | iso_pu_bacteria | 2935608549 | 2935609039 | 100 |
| 116 | iso_pu_bacteria | 2935630451 | 2935631519 | 100 |
| 117 | iso_pu_bacteria | 2935648319 | 2935653252 | 100 |
| 118 | iso_pu_bacteria | 2935656913 | 2935660429 | 100 |
| 119 | iso_pu_bacteria | 2935694250 | 2935701258 | 100 |
| 120 | iso_pu_bacteria | 2935769743 | 2935771872 | 100 |
| 121 | iso_pu_bacteria | 2935777560 | 2935778691 | 100 |
| 122 | iso_pu_bacteria | 2935785616 | 2935788923 | 100 |
| 123 | iso_pu_bacteria | 2935793552 | 2935795277 | 100 |
| 124 | iso_pu_bacteria | 2935819856 | 2935822199 | 100 |
| 125 | iso_pu_bacteria | 2935847175 | 2935847781 | 100 |
| 126 | iso_pu_bacteria | 2935908558 | 2935908946 | 100 |
| 127 | iso_pu_bacteria | 2935916978 | 2935919664 | 100 |
| 128 | iso_pu_bacteria | 2935926038 | 2935926480 | 100 |
| 129 | iso_pu_bacteria | 2935934488 | 2935934930 | 100 |
| 130 | iso_pu_bacteria | 2935942939 | 2935943380 | 100 |
| 131 | iso_pu_bacteria | 2935951376 | 2935951818 | 100 |
| 132 | iso_pu_bacteria | 2935967501 | 2935967943 | 100 |
| 133 | iso_pu_bacteria | 2935975950 | 2935978568 | 100 |
| 134 | iso_pu_bacteria | 2936011229 | 2936016122 | 100 |
| 135 | iso_pu_bacteria | 2936019824 | 2936024755 | 100 |
| 136 | iso_pu_bacteria | 2936028420 | 2936031851 | 100 |
| 137 | iso_pu_bacteria | 2936046547 | 2936049712 | 100 |
| 138 | iso_pu_bacteria | 2936055302 | 2936060816 | 100 |
| 139 | iso_pu_bacteria | 2941507105 | 2941511313 | 100 |
| 140 | iso_pu_bacteria | 2941515067 | 2941519014 | 100 |
| 141 | iso_pu_bacteria | 2941523033 | 2941526406 | 100 |
| 142 | iso_pu_bacteria | 3005416602 | 3005420195 | 100 |
| 143 | iso_pu_bacteria | 3005445848 | 3005447416 | 100 |
| 144 | iso_pu_bacteria | 3005474847 | 3005480360 | 100 |
| 145 | iso_pu_bacteria | 8005314921 | 8005317146 | 100 |
| 146 | iso_pu_bacteria | 8005484373 | 8005485056 | 100 |
| 147 | iso_pu_bacteria | 8005645114 | 8005648790 | 100 |
| 148 | iso_pu_bacteria | 8006984368 | 8006986580 | 100 |
| 149 | iso_pu_bacteria | 8006994254 | 8006995835 | 100 |
| 150 | iso_pu_bacteria | 8016522445 | 8016529449 | 100 |
| 151 | iso_pu_bacteria | 8016530956 | 8016534659 | 100 |
| 152 | iso_pu_bacteria | 8016539877 | 8016547878 | 100 |
| 153 | iso_pu_bacteria | 8016548790 | 8016554255 | 100 |
| 154 | iso_pu_bacteria | 8016557553 | 8016562630 | 100 |
| 155 | iso_pu_bacteria | 8016566248 | 8016573006 | 100 |
| 156 | iso_pu_bacteria | 8016575299 | 8016577156 | 100 |
| 157 | iso_pu_bacteria | 8016583857 | 8016591562 | 100 |
| 158 | iso_pu_bacteria | 8016595262 | 8016600414 | 100 |
| 159 | iso_pu_bacteria | 8016603502 | 8016610324 | 100 |
| 160 | iso_pu_bacteria | 8016613128 | 8016614607 | 100 |
| 161 | iso_pu_bacteria | 8016622563 | 8016626392 | 100 |
| 162 | iso_pu_bacteria | 8019530166 | 8019534424 | 100 |
| 163 | iso_pu_bacteria | 8019538911 | 8019545044 | 100 |
| 164 | iso_pu_bacteria | 8019547302 | 8019553482 | 100 |
| 165 | iso_pu_bacteria | 8019619141 | 8019628352 | 100 |
| 166 | iso_pu_bacteria | 8019629233 | 8019634275 | 100 |
| 167 | iso_pu_bacteria | 8019638758 | 8019645457 | 100 |
| 168 | iso_pu_bacteria | 8019659431 | 8019662152 | 100 |
| 169 | iso_pu_bacteria | 8019668869 | 8019671668 | 100 |
| 170 | iso_pu_bacteria | 8019678201 | 8019684432 | 100 |
| 171 | iso_pu_bacteria | 8019687851 | 8019690241 | 100 |
| 172 | iso_pu_bacteria | 8024486573 | 8024492347 | 100 |
| 173 | iso_pu_bacteria | 8056673599 | 8056673673 | 100 |
| 174 | iso_pu_bacteria | 8056689827 | 8056691357 | 100 |
| 175 | iso_pu_bacteria | 8056875544 | 8056877749 | 100 |
| 176 | 3300009094 | Ga0111539_10097484 | Ga0111539_100974842 | 102 |
| 177 | 3300006038 | Ga0075365_10693248 | Ga0075365_106932482 | 103 |
| 178 | 3300002244 | JGI24742J22300_10056159 | JGI24742J22300_100561592 | 104 |
| 179 | 3300002774 | JGI25150J39212_1004568 | JGI25150J39212_10045684 | 104 |
| 180 | 3300003187 | JGI25151J46595_10032278 | JGI25151J46595_100322782 | 104 |
| 181 | 3300003320 | rootH2_10061177 | rootH2_100611772 | 104 |
| 182 | 3300003323 | rootH1_10104268 | rootH1_101042684 | 104 |
| 183 | 3300005327 | Ga0070658_10136463 | Ga0070658_101364631 | 104 |
| 184 | 3300005328 | Ga0070676_11540057 | Ga0070676_115400571 | 104 |
| 185 | 3300005331 | Ga0070670_101010124 | Ga0070670_1010101242 | 104 |
| 186 | 3300005334 | Ga0068869_100660198 | Ga0068869_1006601981 | 104 |
| 187 | 3300005336 | Ga0070680_100904352 | Ga0070680_1009043521 | 104 |
| 188 | 3300005337 | Ga0070682_100395399 | Ga0070682_1003953991 | 104 |
| 189 | 3300005337 | Ga0070682_100510009 | Ga0070682_1005100091 | 104 |
| 190 | 3300005337 | Ga0070682_101581953 | Ga0070682_1015819531 | 104 |
| 191 | 3300005338 | Ga0068868_101538427 | Ga0068868_1015384272 | 104 |
| 192 | 3300005339 | Ga0070660_100063644 | Ga0070660_1000636442 | 104 |
| 193 | 3300005339 | Ga0070660_100119385 | Ga0070660_1001193852 | 104 |
| 194 | 3300005339 | Ga0070660_100681149 | Ga0070660_1006811492 | 104 |
| 195 | 3300005340 | Ga0070689_100893347 | Ga0070689_1008933472 | 104 |
| 196 | 3300005340 | Ga0070689_101167600 | Ga0070689_1011676002 | 104 |
| 197 | 3300005341 | Ga0070691_10260330 | Ga0070691_102603301 | 104 |
| 198 | 3300005343 | Ga0070687_100032178 | Ga0070687_1000321783 | 104 |
| 199 | 3300005344 | Ga0070661_100402284 | Ga0070661_1004022842 | 104 |
| 200 | 3300005344 | Ga0070661_101892819 | Ga0070661_1018928191 | 104 |
| 201 | 3300005345 | Ga0070692_10198421 | Ga0070692_101984212 | 104 |
| 202 | 3300005347 | Ga0070668_100085455 | Ga0070668_1000854554 | 104 |
| 203 | 3300005347 | Ga0070668_100159129 | Ga0070668_1001591292 | 104 |
| 204 | 3300005347 | Ga0070668_100445378 | Ga0070668_1004453782 | 104 |
| 205 | 3300005347 | Ga0070668_100493870 | Ga0070668_1004938701 | 104 |
| 206 | 3300005353 | Ga0070669_100410377 | Ga0070669_1004103773 | 104 |
| 207 | 3300005353 | Ga0070669_101177780 | Ga0070669_1011777802 | 104 |
| 208 | 3300005353 | Ga0070669_101683811 | Ga0070669_1016838111 | 104 |
| 209 | 3300005354 | Ga0070675_100126736 | Ga0070675_1001267362 | 104 |
| 210 | 3300005355 | Ga0070671_100760213 | Ga0070671_1007602132 | 104 |
| 211 | 3300005356 | Ga0070674_100229913 | Ga0070674_1002299132 | 104 |
| 212 | 3300005356 | Ga0070674_100239610 | Ga0070674_1002396101 | 104 |
| 213 | 3300005356 | Ga0070674_100618044 | Ga0070674_1006180442 | 104 |
| 214 | 3300005364 | Ga0070673_100092112 | Ga0070673_1000921123 | 104 |
| 215 | 3300005364 | Ga0070673_102324819 | Ga0070673_1023248192 | 104 |
| 216 | 3300005365 | Ga0070688_100253166 | Ga0070688_1002531662 | 104 |
| 217 | 3300005366 | Ga0070659_100283117 | Ga0070659_1002831172 | 104 |
| 218 | 3300005366 | Ga0070659_101128352 | Ga0070659_1011283521 | 104 |
| 219 | 3300005367 | Ga0070667_100138172 | Ga0070667_1001381722 | 104 |
| 220 | 3300005367 | Ga0070667_100538464 | Ga0070667_1005384641 | 104 |
| 221 | 3300005435 | Ga0070714_100215391 | Ga0070714_1002153912 | 104 |
| 222 | 3300005438 | Ga0070701_10529756 | Ga0070701_105297562 | 104 |
| 223 | 3300005439 | Ga0070711_101261078 | Ga0070711_1012610781 | 104 |
| 224 | 3300005441 | Ga0070700_101063977 | Ga0070700_1010639772 | 104 |
| 225 | 3300005455 | Ga0070663_100141798 | Ga0070663_1001417981 | 104 |
| 226 | 3300005455 | Ga0070663_100412886 | Ga0070663_1004128862 | 104 |
| 227 | 3300005455 | Ga0070663_100970268 | Ga0070663_1009702682 | 104 |
| 228 | 3300005455 | Ga0070663_101291933 | Ga0070663_1012919332 | 104 |
| 229 | 3300005456 | Ga0070678_100895892 | Ga0070678_1008958921 | 104 |
| 230 | 3300005456 | Ga0070678_101119005 | Ga0070678_1011190052 | 104 |
| 231 | 3300005457 | Ga0070662_100242347 | Ga0070662_1002423472 | 104 |
| 232 | 3300005459 | Ga0068867_100144536 | Ga0068867_1001445362 | 104 |
| 233 | 3300005459 | Ga0068867_100182446 | Ga0068867_1001824462 | 104 |
| 234 | 3300005459 | Ga0068867_100642876 | Ga0068867_1006428761 | 104 |
| 235 | 3300005518 | Ga0070699_102118125 | Ga0070699_1021181251 | 104 |
| 236 | 3300005535 | Ga0070684_100009651 | Ga0070684_1000096513 | 104 |
| 237 | 3300005535 | Ga0070684_102165089 | Ga0070684_1021650891 | 104 |
| 238 | 3300005539 | Ga0068853_100648677 | Ga0068853_1006486772 | 104 |
| 239 | 3300005539 | Ga0068853_100676096 | Ga0068853_1006760962 | 104 |
| 240 | 3300005539 | Ga0068853_101276634 | Ga0068853_1012766342 | 104 |
| 241 | 3300005543 | Ga0070672_100182223 | Ga0070672_1001822232 | 104 |
| 242 | 3300005544 | Ga0070686_100251596 | Ga0070686_1002515961 | 104 |
| 243 | 3300005544 | Ga0070686_100994014 | Ga0070686_1009940141 | 104 |
| 244 | 3300005546 | Ga0070696_101031132 | Ga0070696_1010311322 | 104 |
| 245 | 3300005547 | Ga0070693_100098089 | Ga0070693_1000980892 | 104 |
| 246 | 3300005547 | Ga0070693_100241639 | Ga0070693_1002416392 | 104 |
| 247 | 3300005548 | Ga0070665_100054664 | Ga0070665_1000546642 | 104 |
| 248 | 3300005548 | Ga0070665_100449901 | Ga0070665_1004499012 | 104 |
| 249 | 3300005548 | Ga0070665_100637708 | Ga0070665_1006377082 | 104 |
| 250 | 3300005548 | Ga0070665_101042886 | Ga0070665_1010428862 | 104 |
| 251 | 3300005548 | Ga0070665_101112075 | Ga0070665_1011120751 | 104 |
| 252 | 3300005548 | Ga0070665_101455999 | Ga0070665_1014559991 | 104 |
| 253 | 3300005564 | Ga0070664_100160106 | Ga0070664_1001601062 | 104 |
| 254 | 3300005577 | Ga0068857_100094952 | Ga0068857_1000949522 | 104 |
| 255 | 3300005577 | Ga0068857_101155552 | Ga0068857_1011555522 | 104 |
| 256 | 3300005578 | Ga0068854_100725574 | Ga0068854_1007255742 | 104 |
| 257 | 3300005578 | Ga0068854_100767556 | Ga0068854_1007675562 | 104 |
| 258 | 3300005615 | Ga0070702_100133682 | Ga0070702_1001336822 | 104 |
| 259 | 3300005615 | Ga0070702_100424572 | Ga0070702_1004245722 | 104 |
| 260 | 3300005615 | Ga0070702_100953772 | Ga0070702_1009537722 | 104 |
| 261 | 3300005616 | Ga0068852_100606191 | Ga0068852_1006061912 | 104 |
| 262 | 3300005616 | Ga0068852_101153310 | Ga0068852_1011533102 | 104 |
| 263 | 3300005617 | Ga0068859_101877552 | Ga0068859_1018775521 | 104 |
| 264 | 3300005618 | Ga0068864_100117769 | Ga0068864_1001177692 | 104 |
| 265 | 3300005618 | Ga0068864_100812271 | Ga0068864_1008122712 | 104 |
| 266 | 3300005718 | Ga0068866_10530964 | Ga0068866_105309642 | 104 |
| 267 | 3300005718 | Ga0068866_10587354 | Ga0068866_105873541 | 104 |
| 268 | 3300005719 | Ga0068861_100026842 | Ga0068861_1000268423 | 104 |
| 269 | 3300005719 | Ga0068861_100043262 | Ga0068861_1000432621 | 104 |
| 270 | 3300005719 | Ga0068861_101679600 | Ga0068861_1016796001 | 104 |
| 271 | 3300005840 | Ga0068870_10266369 | Ga0068870_102663692 | 104 |
| 272 | 3300005841 | Ga0068863_100452979 | Ga0068863_1004529792 | 104 |
| 273 | 3300005841 | Ga0068863_101281329 | Ga0068863_1012813291 | 104 |
| 274 | 3300005841 | Ga0068863_101405916 | Ga0068863_1014059162 | 104 |
| 275 | 3300005842 | Ga0068858_100167543 | Ga0068858_1001675432 | 104 |
| 276 | 3300005842 | Ga0068858_100990254 | Ga0068858_1009902542 | 104 |
| 277 | 3300005842 | Ga0068858_101083150 | Ga0068858_1010831502 | 104 |
| 278 | 3300005843 | Ga0068860_100712905 | Ga0068860_1007129052 | 104 |
| 279 | 3300005843 | Ga0068860_101843462 | Ga0068860_1018434621 | 104 |
| 280 | 3300005844 | Ga0068862_100895960 | Ga0068862_1008959602 | 104 |
| 281 | 3300005981 | Ga0081538_10146460 | Ga0081538_101464602 | 104 |
| 282 | 3300005983 | Ga0081540_1000979 | Ga0081540_100097931 | 104 |
| 283 | 3300005983 | Ga0081540_1002120 | Ga0081540_100212010 | 104 |
| 284 | 3300005983 | Ga0081540_1016464 | Ga0081540_10164643 | 104 |
| 285 | 3300005983 | Ga0081540_1062415 | Ga0081540_10624152 | 104 |
| 286 | 3300005983 | Ga0081540_1086805 | Ga0081540_10868052 | 104 |
| 287 | 3300005983 | Ga0081540_1154399 | Ga0081540_11543992 | 104 |
| 288 | 3300005985 | Ga0081539_10355003 | Ga0081539_103550031 | 104 |
| 289 | 3300006028 | Ga0070717_11701812 | Ga0070717_117018122 | 104 |
| 290 | 3300006038 | Ga0075365_10008619 | Ga0075365_100086195 | 104 |
| 291 | 3300006038 | Ga0075365_10040202 | Ga0075365_100402024 | 104 |
| 292 | 3300006038 | Ga0075365_10367933 | Ga0075365_103679332 | 104 |
| 293 | 3300006038 | Ga0075365_10589218 | Ga0075365_105892182 | 104 |
| 294 | 3300006038 | Ga0075365_10654827 | Ga0075365_106548272 | 104 |
| 295 | 3300006042 | Ga0075368_10091715 | Ga0075368_100917152 | 104 |
| 296 | 3300006042 | Ga0075368_10323246 | Ga0075368_103232461 | 104 |
| 297 | 3300006048 | Ga0075363_100206140 | Ga0075363_1002061402 | 104 |
| 298 | 3300006048 | Ga0075363_100346176 | Ga0075363_1003461762 | 104 |
| 299 | 3300006048 | Ga0075363_100393687 | Ga0075363_1003936872 | 104 |
| 300 | 3300006048 | Ga0075363_100801811 | Ga0075363_1008018112 | 104 |
| 301 | 3300006051 | Ga0075364_10051506 | Ga0075364_100515062 | 104 |
| 302 | 3300006051 | Ga0075364_10670220 | Ga0075364_106702201 | 104 |
| 303 | 3300006051 | Ga0075364_10754760 | Ga0075364_107547602 | 104 |
| 304 | 3300006173 | Ga0070716_100073021 | Ga0070716_1000730212 | 104 |
| 305 | 3300006175 | Ga0070712_100170191 | Ga0070712_1001701912 | 104 |
| 306 | 3300006177 | Ga0075362_10307383 | Ga0075362_103073832 | 104 |
| 307 | 3300006178 | Ga0075367_10118707 | Ga0075367_101187072 | 104 |
| 308 | 3300006178 | Ga0075367_10421078 | Ga0075367_104210782 | 104 |
| 309 | 3300006178 | Ga0075367_10689867 | Ga0075367_106898672 | 104 |
| 310 | 3300006186 | Ga0075369_10044595 | Ga0075369_100445952 | 104 |
| 311 | 3300006186 | Ga0075369_10124306 | Ga0075369_101243062 | 104 |
| 312 | 3300006186 | Ga0075369_10466375 | Ga0075369_104663752 | 104 |
| 313 | 3300006195 | Ga0075366_10117831 | Ga0075366_101178313 | 104 |
| 314 | 3300006195 | Ga0075366_10261934 | Ga0075366_102619342 | 104 |
| 315 | 3300006195 | Ga0075366_10267189 | Ga0075366_102671892 | 104 |
| 316 | 3300006195 | Ga0075366_10459588 | Ga0075366_104595882 | 104 |
| 317 | 3300006195 | Ga0075366_10644579 | Ga0075366_106445792 | 104 |
| 318 | 3300006195 | Ga0075366_10717995 | Ga0075366_107179951 | 104 |
| 319 | 3300006237 | Ga0097621_100135878 | Ga0097621_1001358783 | 104 |
| 320 | 3300006237 | Ga0097621_100738133 | Ga0097621_1007381332 | 104 |
| 321 | 3300006353 | Ga0075370_10348549 | Ga0075370_103485492 | 104 |
| 322 | 3300006358 | Ga0068871_100105154 | Ga0068871_1001051543 | 104 |
| 323 | 3300006358 | Ga0068871_100708175 | Ga0068871_1007081752 | 104 |
| 324 | 3300006358 | Ga0068871_100821995 | Ga0068871_1008219952 | 104 |
| 325 | 3300006358 | Ga0068871_101501112 | Ga0068871_1015011121 | 104 |
| 326 | 3300006358 | Ga0068871_101791650 | Ga0068871_1017916502 | 104 |
| 327 | 3300006844 | Ga0075428_100195180 | Ga0075428_1001951803 | 104 |
| 328 | 3300006844 | Ga0075428_100811114 | Ga0075428_1008111142 | 104 |
| 329 | 3300006871 | Ga0075434_100360265 | Ga0075434_1003602652 | 104 |
| 330 | 3300006881 | Ga0068865_100040566 | Ga0068865_1000405662 | 104 |
| 331 | 3300006881 | Ga0068865_100897288 | Ga0068865_1008972882 | 104 |
| 332 | 3300006931 | Ga0097620_101877645 | Ga0097620_1018776451 | 104 |
| 333 | 3300007076 | Ga0075435_102056085 | Ga0075435_1020560851 | 104 |
| 334 | 3300009092 | Ga0105250_10223894 | Ga0105250_102238942 | 104 |
| 335 | 3300009094 | Ga0111539_11381532 | Ga0111539_113815321 | 104 |
| 336 | 3300009098 | Ga0105245_10188809 | Ga0105245_101888093 | 104 |
| 337 | 3300009098 | Ga0105245_10910148 | Ga0105245_109101482 | 104 |
| 338 | 3300009098 | Ga0105245_11232222 | Ga0105245_112322221 | 104 |
| 339 | 3300009101 | Ga0105247_10488649 | Ga0105247_104886492 | 104 |
| 340 | 3300009101 | Ga0105247_10794454 | Ga0105247_107944542 | 104 |
| 341 | 3300009147 | Ga0114129_10053995 | Ga0114129_100539952 | 104 |
| 342 | 3300009147 | Ga0114129_10348949 | Ga0114129_103489492 | 104 |
| 343 | 3300009148 | Ga0105243_10103459 | Ga0105243_101034592 | 104 |
| 344 | 3300009148 | Ga0105243_11721683 | Ga0105243_117216832 | 104 |
| 345 | 3300009174 | Ga0105241_10175477 | Ga0105241_101754772 | 104 |
| 346 | 3300009174 | Ga0105241_11352439 | Ga0105241_113524391 | 104 |
| 347 | 3300009176 | Ga0105242_10385103 | Ga0105242_103851032 | 104 |
| 348 | 3300009176 | Ga0105242_13027976 | Ga0105242_130279761 | 104 |
| 349 | 3300009177 | Ga0105248_10296766 | Ga0105248_102967662 | 104 |
| 350 | 3300009177 | Ga0105248_10419139 | Ga0105248_104191392 | 104 |
| 351 | 3300009545 | Ga0105237_10438266 | Ga0105237_104382662 | 104 |
| 352 | 3300009551 | Ga0105238_10485112 | Ga0105238_104851122 | 104 |
| 353 | 3300009551 | Ga0105238_10801412 | Ga0105238_108014122 | 104 |
| 354 | 3300009551 | Ga0105238_10833253 | Ga0105238_108332532 | 104 |
| 355 | 3300009551 | Ga0105238_11128934 | Ga0105238_111289341 | 104 |
| 356 | 3300009553 | Ga0105249_10253063 | Ga0105249_102530632 | 104 |
| 357 | 3300010375 | Ga0105239_10229598 | Ga0105239_102295983 | 104 |
| 358 | 3300010375 | Ga0105239_11342977 | Ga0105239_113429771 | 104 |
| 359 | 3300010375 | Ga0105239_12590213 | Ga0105239_125902132 | 104 |
| 360 | 3300012500 | Ga0157314_1009460 | Ga0157314_10094601 | 104 |
| 361 | 3300013100 | Ga0157373_10601031 | Ga0157373_106010312 | 104 |
| 362 | 3300013102 | Ga0157371_10303289 | Ga0157371_103032892 | 104 |
| 363 | 3300013104 | Ga0157370_10223111 | Ga0157370_102231112 | 104 |
| 364 | 3300013104 | Ga0157370_10632446 | Ga0157370_106324462 | 104 |
| 365 | 3300013104 | Ga0157370_11054509 | Ga0157370_110545092 | 104 |
| 366 | 3300013105 | Ga0157369_10236078 | Ga0157369_102360782 | 104 |
| 367 | 3300013105 | Ga0157369_10528714 | Ga0157369_105287142 | 104 |
| 368 | 3300013296 | Ga0157374_10718941 | Ga0157374_107189412 | 104 |
| 369 | 3300013296 | Ga0157374_12005856 | Ga0157374_120058561 | 104 |
| 370 | 3300013296 | Ga0157374_12380889 | Ga0157374_123808891 | 104 |
| 371 | 3300013297 | Ga0157378_10151967 | Ga0157378_101519673 | 104 |
| 372 | 3300013297 | Ga0157378_11267419 | Ga0157378_112674191 | 104 |
| 373 | 3300013306 | Ga0163162_10935187 | Ga0163162_109351872 | 104 |
| 374 | 3300013306 | Ga0163162_12937819 | Ga0163162_129378191 | 104 |
| 375 | 3300013307 | Ga0157372_10426876 | Ga0157372_104268762 | 104 |
| 376 | 3300013307 | Ga0157372_11561266 | Ga0157372_115612662 | 104 |
| 377 | 3300013307 | Ga0157372_11570932 | Ga0157372_115709322 | 104 |
| 378 | 3300013308 | Ga0157375_10134785 | Ga0157375_101347853 | 104 |
| 379 | 3300013308 | Ga0157375_10425717 | Ga0157375_104257172 | 104 |
| 380 | 3300013308 | Ga0157375_11085267 | Ga0157375_110852672 | 104 |
| 381 | 3300013308 | Ga0157375_11655899 | Ga0157375_116558991 | 104 |
| 382 | 3300013308 | Ga0157375_12210842 | Ga0157375_122108422 | 104 |
| 383 | 3300014325 | Ga0163163_11997197 | Ga0163163_119971972 | 104 |
| 384 | 3300014325 | Ga0163163_12046122 | Ga0163163_120461221 | 104 |
| 385 | 3300014326 | Ga0157380_10095986 | Ga0157380_100959862 | 104 |
| 386 | 3300014497 | Ga0182008_10224458 | Ga0182008_102244582 | 104 |
| 387 | 3300014745 | Ga0157377_10541486 | Ga0157377_105414862 | 104 |
| 388 | 3300014968 | Ga0157379_10855542 | Ga0157379_108555421 | 104 |
| 389 | 3300014968 | Ga0157379_11152761 | Ga0157379_111527612 | 104 |
| 390 | 3300014969 | Ga0157376_10362954 | Ga0157376_103629542 | 104 |
| 391 | 3300017792 | Ga0163161_10007714 | Ga0163161_100077148 | 104 |
| 392 | 3300017792 | Ga0163161_10478393 | Ga0163161_104783932 | 104 |
| 393 | 3300017792 | Ga0163161_12033858 | Ga0163161_120338581 | 104 |
| 394 | 3300017792 | Ga0163161_12102111 | Ga0163161_121021111 | 104 |
| 395 | 3300025208 | Ga0209436_100001 | Ga0209436_10000123 | 104 |
| 396 | 3300025245 | Ga0207425_1014439 | Ga0207425_10144392 | 104 |
| 397 | 3300025246 | Ga0209646_1007456 | Ga0209646_10074563 | 104 |
| 398 | 3300025258 | Ga0209129_1000750 | Ga0209129_10007506 | 104 |
| 399 | 3300025258 | Ga0209129_1002899 | Ga0209129_10028997 | 104 |
| 400 | 3300025258 | Ga0209129_1003789 | Ga0209129_10037895 | 104 |
| 401 | 3300025273 | Ga0209673_1003813 | Ga0209673_100381310 | 104 |
| 402 | 3300025284 | Ga0209130_1000004 | Ga0209130_100000489 | 104 |
| 403 | 3300025295 | Ga0209564_1000566 | Ga0209564_100056611 | 104 |
| 404 | 3300025297 | Ga0209758_1000468 | Ga0209758_100046865 | 104 |
| 405 | 3300025297 | Ga0209758_1000977 | Ga0209758_100097744 | 104 |
| 406 | 3300025297 | Ga0209758_1002398 | Ga0209758_100239813 | 104 |
| 407 | 3300025299 | Ga0209256_1004862 | Ga0209256_10048626 | 104 |
| 408 | 3300025302 | Ga0207426_1000003 | Ga0207426_1000003639 | 104 |
| 409 | 3300025302 | Ga0207426_1058031 | Ga0207426_10580312 | 104 |
| 410 | 3300025303 | Ga0209051_1017453 | Ga0209051_10174532 | 104 |
| 411 | 3300025304 | Ga0209257_1056832 | Ga0209257_10568322 | 104 |
| 412 | 3300025315 | Ga0207697_10102845 | Ga0207697_101028452 | 104 |
| 413 | 3300025315 | Ga0207697_10260049 | Ga0207697_102600492 | 104 |
| 414 | 3300025893 | Ga0207682_10161166 | Ga0207682_101611662 | 104 |
| 415 | 3300025898 | Ga0207692_10304648 | Ga0207692_103046481 | 104 |
| 416 | 3300025899 | Ga0207642_10063551 | Ga0207642_100635512 | 104 |
| 417 | 3300025899 | Ga0207642_10259927 | Ga0207642_102599272 | 104 |
| 418 | 3300025901 | Ga0207688_10043066 | Ga0207688_100430662 | 104 |
| 419 | 3300025901 | Ga0207688_10431903 | Ga0207688_104319031 | 104 |
| 420 | 3300025904 | Ga0207647_10412067 | Ga0207647_104120671 | 104 |
| 421 | 3300025905 | Ga0207685_10444280 | Ga0207685_104442802 | 104 |
| 422 | 3300025907 | Ga0207645_10233471 | Ga0207645_102334711 | 104 |
| 423 | 3300025909 | Ga0207705_10711821 | Ga0207705_107118212 | 104 |
| 424 | 3300025909 | Ga0207705_11254552 | Ga0207705_112545521 | 104 |
| 425 | 3300025911 | Ga0207654_10076776 | Ga0207654_100767762 | 104 |
| 426 | 3300025911 | Ga0207654_10788706 | Ga0207654_107887062 | 104 |
| 427 | 3300025911 | Ga0207654_11119893 | Ga0207654_111198931 | 104 |
| 428 | 3300025912 | Ga0207707_10019379 | Ga0207707_100193792 | 104 |
| 429 | 3300025914 | Ga0207671_10149205 | Ga0207671_101492052 | 104 |
| 430 | 3300025914 | Ga0207671_10822285 | Ga0207671_108222852 | 104 |
| 431 | 3300025915 | Ga0207693_10032462 | Ga0207693_100324622 | 104 |
| 432 | 3300025917 | Ga0207660_10416470 | Ga0207660_104164702 | 104 |
| 433 | 3300025918 | Ga0207662_10306896 | Ga0207662_103068961 | 104 |
| 434 | 3300025919 | Ga0207657_10051847 | Ga0207657_100518474 | 104 |
| 435 | 3300025919 | Ga0207657_10326391 | Ga0207657_103263912 | 104 |
| 436 | 3300025919 | Ga0207657_10362697 | Ga0207657_103626972 | 104 |
| 437 | 3300025920 | Ga0207649_10162924 | Ga0207649_101629242 | 104 |
| 438 | 3300025921 | Ga0207652_10210138 | Ga0207652_102101382 | 104 |
| 439 | 3300025924 | Ga0207694_10372510 | Ga0207694_103725102 | 104 |
| 440 | 3300025924 | Ga0207694_10504134 | Ga0207694_105041342 | 104 |
| 441 | 3300025924 | Ga0207694_11106399 | Ga0207694_111063991 | 104 |
| 442 | 3300025925 | Ga0207650_10348073 | Ga0207650_103480732 | 104 |
| 443 | 3300025925 | Ga0207650_10435607 | Ga0207650_104356072 | 104 |
| 444 | 3300025925 | Ga0207650_11531618 | Ga0207650_115316182 | 104 |
| 445 | 3300025927 | Ga0207687_10116148 | Ga0207687_101161482 | 104 |
| 446 | 3300025927 | Ga0207687_10768177 | Ga0207687_107681772 | 104 |
| 447 | 3300025932 | Ga0207690_10063181 | Ga0207690_100631812 | 104 |
| 448 | 3300025932 | Ga0207690_10418464 | Ga0207690_104184642 | 104 |
| 449 | 3300025933 | Ga0207706_10071719 | Ga0207706_100717194 | 104 |
| 450 | 3300025933 | Ga0207706_10344325 | Ga0207706_103443252 | 104 |
| 451 | 3300025933 | Ga0207706_10872649 | Ga0207706_108726491 | 104 |
| 452 | 3300025935 | Ga0207709_10054475 | Ga0207709_100544752 | 104 |
| 453 | 3300025935 | Ga0207709_11817843 | Ga0207709_118178431 | 104 |
| 454 | 3300025935 | Ga0207709_11824144 | Ga0207709_118241442 | 104 |
| 455 | 3300025936 | Ga0207670_11415565 | Ga0207670_114155652 | 104 |
| 456 | 3300025937 | Ga0207669_10075249 | Ga0207669_100752492 | 104 |
| 457 | 3300025937 | Ga0207669_10324539 | Ga0207669_103245392 | 104 |
| 458 | 3300025937 | Ga0207669_11205343 | Ga0207669_112053431 | 104 |
| 459 | 3300025938 | Ga0207704_11733015 | Ga0207704_117330151 | 104 |
| 460 | 3300025939 | Ga0207665_10054296 | Ga0207665_100542963 | 104 |
| 461 | 3300025940 | Ga0207691_10109172 | Ga0207691_101091722 | 104 |
| 462 | 3300025940 | Ga0207691_10670634 | Ga0207691_106706342 | 104 |
| 463 | 3300025941 | Ga0207711_10025904 | Ga0207711_100259042 | 104 |
| 464 | 3300025941 | Ga0207711_10057138 | Ga0207711_100571382 | 104 |
| 465 | 3300025942 | Ga0207689_10980980 | Ga0207689_109809802 | 104 |
| 466 | 3300025944 | Ga0207661_10036554 | Ga0207661_100365542 | 104 |
| 467 | 3300025945 | Ga0207679_10714646 | Ga0207679_107146462 | 104 |
| 468 | 3300025960 | Ga0207651_10101766 | Ga0207651_101017662 | 104 |
| 469 | 3300025960 | Ga0207651_10317379 | Ga0207651_103173792 | 104 |
| 470 | 3300025961 | Ga0207712_10115895 | Ga0207712_101158953 | 104 |
| 471 | 3300025972 | Ga0207668_10083578 | Ga0207668_100835782 | 104 |
| 472 | 3300025972 | Ga0207668_10576758 | Ga0207668_105767581 | 104 |
| 473 | 3300025972 | Ga0207668_10749525 | Ga0207668_107495252 | 104 |
| 474 | 3300025972 | Ga0207668_10952966 | Ga0207668_109529662 | 104 |
| 475 | 3300025981 | Ga0207640_11989356 | Ga0207640_119893561 | 104 |
| 476 | 3300025986 | Ga0207658_10665562 | Ga0207658_106655622 | 104 |
| 477 | 3300025986 | Ga0207658_10815411 | Ga0207658_108154112 | 104 |
| 478 | 3300025986 | Ga0207658_10919048 | Ga0207658_109190482 | 104 |
| 479 | 3300026023 | Ga0207677_10845390 | Ga0207677_108453902 | 104 |
| 480 | 3300026023 | Ga0207677_12003421 | Ga0207677_120034211 | 104 |
| 481 | 3300026035 | Ga0207703_10054622 | Ga0207703_100546224 | 104 |
| 482 | 3300026035 | Ga0207703_10187420 | Ga0207703_101874201 | 104 |
| 483 | 3300026035 | Ga0207703_10354760 | Ga0207703_103547602 | 104 |
| 484 | 3300026035 | Ga0207703_10636086 | Ga0207703_106360862 | 104 |
| 485 | 3300026067 | Ga0207678_10019138 | Ga0207678_100191381 | 104 |
| 486 | 3300026067 | Ga0207678_10301805 | Ga0207678_103018052 | 104 |
| 487 | 3300026067 | Ga0207678_10353675 | Ga0207678_103536752 | 104 |
| 488 | 3300026067 | Ga0207678_11384972 | Ga0207678_113849722 | 104 |
| 489 | 3300026067 | Ga0207678_11543787 | Ga0207678_115437872 | 104 |
| 490 | 3300026075 | Ga0207708_10242601 | Ga0207708_102426012 | 104 |
| 491 | 3300026075 | Ga0207708_10245582 | Ga0207708_102455822 | 104 |
| 492 | 3300026075 | Ga0207708_10578217 | Ga0207708_105782172 | 104 |
| 493 | 3300026078 | Ga0207702_10048792 | Ga0207702_100487923 | 104 |
| 494 | 3300026078 | Ga0207702_10446278 | Ga0207702_104462782 | 104 |
| 495 | 3300026088 | Ga0207641_10218805 | Ga0207641_102188052 | 104 |
| 496 | 3300026088 | Ga0207641_11883783 | Ga0207641_118837831 | 104 |
| 497 | 3300026089 | Ga0207648_10221230 | Ga0207648_102212302 | 104 |
| 498 | 3300026089 | Ga0207648_10245979 | Ga0207648_102459792 | 104 |
| 499 | 3300026089 | Ga0207648_10635668 | Ga0207648_106356682 | 104 |
| 500 | 3300026095 | Ga0207676_10101932 | Ga0207676_101019321 | 104 |
| 501 | 3300026116 | Ga0207674_10562356 | Ga0207674_105623562 | 104 |
| 502 | 3300026116 | Ga0207674_10612509 | Ga0207674_106125092 | 104 |
| 503 | 3300026118 | Ga0207675_100016940 | Ga0207675_1000169404 | 104 |
| 504 | 3300026118 | Ga0207675_102261919 | Ga0207675_1022619191 | 104 |
| 505 | 3300026121 | Ga0207683_10164919 | Ga0207683_101649192 | 104 |
| 506 | 3300026121 | Ga0207683_10727754 | Ga0207683_107277541 | 104 |
| 507 | 3300026121 | Ga0207683_10839005 | Ga0207683_108390052 | 104 |
| 508 | 3300026121 | Ga0207683_11952133 | Ga0207683_119521331 | 104 |
| 509 | 3300026142 | Ga0207698_10156543 | Ga0207698_101565432 | 104 |
| 510 | 3300026142 | Ga0207698_10500187 | Ga0207698_105001872 | 104 |
| 511 | 3300027866 | Ga0209813_10101472 | Ga0209813_101014722 | 104 |
| 512 | 3300027866 | Ga0209813_10111513 | Ga0209813_101115132 | 104 |
| 513 | 3300027907 | Ga0207428_10387327 | Ga0207428_103873272 | 104 |
| 514 | 3300028379 | Ga0268266_10003390 | Ga0268266_1000339012 | 104 |
| 515 | 3300028379 | Ga0268266_10074725 | Ga0268266_100747252 | 104 |
| 516 | 3300028379 | Ga0268266_10121010 | Ga0268266_101210102 | 104 |
| 517 | 3300028379 | Ga0268266_10514936 | Ga0268266_105149362 | 104 |
| 518 | 3300028379 | Ga0268266_10764908 | Ga0268266_107649082 | 104 |
| 519 | 3300028379 | Ga0268266_11468938 | Ga0268266_114689382 | 104 |
| 520 | 3300028379 | Ga0268266_11945621 | Ga0268266_119456212 | 104 |
| 521 | 3300028380 | Ga0268265_10044700 | Ga0268265_100447002 | 104 |
| 522 | 3300028380 | Ga0268265_10662773 | Ga0268265_106627732 | 104 |
| 523 | 3300028380 | Ga0268265_10724805 | Ga0268265_107248051 | 104 |
| 524 | 3300028380 | Ga0268265_12255301 | Ga0268265_122553011 | 104 |
| 525 | 3300028381 | Ga0268264_10927143 | Ga0268264_109271432 | 104 |
| 526 | 3300028381 | Ga0268264_11107421 | Ga0268264_111074212 | 104 |
| 527 | 3300028794 | Ga0307515_10001393 | Ga0307515_1000139344 | 104 |
| 528 | 3300028794 | Ga0307515_10021427 | Ga0307515_100214273 | 104 |
| 529 | 3300031456 | Ga0307513_10011737 | Ga0307513_1001173714 | 104 |
| 530 | 3300031616 | Ga0307508_10031547 | Ga0307508_100315474 | 104 |
| 531 | 3300031616 | Ga0307508_10245074 | Ga0307508_102450742 | 104 |
| 532 | 3300031730 | Ga0307516_10448431 | Ga0307516_104484312 | 104 |
| 533 | 3300032126 | Ga0307415_100701851 | Ga0307415_1007018512 | 104 |
| 534 | 3300033180 | Ga0307510_10078712 | Ga0307510_100787124 | 104 |
| 535 | 3300033442 | Ga0315911_1000006 | Ga0315911_10000066 | 104 |
| 536 | 3300034818 | Ga0373950_0133437 | Ga0373950_0133437_178_492 | 104 |
| 537 | 3300035170 | Ga0373943_0182569 | Ga0373943_0182569_313_627 | 104 |
| 538 | 3300035692 | Ga0373935_0209912 | Ga0373935_0209912_477_791 | 104 |
| 539 | 3300035725 | Ga0373947_0059831 | Ga0373947_0059831_201_515 | 104 |
| 540 | 3300035725 | Ga0373947_0752927 | Ga0373947_0752927_35_352 | 104 |
| 541 | 3300037068 | Ga0373925_0299820 | Ga0373925_0299820_253_567 | 104 |
| 542 | 3300037068 | Ga0373925_1169365 | Ga0373925_1169365_240_557 | 104 |
| 543 | 3300037312 | Ga0395899_0056456 | Ga0395899_0056456_1493_1807 | 104 |
| 544 | 3300037418 | Ga0395900_0012534 | Ga0395900_0012534_4509_4823 | 104 |
| 545 | 3300037418 | Ga0395900_0076909 | Ga0395900_0076909_2525_2854 | 104 |
| 546 | 3300037466 | Ga0395898_0025456 | Ga0395898_0025456_5002_5316 | 104 |
| 547 | 3300037466 | Ga0395898_0030570 | Ga0395898_0030570_638_967 | 104 |
| 548 | 3300037471 | Ga0395905_0002553 | Ga0395905_0002553_6460_6789 | 104 |
| 549 | 3300038443 | Ga0395901_0028377 | Ga0395901_0028377_2873_3202 | 104 |
| 550 | 3300041413 | Ga0439465_0079791 | Ga0439465_0079791_31_345 | 104 |
| 551 | 3300041413 | Ga0439465_0208685 | Ga0439465_0208685_74_391 | 104 |
| 552 | 3300041443 | Ga0451789_0589456 | Ga0451789_0589456_307_627 | 104 |
| 553 | 3300041451 | Ga0451791_0313286 | Ga0451791_0313286_622_936 | 104 |
| 554 | 3300041453 | Ga0451797_0174660 | Ga0451797_0174660_139_459 | 104 |
| 555 | 3300041453 | Ga0451797_0692193 | Ga0451797_0692193_46_369 | 104 |
| 556 | 3300041453 | Ga0451797_1503990 | Ga0451797_1503990_52_366 | 104 |
| 557 | 3300041458 | Ga0451798_0348921 | Ga0451798_0348921_240_554 | 104 |
| 558 | 3300041459 | Ga0451800_0241826 | Ga0451800_0241826_114_437 | 104 |
| 559 | 3300041459 | Ga0451800_0935838 | Ga0451800_0935838_116_430 | 104 |
| 560 | 3300041463 | Ga0451804_0084282 | Ga0451804_0084282_107_430 | 104 |
| 561 | 3300041486 | Ga0451807_1711485 | Ga0451807_1711485_144_458 | 104 |
| 562 | 3300041496 | Ga0451839_0403398 | Ga0451839_0403398_328_642 | 104 |
| 563 | 3300041501 | Ga0451845_0035050 | Ga0451845_0035050_28_342 | 104 |
| 564 | 3300041503 | Ga0451847_0253765 | Ga0451847_0253765_47_361 | 104 |
| 565 | 3300041505 | Ga0451849_1402645 | Ga0451849_1402645_393_707 | 104 |
| 566 | 3300041507 | Ga0451851_0518039 | Ga0451851_0518039_164_478 | 104 |
| 567 | 3300041512 | Ga0451853_3398724 | Ga0451853_3398724_160_474 | 104 |
| 568 | 3300044684 | Ga0466966_0146212 | Ga0466966_0146212_970_1284 | 104 |
| 569 | 3300044694 | Ga0466963_0259700 | Ga0466963_0259700_708_1022 | 104 |
| 570 | 3300044719 | Ga0466971_0129724 | Ga0466971_0129724_218_532 | 104 |
| 571 | 3300044765 | Ga0466970_0028377 | Ga0466970_0028377_974_1288 | 104 |
| 572 | 3300045049 | Ga0466959_0072284 | Ga0466959_0072284_1281_1595 | 104 |
| 573 | 3300045976 | Ga0466967_0259907 | Ga0466967_0259907_624_938 | 104 |
| 574 | 3300045976 | Ga0466967_1361779 | Ga0466967_1361779_306_623 | 104 |
| 575 | 3300046454 | Ga0495592_0050253 | Ga0495592_0050253_1451_1765 | 104 |
| 576 | 3300046455 | Ga0495603_0019982 | Ga0495603_0019982_3049_3366 | 104 |
| 577 | 3300046457 | Ga0495590_0155640 | Ga0495590_0155640_304_618 | 104 |
| 578 | 3300046457 | Ga0495590_0355096 | Ga0495590_0355096_36_353 | 104 |
| 579 | 3300046460 | Ga0495638_0004182 | Ga0495638_0004182_2463_2777 | 104 |
| 580 | 3300046460 | Ga0495638_0029879 | Ga0495638_0029879_472_786 | 104 |
| 581 | 3300046460 | Ga0495638_0514339 | Ga0495638_0514339_49_363 | 104 |
| 582 | 3300046461 | Ga0495641_0397548 | Ga0495641_0397548_300_614 | 104 |
| 583 | 3300046471 | Ga0495650_0171527 | Ga0495650_0171527_29_343 | 104 |
| 584 | 3300046472 | Ga0495580_0310275 | Ga0495580_0310275_587_901 | 104 |
| 585 | 3300046474 | Ga0495605_0000882 | Ga0495605_0000882_7833_8147 | 104 |
| 586 | 3300046475 | Ga0495639_0010705 | Ga0495639_0010705_2974_3291 | 104 |
| 587 | 3300046475 | Ga0495639_0524303 | Ga0495639_0524303_261_575 | 104 |
| 588 | 3300046476 | Ga0495662_0356199 | Ga0495662_0356199_122_436 | 104 |
| 589 | 3300046477 | Ga0495664_0007342 | Ga0495664_0007342_3892_4206 | 104 |
| 590 | 3300046477 | Ga0495664_0114850 | Ga0495664_0114850_120_434 | 104 |
| 591 | 3300046491 | Ga0495584_0105602 | Ga0495584_0105602_939_1253 | 104 |
| 592 | 3300046492 | Ga0495585_0034342 | Ga0495585_0034342_2272_2586 | 104 |
| 593 | 3300046492 | Ga0495585_0142526 | Ga0495585_0142526_234_551 | 104 |
| 594 | 3300046492 | Ga0495585_0359038 | Ga0495585_0359038_85_399 | 104 |
| 595 | 3300046499 | Ga0495594_0158117 | Ga0495594_0158117_874_1188 | 104 |
| 596 | 3300046500 | Ga0495596_0090464 | Ga0495596_0090464_647_961 | 104 |
| 597 | 3300046500 | Ga0495596_0243911 | Ga0495596_0243911_51_365 | 104 |
| 598 | 3300046501 | Ga0495607_0050852 | Ga0495607_0050852_1624_1938 | 104 |
| 599 | 3300046506 | Ga0495583_0016358 | Ga0495583_0016358_3117_3431 | 104 |
| 600 | 3300046507 | Ga0495606_0032075 | Ga0495606_0032075_1638_1952 | 104 |
| 601 | 3300046507 | Ga0495606_0080822 | Ga0495606_0080822_1010_1324 | 104 |
| 602 | 3300046507 | Ga0495606_0301535 | Ga0495606_0301535_299_616 | 104 |
| 603 | 3300046511 | Ga0495608_0259714 | Ga0495608_0259714_378_692 | 104 |
| 604 | 3300046512 | Ga0495610_0026067 | Ga0495610_0026067_1128_1445 | 104 |
| 605 | 3300046512 | Ga0495610_0090811 | Ga0495610_0090811_813_1127 | 104 |
| 606 | 3300046513 | Ga0495616_0172638 | Ga0495616_0172638_212_526 | 104 |
| 607 | 3300046515 | Ga0495620_0042448 | Ga0495620_0042448_23_337 | 104 |
| 608 | 3300046516 | Ga0495628_0114288 | Ga0495628_0114288_597_911 | 104 |
| 609 | 3300046516 | Ga0495628_0661467 | Ga0495628_0661467_41_355 | 104 |
| 610 | 3300046518 | Ga0495631_0026994 | Ga0495631_0026994_2166_2480 | 104 |
| 611 | 3300046518 | Ga0495631_0134718 | Ga0495631_0134718_438_752 | 104 |
| 612 | 3300046518 | Ga0495631_0169944 | Ga0495631_0169944_169_483 | 104 |
| 613 | 3300046518 | Ga0495631_0417383 | Ga0495631_0417383_113_427 | 104 |
| 614 | 3300046519 | Ga0495632_0066757 | Ga0495632_0066757_1274_1588 | 104 |
| 615 | 3300046522 | Ga0495643_0030117 | Ga0495643_0030117_1201_1518 | 104 |
| 616 | 3300046522 | Ga0495643_0107297 | Ga0495643_0107297_670_984 | 104 |
| 617 | 3300046524 | Ga0495648_0104555 | Ga0495648_0104555_701_1015 | 104 |
| 618 | 3300046524 | Ga0495648_0164241 | Ga0495648_0164241_443_757 | 104 |
| 619 | 3300046524 | Ga0495648_0280343 | Ga0495648_0280343_125_442 | 104 |
| 620 | 3300046525 | Ga0495663_0013581 | Ga0495663_0013581_34_348 | 104 |
| 621 | 3300046525 | Ga0495663_0057601 | Ga0495663_0057601_172_489 | 104 |
| 622 | 3300046526 | Ga0495666_0231368 | Ga0495666_0231368_239_556 | 104 |
| 623 | 3300046529 | Ga0495652_0111683 | Ga0495652_0111683_713_1027 | 104 |
| 624 | 3300046530 | Ga0495654_0114022 | Ga0495654_0114022_684_998 | 104 |
| 625 | 3300046530 | Ga0495654_0176616 | Ga0495654_0176616_349_663 | 104 |
| 626 | 3300046536 | Ga0495587_0219184 | Ga0495587_0219184_476_790 | 104 |
| 627 | 3300046537 | Ga0495598_0106697 | Ga0495598_0106697_374_688 | 104 |
| 628 | 3300046537 | Ga0495598_0213037 | Ga0495598_0213037_102_419 | 104 |
| 629 | 3300046538 | Ga0495609_0082805 | Ga0495609_0082805_742_1059 | 104 |
| 630 | 3300046538 | Ga0495609_0243715 | Ga0495609_0243715_252_566 | 104 |
| 631 | 3300046539 | Ga0495621_0104389 | Ga0495621_0104389_368_685 | 104 |
| 632 | 3300046542 | Ga0495597_0077349 | Ga0495597_0077349_130_444 | 104 |
| 633 | 3300046543 | Ga0495645_0005428 | Ga0495645_0005428_6436_6750 | 104 |
| 634 | 3300046543 | Ga0495645_0271759 | Ga0495645_0271759_429_743 | 104 |
| 635 | 3300046557 | Ga0495622_0179375 | Ga0495622_0179375_458_775 | 104 |
| 636 | 3300046558 | Ga0495633_0165467 | Ga0495633_0165467_527_841 | 104 |
| 637 | 3300046559 | Ga0495667_0038917 | Ga0495667_0038917_1606_1920 | 104 |
| 638 | 3300046615 | Ga0495656_0065604 | Ga0495656_0065604_274_588 | 104 |
| 639 | 3300046615 | Ga0495656_0065673 | Ga0495656_0065673_282_596 | 104 |
| 640 | 3300046615 | Ga0495656_0648005 | Ga0495656_0648005_146_460 | 104 |
| 641 | 3300046616 | Ga0495668_0010544 | Ga0495668_0010544_3762_4076 | 104 |
| 642 | 3300046616 | Ga0495668_0162294 | Ga0495668_0162294_792_1106 | 104 |
| 643 | 3300046616 | Ga0495668_0198652 | Ga0495668_0198652_282_596 | 104 |
| 644 | 3300046616 | Ga0495668_0322551 | Ga0495668_0322551_168_482 | 104 |
| 645 | 3300046616 | Ga0495668_0687770 | Ga0495668_0687770_94_417 | 104 |
| 646 | 3300046642 | Ga0495634_0115841 | Ga0495634_0115841_693_1007 | 104 |
| 647 | 3300046648 | Ga0495611_0055449 | Ga0495611_0055449_1066_1380 | 104 |
| 648 | 3300046648 | Ga0495611_0245141 | Ga0495611_0245141_97_411 | 104 |
| 649 | 3300046660 | Ga0495625_0006043 | Ga0495625_0006043_8067_8381 | 104 |
| 650 | 3300046660 | Ga0495625_0334995 | Ga0495625_0334995_237_551 | 104 |
| 651 | 3300046660 | Ga0495625_0711140 | Ga0495625_0711140_184_507 | 104 |
| 652 | 3300046663 | Ga0495635_0019609 | Ga0495635_0019609_795_1109 | 104 |
| 653 | 3300046664 | Ga0495659_0000001 | Ga0495659_0000001_275509_275823 | 104 |
| 654 | 3300046664 | Ga0495659_0200695 | Ga0495659_0200695_127_441 | 104 |
| 655 | 3300046674 | Ga0495588_0005074 | Ga0495588_0005074_2431_2748 | 104 |
| 656 | 3300046675 | Ga0495657_0005171 | Ga0495657_0005171_6203_6517 | 104 |
| 657 | 3300046678 | Ga0495599_0034262 | Ga0495599_0034262_1157_1471 | 104 |
| 658 | 3300046678 | Ga0495599_0065984 | Ga0495599_0065984_813_1127 | 104 |
| 659 | 3300046679 | Ga0495623_0016633 | Ga0495623_0016633_2121_2435 | 104 |
| 660 | 3300046680 | Ga0495646_0037433 | Ga0495646_0037433_342_656 | 104 |
| 661 | 3300046680 | Ga0495646_0087925 | Ga0495646_0087925_1457_1771 | 104 |
| 662 | 3300046683 | Ga0495658_0080762 | Ga0495658_0080762_652_966 | 104 |
| 663 | 3300046684 | Ga0495669_0051414 | Ga0495669_0051414_189_503 | 104 |
| 664 | 3300046689 | Ga0495613_0014966 | Ga0495613_0014966_3202_3516 | 104 |
| 665 | 3300046690 | Ga0495624_0273011 | Ga0495624_0273011_24_338 | 104 |
| 666 | 3300046690 | Ga0495624_0308663 | Ga0495624_0308663_614_931 | 104 |
| 667 | 3300046690 | Ga0495624_0351621 | Ga0495624_0351621_172_486 | 104 |
| 668 | 3300046691 | Ga0495670_0024618 | Ga0495670_0024618_1260_1574 | 104 |
| 669 | 3300046692 | Ga0495671_0000035 | Ga0495671_0000035_132479_132793 | 104 |
| 670 | 3300046692 | Ga0495671_0198892 | Ga0495671_0198892_435_758 | 104 |
| 671 | 3300046692 | Ga0495671_0475106 | Ga0495671_0475106_147_464 | 104 |
| 672 | 3300046694 | Ga0495649_0024030 | Ga0495649_0024030_1572_1889 | 104 |
| 673 | 3300046794 | Ga0495589_0441862 | Ga0495589_0441862_136_450 | 104 |
| 674 | 3300046809 | Ga0495600_0058255 | Ga0495600_0058255_511_825 | 104 |
| 675 | 3300046810 | Ga0495660_0009064 | Ga0495660_0009064_5017_5331 | 104 |
| 676 | 3300046810 | Ga0495660_0017169 | Ga0495660_0017169_1693_2007 | 104 |
| 677 | 3300046810 | Ga0495660_0080596 | Ga0495660_0080596_762_1076 | 104 |
| 678 | 3300047317 | Ga0495604_0019135 | Ga0495604_0019135_3559_3873 | 104 |
| 679 | 3300047317 | Ga0495604_0230915 | Ga0495604_0230915_221_535 | 104 |
| 680 | 3300047318 | Ga0495636_0090785 | Ga0495636_0090785_514_828 | 104 |
| 681 | 3300047319 | Ga0495674_0010589 | Ga0495674_0010589_4737_5051 | 104 |
| 682 | 3300047320 | Ga0495672_0000066 | Ga0495672_0000066_76823_77137 | 104 |
| 683 | 3300047320 | Ga0495672_0012040 | Ga0495672_0012040_2381_2695 | 104 |
| 684 | 3300047320 | Ga0495672_0052403 | Ga0495672_0052403_1348_1662 | 104 |
| 685 | 3300047320 | Ga0495672_0175862 | Ga0495672_0175862_318_632 | 104 |
| 686 | 3300047320 | Ga0495672_0335535 | Ga0495672_0335535_357_671 | 104 |
| 687 | 3300047321 | Ga0495676_0293471 | Ga0495676_0293471_720_1034 | 104 |
| 688 | 3300047322 | Ga0495680_0008649 | Ga0495680_0008649_393_707 | 104 |
| 689 | 3300047323 | Ga0495683_0391727 | Ga0495683_0391727_189_506 | 104 |
| 690 | 3300047444 | Ga0495675_0003429 | Ga0495675_0003429_8788_9102 | 104 |
| 691 | 3300047445 | Ga0495677_0045869 | Ga0495677_0045869_1081_1395 | 104 |
| 692 | 3300047469 | Ga0495673_0141652 | Ga0495673_0141652_143_457 | 104 |
| 693 | 3300047469 | Ga0495673_0183913 | Ga0495673_0183913_453_767 | 104 |
| 694 | 3300047469 | Ga0495673_0198737 | Ga0495673_0198737_413_736 | 104 |
| 695 | 3300047470 | Ga0495681_0166983 | Ga0495681_0166983_21_335 | 104 |
| 696 | 3300047471 | Ga0495684_0087439 | Ga0495684_0087439_615_929 | 104 |
| 697 | 3300047472 | Ga0495686_0084708 | Ga0495686_0084708_716_1030 | 104 |
| 698 | 3300047472 | Ga0495686_0179669 | Ga0495686_0179669_417_731 | 104 |
| 699 | 3300047472 | Ga0495686_0216632 | Ga0495686_0216632_456_770 | 104 |
| 700 | 3300048088 | Ga0495602_0009971 | Ga0495602_0009971_6227_6541 | 104 |
| 701 | 3300048090 | Ga0495615_0056467 | Ga0495615_0056467_692_1006 | 104 |
| 702 | 3300048090 | Ga0495615_0238906 | Ga0495615_0238906_88_405 | 104 |
| 703 | 3300048091 | Ga0495626_0053772 | Ga0495626_0053772_873_1190 | 104 |
| 704 | 3300048091 | Ga0495626_0301367 | Ga0495626_0301367_284_598 | 104 |
| 705 | 3300048903 | Ga0496100_0018898 | Ga0496100_0018898_3331_3645 | 104 |
| 706 | 3300048903 | Ga0496100_0624579 | Ga0496100_0624579_102_416 | 104 |
| 707 | 3300048903 | Ga0496100_1139752 | Ga0496100_1139752_238_552 | 104 |
| 708 | 3300048904 | Ga0496101_0553999 | Ga0496101_0553999_399_713 | 104 |
| 709 | 3300048904 | Ga0496101_0772542 | Ga0496101_0772542_11_325 | 104 |
| 710 | 3300048905 | Ga0496102_0264305 | Ga0496102_0264305_753_1067 | 104 |
| 711 | 3300048905 | Ga0496102_0843607 | Ga0496102_0843607_332_646 | 104 |
| 712 | 3300048905 | Ga0496102_0897480 | Ga0496102_0897480_122_436 | 104 |
| 713 | 3300048905 | Ga0496102_1428297 | Ga0496102_1428297_242_556 | 104 |
| 714 | 3300048906 | Ga0496103_0082121 | Ga0496103_0082121_1696_2010 | 104 |
| 715 | 3300048907 | Ga0496104_0254219 | Ga0496104_0254219_215_529 | 104 |
| 716 | 3300048907 | Ga0496104_0414267 | Ga0496104_0414267_725_1039 | 104 |
| 717 | 3300048909 | Ga0496106_0227948 | Ga0496106_0227948_602_916 | 104 |
| 718 | 3300048909 | Ga0496106_0349388 | Ga0496106_0349388_788_1102 | 104 |
| 719 | 3300048909 | Ga0496106_0685787 | Ga0496106_0685787_339_653 | 104 |
| 720 | 3300048909 | Ga0496106_1170744 | Ga0496106_1170744_114_428 | 104 |
| 721 | 3300048910 | Ga0496107_0022694 | Ga0496107_0022694_1164_1478 | 104 |
| 722 | 3300048911 | Ga0496108_0287153 | Ga0496108_0287153_829_1143 | 104 |
| 723 | 3300048912 | Ga0496109_0074991 | Ga0496109_0074991_2574_2888 | 104 |
| 724 | 3300048915 | Ga0496112_0759066 | Ga0496112_0759066_544_858 | 104 |
| 725 | 3300048917 | Ga0496114_0990009 | Ga0496114_0990009_326_640 | 104 |
| 726 | 3300048918 | Ga0496115_0475818 | Ga0496115_0475818_357_671 | 104 |
| 727 | 3300048918 | Ga0496115_1153571 | Ga0496115_1153571_41_355 | 104 |
| 728 | 3300048919 | Ga0496116_0042554 | Ga0496116_0042554_2703_3020 | 104 |
| 729 | 3300048920 | Ga0496117_0076506 | Ga0496117_0076506_1202_1516 | 104 |
| 730 | 3300048920 | Ga0496117_0590343 | Ga0496117_0590343_159_476 | 104 |
| 731 | 3300048921 | Ga0496118_0046965 | Ga0496118_0046965_2703_3020 | 104 |
| 732 | 3300048921 | Ga0496118_0060931 | Ga0496118_0060931_691_1005 | 104 |
| 733 | 3300048921 | Ga0496118_0337355 | Ga0496118_0337355_329_643 | 104 |
| 734 | 3300048921 | Ga0496118_0398540 | Ga0496118_0398540_60_374 | 104 |
| 735 | 3300048923 | Ga0496120_0114125 | Ga0496120_0114125_731_1045 | 104 |
| 736 | 3300048924 | Ga0496121_0007499 | Ga0496121_0007499_7528_7842 | 104 |
| 737 | 3300048924 | Ga0496121_0042459 | Ga0496121_0042459_3593_3907 | 104 |
| 738 | 3300048924 | Ga0496121_0048693 | Ga0496121_0048693_2252_2566 | 104 |
| 739 | 3300048924 | Ga0496121_0090484 | Ga0496121_0090484_1631_1948 | 104 |
| 740 | 3300048924 | Ga0496121_0165387 | Ga0496121_0165387_344_661 | 104 |
| 741 | 3300048924 | Ga0496121_0197453 | Ga0496121_0197453_820_1134 | 104 |
| 742 | 3300048924 | Ga0496121_0381963 | Ga0496121_0381963_155_469 | 104 |
| 743 | 3300048924 | Ga0496121_0430740 | Ga0496121_0430740_419_733 | 104 |
| 744 | 3300048925 | Ga0496122_0029922 | Ga0496122_0029922_787_1104 | 104 |
| 745 | 3300048926 | Ga0496123_0131374 | Ga0496123_0131374_970_1287 | 104 |
| 746 | 3300048926 | Ga0496123_0283718 | Ga0496123_0283718_225_539 | 104 |
| 747 | 3300048927 | Ga0496124_0455107 | Ga0496124_0455107_215_532 | 104 |
| 748 | 3300048927 | Ga0496124_0549259 | Ga0496124_0549259_385_699 | 104 |
| 749 | 3300048927 | Ga0496124_0737022 | Ga0496124_0737022_181_495 | 104 |
| 750 | 3300048928 | Ga0496125_0000272 | Ga0496125_0000272_222_536 | 104 |
| 751 | 3300048928 | Ga0496125_0003504 | Ga0496125_0003504_15865_16179 | 104 |
| 752 | 3300048928 | Ga0496125_0242611 | Ga0496125_0242611_662_976 | 104 |
| 753 | 3300048928 | Ga0496125_0396184 | Ga0496125_0396184_137_451 | 104 |
| 754 | 3300048929 | Ga0496126_0157364 | Ga0496126_0157364_1182_1496 | 104 |
| 755 | 3300048929 | Ga0496126_0223066 | Ga0496126_0223066_21_335 | 104 |
| 756 | 3300048929 | Ga0496126_0566258 | Ga0496126_0566258_327_641 | 104 |
| 757 | 3300048929 | Ga0496126_0820230 | Ga0496126_0820230_226_540 | 104 |
| 758 | 3300048929 | Ga0496126_1310803 | Ga0496126_1310803_179_493 | 104 |
| 759 | 3300049459 | Ga0495678_054826 | Ga0495678_054826_24_338 | 104 |
| 760 | 3300049460 | Ga0495682_0027769 | Ga0495682_0027769_1431_1745 | 104 |
| 761 | 3300049460 | Ga0495682_0124187 | Ga0495682_0124187_534_848 | 104 |
| 762 | 3300049568 | Ga0501031_0080173 | Ga0501031_0080173_851_1165 | 104 |
| 763 | 3300049568 | Ga0501031_0275193 | Ga0501031_0275193_679_993 | 104 |
| 764 | 3300049569 | Ga0501032_0000129 | Ga0501032_0000129_45305_45619 | 104 |
| 765 | 3300049570 | Ga0501033_0001179 | Ga0501033_0001179_14650_14964 | 104 |
| 766 | 3300049570 | Ga0501033_0116995 | Ga0501033_0116995_553_867 | 104 |
| 767 | 3300049570 | Ga0501033_0133485 | Ga0501033_0133485_1041_1355 | 104 |
| 768 | 3300049570 | Ga0501033_0652720 | Ga0501033_0652720_302_616 | 104 |
| 769 | 3300049570 | Ga0501033_0873357 | Ga0501033_0873357_41_355 | 104 |
| 770 | 3300049571 | Ga0501034_0000503 | Ga0501034_0000503_25217_25531 | 104 |
| 771 | 3300049571 | Ga0501034_0239638 | Ga0501034_0239638_1223_1537 | 104 |
| 772 | 3300049571 | Ga0501034_0586247 | Ga0501034_0586247_474_788 | 104 |
| 773 | 3300049571 | Ga0501034_0777062 | Ga0501034_0777062_85_399 | 104 |
| 774 | 3300049572 | Ga0501036_0001453 | Ga0501036_0001453_17373_17687 | 104 |
| 775 | 3300049572 | Ga0501036_0171015 | Ga0501036_0171015_833_1147 | 104 |
| 776 | 3300049572 | Ga0501036_0213443 | Ga0501036_0213443_962_1276 | 104 |
| 777 | 3300049573 | Ga0501037_0000106 | Ga0501037_0000106_61964_62278 | 104 |
| 778 | 3300049573 | Ga0501037_0108472 | Ga0501037_0108472_554_868 | 104 |
| 779 | 3300049573 | Ga0501037_0143047 | Ga0501037_0143047_465_779 | 104 |
| 780 | 3300049573 | Ga0501037_0254999 | Ga0501037_0254999_455_784 | 104 |
| 781 | 3300049574 | Ga0501038_0001655 | Ga0501038_0001655_17309_17623 | 104 |
| 782 | 3300049574 | Ga0501038_0095220 | Ga0501038_0095220_491_805 | 104 |
| 783 | 3300049574 | Ga0501038_0576133 | Ga0501038_0576133_143_472 | 104 |
| 784 | 3300049574 | Ga0501038_0995126 | Ga0501038_0995126_162_479 | 104 |
| 785 | 3300049575 | Ga0501039_0000416 | Ga0501039_0000416_18315_18629 | 104 |
| 786 | 3300049575 | Ga0501039_0361693 | Ga0501039_0361693_137_451 | 104 |
| 787 | 3300049575 | Ga0501039_0870684 | Ga0501039_0870684_104_418 | 104 |
| 788 | 3300049575 | Ga0501039_1082497 | Ga0501039_1082497_130_444 | 104 |
| 789 | 3300049577 | Ga0501041_0614810 | Ga0501041_0614810_97_411 | 104 |
| 790 | 3300049578 | Ga0501042_0320311 | Ga0501042_0320311_151_465 | 104 |
| 791 | 3300049579 | Ga0501043_0000035 | Ga0501043_0000035_132178_132492 | 104 |
| 792 | 3300049579 | Ga0501043_0074841 | Ga0501043_0074841_1286_1600 | 104 |
| 793 | 3300049579 | Ga0501043_0116718 | Ga0501043_0116718_572_901 | 104 |
| 794 | 3300049579 | Ga0501043_0184225 | Ga0501043_0184225_373_687 | 104 |
| 795 | 3300049579 | Ga0501043_0861069 | Ga0501043_0861069_302_619 | 104 |
| 796 | 3300049580 | Ga0501046_0000235 | Ga0501046_0000235_32664_32978 | 104 |
| 797 | 3300049580 | Ga0501046_0069988 | Ga0501046_0069988_799_1116 | 104 |
| 798 | 3300049581 | Ga0501047_0000844 | Ga0501047_0000844_17203_17517 | 104 |
| 799 | 3300049581 | Ga0501047_0014131 | Ga0501047_0014131_75_404 | 104 |
| 800 | 3300049581 | Ga0501047_0187014 | Ga0501047_0187014_853_1170 | 104 |
| 801 | 3300049581 | Ga0501047_1114838 | Ga0501047_1114838_16_330 | 104 |
| 802 | 3300049582 | Ga0501048_0001444 | Ga0501048_0001444_687_1001 | 104 |
| 803 | 3300049582 | Ga0501048_0093360 | Ga0501048_0093360_974_1288 | 104 |
| 804 | 3300049583 | Ga0501067_0000160 | Ga0501067_0000160_24312_24626 | 104 |
| 805 | 3300049584 | Ga0501068_0000014 | Ga0501068_0000014_10473_10787 | 104 |
| 806 | 3300049585 | Ga0501069_0004593 | Ga0501069_0004593_6589_6903 | 104 |
| 807 | 3300049586 | Ga0501070_0043404 | Ga0501070_0043404_1849_2163 | 104 |
| 808 | 3300049586 | Ga0501070_0067819 | Ga0501070_0067819_251_580 | 104 |
| 809 | 3300049587 | Ga0501071_0052208 | Ga0501071_0052208_272_586 | 104 |
| 810 | 3300049588 | Ga0501072_0001159 | Ga0501072_0001159_175_489 | 104 |
| 811 | 3300049589 | Ga0501073_0000417 | Ga0501073_0000417_3551_3865 | 104 |
| 812 | 3300049589 | Ga0501073_0700938 | Ga0501073_0700938_119_436 | 104 |
| 813 | 3300049590 | Ga0501074_0001839 | Ga0501074_0001839_3418_3732 | 104 |
| 814 | 3300049592 | Ga0501076_0991825 | Ga0501076_0991825_351_665 | 104 |
| 815 | 3300049741 | Ga0501079_0000261 | Ga0501079_0000261_6828_7142 | 104 |
| 816 | 3300049742 | Ga0501080_0000917 | Ga0501080_0000917_8710_9024 | 104 |
| 817 | 3300049743 | Ga0501081_1238644 | Ga0501081_1238644_221_535 | 104 |
| 818 | 3300049743 | Ga0501081_1365144 | Ga0501081_1365144_160_474 | 104 |
| 819 | 3300049744 | Ga0501083_0000301 | Ga0501083_0000301_24201_24515 | 104 |
| 820 | 3300049744 | Ga0501083_0334581 | Ga0501083_0334581_170_487 | 104 |
| 821 | 3300049766 | Ga0501269_007654 | Ga0501269_007654_606_920 | 104 |
| 822 | 3300049822 | Ga0501035_0000324 | Ga0501035_0000324_29767_30081 | 104 |
| 823 | 3300049822 | Ga0501035_0041846 | Ga0501035_0041846_806_1120 | 104 |
| 824 | 3300049822 | Ga0501035_0183194 | Ga0501035_0183194_744_1058 | 104 |
| 825 | 3300049822 | Ga0501035_0209110 | Ga0501035_0209110_872_1186 | 104 |
| 826 | 3300049823 | Ga0501044_0000051 | Ga0501044_0000051_126062_126376 | 104 |
| 827 | 3300049823 | Ga0501044_0301936 | Ga0501044_0301936_661_975 | 104 |
| 828 | 3300049823 | Ga0501044_1203345 | Ga0501044_1203345_286_600 | 104 |
| 829 | 3300049824 | Ga0501045_0040080 | Ga0501045_0040080_780_1094 | 104 |
| 830 | 3300049824 | Ga0501045_0563915 | Ga0501045_0563915_62_376 | 104 |
| 831 | 3300050489 | nmdc:mga03683_471999_c1 | nmdc:mga03683_471999_c1_205_519 | 104 |
| 832 | 3300050489 | nmdc:mga03683_612453_c1 | nmdc:mga03683_612453_c1_102_416 | 104 |
| 833 | 3300050490 | nmdc:mga03n38_106245_c1 | nmdc:mga03n38_106245_c1_232_546 | 104 |
| 834 | 3300050490 | nmdc:mga03n38_128379_c1 | nmdc:mga03n38_128379_c1_909_1223 | 104 |
| 835 | 3300050490 | nmdc:mga03n38_273834_c2 | nmdc:mga03n38_273834_c2_41_358 | 104 |
| 836 | 3300050491 | nmdc:mga00v17_263510_c1 | nmdc:mga00v17_263510_c1_649_963 | 104 |
| 837 | 3300050491 | nmdc:mga00v17_289371_c1 | nmdc:mga00v17_289371_c1_281_598 | 104 |
| 838 | 3300050492 | nmdc:mga0yw44_121480_c1 | nmdc:mga0yw44_121480_c1_1155_1469 | 104 |
| 839 | 3300050492 | nmdc:mga0yw44_1241_c1 | nmdc:mga0yw44_1241_c1_3700_4014 | 104 |
| 840 | 3300050492 | nmdc:mga0yw44_152714_c1 | nmdc:mga0yw44_152714_c1_457_771 | 104 |
| 841 | 3300050492 | nmdc:mga0yw44_284549_c1 | nmdc:mga0yw44_284549_c1_302_616 | 104 |
| 842 | 3300050492 | nmdc:mga0yw44_45937_c1 | nmdc:mga0yw44_45937_c1_419_736 | 104 |
| 843 | 3300050492 | nmdc:mga0yw44_547448_c1 | nmdc:mga0yw44_547448_c1_96_410 | 104 |
| 844 | 3300050492 | nmdc:mga0yw44_793716_c1 | nmdc:mga0yw44_793716_c1_19_333 | 104 |
| 845 | 3300050493 | nmdc:mga0k408_110552_c1 | nmdc:mga0k408_110552_c1_549_869 | 104 |
| 846 | 3300050493 | nmdc:mga0k408_135884_c1 | nmdc:mga0k408_135884_c1_593_907 | 104 |
| 847 | 3300050493 | nmdc:mga0k408_331466_c1 | nmdc:mga0k408_331466_c1_185_499 | 104 |
| 848 | 3300050493 | nmdc:mga0k408_640343_c1 | nmdc:mga0k408_640343_c1_241_564 | 104 |
| 849 | 3300050494 | nmdc:mga06z11_636333_c1 | nmdc:mga06z11_636333_c1_314_628 | 104 |
| 850 | 3300050494 | nmdc:mga06z11_745189_c1 | nmdc:mga06z11_745189_c1_68_391 | 104 |
| 851 | 3300050495 | nmdc:mga04h51_111064_c1 | nmdc:mga04h51_111064_c1_81_395 | 104 |
| 852 | 3300050495 | nmdc:mga04h51_149357_c1 | nmdc:mga04h51_149357_c1_440_754 | 104 |
| 853 | 3300050496 | nmdc:mga07m45_118877_c1 | nmdc:mga07m45_118877_c1_564_878 | 104 |
| 854 | 3300050507 | nmdc:mga05p37_1096040_c1 | nmdc:mga05p37_1096040_c1_74_397 | 104 |
| 855 | 3300050507 | nmdc:mga05p37_91569_c1 | nmdc:mga05p37_91569_c1_390_707 | 104 |
| 856 | 3300050512 | nmdc:mga0n895_437936_c1 | nmdc:mga0n895_437936_c1_408_722 | 104 |
| 857 | 3300050513 | nmdc:mga0rr50_638421_c1 | nmdc:mga0rr50_638421_c1_53_367 | 104 |
| 858 | 3300050516 | nmdc:mga0sz30_163093_c1 | nmdc:mga0sz30_163093_c1_101_421 | 104 |
| 859 | 3300050516 | nmdc:mga0sz30_414884_c1 | nmdc:mga0sz30_414884_c1_58_381 | 104 |
| 860 | 3300050516 | nmdc:mga0sz30_6813_c3 | nmdc:mga0sz30_6813_c3_234_551 | 104 |
| 861 | 3300053077 | Ga0495601_0387858 | Ga0495601_0387858_38_352 | 104 |
| 862 | 3300053078 | Ga0495612_0010268 | Ga0495612_0010268_3428_3742 | 104 |
| 863 | 3300053078 | Ga0495612_0041356 | Ga0495612_0041356_300_614 | 104 |
| 864 | 3300053084 | Ga0495595_0318258 | Ga0495595_0318258_425_739 | 104 |
| 865 | 3300053087 | Ga0500643_000032 | Ga0500643_000032_88067_88381 | 104 |
| 866 | 3300053088 | Ga0500644_0304405 | Ga0500644_0304405_356_670 | 104 |
| 867 | 3300053090 | Ga0500646_0053575 | Ga0500646_0053575_767_1081 | 104 |
| 868 | 3300053092 | Ga0500583_0048511 | Ga0500583_0048511_1035_1349 | 104 |
| 869 | 3300053092 | Ga0500583_0133509 | Ga0500583_0133509_165_479 | 104 |
| 870 | 3300053092 | Ga0500583_0517724 | Ga0500583_0517724_110_424 | 104 |
| 871 | 3300053094 | Ga0500566_0004691 | Ga0500566_0004691_2796_3110 | 104 |
| 872 | 3300053096 | Ga0500641_0089183 | Ga0500641_0089183_435_749 | 104 |
| 873 | 3300053096 | Ga0500641_0164785 | Ga0500641_0164785_223_537 | 104 |
| 874 | 3300053096 | Ga0500641_0415350 | Ga0500641_0415350_58_372 | 104 |
| 875 | 3300053103 | Ga0500555_008642 | Ga0500555_008642_731_1045 | 104 |
| 876 | 3300053104 | Ga0500556_0244505 | Ga0500556_0244505_142_456 | 104 |
| 877 | 3300053105 | Ga0500557_021384 | Ga0500557_021384_1499_1813 | 104 |
| 878 | 3300053108 | Ga0500562_027034 | Ga0500562_027034_735_1052 | 104 |
| 879 | 3300053109 | Ga0500569_050034 | Ga0500569_050034_122_436 | 104 |
| 880 | 3300053116 | Ga0500592_014572 | Ga0500592_014572_386_700 | 104 |
| 881 | 3300053118 | Ga0500594_0002401 | Ga0500594_0002401_2117_2431 | 104 |
| 882 | 3300053118 | Ga0500594_0103937 | Ga0500594_0103937_486_800 | 104 |
| 883 | 3300053119 | Ga0500595_021164 | Ga0500595_021164_26_340 | 104 |
| 884 | 3300053119 | Ga0500595_032344 | Ga0500595_032344_1351_1665 | 104 |
| 885 | 3300053122 | Ga0500608_204478 | Ga0500608_204478_341_655 | 104 |
| 886 | 3300053126 | Ga0500621_144765 | Ga0500621_144765_98_412 | 104 |
| 887 | 3300053128 | Ga0500626_136979 | Ga0500626_136979_332_646 | 104 |
| 888 | 3300053130 | Ga0500642_0000173 | Ga0500642_0000173_12737_13051 | 104 |
| 889 | 3300053130 | Ga0500642_0247371 | Ga0500642_0247371_433_747 | 104 |
| 890 | 3300053131 | Ga0500652_280158 | Ga0500652_280158_248_562 | 104 |
| 891 | 3300053133 | Ga0500655_036468 | Ga0500655_036468_77_391 | 104 |
| 892 | 3300053133 | Ga0500655_083723 | Ga0500655_083723_140_454 | 104 |
| 893 | 3300053136 | Ga0500559_0346537 | Ga0500559_0346537_131_445 | 104 |
| 894 | 3300053139 | Ga0500568_0000411 | Ga0500568_0000411_1527_1841 | 104 |
| 895 | 3300053139 | Ga0500568_0020317 | Ga0500568_0020317_591_905 | 104 |
| 896 | 3300053139 | Ga0500568_0042194 | Ga0500568_0042194_1093_1407 | 104 |
| 897 | 3300053139 | Ga0500568_0237144 | Ga0500568_0237144_280_594 | 104 |
| 898 | 3300053146 | Ga0500588_0067660 | Ga0500588_0067660_303_617 | 104 |
| 899 | 3300053146 | Ga0500588_0225933 | Ga0500588_0225933_325_639 | 104 |
| 900 | 3300053147 | Ga0500589_050279 | Ga0500589_050279_447_761 | 104 |
| 901 | 3300053147 | Ga0500589_110811 | Ga0500589_110811_104_418 | 104 |
| 902 | 3300053151 | Ga0500604_0086442 | Ga0500604_0086442_653_967 | 104 |
| 903 | 3300053151 | Ga0500604_0097467 | Ga0500604_0097467_261_575 | 104 |
| 904 | 3300053153 | Ga0500616_0006355 | Ga0500616_0006355_2198_2512 | 104 |
| 905 | 3300053153 | Ga0500616_0258737 | Ga0500616_0258737_350_664 | 104 |
| 906 | 3300053156 | Ga0500622_0000428 | Ga0500622_0000428_29297_29614 | 104 |
| 907 | 3300053156 | Ga0500622_0006595 | Ga0500622_0006595_2202_2516 | 104 |
| 908 | 3300053158 | Ga0500627_0092747 | Ga0500627_0092747_347_661 | 104 |
| 909 | 3300053161 | Ga0500634_0210020 | Ga0500634_0210020_22_336 | 104 |
| 910 | 3300053731 | Ga0500609_036270 | Ga0500609_036270_56_370 | 104 |
| 911 | 3300053736 | Ga0500599_003267 | Ga0500599_003267_527_841 | 104 |
| 912 | 3300054114 | Ga0501084_0429030 | Ga0501084_0429030_162_476 | 104 |
| 913 | 3300054114 | Ga0501084_0903347 | Ga0501084_0903347_52_369 | 104 |
| 914 | 3300054114 | Ga0501084_1196225 | Ga0501084_1196225_163_477 | 104 |
| 915 | 3300060353 | Ga0501082_0018584 | Ga0501082_0018584_648_962 | 104 |
| 916 | 3300060353 | Ga0501082_0133402 | Ga0501082_0133402_788_1105 | 104 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8tgy-assembly1.cif.gz_E | crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea | 0.9589 | 1 | 103 |
| 8tgy-assembly1.cif.gz_E | crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea | 0.95 | 1 | 103 |
| 7ssu-assembly1.cif.gz_B | structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium | 0.8904 | 1 | 97 |
| 7mgx-assembly2.cif.gz_F | structure of emre-d3 mutant in complex with monobody l10 and methyl viologen | 0.8807 | 1 | 97 |
| 7mgx-assembly1.cif.gz_B | structure of emre-d3 mutant in complex with monobody l10 and methyl viologen | 0.8592 | 1 | 97 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P69937_1_105_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 1.002 | 1 | 103 | 1.10.3730.20 |
| af_P69937_1_105_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.9921 | 1 | 103 | 1.10.3730.20 |
| af_P9WGF1_2_106_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.8984 | 3 | 102 | 1.10.3730.20 |
| af_I1KSB6_13_116_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.8838 | 1 | 100 | 1.10.3730.20 |
| af_P23895_1_110_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.8704 | 2 | 103 | 1.10.3730.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q328H6-F1-model_v4 | Guanidinium exporter | 1.002 | 1 | 101 |
GO:0005886
GO:0022857 |
| AF-A0A4R7PG08-F1-model_v4 | deleted | 0.9979 | 1 | 103 |
|
| AF-I6Z3E1-F1-model_v4 | Cation membrane transporter | 0.9918 | 1 | 101 |
GO:0005886
GO:0022857 |
| AF-A0A561VJF6-F1-model_v4 | Quaternary ammonium compound-resistance protein SugE | 0.9883 | 1 | 103 |
GO:0005886
GO:0022857 |
| AF-A0A4R7PG08-F1-model_v4 | deleted | 0.9883 | 1 | 103 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar