F485614

General Info

Members Datasets Scaffolds Average Seq Length
916 511 804 103

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10644579|Ga0075366_106445792
Length 109
Sequence MAWGILFVAGLMEIGWAIGLKYTEGFSKLVPSVLTLACMTASVILLGLAVKTLPIGTAYAVWTGIGAVGTAILGMLIFKEPATAMRLVCLALIVAGILGLKLFSPGGGA

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
4 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
5 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
6 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
7 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
8 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
9 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
10 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
11 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
12 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
13 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
14 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
15 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
16 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
17 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
18 2643221645 Massilia sp. Root351 Isolate Unclassified
19 2643221664 Massilia sp. Root418 Isolate Unclassified
20 2643221733 Bosea sp. Root381 Isolate Unclassified
21 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
22 2738541280 Massilia sp. GV090 Isolate Unclassified
23 2738541300 Massilia sp. GV016 Isolate Unclassified
24 2738543018 Massilia sp. GV045 Isolate Unclassified
25 2738543030 Massilia sp. GV097 Isolate Unclassified
26 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
27 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
28 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
29 2791355199
30 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
31 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
32 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
33 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
34 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
35 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
36 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
37 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
38 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
39 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
40 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
41 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
42 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
43 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
44 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
45 2904699407
46 2906610324
47 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
48 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
49 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
50 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
51 2922425934
52 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
53 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
54 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
55 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
56 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
57 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
58 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
59 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
60 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
61 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
62 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
63 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
64 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
65 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
66 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
67 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
68 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
69 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
70 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
71 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
72 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
73 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
74 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
75 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
76 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
77 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
78 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
79 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
80 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
81 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
82 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
83 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
84 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
85 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
86 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
87 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
88 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
89 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
90 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
91 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
92 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
93 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
94 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
95 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
96 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
97 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
98 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
99 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
100 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
101 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
102 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
103 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
104 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
105 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
106 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
107 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
108 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
109 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
110 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
111 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
112 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
113 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
114 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
115 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
116 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
117 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
118 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
119 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
120 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
121 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
122 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
123 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
124 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
125 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
126 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
127 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
128 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
129 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
130 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
131 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
132 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
133 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
134 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
135 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
136 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
137 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
138 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
139 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
140 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
141 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
142 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
143 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
144 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
145 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
146 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
147 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
148 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
149 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
150 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
151 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
152 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
153 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
154 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
155 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
156 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
157 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
158 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
159 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
160 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
161 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
162 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
163 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
164 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
165 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
166 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
167 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
168 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
169 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
170 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
171 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
172 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
173 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
174 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
175 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
176 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
177 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
178 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
179 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
180 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
181 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
182 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
183 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
184 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
185 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
186 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
187 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
188 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
189 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
190 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
191 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
192 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
193 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
194 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
195 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
196 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
198 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
199 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
200 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
201 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
202 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
255 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
256 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
260 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
261 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
262 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
263 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
264 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
265 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
266 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
267 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
268 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
269 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
270 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
271 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
272 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
273 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
274 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
275 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
276 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
277 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
278 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
279 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
280 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
281 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
282 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
283 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
284 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
285 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
286 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
287 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
288 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
289 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
290 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
291 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
292 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
293 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
294 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
295 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
296 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
297 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
298 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
299 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
300 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
301 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
302 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
303 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
304 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
305 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
306 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
307 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
308 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
309 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
310 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
311 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
312 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
313 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
314 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
315 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
316 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
317 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
318 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
319 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
320 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
321 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
322 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
323 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
324 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
325 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
326 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
327 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
328 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
329 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
330 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
331 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
332 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
333 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
334 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
335 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
336 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
337 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
338 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
339 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
340 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
341 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
342 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
343 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
344 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
345 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
346 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
347 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
348 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
349 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
350 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
351 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
352 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
353 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
354 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
355 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
356 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
357 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
358 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
359 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
360 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
361 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
362 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
363 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
364 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
365 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
366 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
367 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
368 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
369 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
370 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
371 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
372 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
373 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
374 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
375 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
376 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
377 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
378 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
379 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
380 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
381 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
382 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
383 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
384 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
385 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
386 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
387 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
388 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
389 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
390 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
391 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
392 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
393 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
394 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
395 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
396 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
397 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
398 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
399 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
400 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
415 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
416 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
417 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
418 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
419 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
420 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
421 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
422 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
423 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
424 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
425 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
426 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
427 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
428 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
430 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
431 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
432 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
433 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
434 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
435 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
436 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
437 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
438 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
439 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
440 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
441 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
442 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
443 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
444 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
445 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
446 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
447 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
448 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
449 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
450 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
451 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
452 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
453 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
454 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
455 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
456 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
457 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
458 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
459 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
460 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
461 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
462 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
463 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
464 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
465 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
466 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
467 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
468 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
469 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
470 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
471 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
472 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
473 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
474 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
475 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
476 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
477 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
478 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
479 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
480 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
481 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
482 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
483 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
484 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
485 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
486 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
487 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
488 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
489 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
490 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
491 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
492 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
493 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
494 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
495 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
496 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
497 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
498 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
499 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
500 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
501 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
502 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
503 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
504 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
505 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
506 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
507 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
508 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
509 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
510 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
511 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.16
Metatranscriptomes 0
Isolates 11.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.86
Nodule 9.28
Rhizoplane 3.93
Rhizosphere 65.5
Stem 0
Stem Tuber 0
Unclassified 7.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24742J22300_10056159 3300002244 Bacteria 719
2 JGI25150J39212_1004568 3300002774 Bacteria 3059
3 JGI25151J46595_10032278 3300003187 Bacteria 2032
4 rootH2_10061177 3300003320 Bacteria 2028
5 rootH1_10104268 3300003323 Bacteria 2358
6 Ga0070658_10136463 3300005327 Bacteria 2047
7 Ga0070658_11837011 3300005327 Bacteria 524
8 Ga0070676_11540057 3300005328 Bacteria 513
9 Ga0070670_101010124 3300005331 Bacteria 757
10 Ga0068869_100660198 3300005334 Bacteria 888
11 Ga0070680_100904352 3300005336 Bacteria 761
12 Ga0070682_100395399 3300005337 Bacteria 1044
13 Ga0070682_100510009 3300005337 Bacteria 934
14 Ga0070682_101581953 3300005337 Bacteria 566
15 Ga0068868_101538427 3300005338 Bacteria 624
16 Ga0070660_100063644 3300005339 Bacteria 2867
17 Ga0070660_100119385 3300005339 Bacteria 2103
18 Ga0070660_100681149 3300005339 Bacteria 862
19 Ga0070689_100441180 3300005340 Bacteria 1106
20 Ga0070689_100893347 3300005340 Bacteria 786
21 Ga0070689_101167600 3300005340 Bacteria 690
22 Ga0070691_10260330 3300005341 Bacteria 934
23 Ga0070687_100032178 3300005343 Bacteria 2578
24 Ga0070661_100402284 3300005344 Bacteria 1083
25 Ga0070661_100795548 3300005344 Bacteria 776
26 Ga0070661_101892819 3300005344 Bacteria 507
27 Ga0070692_10198421 3300005345 Bacteria 1174
28 Ga0070668_100085455 3300005347 Bacteria 2479
29 Ga0070668_100159129 3300005347 Bacteria 1831
30 Ga0070668_100445378 3300005347 Bacteria 1112
31 Ga0070668_100493870 3300005347 Bacteria 1058
32 Ga0070669_100410377 3300005353 Bacteria 1110
33 Ga0070669_101177780 3300005353 Bacteria 661
34 Ga0070669_101683811 3300005353 Bacteria 553
35 Ga0070675_100126736 3300005354 Bacteria 2172
36 Ga0070671_100760213 3300005355 Bacteria 843
37 Ga0070674_100229913 3300005356 Bacteria 1447
38 Ga0070674_100239610 3300005356 Bacteria 1419
39 Ga0070674_100618044 3300005356 Bacteria 918
40 Ga0070673_100092112 3300005364 Bacteria 2479
41 Ga0070673_102324819 3300005364 Bacteria 509
42 Ga0070688_100253166 3300005365 Bacteria 1255
43 Ga0070659_100283117 3300005366 Bacteria 1379
44 Ga0070659_101128352 3300005366 Bacteria 692
45 Ga0070667_100138172 3300005367 Bacteria 2132
46 Ga0070667_100538464 3300005367 Bacteria 1072
47 Ga0070714_100215391 3300005435 Bacteria 1763
48 Ga0070701_10529756 3300005438 Bacteria 769
49 Ga0070711_101261078 3300005439 Bacteria 640
50 Ga0070700_101063977 3300005441 Bacteria 669
51 Ga0070663_100141798 3300005455 Bacteria 1835
52 Ga0070663_100412886 3300005455 Bacteria 1106
53 Ga0070663_100631601 3300005455 Bacteria 904
54 Ga0070663_100970268 3300005455 Bacteria 737
55 Ga0070663_101291933 3300005455 Bacteria 644
56 Ga0070678_100412271 3300005456 Bacteria 1176
57 Ga0070678_100895892 3300005456 Bacteria 811
58 Ga0070678_101119005 3300005456 Bacteria 728
59 Ga0070662_100242347 3300005457 Bacteria 1446
60 Ga0068867_100144536 3300005459 Bacteria 1862
61 Ga0068867_100182446 3300005459 Bacteria 1669
62 Ga0068867_100642876 3300005459 Bacteria 930
63 Ga0070699_102118125 3300005518 Bacteria 514
64 Ga0070684_100009651 3300005535 Bacteria 7610
65 Ga0070684_102165089 3300005535 Bacteria 525
66 Ga0068853_100648677 3300005539 Bacteria 1005
67 Ga0068853_100676096 3300005539 Bacteria 984
68 Ga0068853_101276634 3300005539 Bacteria 709
69 Ga0070672_100182223 3300005543 Bacteria 1750
70 Ga0070686_100251596 3300005544 Bacteria 1291
71 Ga0070686_100994014 3300005544 Bacteria 688
72 Ga0070696_101031132 3300005546 Bacteria 689
73 Ga0070693_100098089 3300005547 Bacteria 1780
74 Ga0070693_100241639 3300005547 Bacteria 1193
75 Ga0070665_100054664 3300005548 Bacteria 4004
76 Ga0070665_100430766 3300005548 Bacteria 1328
77 Ga0070665_100449901 3300005548 Bacteria 1297
78 Ga0070665_100637708 3300005548 Bacteria 1078
79 Ga0070665_101042886 3300005548 Bacteria 830
80 Ga0070665_101112075 3300005548 Bacteria 802
81 Ga0070665_101455999 3300005548 Bacteria 694
82 Ga0070664_100160106 3300005564 Bacteria 1991
83 Ga0068857_100094952 3300005577 Bacteria 2670
84 Ga0068857_101155552 3300005577 Bacteria 749
85 Ga0068854_100725574 3300005578 Bacteria 860
86 Ga0068854_100767556 3300005578 Bacteria 838
87 Ga0070702_100133682 3300005615 Bacteria 1570
88 Ga0070702_100424572 3300005615 Bacteria 958
89 Ga0070702_100953772 3300005615 Bacteria 676
90 Ga0068852_100606191 3300005616 Bacteria 1100
91 Ga0068852_101153310 3300005616 Bacteria 796
92 Ga0068859_101877552 3300005617 Bacteria 661
93 Ga0068864_100117769 3300005618 Bacteria 2371
94 Ga0068864_100812271 3300005618 Bacteria 920
95 Ga0068866_10530964 3300005718 Bacteria 783
96 Ga0068866_10587354 3300005718 Bacteria 750
97 Ga0068861_100026842 3300005719 Bacteria 4190
98 Ga0068861_100043262 3300005719 Bacteria 3379
99 Ga0068861_101679600 3300005719 Bacteria 627
100 Ga0068870_10266369 3300005840 Bacteria 1068
101 Ga0068863_100452979 3300005841 Bacteria 1259
102 Ga0068863_101281329 3300005841 Bacteria 740
103 Ga0068863_101405916 3300005841 Bacteria 705
104 Ga0068858_100167543 3300005842 Bacteria 2071
105 Ga0068858_100990254 3300005842 Bacteria 824
106 Ga0068858_101083150 3300005842 Bacteria 786
107 Ga0068860_100097783 3300005843 Bacteria 2799
108 Ga0068860_100712905 3300005843 Bacteria 1013
109 Ga0068860_101843462 3300005843 Bacteria 626
110 Ga0068862_100229211 3300005844 Bacteria 1685
111 Ga0068862_100895960 3300005844 Bacteria 872
112 Ga0081538_10146460 3300005981 Bacteria 1078
113 Ga0081540_1000979 3300005983 Bacteria 25757
114 Ga0081540_1002120 3300005983 Bacteria 16520
115 Ga0081540_1016464 3300005983 Bacteria 4624
116 Ga0081540_1062415 3300005983 Bacteria 1770
117 Ga0081540_1086805 3300005983 Bacteria 1389
118 Ga0081540_1154399 3300005983 Bacteria 900
119 Ga0081539_10355003 3300005985 Bacteria 615
120 Ga0070717_11701812 3300006028 Bacteria 571
121 Ga0075365_10008619 3300006038 Bacteria 5806
122 Ga0075365_10040202 3300006038 Bacteria 3049
123 Ga0075365_10367933 3300006038 Bacteria 1014
124 Ga0075365_10589218 3300006038 Bacteria 786
125 Ga0075365_10654827 3300006038 Bacteria 742
126 Ga0075365_10693248 3300006038 Bacteria 720
127 Ga0075368_10091715 3300006042 Bacteria 1243
128 Ga0075368_10323246 3300006042 Bacteria 668
129 Ga0075363_100206140 3300006048 Bacteria 1124
130 Ga0075363_100346176 3300006048 Bacteria 867
131 Ga0075363_100393687 3300006048 Bacteria 813
132 Ga0075363_100801811 3300006048 Bacteria 573
133 Ga0075364_10051506 3300006051 Bacteria 2689
134 Ga0075364_10670220 3300006051 Bacteria 708
135 Ga0075364_10754760 3300006051 Bacteria 664
136 Ga0070716_100073021 3300006173 Bacteria 2022
137 Ga0070712_100170191 3300006175 Bacteria 1690
138 Ga0075362_10307383 3300006177 Bacteria 788
139 Ga0075367_10118707 3300006178 Bacteria 1628
140 Ga0075367_10421078 3300006178 Bacteria 845
141 Ga0075367_10689867 3300006178 Bacteria 649
142 Ga0075369_10044595 3300006186 Bacteria 1905
143 Ga0075369_10124306 3300006186 Bacteria 1169
144 Ga0075369_10466375 3300006186 Bacteria 599
145 Ga0075366_10117831 3300006195 Bacteria 1599
146 Ga0075366_10261934 3300006195 Bacteria 1055
147 Ga0075366_10267189 3300006195 Bacteria 1044
148 Ga0075366_10459588 3300006195 Bacteria 786
149 Ga0075366_10644579 3300006195 Bacteria 657
150 Ga0075366_10717995 3300006195 Bacteria 621
151 Ga0097621_100135878 3300006237 Bacteria 2097
152 Ga0097621_100738133 3300006237 Bacteria 909
153 Ga0075370_10348549 3300006353 Bacteria 884
154 Ga0068871_100105154 3300006358 Bacteria 2368
155 Ga0068871_100708175 3300006358 Bacteria 923
156 Ga0068871_100821995 3300006358 Bacteria 857
157 Ga0068871_101501112 3300006358 Bacteria 637
158 Ga0068871_101791650 3300006358 Bacteria 583
159 Ga0075428_100195180 3300006844 Bacteria 2189
160 Ga0075428_100811114 3300006844 Bacteria 994
161 Ga0075434_100360265 3300006871 Bacteria 1475
162 Ga0068865_100040566 3300006881 Bacteria 3164
163 Ga0068865_100897288 3300006881 Bacteria 771
164 Ga0097620_101877645 3300006931 Bacteria 661
165 Ga0075435_102056085 3300007076 Bacteria 502
166 Ga0105250_10223894 3300009092 Bacteria 798
167 Ga0111539_10097484 3300009094 Bacteria 3454
168 Ga0111539_11381532 3300009094 Bacteria 817
169 Ga0105245_10188809 3300009098 Bacteria 1973
170 Ga0105245_10910148 3300009098 Bacteria 921
171 Ga0105245_11232222 3300009098 Bacteria 796
172 Ga0105247_10488649 3300009101 Bacteria 895
173 Ga0105247_10794454 3300009101 Bacteria 721
174 Ga0114129_10053995 3300009147 Bacteria 5635
175 Ga0114129_10348949 3300009147 Bacteria 1961
176 Ga0105243_10103459 3300009148 Bacteria 2368
177 Ga0105243_11721683 3300009148 Bacteria 656
178 Ga0105241_10175477 3300009174 Bacteria 1773
179 Ga0105241_11352439 3300009174 Bacteria 680
180 Ga0105242_10385103 3300009176 Bacteria 1305
181 Ga0105242_13027976 3300009176 Bacteria 520
182 Ga0105248_10296766 3300009177 Bacteria 1820
183 Ga0105248_10419139 3300009177 Bacteria 1508
184 Ga0105237_10438266 3300009545 Bacteria 1312
185 Ga0105238_10485112 3300009551 Bacteria 1236
186 Ga0105238_10801412 3300009551 Bacteria 957
187 Ga0105238_10833253 3300009551 Bacteria 939
188 Ga0105238_11128934 3300009551 Bacteria 807
189 Ga0105249_10253063 3300009553 Bacteria 1747
190 Ga0105239_10229598 3300010375 Bacteria 2082
191 Ga0105239_11342977 3300010375 Bacteria 825
192 Ga0105239_12590213 3300010375 Bacteria 591
193 Ga0157314_1009460 3300012500 Bacteria 824
194 Ga0157326_1068441 3300012513 Bacteria 558
195 Ga0157373_10601031 3300013100 Bacteria 801
196 Ga0157371_10303289 3300013102 Bacteria 1156
197 Ga0157370_10223111 3300013104 Bacteria 1745
198 Ga0157370_10632446 3300013104 Bacteria 979
199 Ga0157370_11054509 3300013104 Bacteria 735
200 Ga0157369_10236078 3300013105 Bacteria 1910
201 Ga0157369_10528714 3300013105 Bacteria 1220
202 Ga0157374_10718941 3300013296 Bacteria 1012
203 Ga0157374_12005856 3300013296 Bacteria 605
204 Ga0157374_12380889 3300013296 Bacteria 557
205 Ga0157378_10151967 3300013297 Bacteria 2158
206 Ga0157378_11267419 3300013297 Bacteria 778
207 Ga0163162_10626212 3300013306 Bacteria 1201
208 Ga0163162_10935187 3300013306 Bacteria 979
209 Ga0163162_12937819 3300013306 Bacteria 548
210 Ga0157372_10426876 3300013307 Bacteria 1545
211 Ga0157372_11561266 3300013307 Bacteria 760
212 Ga0157372_11570932 3300013307 Bacteria 757
213 Ga0157375_10134785 3300013308 Bacteria 2592
214 Ga0157375_10425717 3300013308 Bacteria 1493
215 Ga0157375_11085267 3300013308 Bacteria 937
216 Ga0157375_11655899 3300013308 Bacteria 757
217 Ga0157375_12210842 3300013308 Bacteria 655
218 Ga0163163_11335015 3300014325 Bacteria 779
219 Ga0163163_11997197 3300014325 Bacteria 640
220 Ga0163163_12046122 3300014325 Bacteria 632
221 Ga0157380_10095986 3300014326 Bacteria 2457
222 Ga0182008_10224458 3300014497 Bacteria 962
223 Ga0182008_10313625 3300014497 Bacteria 824
224 Ga0157377_10541486 3300014745 Bacteria 821
225 Ga0157379_10855542 3300014968 Bacteria 861
226 Ga0157379_11152761 3300014968 Bacteria 744
227 Ga0157376_10362954 3300014969 Bacteria 1390
228 Ga0163161_10007714 3300017792 Bacteria 7444
229 Ga0163161_10478393 3300017792 Bacteria 1011
230 Ga0163161_12033858 3300017792 Bacteria 511
231 Ga0163161_12102111 3300017792 Bacteria 502
232 Ga0209436_100001 3300025208 Bacteria 304543
233 Ga0207425_1014439 3300025245 Bacteria 1793
234 Ga0209646_1007456 3300025246 Bacteria 1788
235 Ga0209129_1000750 3300025258 Bacteria 20640
236 Ga0209129_1002899 3300025258 Bacteria 7881
237 Ga0209129_1003789 3300025258 Bacteria 6345
238 Ga0209673_1003813 3300025273 Bacteria 8545
239 Ga0209130_1000004 3300025284 Bacteria 633436
240 Ga0209564_1000566 3300025295 Bacteria 58647
241 Ga0209758_1000468 3300025297 Bacteria 66625
242 Ga0209758_1000977 3300025297 Bacteria 38489
243 Ga0209758_1002398 3300025297 Bacteria 19243
244 Ga0209256_1004862 3300025299 Bacteria 8115
245 Ga0207426_1000003 3300025302 Bacteria 1063212
246 Ga0207426_1058031 3300025302 Bacteria 1125
247 Ga0209051_1017453 3300025303 Bacteria 3206
248 Ga0209257_1056832 3300025304 Bacteria 1079
249 Ga0207697_10102845 3300025315 Bacteria 1219
250 Ga0207697_10260049 3300025315 Bacteria 768
251 Ga0207682_10161166 3300025893 Bacteria 1016
252 Ga0207692_10304648 3300025898 Bacteria 971
253 Ga0207642_10063551 3300025899 Bacteria 1727
254 Ga0207642_10259927 3300025899 Bacteria 989
255 Ga0207688_10043066 3300025901 Bacteria 2513
256 Ga0207688_10431903 3300025901 Bacteria 819
257 Ga0207647_10412067 3300025904 Bacteria 760
258 Ga0207685_10444280 3300025905 Bacteria 673
259 Ga0207645_10233471 3300025907 Bacteria 1214
260 Ga0207705_10711821 3300025909 Bacteria 780
261 Ga0207705_11254552 3300025909 Bacteria 567
262 Ga0207654_10076776 3300025911 Bacteria 2001
263 Ga0207654_10788706 3300025911 Bacteria 686
264 Ga0207654_11119893 3300025911 Bacteria 573
265 Ga0207707_10019379 3300025912 Bacteria 5938
266 Ga0207671_10149205 3300025914 Bacteria 1806
267 Ga0207671_10822285 3300025914 Bacteria 736
268 Ga0207693_10032462 3300025915 Bacteria 4121
269 Ga0207660_10416470 3300025917 Bacteria 1083
270 Ga0207662_10306896 3300025918 Bacteria 1056
271 Ga0207657_10051847 3300025919 Bacteria 3565
272 Ga0207657_10326391 3300025919 Bacteria 1213
273 Ga0207657_10362697 3300025919 Bacteria 1142
274 Ga0207649_10162924 3300025920 Bacteria 1547
275 Ga0207649_10177366 3300025920 Bacteria 1489
276 Ga0207652_10210138 3300025921 Bacteria 1752
277 Ga0207694_10372510 3300025924 Bacteria 1184
278 Ga0207694_10504134 3300025924 Bacteria 1014
279 Ga0207694_10534288 3300025924 Bacteria 983
280 Ga0207694_11106399 3300025924 Bacteria 670
281 Ga0207650_10348073 3300025925 Bacteria 1218
282 Ga0207650_10435607 3300025925 Bacteria 1089
283 Ga0207650_11531618 3300025925 Bacteria 566
284 Ga0207687_10116148 3300025927 Bacteria 1994
285 Ga0207687_10768177 3300025927 Bacteria 821
286 Ga0207690_10063181 3300025932 Bacteria 2524
287 Ga0207690_10418464 3300025932 Bacteria 1072
288 Ga0207706_10071719 3300025933 Bacteria 3047
289 Ga0207706_10344325 3300025933 Bacteria 1296
290 Ga0207706_10872649 3300025933 Bacteria 761
291 Ga0207709_10054475 3300025935 Bacteria 2467
292 Ga0207709_11817843 3300025935 Bacteria 507
293 Ga0207709_11824144 3300025935 Bacteria 506
294 Ga0207670_10390914 3300025936 Bacteria 1110
295 Ga0207670_11415565 3300025936 Bacteria 590
296 Ga0207669_10075249 3300025937 Bacteria 2138
297 Ga0207669_10324539 3300025937 Bacteria 1180
298 Ga0207669_11205343 3300025937 Bacteria 641
299 Ga0207704_11733015 3300025938 Bacteria 537
300 Ga0207665_10054296 3300025939 Bacteria 2701
301 Ga0207691_10109172 3300025940 Bacteria 2461
302 Ga0207691_10670634 3300025940 Bacteria 875
303 Ga0207711_10025904 3300025941 Bacteria 4919
304 Ga0207711_10057138 3300025941 Bacteria 3354
305 Ga0207689_10980980 3300025942 Bacteria 713
306 Ga0207661_10036554 3300025944 Bacteria 3834
307 Ga0207679_10714646 3300025945 Bacteria 910
308 Ga0207651_10101766 3300025960 Bacteria 2134
309 Ga0207651_10317379 3300025960 Bacteria 1301
310 Ga0207712_10115895 3300025961 Bacteria 2018
311 Ga0207668_10083578 3300025972 Bacteria 2323
312 Ga0207668_10576758 3300025972 Bacteria 977
313 Ga0207668_10749525 3300025972 Bacteria 861
314 Ga0207668_10952966 3300025972 Bacteria 765
315 Ga0207640_11989356 3300025981 Bacteria 526
316 Ga0207658_10665562 3300025986 Bacteria 939
317 Ga0207658_10815411 3300025986 Bacteria 848
318 Ga0207658_10919048 3300025986 Bacteria 797
319 Ga0207677_10845390 3300026023 Bacteria 822
320 Ga0207677_12003421 3300026023 Bacteria 538
321 Ga0207703_10054622 3300026035 Bacteria 3249
322 Ga0207703_10187420 3300026035 Bacteria 1830
323 Ga0207703_10354760 3300026035 Bacteria 1351
324 Ga0207703_10636086 3300026035 Bacteria 1011
325 Ga0207678_10019138 3300026067 Bacteria 6011
326 Ga0207678_10258769 3300026067 Bacteria 1491
327 Ga0207678_10301805 3300026067 Bacteria 1376
328 Ga0207678_10353675 3300026067 Bacteria 1267
329 Ga0207678_11384972 3300026067 Bacteria 622
330 Ga0207678_11543787 3300026067 Bacteria 586
331 Ga0207708_10242601 3300026075 Bacteria 1450
332 Ga0207708_10245582 3300026075 Bacteria 1441
333 Ga0207708_10578217 3300026075 Bacteria 950
334 Ga0207702_10048792 3300026078 Bacteria 3571
335 Ga0207702_10446278 3300026078 Bacteria 1254
336 Ga0207641_10218805 3300026088 Bacteria 1765
337 Ga0207641_11883783 3300026088 Bacteria 600
338 Ga0207648_10221230 3300026089 Bacteria 1683
339 Ga0207648_10245979 3300026089 Bacteria 1594
340 Ga0207648_10635668 3300026089 Bacteria 986
341 Ga0207676_10101932 3300026095 Bacteria 2381
342 Ga0207674_10562356 3300026116 Bacteria 1102
343 Ga0207674_10612509 3300026116 Bacteria 1052
344 Ga0207675_100016940 3300026118 Bacteria 6810
345 Ga0207675_102261919 3300026118 Bacteria 558
346 Ga0207683_10164919 3300026121 Bacteria 2004
347 Ga0207683_10252968 3300026121 Bacteria 1608
348 Ga0207683_10727754 3300026121 Bacteria 920
349 Ga0207683_10839005 3300026121 Bacteria 853
350 Ga0207683_11952133 3300026121 Bacteria 535
351 Ga0207698_10156543 3300026142 Bacteria 1986
352 Ga0207698_10500187 3300026142 Bacteria 1183
353 Ga0209813_10101472 3300027866 Bacteria 980
354 Ga0209813_10111513 3300027866 Bacteria 943
355 Ga0207428_10387327 3300027907 Bacteria 1025
356 Ga0268266_10003390 3300028379 Bacteria 15951
357 Ga0268266_10074725 3300028379 Bacteria 2943
358 Ga0268266_10121010 3300028379 Bacteria 2329
359 Ga0268266_10374299 3300028379 Bacteria 1342
360 Ga0268266_10514936 3300028379 Bacteria 1143
361 Ga0268266_10764908 3300028379 Bacteria 932
362 Ga0268266_11468938 3300028379 Bacteria 657
363 Ga0268266_11945621 3300028379 Bacteria 562
364 Ga0268265_10044700 3300028380 Bacteria 3300
365 Ga0268265_10662773 3300028380 Bacteria 1004
366 Ga0268265_10724805 3300028380 Bacteria 963
367 Ga0268265_12255301 3300028380 Bacteria 551
368 Ga0268264_10065341 3300028381 Bacteria 3065
369 Ga0268264_10927143 3300028381 Bacteria 875
370 Ga0268264_11107421 3300028381 Bacteria 800
371 Ga0307515_10001393 3300028794 Bacteria 54715
372 Ga0307515_10021427 3300028794 Bacteria 11463
373 Ga0307513_10011737 3300031456 Bacteria 10864
374 Ga0307508_10031547 3300031616 Bacteria 4790
375 Ga0307508_10245074 3300031616 Bacteria 1389
376 Ga0307516_10448431 3300031730 Bacteria 947
377 Ga0307415_100701851 3300032126 Bacteria 913
378 Ga0307510_10078712 3300033180 Bacteria 3222
379 Ga0315911_1000006 3300033442 Bacteria 414563
380 Ga0373950_0133437 3300034818 Bacteria 557
381 Ga0373943_0182569 3300035170 Bacteria 1154
382 Ga0373935_0209912 3300035692 Bacteria 1349
383 Ga0373947_0059831 3300035725 Bacteria 2311
384 Ga0373947_0752927 3300035725 Bacteria 665
385 Ga0373925_0299820 3300037068 Bacteria 1297
386 Ga0373925_1169365 3300037068 Bacteria 632
387 Ga0395899_0056456 3300037312 Bacteria 2902
388 Ga0395900_0012534 3300037418 Bacteria 8673
389 Ga0395900_0076909 3300037418 Bacteria 3429
390 Ga0395898_0025456 3300037466 Bacteria 5962
391 Ga0395898_0030570 3300037466 Bacteria 5389
392 Ga0395905_0002553 3300037471 Bacteria 20072
393 Ga0395901_0028377 3300038443 Bacteria 5754
394 Ga0439465_0079791 3300041413 Bacteria 1108
395 Ga0439465_0208685 3300041413 Bacteria 713
396 Ga0439465_0360995 3300041413 Bacteria 550
397 Ga0451789_0589456 3300041443 Bacteria 711
398 Ga0451791_0313286 3300041451 Bacteria 1074
399 Ga0451797_0174660 3300041453 Bacteria 673
400 Ga0451797_0692193 3300041453 Bacteria 802
401 Ga0451797_1503990 3300041453 Bacteria 682
402 Ga0451798_0348921 3300041458 Bacteria 651
403 Ga0451800_0241826 3300041459 Bacteria 603
404 Ga0451800_0935838 3300041459 Bacteria 757
405 Ga0451804_0084282 3300041463 Bacteria 581
406 Ga0451807_1711485 3300041486 Bacteria 642
407 Ga0451839_0403398 3300041496 Bacteria 662
408 Ga0451845_0035050 3300041501 Bacteria 707
409 Ga0451847_0253765 3300041503 Bacteria 556
410 Ga0451849_1402645 3300041505 Bacteria 1337
411 Ga0451851_0518039 3300041507 Bacteria 658
412 Ga0451853_3398724 3300041512 Bacteria 578
413 Ga0439446_0269951 3300042156 Bacteria 591
414 Ga0466966_0034096 3300044684 Bacteria 3294
415 Ga0466966_0146212 3300044684 Bacteria 1443
416 Ga0466963_0259700 3300044694 Bacteria 1219
417 Ga0466971_0129724 3300044719 Bacteria 1170
418 Ga0466970_0028377 3300044765 Bacteria 2939
419 Ga0466959_0072284 3300045049 Bacteria 2497
420 Ga0466959_1038728 3300045049 Bacteria 545
421 Ga0466967_0259907 3300045976 Bacteria 1661
422 Ga0466967_1361779 3300045976 Bacteria 707
423 Ga0495592_0050253 3300046454 Bacteria 3098
424 Ga0495603_0019982 3300046455 Bacteria 4058
425 Ga0495590_0155640 3300046457 Bacteria 829
426 Ga0495590_0355096 3300046457 Bacteria 557
427 Ga0495638_0001093 3300046460 Bacteria 26413
428 Ga0495638_0004182 3300046460 Bacteria 10997
429 Ga0495638_0029879 3300046460 Bacteria 3513
430 Ga0495638_0514339 3300046460 Bacteria 601
431 Ga0495641_0397548 3300046461 Bacteria 625
432 Ga0495650_0000150 3300046471 Bacteria 158574
433 Ga0495650_0171527 3300046471 Bacteria 768
434 Ga0495580_0310275 3300046472 Bacteria 1073
435 Ga0495605_0000882 3300046474 Bacteria 20665
436 Ga0495639_0010705 3300046475 Bacteria 3949
437 Ga0495639_0524303 3300046475 Bacteria 606
438 Ga0495662_0356199 3300046476 Bacteria 719
439 Ga0495664_0007342 3300046477 Bacteria 6118
440 Ga0495664_0114850 3300046477 Bacteria 1626
441 Ga0495584_0105602 3300046491 Bacteria 1424
442 Ga0495585_0034342 3300046492 Bacteria 2867
443 Ga0495585_0100853 3300046492 Bacteria 1544
444 Ga0495585_0142526 3300046492 Bacteria 1254
445 Ga0495585_0359038 3300046492 Bacteria 707
446 Ga0495594_0158117 3300046499 Bacteria 1288
447 Ga0495596_0090464 3300046500 Bacteria 1188
448 Ga0495596_0243911 3300046500 Bacteria 697
449 Ga0495607_0050852 3300046501 Bacteria 2410
450 Ga0495583_0016358 3300046506 Bacteria 3991
451 Ga0495606_0007239 3300046507 Bacteria 9999
452 Ga0495606_0032075 3300046507 Bacteria 3644
453 Ga0495606_0080822 3300046507 Bacteria 2022
454 Ga0495606_0301535 3300046507 Bacteria 868
455 Ga0495608_0259714 3300046511 Bacteria 1081
456 Ga0495610_0009298 3300046512 Bacteria 6230
457 Ga0495610_0026067 3300046512 Bacteria 3126
458 Ga0495610_0090811 3300046512 Bacteria 1385
459 Ga0495616_0172638 3300046513 Bacteria 966
460 Ga0495620_0042448 3300046515 Bacteria 1987
461 Ga0495628_0114288 3300046516 Bacteria 2074
462 Ga0495628_0661467 3300046516 Bacteria 741
463 Ga0495631_0026994 3300046518 Bacteria 2631
464 Ga0495631_0134718 3300046518 Bacteria 1061
465 Ga0495631_0169944 3300046518 Bacteria 935
466 Ga0495631_0417383 3300046518 Bacteria 571
467 Ga0495632_0066757 3300046519 Bacteria 1735
468 Ga0495643_0030117 3300046522 Bacteria 3032
469 Ga0495643_0107297 3300046522 Bacteria 1424
470 Ga0495644_0040197 3300046523 Bacteria 1763
471 Ga0495648_0104555 3300046524 Bacteria 1555
472 Ga0495648_0164241 3300046524 Bacteria 1144
473 Ga0495648_0280343 3300046524 Bacteria 790
474 Ga0495663_0013581 3300046525 Bacteria 2278
475 Ga0495663_0057601 3300046525 Bacteria 1216
476 Ga0495666_0231368 3300046526 Bacteria 845
477 Ga0495652_0111683 3300046529 Bacteria 2197
478 Ga0495654_0114022 3300046530 Bacteria 1230
479 Ga0495654_0176616 3300046530 Bacteria 928
480 Ga0495587_0219184 3300046536 Bacteria 1073
481 Ga0495598_0040795 3300046537 Bacteria 1355
482 Ga0495598_0106697 3300046537 Bacteria 934
483 Ga0495598_0213037 3300046537 Bacteria 702
484 Ga0495609_0082805 3300046538 Bacteria 1401
485 Ga0495609_0243715 3300046538 Bacteria 741
486 Ga0495609_0347108 3300046538 Bacteria 599
487 Ga0495621_0042629 3300046539 Bacteria 1598
488 Ga0495621_0104389 3300046539 Bacteria 1081
489 Ga0495597_0077349 3300046542 Bacteria 1426
490 Ga0495645_0005428 3300046543 Bacteria 8746
491 Ga0495645_0271759 3300046543 Bacteria 1118
492 Ga0495622_0179375 3300046557 Bacteria 950
493 Ga0495633_0165467 3300046558 Bacteria 1020
494 Ga0495667_0038917 3300046559 Bacteria 3166
495 Ga0495656_0065604 3300046615 Bacteria 1597
496 Ga0495656_0065673 3300046615 Bacteria 1596
497 Ga0495656_0648005 3300046615 Bacteria 567
498 Ga0495668_0010544 3300046616 Bacteria 5586
499 Ga0495668_0162294 3300046616 Bacteria 1224
500 Ga0495668_0198652 3300046616 Bacteria 1098
501 Ga0495668_0322551 3300046616 Bacteria 847
502 Ga0495668_0687770 3300046616 Bacteria 566
503 Ga0495634_0115841 3300046642 Bacteria 1719
504 Ga0495611_0055449 3300046648 Bacteria 1793
505 Ga0495611_0231224 3300046648 Bacteria 859
506 Ga0495611_0245141 3300046648 Bacteria 831
507 Ga0495625_0006043 3300046660 Bacteria 10872
508 Ga0495625_0334995 3300046660 Bacteria 960
509 Ga0495625_0711140 3300046660 Bacteria 592
510 Ga0495635_0019609 3300046663 Bacteria 4711
511 Ga0495659_0000001 3300046664 Bacteria 325846
512 Ga0495659_0200695 3300046664 Bacteria 818
513 Ga0495588_0005074 3300046674 Bacteria 5849
514 Ga0495588_0034992 3300046674 Bacteria 2543
515 Ga0495657_0005171 3300046675 Bacteria 10333
516 Ga0495599_0034262 3300046678 Bacteria 3190
517 Ga0495599_0065984 3300046678 Bacteria 2261
518 Ga0495623_0016633 3300046679 Bacteria 4750
519 Ga0495646_0037433 3300046680 Bacteria 3001
520 Ga0495646_0087925 3300046680 Bacteria 1800
521 Ga0495658_0080762 3300046683 Bacteria 1908
522 Ga0495669_0051414 3300046684 Bacteria 1849
523 Ga0495613_0014966 3300046689 Bacteria 5758
524 Ga0495624_0273011 3300046690 Bacteria 1021
525 Ga0495624_0308663 3300046690 Bacteria 953
526 Ga0495624_0351621 3300046690 Bacteria 886
527 Ga0495670_0024618 3300046691 Bacteria 2976
528 Ga0495670_0056306 3300046691 Bacteria 1972
529 Ga0495671_0000035 3300046692 Bacteria 188543
530 Ga0495671_0198892 3300046692 Bacteria 972
531 Ga0495671_0244940 3300046692 Bacteria 866
532 Ga0495671_0475106 3300046692 Bacteria 597
533 Ga0495649_0024030 3300046694 Bacteria 3402
534 Ga0495589_0441862 3300046794 Bacteria 595
535 Ga0495600_0058255 3300046809 Bacteria 2523
536 Ga0495660_0009064 3300046810 Bacteria 5810
537 Ga0495660_0017169 3300046810 Bacteria 4168
538 Ga0495660_0080596 3300046810 Bacteria 1708
539 Ga0495604_0019135 3300047317 Bacteria 5483
540 Ga0495604_0230915 3300047317 Bacteria 1269
541 Ga0495636_0090785 3300047318 Bacteria 1326
542 Ga0495636_0218643 3300047318 Bacteria 874
543 Ga0495674_0010589 3300047319 Bacteria 8729
544 Ga0495672_0000066 3300047320 Bacteria 193318
545 Ga0495672_0012040 3300047320 Bacteria 6057
546 Ga0495672_0052403 3300047320 Bacteria 2397
547 Ga0495672_0175862 3300047320 Bacteria 1088
548 Ga0495672_0335535 3300047320 Bacteria 706
549 Ga0495676_0293471 3300047321 Bacteria 1098
550 Ga0495680_0008649 3300047322 Bacteria 9238
551 Ga0495683_0391727 3300047323 Bacteria 579
552 Ga0495675_0003429 3300047444 Bacteria 9549
553 Ga0495677_0045869 3300047445 Bacteria 1604
554 Ga0495673_0141652 3300047469 Bacteria 937
555 Ga0495673_0183913 3300047469 Bacteria 790
556 Ga0495673_0198737 3300047469 Bacteria 751
557 Ga0495681_0166983 3300047470 Bacteria 913
558 Ga0495681_0178368 3300047470 Bacteria 874
559 Ga0495684_0087439 3300047471 Bacteria 2362
560 Ga0495686_0084708 3300047472 Bacteria 1931
561 Ga0495686_0179669 3300047472 Bacteria 1227
562 Ga0495686_0216632 3300047472 Bacteria 1091
563 Ga0495602_0009971 3300048088 Bacteria 9856
564 Ga0495615_0056467 3300048090 Bacteria 1025
565 Ga0495615_0238906 3300048090 Bacteria 572
566 Ga0495626_0053772 3300048091 Bacteria 1852
567 Ga0495626_0301367 3300048091 Bacteria 633
568 Ga0496100_0018898 3300048903 Bacteria 4101
569 Ga0496100_0624579 3300048903 Bacteria 838
570 Ga0496100_1139752 3300048903 Bacteria 615
571 Ga0496101_0553999 3300048904 Bacteria 909
572 Ga0496101_0772542 3300048904 Bacteria 758
573 Ga0496102_0264305 3300048905 Bacteria 1622
574 Ga0496102_0843607 3300048905 Bacteria 838
575 Ga0496102_0897480 3300048905 Bacteria 808
576 Ga0496102_1428297 3300048905 Bacteria 611
577 Ga0496103_0082121 3300048906 Bacteria 2028
578 Ga0496104_0254219 3300048907 Bacteria 1670
579 Ga0496104_0414267 3300048907 Bacteria 1260
580 Ga0496104_1030480 3300048907 Bacteria 727
581 Ga0496106_0227948 3300048909 Bacteria 1487
582 Ga0496106_0349388 3300048909 Bacteria 1188
583 Ga0496106_0685787 3300048909 Bacteria 817
584 Ga0496106_1170744 3300048909 Bacteria 600
585 Ga0496107_0022694 3300048910 Bacteria 4437
586 Ga0496108_0287153 3300048911 Bacteria 1432
587 Ga0496109_0074991 3300048912 Bacteria 3110
588 Ga0496112_0759066 3300048915 Bacteria 896
589 Ga0496114_0493902 3300048917 Bacteria 1083
590 Ga0496114_0990009 3300048917 Bacteria 724
591 Ga0496115_0257474 3300048918 Bacteria 1435
592 Ga0496115_0475818 3300048918 Bacteria 1006
593 Ga0496115_1153571 3300048918 Bacteria 585
594 Ga0496116_0042554 3300048919 Bacteria 3103
595 Ga0496117_0076506 3300048920 Bacteria 2219
596 Ga0496117_0590343 3300048920 Bacteria 521
597 Ga0496118_0046965 3300048921 Bacteria 3353
598 Ga0496118_0060931 3300048921 Bacteria 2798
599 Ga0496118_0337355 3300048921 Bacteria 810
600 Ga0496118_0398540 3300048921 Bacteria 716
601 Ga0496120_0114125 3300048923 Bacteria 1406
602 Ga0496121_0007499 3300048924 Bacteria 13165
603 Ga0496121_0042459 3300048924 Bacteria 3955
604 Ga0496121_0048693 3300048924 Bacteria 3603
605 Ga0496121_0090484 3300048924 Bacteria 2392
606 Ga0496121_0165387 3300048924 Bacteria 1613
607 Ga0496121_0197453 3300048924 Bacteria 1437
608 Ga0496121_0325218 3300048924 Bacteria 1034
609 Ga0496121_0381963 3300048924 Bacteria 928
610 Ga0496121_0430740 3300048924 Bacteria 856
611 Ga0496122_0029922 3300048925 Bacteria 4576
612 Ga0496123_0131374 3300048926 Bacteria 1386
613 Ga0496123_0283718 3300048926 Bacteria 799
614 Ga0496124_0455107 3300048927 Bacteria 871
615 Ga0496124_0549259 3300048927 Bacteria 763
616 Ga0496124_0737022 3300048927 Bacteria 619
617 Ga0496125_0000272 3300048928 Bacteria 105490
618 Ga0496125_0003504 3300048928 Bacteria 18949
619 Ga0496125_0242611 3300048928 Bacteria 1143
620 Ga0496125_0396184 3300048928 Bacteria 808
621 Ga0496126_0157364 3300048929 Bacteria 1944
622 Ga0496126_0223066 3300048929 Bacteria 1582
623 Ga0496126_0566258 3300048929 Bacteria 899
624 Ga0496126_0820230 3300048929 Bacteria 712
625 Ga0496126_1310803 3300048929 Bacteria 527
626 Ga0495678_054826 3300049459 Bacteria 1524
627 Ga0495682_0027769 3300049460 Bacteria 2099
628 Ga0495682_0124187 3300049460 Bacteria 924
629 Ga0501031_0080173 3300049568 Bacteria 2127
630 Ga0501031_0275193 3300049568 Bacteria 1092
631 Ga0501031_0278267 3300049568 Bacteria 1086
632 Ga0501032_0000129 3300049569 Bacteria 62082
633 Ga0501033_0001179 3300049570 Bacteria 23588
634 Ga0501033_0073910 3300049570 Bacteria 2503
635 Ga0501033_0116995 3300049570 Bacteria 1936
636 Ga0501033_0133485 3300049570 Bacteria 1797
637 Ga0501033_0652720 3300049570 Bacteria 719
638 Ga0501033_0873357 3300049570 Bacteria 605
639 Ga0501034_0000503 3300049571 Bacteria 63099
640 Ga0501034_0239638 3300049571 Bacteria 1760
641 Ga0501034_0586247 3300049571 Bacteria 1021
642 Ga0501034_0777062 3300049571 Bacteria 852
643 Ga0501036_0001453 3300049572 Bacteria 18220
644 Ga0501036_0171015 3300049572 Bacteria 1831
645 Ga0501036_0213443 3300049572 Bacteria 1621
646 Ga0501037_0000106 3300049573 Bacteria 79430
647 Ga0501037_0108472 3300049573 Bacteria 2000
648 Ga0501037_0143047 3300049573 Bacteria 1711
649 Ga0501037_0254999 3300049573 Bacteria 1227
650 Ga0501038_0001655 3300049574 Bacteria 20704
651 Ga0501038_0095220 3300049574 Bacteria 2487
652 Ga0501038_0576133 3300049574 Bacteria 854
653 Ga0501038_0995126 3300049574 Bacteria 616
654 Ga0501039_0000416 3300049575 Bacteria 30616
655 Ga0501039_0361693 3300049575 Bacteria 1140
656 Ga0501039_0870684 3300049575 Bacteria 702
657 Ga0501039_1082497 3300049575 Bacteria 622
658 Ga0501041_0614810 3300049577 Bacteria 694
659 Ga0501042_0320311 3300049578 Bacteria 1120
660 Ga0501043_0000035 3300049579 Bacteria 133200
661 Ga0501043_0074841 3300049579 Bacteria 2660
662 Ga0501043_0116718 3300049579 Bacteria 2094
663 Ga0501043_0175035 3300049579 Bacteria 1673
664 Ga0501043_0184225 3300049579 Bacteria 1626
665 Ga0501043_0861069 3300049579 Bacteria 652
666 Ga0501046_0000235 3300049580 Bacteria 57005
667 Ga0501046_0069988 3300049580 Bacteria 2729
668 Ga0501046_0219622 3300049580 Bacteria 1408
669 Ga0501047_0000844 3300049581 Bacteria 31650
670 Ga0501047_0011760 3300049581 Bacteria 8276
671 Ga0501047_0014131 3300049581 Bacteria 7586
672 Ga0501047_0187014 3300049581 Bacteria 1936
673 Ga0501047_1114838 3300049581 Bacteria 602
674 Ga0501048_0001444 3300049582 Bacteria 18038
675 Ga0501048_0093360 3300049582 Bacteria 2123
676 Ga0501067_0000160 3300049583 Bacteria 37883
677 Ga0501067_0065736 3300049583 Bacteria 2008
678 Ga0501068_0000014 3300049584 Bacteria 62762
679 Ga0501069_0004593 3300049585 Bacteria 7142
680 Ga0501069_0112465 3300049585 Bacteria 1551
681 Ga0501070_0002059 3300049586 Bacteria 17669
682 Ga0501070_0043404 3300049586 Bacteria 3741
683 Ga0501070_0067819 3300049586 Bacteria 2955
684 Ga0501071_0052208 3300049587 Bacteria 2948
685 Ga0501071_0053226 3300049587 Bacteria 2919
686 Ga0501072_0001159 3300049588 Bacteria 19618
687 Ga0501073_0000417 3300049589 Bacteria 29149
688 Ga0501073_0665876 3300049589 Bacteria 718
689 Ga0501073_0700938 3300049589 Bacteria 698
690 Ga0501074_0001839 3300049590 Bacteria 14545
691 Ga0501076_0991825 3300049592 Bacteria 692
692 Ga0501079_0000261 3300049741 Bacteria 32317
693 Ga0501080_0000917 3300049742 Bacteria 24141
694 Ga0501080_0019039 3300049742 Bacteria 6357
695 Ga0501081_1238644 3300049743 Bacteria 565
696 Ga0501081_1365144 3300049743 Bacteria 538
697 Ga0501083_0000301 3300049744 Bacteria 31182
698 Ga0501083_0334581 3300049744 Bacteria 984
699 Ga0501269_007654 3300049766 Bacteria 1305
700 Ga0501035_0000324 3300049822 Bacteria 55297
701 Ga0501035_0000807 3300049822 Bacteria 33393
702 Ga0501035_0041846 3300049822 Bacteria 4135
703 Ga0501035_0183194 3300049822 Bacteria 1803
704 Ga0501035_0209110 3300049822 Bacteria 1670
705 Ga0501044_0000051 3300049823 Bacteria 143658
706 Ga0501044_0001093 3300049823 Bacteria 32295
707 Ga0501044_0172931 3300049823 Bacteria 2130
708 Ga0501044_0301936 3300049823 Bacteria 1529
709 Ga0501044_1203345 3300049823 Bacteria 625
710 Ga0501045_0040080 3300049824 Bacteria 3408
711 Ga0501045_0563915 3300049824 Bacteria 844
712 nmdc:mga03683_471999_c1 3300050489 Bacteria 605
713 nmdc:mga03683_612453_c1 3300050489 Bacteria 534
714 nmdc:mga03n38_106245_c1 3300050490 Bacteria 1361
715 nmdc:mga03n38_128379_c1 3300050490 Bacteria 1254
716 nmdc:mga03n38_273834_c2 3300050490 Bacteria 589
717 nmdc:mga00v17_263510_c1 3300050491 Bacteria 1118
718 nmdc:mga00v17_289371_c1 3300050491 Bacteria 1064
719 nmdc:mga0yw44_121480_c1 3300050492 Bacteria 1683
720 nmdc:mga0yw44_1241_c1 3300050492 Bacteria 10009
721 nmdc:mga0yw44_152714_c1 3300050492 Bacteria 1507
722 nmdc:mga0yw44_284549_c1 3300050492 Bacteria 1105
723 nmdc:mga0yw44_45937_c1 3300050492 Bacteria 2621
724 nmdc:mga0yw44_547448_c1 3300050492 Bacteria 786
725 nmdc:mga0yw44_793716_c1 3300050492 Bacteria 643
726 nmdc:mga0k408_110552_c1 3300050493 Bacteria 1624
727 nmdc:mga0k408_135884_c1 3300050493 Bacteria 1461
728 nmdc:mga0k408_331466_c1 3300050493 Bacteria 908
729 nmdc:mga0k408_640343_c1 3300050493 Bacteria 625
730 nmdc:mga06z11_636333_c1 3300050494 Bacteria 649
731 nmdc:mga06z11_745189_c1 3300050494 Bacteria 597
732 nmdc:mga04h51_111064_c1 3300050495 Bacteria 1011
733 nmdc:mga04h51_149357_c1 3300050495 Bacteria 892
734 nmdc:mga07m45_118877_c1 3300050496 Bacteria 1526
735 nmdc:mga05p37_1096040_c1 3300050507 Bacteria 834
736 nmdc:mga05p37_91569_c1 3300050507 Bacteria 3747
737 nmdc:mga0n895_437936_c1 3300050512 Bacteria 1320
738 nmdc:mga0rr50_638421_c1 3300050513 Bacteria 908
739 nmdc:mga0sz30_163093_c1 3300050516 Bacteria 987
740 nmdc:mga0sz30_414884_c1 3300050516 Bacteria 603
741 nmdc:mga0sz30_6813_c3 3300050516 Bacteria 863
742 Ga0495601_0387858 3300053077 Bacteria 906
743 Ga0495612_0010268 3300053078 Bacteria 3789
744 Ga0495612_0041356 3300053078 Bacteria 1880
745 Ga0495595_0318258 3300053084 Bacteria 783
746 Ga0500643_000032 3300053087 Bacteria 200350
747 Ga0500644_0304405 3300053088 Bacteria 683
748 Ga0500646_0053575 3300053090 Bacteria 1170
749 Ga0500583_0048511 3300053092 Bacteria 1960
750 Ga0500583_0133509 3300053092 Bacteria 1232
751 Ga0500583_0197464 3300053092 Bacteria 1000
752 Ga0500583_0517724 3300053092 Bacteria 558
753 Ga0500566_0004691 3300053094 Bacteria 8134
754 Ga0500641_0089183 3300053096 Bacteria 1315
755 Ga0500641_0164785 3300053096 Bacteria 955
756 Ga0500641_0415350 3300053096 Bacteria 526
757 Ga0500650_0128609 3300053098 Bacteria 1178
758 Ga0500555_008642 3300053103 Bacteria 2904
759 Ga0500556_0153844 3300053104 Bacteria 907
760 Ga0500556_0244505 3300053104 Bacteria 707
761 Ga0500557_021384 3300053105 Bacteria 1854
762 Ga0500562_027034 3300053108 Bacteria 1505
763 Ga0500569_050034 3300053109 Bacteria 1257
764 Ga0500592_014572 3300053116 Bacteria 1260
765 Ga0500594_0002401 3300053118 Bacteria 4078
766 Ga0500594_0103937 3300053118 Bacteria 877
767 Ga0500595_021164 3300053119 Bacteria 2326
768 Ga0500595_032344 3300053119 Bacteria 1747
769 Ga0500608_204478 3300053122 Bacteria 813
770 Ga0500621_144765 3300053126 Bacteria 898
771 Ga0500626_136979 3300053128 Bacteria 1032
772 Ga0500642_0000173 3300053130 Bacteria 26732
773 Ga0500642_0238158 3300053130 Bacteria 839
774 Ga0500642_0247371 3300053130 Bacteria 819
775 Ga0500652_280158 3300053131 Bacteria 651
776 Ga0500655_015433 3300053133 Bacteria 1402
777 Ga0500655_036468 3300053133 Bacteria 957
778 Ga0500655_083723 3300053133 Bacteria 658
779 Ga0500559_0346537 3300053136 Bacteria 695
780 Ga0500568_0000411 3300053139 Bacteria 32773
781 Ga0500568_0020317 3300053139 Bacteria 2875
782 Ga0500568_0042194 3300053139 Bacteria 1829
783 Ga0500568_0237144 3300053139 Bacteria 665
784 Ga0500588_0067660 3300053146 Bacteria 1162
785 Ga0500588_0225933 3300053146 Bacteria 699
786 Ga0500589_050279 3300053147 Bacteria 1934
787 Ga0500589_110811 3300053147 Bacteria 1177
788 Ga0500604_0086442 3300053151 Bacteria 1019
789 Ga0500604_0097467 3300053151 Bacteria 966
790 Ga0500616_0006355 3300053153 Bacteria 7753
791 Ga0500616_0258737 3300053153 Bacteria 740
792 Ga0500622_0000428 3300053156 Bacteria 39928
793 Ga0500622_0006595 3300053156 Bacteria 6694
794 Ga0500627_0092747 3300053158 Bacteria 1352
795 Ga0500634_0210020 3300053161 Bacteria 846
796 Ga0500609_036270 3300053731 Bacteria 680
797 Ga0500599_003267 3300053736 Bacteria 1971
798 Ga0501084_0429030 3300054114 Bacteria 1117
799 Ga0501084_0903347 3300054114 Bacteria 743
800 Ga0501084_1196225 3300054114 Bacteria 638
801 Ga0501082_0018584 3300060353 Bacteria 5991
802 Ga0501082_0064726 3300060353 Bacteria 3149
803 Ga0501082_0133402 3300060353 Bacteria 2155
804 Ga0466962_0661545 3300061719 Bacteria 534

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046674 Ga0495588_0034992 Ga0495588_0034992_874_1194 77
2 3300044684 Ga0466966_0034096 Ga0466966_0034096_2378_2698 89
3 3300045049 Ga0466959_1038728 Ga0466959_1038728_60_380 89
4 3300049568 Ga0501031_0278267 Ga0501031_0278267_304_621 89
5 3300049580 Ga0501046_0219622 Ga0501046_0219622_1076_1393 89
6 3300049581 Ga0501047_0011760 Ga0501047_0011760_2952_3269 89
7 3300049583 Ga0501067_0065736 Ga0501067_0065736_611_928 89
8 3300049585 Ga0501069_0112465 Ga0501069_0112465_379_696 89
9 3300049586 Ga0501070_0002059 Ga0501070_0002059_12675_12992 89
10 3300049587 Ga0501071_0053226 Ga0501071_0053226_426_743 89
11 3300049589 Ga0501073_0665876 Ga0501073_0665876_281_598 89
12 3300049742 Ga0501080_0019039 Ga0501080_0019039_5872_6189 89
13 3300049822 Ga0501035_0000807 Ga0501035_0000807_32031_32348 89
14 3300049823 Ga0501044_0001093 Ga0501044_0001093_27304_27621 89
15 3300053092 Ga0500583_0197464 Ga0500583_0197464_653_973 89
16 3300053098 Ga0500650_0128609 Ga0500650_0128609_379_699 89
17 3300053104 Ga0500556_0153844 Ga0500556_0153844_487_807 89
18 3300053130 Ga0500642_0238158 Ga0500642_0238158_47_367 89
19 3300053133 Ga0500655_015433 Ga0500655_015433_987_1307 89
20 3300060353 Ga0501082_0064726 Ga0501082_0064726_1108_1425 89
21 3300061719 Ga0466962_0661545 Ga0466962_0661545_190_510 89
22 3300012513 Ga0157326_1068441 Ga0157326_10684411 90
23 3300049579 Ga0501043_0175035 Ga0501043_0175035_980_1294 92
24 3300049570 Ga0501033_0073910 Ga0501033_0073910_1580_1894 93
25 3300046507 Ga0495606_0007239 Ga0495606_0007239_7673_7990 94
26 3300046512 Ga0495610_0009298 Ga0495610_0009298_4870_5187 94
27 3300049823 Ga0501044_0172931 Ga0501044_0172931_453_767 94
28 3300005548 Ga0070665_100430766 Ga0070665_1004307661 95
29 3300028379 Ga0268266_10374299 Ga0268266_103742991 95
30 3300046492 Ga0495585_0100853 Ga0495585_0100853_779_1105 95
31 3300046523 Ga0495644_0040197 Ga0495644_0040197_1025_1351 95
32 3300046537 Ga0495598_0040795 Ga0495598_0040795_816_1142 95
33 3300046539 Ga0495621_0042629 Ga0495621_0042629_287_613 95
34 3300046648 Ga0495611_0231224 Ga0495611_0231224_411_737 95
35 3300046691 Ga0495670_0056306 Ga0495670_0056306_1425_1751 95
36 3300047318 Ga0495636_0218643 Ga0495636_0218643_195_521 95
37 3300047470 Ga0495681_0178368 Ga0495681_0178368_413_739 95
38 3300046538 Ga0495609_0347108 Ga0495609_0347108_85_399 96
39 3300005327 Ga0070658_11837011 Ga0070658_118370111 98
40 3300005340 Ga0070689_100441180 Ga0070689_1004411801 98
41 3300005344 Ga0070661_100795548 Ga0070661_1007955481 98
42 3300005455 Ga0070663_100631601 Ga0070663_1006316011 98
43 3300005456 Ga0070678_100412271 Ga0070678_1004122712 98
44 3300005843 Ga0068860_100097783 Ga0068860_1000977832 98
45 3300005844 Ga0068862_100229211 Ga0068862_1002292113 98
46 3300013306 Ga0163162_10626212 Ga0163162_106262123 98
47 3300014325 Ga0163163_11335015 Ga0163163_113350152 98
48 3300014497 Ga0182008_10313625 Ga0182008_103136252 98
49 3300025920 Ga0207649_10177366 Ga0207649_101773661 98
50 3300025924 Ga0207694_10534288 Ga0207694_105342882 98
51 3300025936 Ga0207670_10390914 Ga0207670_103909141 98
52 3300026067 Ga0207678_10258769 Ga0207678_102587692 98
53 3300026121 Ga0207683_10252968 Ga0207683_102529682 98
54 3300028381 Ga0268264_10065341 Ga0268264_100653411 98
55 3300048907 Ga0496104_1030480 Ga0496104_1030480_13_336 98
56 3300048917 Ga0496114_0493902 Ga0496114_0493902_750_1073 98
57 3300048918 Ga0496115_0257474 Ga0496115_0257474_752_1075 98
58 3300048924 Ga0496121_0325218 Ga0496121_0325218_679_1002 98
59 3300041413 Ga0439465_0360995 Ga0439465_0360995_188_490 99
60 3300042156 Ga0439446_0269951 Ga0439446_0269951_59_361 99
61 3300046460 Ga0495638_0001093 Ga0495638_0001093_25030_25353 99
62 3300046471 Ga0495650_0000150 Ga0495650_0000150_102763_103086 99
63 3300046692 Ga0495671_0244940 Ga0495671_0244940_183_482 99
64 iso_pu_bacteria 2507262055 2507508421 100
65 iso_pu_bacteria 2508501009 2508542488 100
66 iso_pu_bacteria 2510917030 2511199992 100
67 iso_pu_bacteria 2513237096 2513658008 100
68 iso_pu_bacteria 2513237101 2513692732 100
69 iso_pu_bacteria 2513237137 2513855710 100
70 iso_pu_bacteria 2513237144 2513913118 100
71 iso_pu_bacteria 2513237145 2513919898 100
72 iso_pu_bacteria 2515154112 2515627086 100
73 iso_pu_bacteria 2517572143 2517892249 100
74 iso_pu_bacteria 2524023205 2524437517 100
75 iso_pu_bacteria 2524023210 2524465677 100
76 iso_pu_bacteria 2524023228 2524540316 100
77 iso_pu_bacteria 2582581298 2585224251 100
78 iso_pu_bacteria 2585427529 2585546372 100
79 iso_pu_bacteria 2617270742 2617385692 100
80 iso_pu_bacteria 2643221634 2644192860 100
81 iso_pu_bacteria 2643221645 2644251530 100
82 iso_pu_bacteria 2643221664 2644357399 100
83 iso_pu_bacteria 2643221733 2644728278 100
84 iso_pu_bacteria 2728368998 2728747396 100
85 iso_pu_bacteria 2738541280 2738739991 100
86 iso_pu_bacteria 2738541300 2738844254 100
87 iso_pu_bacteria 2738543018 2739274186 100
88 iso_pu_bacteria 2738543030 2739343230 100
89 iso_pu_bacteria 2744054633 2745076491 100
90 iso_pu_bacteria 2775507266 2778173928 100
91 iso_pu_bacteria 2791355197 2793072410 100
92 iso_pu_bacteria 2791355199 2793082240 100
93 iso_pu_bacteria 2818991448 2819612896 100
94 iso_pu_bacteria 2838029111 2838030185 100
95 iso_pu_bacteria 2842475841 2842476530 100
96 iso_pu_bacteria 2842502639 2842503713 100
97 iso_pu_bacteria 2874590934 2874598215 100
98 iso_pu_bacteria 2874645413 2874652728 100
99 iso_pu_bacteria 2876761206 2876764686 100
100 iso_pu_bacteria 2876771140 2876778307 100
101 iso_pu_bacteria 2876818435 2876825824 100
102 iso_pu_bacteria 2879074833 2879082101 100
103 iso_pu_bacteria 2879127579 2879135248 100
104 iso_pu_bacteria 2879142872 2879145393 100
105 iso_pu_bacteria 2885374607 2885381922 100
106 iso_pu_bacteria 2885409591 2885411442 100
107 iso_pu_bacteria 2903748898 2903749163 100
108 iso_pu_bacteria 2904699407 2904702408 100
109 iso_pu_bacteria 2906610324 2906618770 100
110 iso_pu_bacteria 2906635258 2906643129 100
111 iso_pu_bacteria 2906660503 2906666221 100
112 iso_pu_bacteria 2908739725 2908742529 100
113 iso_pu_bacteria 2919100787 2919106973 100
114 iso_pu_bacteria 2922425934 2922430449 100
115 iso_pu_bacteria 2935608549 2935609039 100
116 iso_pu_bacteria 2935630451 2935631519 100
117 iso_pu_bacteria 2935648319 2935653252 100
118 iso_pu_bacteria 2935656913 2935660429 100
119 iso_pu_bacteria 2935694250 2935701258 100
120 iso_pu_bacteria 2935769743 2935771872 100
121 iso_pu_bacteria 2935777560 2935778691 100
122 iso_pu_bacteria 2935785616 2935788923 100
123 iso_pu_bacteria 2935793552 2935795277 100
124 iso_pu_bacteria 2935819856 2935822199 100
125 iso_pu_bacteria 2935847175 2935847781 100
126 iso_pu_bacteria 2935908558 2935908946 100
127 iso_pu_bacteria 2935916978 2935919664 100
128 iso_pu_bacteria 2935926038 2935926480 100
129 iso_pu_bacteria 2935934488 2935934930 100
130 iso_pu_bacteria 2935942939 2935943380 100
131 iso_pu_bacteria 2935951376 2935951818 100
132 iso_pu_bacteria 2935967501 2935967943 100
133 iso_pu_bacteria 2935975950 2935978568 100
134 iso_pu_bacteria 2936011229 2936016122 100
135 iso_pu_bacteria 2936019824 2936024755 100
136 iso_pu_bacteria 2936028420 2936031851 100
137 iso_pu_bacteria 2936046547 2936049712 100
138 iso_pu_bacteria 2936055302 2936060816 100
139 iso_pu_bacteria 2941507105 2941511313 100
140 iso_pu_bacteria 2941515067 2941519014 100
141 iso_pu_bacteria 2941523033 2941526406 100
142 iso_pu_bacteria 3005416602 3005420195 100
143 iso_pu_bacteria 3005445848 3005447416 100
144 iso_pu_bacteria 3005474847 3005480360 100
145 iso_pu_bacteria 8005314921 8005317146 100
146 iso_pu_bacteria 8005484373 8005485056 100
147 iso_pu_bacteria 8005645114 8005648790 100
148 iso_pu_bacteria 8006984368 8006986580 100
149 iso_pu_bacteria 8006994254 8006995835 100
150 iso_pu_bacteria 8016522445 8016529449 100
151 iso_pu_bacteria 8016530956 8016534659 100
152 iso_pu_bacteria 8016539877 8016547878 100
153 iso_pu_bacteria 8016548790 8016554255 100
154 iso_pu_bacteria 8016557553 8016562630 100
155 iso_pu_bacteria 8016566248 8016573006 100
156 iso_pu_bacteria 8016575299 8016577156 100
157 iso_pu_bacteria 8016583857 8016591562 100
158 iso_pu_bacteria 8016595262 8016600414 100
159 iso_pu_bacteria 8016603502 8016610324 100
160 iso_pu_bacteria 8016613128 8016614607 100
161 iso_pu_bacteria 8016622563 8016626392 100
162 iso_pu_bacteria 8019530166 8019534424 100
163 iso_pu_bacteria 8019538911 8019545044 100
164 iso_pu_bacteria 8019547302 8019553482 100
165 iso_pu_bacteria 8019619141 8019628352 100
166 iso_pu_bacteria 8019629233 8019634275 100
167 iso_pu_bacteria 8019638758 8019645457 100
168 iso_pu_bacteria 8019659431 8019662152 100
169 iso_pu_bacteria 8019668869 8019671668 100
170 iso_pu_bacteria 8019678201 8019684432 100
171 iso_pu_bacteria 8019687851 8019690241 100
172 iso_pu_bacteria 8024486573 8024492347 100
173 iso_pu_bacteria 8056673599 8056673673 100
174 iso_pu_bacteria 8056689827 8056691357 100
175 iso_pu_bacteria 8056875544 8056877749 100
176 3300009094 Ga0111539_10097484 Ga0111539_100974842 102
177 3300006038 Ga0075365_10693248 Ga0075365_106932482 103
178 3300002244 JGI24742J22300_10056159 JGI24742J22300_100561592 104
179 3300002774 JGI25150J39212_1004568 JGI25150J39212_10045684 104
180 3300003187 JGI25151J46595_10032278 JGI25151J46595_100322782 104
181 3300003320 rootH2_10061177 rootH2_100611772 104
182 3300003323 rootH1_10104268 rootH1_101042684 104
183 3300005327 Ga0070658_10136463 Ga0070658_101364631 104
184 3300005328 Ga0070676_11540057 Ga0070676_115400571 104
185 3300005331 Ga0070670_101010124 Ga0070670_1010101242 104
186 3300005334 Ga0068869_100660198 Ga0068869_1006601981 104
187 3300005336 Ga0070680_100904352 Ga0070680_1009043521 104
188 3300005337 Ga0070682_100395399 Ga0070682_1003953991 104
189 3300005337 Ga0070682_100510009 Ga0070682_1005100091 104
190 3300005337 Ga0070682_101581953 Ga0070682_1015819531 104
191 3300005338 Ga0068868_101538427 Ga0068868_1015384272 104
192 3300005339 Ga0070660_100063644 Ga0070660_1000636442 104
193 3300005339 Ga0070660_100119385 Ga0070660_1001193852 104
194 3300005339 Ga0070660_100681149 Ga0070660_1006811492 104
195 3300005340 Ga0070689_100893347 Ga0070689_1008933472 104
196 3300005340 Ga0070689_101167600 Ga0070689_1011676002 104
197 3300005341 Ga0070691_10260330 Ga0070691_102603301 104
198 3300005343 Ga0070687_100032178 Ga0070687_1000321783 104
199 3300005344 Ga0070661_100402284 Ga0070661_1004022842 104
200 3300005344 Ga0070661_101892819 Ga0070661_1018928191 104
201 3300005345 Ga0070692_10198421 Ga0070692_101984212 104
202 3300005347 Ga0070668_100085455 Ga0070668_1000854554 104
203 3300005347 Ga0070668_100159129 Ga0070668_1001591292 104
204 3300005347 Ga0070668_100445378 Ga0070668_1004453782 104
205 3300005347 Ga0070668_100493870 Ga0070668_1004938701 104
206 3300005353 Ga0070669_100410377 Ga0070669_1004103773 104
207 3300005353 Ga0070669_101177780 Ga0070669_1011777802 104
208 3300005353 Ga0070669_101683811 Ga0070669_1016838111 104
209 3300005354 Ga0070675_100126736 Ga0070675_1001267362 104
210 3300005355 Ga0070671_100760213 Ga0070671_1007602132 104
211 3300005356 Ga0070674_100229913 Ga0070674_1002299132 104
212 3300005356 Ga0070674_100239610 Ga0070674_1002396101 104
213 3300005356 Ga0070674_100618044 Ga0070674_1006180442 104
214 3300005364 Ga0070673_100092112 Ga0070673_1000921123 104
215 3300005364 Ga0070673_102324819 Ga0070673_1023248192 104
216 3300005365 Ga0070688_100253166 Ga0070688_1002531662 104
217 3300005366 Ga0070659_100283117 Ga0070659_1002831172 104
218 3300005366 Ga0070659_101128352 Ga0070659_1011283521 104
219 3300005367 Ga0070667_100138172 Ga0070667_1001381722 104
220 3300005367 Ga0070667_100538464 Ga0070667_1005384641 104
221 3300005435 Ga0070714_100215391 Ga0070714_1002153912 104
222 3300005438 Ga0070701_10529756 Ga0070701_105297562 104
223 3300005439 Ga0070711_101261078 Ga0070711_1012610781 104
224 3300005441 Ga0070700_101063977 Ga0070700_1010639772 104
225 3300005455 Ga0070663_100141798 Ga0070663_1001417981 104
226 3300005455 Ga0070663_100412886 Ga0070663_1004128862 104
227 3300005455 Ga0070663_100970268 Ga0070663_1009702682 104
228 3300005455 Ga0070663_101291933 Ga0070663_1012919332 104
229 3300005456 Ga0070678_100895892 Ga0070678_1008958921 104
230 3300005456 Ga0070678_101119005 Ga0070678_1011190052 104
231 3300005457 Ga0070662_100242347 Ga0070662_1002423472 104
232 3300005459 Ga0068867_100144536 Ga0068867_1001445362 104
233 3300005459 Ga0068867_100182446 Ga0068867_1001824462 104
234 3300005459 Ga0068867_100642876 Ga0068867_1006428761 104
235 3300005518 Ga0070699_102118125 Ga0070699_1021181251 104
236 3300005535 Ga0070684_100009651 Ga0070684_1000096513 104
237 3300005535 Ga0070684_102165089 Ga0070684_1021650891 104
238 3300005539 Ga0068853_100648677 Ga0068853_1006486772 104
239 3300005539 Ga0068853_100676096 Ga0068853_1006760962 104
240 3300005539 Ga0068853_101276634 Ga0068853_1012766342 104
241 3300005543 Ga0070672_100182223 Ga0070672_1001822232 104
242 3300005544 Ga0070686_100251596 Ga0070686_1002515961 104
243 3300005544 Ga0070686_100994014 Ga0070686_1009940141 104
244 3300005546 Ga0070696_101031132 Ga0070696_1010311322 104
245 3300005547 Ga0070693_100098089 Ga0070693_1000980892 104
246 3300005547 Ga0070693_100241639 Ga0070693_1002416392 104
247 3300005548 Ga0070665_100054664 Ga0070665_1000546642 104
248 3300005548 Ga0070665_100449901 Ga0070665_1004499012 104
249 3300005548 Ga0070665_100637708 Ga0070665_1006377082 104
250 3300005548 Ga0070665_101042886 Ga0070665_1010428862 104
251 3300005548 Ga0070665_101112075 Ga0070665_1011120751 104
252 3300005548 Ga0070665_101455999 Ga0070665_1014559991 104
253 3300005564 Ga0070664_100160106 Ga0070664_1001601062 104
254 3300005577 Ga0068857_100094952 Ga0068857_1000949522 104
255 3300005577 Ga0068857_101155552 Ga0068857_1011555522 104
256 3300005578 Ga0068854_100725574 Ga0068854_1007255742 104
257 3300005578 Ga0068854_100767556 Ga0068854_1007675562 104
258 3300005615 Ga0070702_100133682 Ga0070702_1001336822 104
259 3300005615 Ga0070702_100424572 Ga0070702_1004245722 104
260 3300005615 Ga0070702_100953772 Ga0070702_1009537722 104
261 3300005616 Ga0068852_100606191 Ga0068852_1006061912 104
262 3300005616 Ga0068852_101153310 Ga0068852_1011533102 104
263 3300005617 Ga0068859_101877552 Ga0068859_1018775521 104
264 3300005618 Ga0068864_100117769 Ga0068864_1001177692 104
265 3300005618 Ga0068864_100812271 Ga0068864_1008122712 104
266 3300005718 Ga0068866_10530964 Ga0068866_105309642 104
267 3300005718 Ga0068866_10587354 Ga0068866_105873541 104
268 3300005719 Ga0068861_100026842 Ga0068861_1000268423 104
269 3300005719 Ga0068861_100043262 Ga0068861_1000432621 104
270 3300005719 Ga0068861_101679600 Ga0068861_1016796001 104
271 3300005840 Ga0068870_10266369 Ga0068870_102663692 104
272 3300005841 Ga0068863_100452979 Ga0068863_1004529792 104
273 3300005841 Ga0068863_101281329 Ga0068863_1012813291 104
274 3300005841 Ga0068863_101405916 Ga0068863_1014059162 104
275 3300005842 Ga0068858_100167543 Ga0068858_1001675432 104
276 3300005842 Ga0068858_100990254 Ga0068858_1009902542 104
277 3300005842 Ga0068858_101083150 Ga0068858_1010831502 104
278 3300005843 Ga0068860_100712905 Ga0068860_1007129052 104
279 3300005843 Ga0068860_101843462 Ga0068860_1018434621 104
280 3300005844 Ga0068862_100895960 Ga0068862_1008959602 104
281 3300005981 Ga0081538_10146460 Ga0081538_101464602 104
282 3300005983 Ga0081540_1000979 Ga0081540_100097931 104
283 3300005983 Ga0081540_1002120 Ga0081540_100212010 104
284 3300005983 Ga0081540_1016464 Ga0081540_10164643 104
285 3300005983 Ga0081540_1062415 Ga0081540_10624152 104
286 3300005983 Ga0081540_1086805 Ga0081540_10868052 104
287 3300005983 Ga0081540_1154399 Ga0081540_11543992 104
288 3300005985 Ga0081539_10355003 Ga0081539_103550031 104
289 3300006028 Ga0070717_11701812 Ga0070717_117018122 104
290 3300006038 Ga0075365_10008619 Ga0075365_100086195 104
291 3300006038 Ga0075365_10040202 Ga0075365_100402024 104
292 3300006038 Ga0075365_10367933 Ga0075365_103679332 104
293 3300006038 Ga0075365_10589218 Ga0075365_105892182 104
294 3300006038 Ga0075365_10654827 Ga0075365_106548272 104
295 3300006042 Ga0075368_10091715 Ga0075368_100917152 104
296 3300006042 Ga0075368_10323246 Ga0075368_103232461 104
297 3300006048 Ga0075363_100206140 Ga0075363_1002061402 104
298 3300006048 Ga0075363_100346176 Ga0075363_1003461762 104
299 3300006048 Ga0075363_100393687 Ga0075363_1003936872 104
300 3300006048 Ga0075363_100801811 Ga0075363_1008018112 104
301 3300006051 Ga0075364_10051506 Ga0075364_100515062 104
302 3300006051 Ga0075364_10670220 Ga0075364_106702201 104
303 3300006051 Ga0075364_10754760 Ga0075364_107547602 104
304 3300006173 Ga0070716_100073021 Ga0070716_1000730212 104
305 3300006175 Ga0070712_100170191 Ga0070712_1001701912 104
306 3300006177 Ga0075362_10307383 Ga0075362_103073832 104
307 3300006178 Ga0075367_10118707 Ga0075367_101187072 104
308 3300006178 Ga0075367_10421078 Ga0075367_104210782 104
309 3300006178 Ga0075367_10689867 Ga0075367_106898672 104
310 3300006186 Ga0075369_10044595 Ga0075369_100445952 104
311 3300006186 Ga0075369_10124306 Ga0075369_101243062 104
312 3300006186 Ga0075369_10466375 Ga0075369_104663752 104
313 3300006195 Ga0075366_10117831 Ga0075366_101178313 104
314 3300006195 Ga0075366_10261934 Ga0075366_102619342 104
315 3300006195 Ga0075366_10267189 Ga0075366_102671892 104
316 3300006195 Ga0075366_10459588 Ga0075366_104595882 104
317 3300006195 Ga0075366_10644579 Ga0075366_106445792 104
318 3300006195 Ga0075366_10717995 Ga0075366_107179951 104
319 3300006237 Ga0097621_100135878 Ga0097621_1001358783 104
320 3300006237 Ga0097621_100738133 Ga0097621_1007381332 104
321 3300006353 Ga0075370_10348549 Ga0075370_103485492 104
322 3300006358 Ga0068871_100105154 Ga0068871_1001051543 104
323 3300006358 Ga0068871_100708175 Ga0068871_1007081752 104
324 3300006358 Ga0068871_100821995 Ga0068871_1008219952 104
325 3300006358 Ga0068871_101501112 Ga0068871_1015011121 104
326 3300006358 Ga0068871_101791650 Ga0068871_1017916502 104
327 3300006844 Ga0075428_100195180 Ga0075428_1001951803 104
328 3300006844 Ga0075428_100811114 Ga0075428_1008111142 104
329 3300006871 Ga0075434_100360265 Ga0075434_1003602652 104
330 3300006881 Ga0068865_100040566 Ga0068865_1000405662 104
331 3300006881 Ga0068865_100897288 Ga0068865_1008972882 104
332 3300006931 Ga0097620_101877645 Ga0097620_1018776451 104
333 3300007076 Ga0075435_102056085 Ga0075435_1020560851 104
334 3300009092 Ga0105250_10223894 Ga0105250_102238942 104
335 3300009094 Ga0111539_11381532 Ga0111539_113815321 104
336 3300009098 Ga0105245_10188809 Ga0105245_101888093 104
337 3300009098 Ga0105245_10910148 Ga0105245_109101482 104
338 3300009098 Ga0105245_11232222 Ga0105245_112322221 104
339 3300009101 Ga0105247_10488649 Ga0105247_104886492 104
340 3300009101 Ga0105247_10794454 Ga0105247_107944542 104
341 3300009147 Ga0114129_10053995 Ga0114129_100539952 104
342 3300009147 Ga0114129_10348949 Ga0114129_103489492 104
343 3300009148 Ga0105243_10103459 Ga0105243_101034592 104
344 3300009148 Ga0105243_11721683 Ga0105243_117216832 104
345 3300009174 Ga0105241_10175477 Ga0105241_101754772 104
346 3300009174 Ga0105241_11352439 Ga0105241_113524391 104
347 3300009176 Ga0105242_10385103 Ga0105242_103851032 104
348 3300009176 Ga0105242_13027976 Ga0105242_130279761 104
349 3300009177 Ga0105248_10296766 Ga0105248_102967662 104
350 3300009177 Ga0105248_10419139 Ga0105248_104191392 104
351 3300009545 Ga0105237_10438266 Ga0105237_104382662 104
352 3300009551 Ga0105238_10485112 Ga0105238_104851122 104
353 3300009551 Ga0105238_10801412 Ga0105238_108014122 104
354 3300009551 Ga0105238_10833253 Ga0105238_108332532 104
355 3300009551 Ga0105238_11128934 Ga0105238_111289341 104
356 3300009553 Ga0105249_10253063 Ga0105249_102530632 104
357 3300010375 Ga0105239_10229598 Ga0105239_102295983 104
358 3300010375 Ga0105239_11342977 Ga0105239_113429771 104
359 3300010375 Ga0105239_12590213 Ga0105239_125902132 104
360 3300012500 Ga0157314_1009460 Ga0157314_10094601 104
361 3300013100 Ga0157373_10601031 Ga0157373_106010312 104
362 3300013102 Ga0157371_10303289 Ga0157371_103032892 104
363 3300013104 Ga0157370_10223111 Ga0157370_102231112 104
364 3300013104 Ga0157370_10632446 Ga0157370_106324462 104
365 3300013104 Ga0157370_11054509 Ga0157370_110545092 104
366 3300013105 Ga0157369_10236078 Ga0157369_102360782 104
367 3300013105 Ga0157369_10528714 Ga0157369_105287142 104
368 3300013296 Ga0157374_10718941 Ga0157374_107189412 104
369 3300013296 Ga0157374_12005856 Ga0157374_120058561 104
370 3300013296 Ga0157374_12380889 Ga0157374_123808891 104
371 3300013297 Ga0157378_10151967 Ga0157378_101519673 104
372 3300013297 Ga0157378_11267419 Ga0157378_112674191 104
373 3300013306 Ga0163162_10935187 Ga0163162_109351872 104
374 3300013306 Ga0163162_12937819 Ga0163162_129378191 104
375 3300013307 Ga0157372_10426876 Ga0157372_104268762 104
376 3300013307 Ga0157372_11561266 Ga0157372_115612662 104
377 3300013307 Ga0157372_11570932 Ga0157372_115709322 104
378 3300013308 Ga0157375_10134785 Ga0157375_101347853 104
379 3300013308 Ga0157375_10425717 Ga0157375_104257172 104
380 3300013308 Ga0157375_11085267 Ga0157375_110852672 104
381 3300013308 Ga0157375_11655899 Ga0157375_116558991 104
382 3300013308 Ga0157375_12210842 Ga0157375_122108422 104
383 3300014325 Ga0163163_11997197 Ga0163163_119971972 104
384 3300014325 Ga0163163_12046122 Ga0163163_120461221 104
385 3300014326 Ga0157380_10095986 Ga0157380_100959862 104
386 3300014497 Ga0182008_10224458 Ga0182008_102244582 104
387 3300014745 Ga0157377_10541486 Ga0157377_105414862 104
388 3300014968 Ga0157379_10855542 Ga0157379_108555421 104
389 3300014968 Ga0157379_11152761 Ga0157379_111527612 104
390 3300014969 Ga0157376_10362954 Ga0157376_103629542 104
391 3300017792 Ga0163161_10007714 Ga0163161_100077148 104
392 3300017792 Ga0163161_10478393 Ga0163161_104783932 104
393 3300017792 Ga0163161_12033858 Ga0163161_120338581 104
394 3300017792 Ga0163161_12102111 Ga0163161_121021111 104
395 3300025208 Ga0209436_100001 Ga0209436_10000123 104
396 3300025245 Ga0207425_1014439 Ga0207425_10144392 104
397 3300025246 Ga0209646_1007456 Ga0209646_10074563 104
398 3300025258 Ga0209129_1000750 Ga0209129_10007506 104
399 3300025258 Ga0209129_1002899 Ga0209129_10028997 104
400 3300025258 Ga0209129_1003789 Ga0209129_10037895 104
401 3300025273 Ga0209673_1003813 Ga0209673_100381310 104
402 3300025284 Ga0209130_1000004 Ga0209130_100000489 104
403 3300025295 Ga0209564_1000566 Ga0209564_100056611 104
404 3300025297 Ga0209758_1000468 Ga0209758_100046865 104
405 3300025297 Ga0209758_1000977 Ga0209758_100097744 104
406 3300025297 Ga0209758_1002398 Ga0209758_100239813 104
407 3300025299 Ga0209256_1004862 Ga0209256_10048626 104
408 3300025302 Ga0207426_1000003 Ga0207426_1000003639 104
409 3300025302 Ga0207426_1058031 Ga0207426_10580312 104
410 3300025303 Ga0209051_1017453 Ga0209051_10174532 104
411 3300025304 Ga0209257_1056832 Ga0209257_10568322 104
412 3300025315 Ga0207697_10102845 Ga0207697_101028452 104
413 3300025315 Ga0207697_10260049 Ga0207697_102600492 104
414 3300025893 Ga0207682_10161166 Ga0207682_101611662 104
415 3300025898 Ga0207692_10304648 Ga0207692_103046481 104
416 3300025899 Ga0207642_10063551 Ga0207642_100635512 104
417 3300025899 Ga0207642_10259927 Ga0207642_102599272 104
418 3300025901 Ga0207688_10043066 Ga0207688_100430662 104
419 3300025901 Ga0207688_10431903 Ga0207688_104319031 104
420 3300025904 Ga0207647_10412067 Ga0207647_104120671 104
421 3300025905 Ga0207685_10444280 Ga0207685_104442802 104
422 3300025907 Ga0207645_10233471 Ga0207645_102334711 104
423 3300025909 Ga0207705_10711821 Ga0207705_107118212 104
424 3300025909 Ga0207705_11254552 Ga0207705_112545521 104
425 3300025911 Ga0207654_10076776 Ga0207654_100767762 104
426 3300025911 Ga0207654_10788706 Ga0207654_107887062 104
427 3300025911 Ga0207654_11119893 Ga0207654_111198931 104
428 3300025912 Ga0207707_10019379 Ga0207707_100193792 104
429 3300025914 Ga0207671_10149205 Ga0207671_101492052 104
430 3300025914 Ga0207671_10822285 Ga0207671_108222852 104
431 3300025915 Ga0207693_10032462 Ga0207693_100324622 104
432 3300025917 Ga0207660_10416470 Ga0207660_104164702 104
433 3300025918 Ga0207662_10306896 Ga0207662_103068961 104
434 3300025919 Ga0207657_10051847 Ga0207657_100518474 104
435 3300025919 Ga0207657_10326391 Ga0207657_103263912 104
436 3300025919 Ga0207657_10362697 Ga0207657_103626972 104
437 3300025920 Ga0207649_10162924 Ga0207649_101629242 104
438 3300025921 Ga0207652_10210138 Ga0207652_102101382 104
439 3300025924 Ga0207694_10372510 Ga0207694_103725102 104
440 3300025924 Ga0207694_10504134 Ga0207694_105041342 104
441 3300025924 Ga0207694_11106399 Ga0207694_111063991 104
442 3300025925 Ga0207650_10348073 Ga0207650_103480732 104
443 3300025925 Ga0207650_10435607 Ga0207650_104356072 104
444 3300025925 Ga0207650_11531618 Ga0207650_115316182 104
445 3300025927 Ga0207687_10116148 Ga0207687_101161482 104
446 3300025927 Ga0207687_10768177 Ga0207687_107681772 104
447 3300025932 Ga0207690_10063181 Ga0207690_100631812 104
448 3300025932 Ga0207690_10418464 Ga0207690_104184642 104
449 3300025933 Ga0207706_10071719 Ga0207706_100717194 104
450 3300025933 Ga0207706_10344325 Ga0207706_103443252 104
451 3300025933 Ga0207706_10872649 Ga0207706_108726491 104
452 3300025935 Ga0207709_10054475 Ga0207709_100544752 104
453 3300025935 Ga0207709_11817843 Ga0207709_118178431 104
454 3300025935 Ga0207709_11824144 Ga0207709_118241442 104
455 3300025936 Ga0207670_11415565 Ga0207670_114155652 104
456 3300025937 Ga0207669_10075249 Ga0207669_100752492 104
457 3300025937 Ga0207669_10324539 Ga0207669_103245392 104
458 3300025937 Ga0207669_11205343 Ga0207669_112053431 104
459 3300025938 Ga0207704_11733015 Ga0207704_117330151 104
460 3300025939 Ga0207665_10054296 Ga0207665_100542963 104
461 3300025940 Ga0207691_10109172 Ga0207691_101091722 104
462 3300025940 Ga0207691_10670634 Ga0207691_106706342 104
463 3300025941 Ga0207711_10025904 Ga0207711_100259042 104
464 3300025941 Ga0207711_10057138 Ga0207711_100571382 104
465 3300025942 Ga0207689_10980980 Ga0207689_109809802 104
466 3300025944 Ga0207661_10036554 Ga0207661_100365542 104
467 3300025945 Ga0207679_10714646 Ga0207679_107146462 104
468 3300025960 Ga0207651_10101766 Ga0207651_101017662 104
469 3300025960 Ga0207651_10317379 Ga0207651_103173792 104
470 3300025961 Ga0207712_10115895 Ga0207712_101158953 104
471 3300025972 Ga0207668_10083578 Ga0207668_100835782 104
472 3300025972 Ga0207668_10576758 Ga0207668_105767581 104
473 3300025972 Ga0207668_10749525 Ga0207668_107495252 104
474 3300025972 Ga0207668_10952966 Ga0207668_109529662 104
475 3300025981 Ga0207640_11989356 Ga0207640_119893561 104
476 3300025986 Ga0207658_10665562 Ga0207658_106655622 104
477 3300025986 Ga0207658_10815411 Ga0207658_108154112 104
478 3300025986 Ga0207658_10919048 Ga0207658_109190482 104
479 3300026023 Ga0207677_10845390 Ga0207677_108453902 104
480 3300026023 Ga0207677_12003421 Ga0207677_120034211 104
481 3300026035 Ga0207703_10054622 Ga0207703_100546224 104
482 3300026035 Ga0207703_10187420 Ga0207703_101874201 104
483 3300026035 Ga0207703_10354760 Ga0207703_103547602 104
484 3300026035 Ga0207703_10636086 Ga0207703_106360862 104
485 3300026067 Ga0207678_10019138 Ga0207678_100191381 104
486 3300026067 Ga0207678_10301805 Ga0207678_103018052 104
487 3300026067 Ga0207678_10353675 Ga0207678_103536752 104
488 3300026067 Ga0207678_11384972 Ga0207678_113849722 104
489 3300026067 Ga0207678_11543787 Ga0207678_115437872 104
490 3300026075 Ga0207708_10242601 Ga0207708_102426012 104
491 3300026075 Ga0207708_10245582 Ga0207708_102455822 104
492 3300026075 Ga0207708_10578217 Ga0207708_105782172 104
493 3300026078 Ga0207702_10048792 Ga0207702_100487923 104
494 3300026078 Ga0207702_10446278 Ga0207702_104462782 104
495 3300026088 Ga0207641_10218805 Ga0207641_102188052 104
496 3300026088 Ga0207641_11883783 Ga0207641_118837831 104
497 3300026089 Ga0207648_10221230 Ga0207648_102212302 104
498 3300026089 Ga0207648_10245979 Ga0207648_102459792 104
499 3300026089 Ga0207648_10635668 Ga0207648_106356682 104
500 3300026095 Ga0207676_10101932 Ga0207676_101019321 104
501 3300026116 Ga0207674_10562356 Ga0207674_105623562 104
502 3300026116 Ga0207674_10612509 Ga0207674_106125092 104
503 3300026118 Ga0207675_100016940 Ga0207675_1000169404 104
504 3300026118 Ga0207675_102261919 Ga0207675_1022619191 104
505 3300026121 Ga0207683_10164919 Ga0207683_101649192 104
506 3300026121 Ga0207683_10727754 Ga0207683_107277541 104
507 3300026121 Ga0207683_10839005 Ga0207683_108390052 104
508 3300026121 Ga0207683_11952133 Ga0207683_119521331 104
509 3300026142 Ga0207698_10156543 Ga0207698_101565432 104
510 3300026142 Ga0207698_10500187 Ga0207698_105001872 104
511 3300027866 Ga0209813_10101472 Ga0209813_101014722 104
512 3300027866 Ga0209813_10111513 Ga0209813_101115132 104
513 3300027907 Ga0207428_10387327 Ga0207428_103873272 104
514 3300028379 Ga0268266_10003390 Ga0268266_1000339012 104
515 3300028379 Ga0268266_10074725 Ga0268266_100747252 104
516 3300028379 Ga0268266_10121010 Ga0268266_101210102 104
517 3300028379 Ga0268266_10514936 Ga0268266_105149362 104
518 3300028379 Ga0268266_10764908 Ga0268266_107649082 104
519 3300028379 Ga0268266_11468938 Ga0268266_114689382 104
520 3300028379 Ga0268266_11945621 Ga0268266_119456212 104
521 3300028380 Ga0268265_10044700 Ga0268265_100447002 104
522 3300028380 Ga0268265_10662773 Ga0268265_106627732 104
523 3300028380 Ga0268265_10724805 Ga0268265_107248051 104
524 3300028380 Ga0268265_12255301 Ga0268265_122553011 104
525 3300028381 Ga0268264_10927143 Ga0268264_109271432 104
526 3300028381 Ga0268264_11107421 Ga0268264_111074212 104
527 3300028794 Ga0307515_10001393 Ga0307515_1000139344 104
528 3300028794 Ga0307515_10021427 Ga0307515_100214273 104
529 3300031456 Ga0307513_10011737 Ga0307513_1001173714 104
530 3300031616 Ga0307508_10031547 Ga0307508_100315474 104
531 3300031616 Ga0307508_10245074 Ga0307508_102450742 104
532 3300031730 Ga0307516_10448431 Ga0307516_104484312 104
533 3300032126 Ga0307415_100701851 Ga0307415_1007018512 104
534 3300033180 Ga0307510_10078712 Ga0307510_100787124 104
535 3300033442 Ga0315911_1000006 Ga0315911_10000066 104
536 3300034818 Ga0373950_0133437 Ga0373950_0133437_178_492 104
537 3300035170 Ga0373943_0182569 Ga0373943_0182569_313_627 104
538 3300035692 Ga0373935_0209912 Ga0373935_0209912_477_791 104
539 3300035725 Ga0373947_0059831 Ga0373947_0059831_201_515 104
540 3300035725 Ga0373947_0752927 Ga0373947_0752927_35_352 104
541 3300037068 Ga0373925_0299820 Ga0373925_0299820_253_567 104
542 3300037068 Ga0373925_1169365 Ga0373925_1169365_240_557 104
543 3300037312 Ga0395899_0056456 Ga0395899_0056456_1493_1807 104
544 3300037418 Ga0395900_0012534 Ga0395900_0012534_4509_4823 104
545 3300037418 Ga0395900_0076909 Ga0395900_0076909_2525_2854 104
546 3300037466 Ga0395898_0025456 Ga0395898_0025456_5002_5316 104
547 3300037466 Ga0395898_0030570 Ga0395898_0030570_638_967 104
548 3300037471 Ga0395905_0002553 Ga0395905_0002553_6460_6789 104
549 3300038443 Ga0395901_0028377 Ga0395901_0028377_2873_3202 104
550 3300041413 Ga0439465_0079791 Ga0439465_0079791_31_345 104
551 3300041413 Ga0439465_0208685 Ga0439465_0208685_74_391 104
552 3300041443 Ga0451789_0589456 Ga0451789_0589456_307_627 104
553 3300041451 Ga0451791_0313286 Ga0451791_0313286_622_936 104
554 3300041453 Ga0451797_0174660 Ga0451797_0174660_139_459 104
555 3300041453 Ga0451797_0692193 Ga0451797_0692193_46_369 104
556 3300041453 Ga0451797_1503990 Ga0451797_1503990_52_366 104
557 3300041458 Ga0451798_0348921 Ga0451798_0348921_240_554 104
558 3300041459 Ga0451800_0241826 Ga0451800_0241826_114_437 104
559 3300041459 Ga0451800_0935838 Ga0451800_0935838_116_430 104
560 3300041463 Ga0451804_0084282 Ga0451804_0084282_107_430 104
561 3300041486 Ga0451807_1711485 Ga0451807_1711485_144_458 104
562 3300041496 Ga0451839_0403398 Ga0451839_0403398_328_642 104
563 3300041501 Ga0451845_0035050 Ga0451845_0035050_28_342 104
564 3300041503 Ga0451847_0253765 Ga0451847_0253765_47_361 104
565 3300041505 Ga0451849_1402645 Ga0451849_1402645_393_707 104
566 3300041507 Ga0451851_0518039 Ga0451851_0518039_164_478 104
567 3300041512 Ga0451853_3398724 Ga0451853_3398724_160_474 104
568 3300044684 Ga0466966_0146212 Ga0466966_0146212_970_1284 104
569 3300044694 Ga0466963_0259700 Ga0466963_0259700_708_1022 104
570 3300044719 Ga0466971_0129724 Ga0466971_0129724_218_532 104
571 3300044765 Ga0466970_0028377 Ga0466970_0028377_974_1288 104
572 3300045049 Ga0466959_0072284 Ga0466959_0072284_1281_1595 104
573 3300045976 Ga0466967_0259907 Ga0466967_0259907_624_938 104
574 3300045976 Ga0466967_1361779 Ga0466967_1361779_306_623 104
575 3300046454 Ga0495592_0050253 Ga0495592_0050253_1451_1765 104
576 3300046455 Ga0495603_0019982 Ga0495603_0019982_3049_3366 104
577 3300046457 Ga0495590_0155640 Ga0495590_0155640_304_618 104
578 3300046457 Ga0495590_0355096 Ga0495590_0355096_36_353 104
579 3300046460 Ga0495638_0004182 Ga0495638_0004182_2463_2777 104
580 3300046460 Ga0495638_0029879 Ga0495638_0029879_472_786 104
581 3300046460 Ga0495638_0514339 Ga0495638_0514339_49_363 104
582 3300046461 Ga0495641_0397548 Ga0495641_0397548_300_614 104
583 3300046471 Ga0495650_0171527 Ga0495650_0171527_29_343 104
584 3300046472 Ga0495580_0310275 Ga0495580_0310275_587_901 104
585 3300046474 Ga0495605_0000882 Ga0495605_0000882_7833_8147 104
586 3300046475 Ga0495639_0010705 Ga0495639_0010705_2974_3291 104
587 3300046475 Ga0495639_0524303 Ga0495639_0524303_261_575 104
588 3300046476 Ga0495662_0356199 Ga0495662_0356199_122_436 104
589 3300046477 Ga0495664_0007342 Ga0495664_0007342_3892_4206 104
590 3300046477 Ga0495664_0114850 Ga0495664_0114850_120_434 104
591 3300046491 Ga0495584_0105602 Ga0495584_0105602_939_1253 104
592 3300046492 Ga0495585_0034342 Ga0495585_0034342_2272_2586 104
593 3300046492 Ga0495585_0142526 Ga0495585_0142526_234_551 104
594 3300046492 Ga0495585_0359038 Ga0495585_0359038_85_399 104
595 3300046499 Ga0495594_0158117 Ga0495594_0158117_874_1188 104
596 3300046500 Ga0495596_0090464 Ga0495596_0090464_647_961 104
597 3300046500 Ga0495596_0243911 Ga0495596_0243911_51_365 104
598 3300046501 Ga0495607_0050852 Ga0495607_0050852_1624_1938 104
599 3300046506 Ga0495583_0016358 Ga0495583_0016358_3117_3431 104
600 3300046507 Ga0495606_0032075 Ga0495606_0032075_1638_1952 104
601 3300046507 Ga0495606_0080822 Ga0495606_0080822_1010_1324 104
602 3300046507 Ga0495606_0301535 Ga0495606_0301535_299_616 104
603 3300046511 Ga0495608_0259714 Ga0495608_0259714_378_692 104
604 3300046512 Ga0495610_0026067 Ga0495610_0026067_1128_1445 104
605 3300046512 Ga0495610_0090811 Ga0495610_0090811_813_1127 104
606 3300046513 Ga0495616_0172638 Ga0495616_0172638_212_526 104
607 3300046515 Ga0495620_0042448 Ga0495620_0042448_23_337 104
608 3300046516 Ga0495628_0114288 Ga0495628_0114288_597_911 104
609 3300046516 Ga0495628_0661467 Ga0495628_0661467_41_355 104
610 3300046518 Ga0495631_0026994 Ga0495631_0026994_2166_2480 104
611 3300046518 Ga0495631_0134718 Ga0495631_0134718_438_752 104
612 3300046518 Ga0495631_0169944 Ga0495631_0169944_169_483 104
613 3300046518 Ga0495631_0417383 Ga0495631_0417383_113_427 104
614 3300046519 Ga0495632_0066757 Ga0495632_0066757_1274_1588 104
615 3300046522 Ga0495643_0030117 Ga0495643_0030117_1201_1518 104
616 3300046522 Ga0495643_0107297 Ga0495643_0107297_670_984 104
617 3300046524 Ga0495648_0104555 Ga0495648_0104555_701_1015 104
618 3300046524 Ga0495648_0164241 Ga0495648_0164241_443_757 104
619 3300046524 Ga0495648_0280343 Ga0495648_0280343_125_442 104
620 3300046525 Ga0495663_0013581 Ga0495663_0013581_34_348 104
621 3300046525 Ga0495663_0057601 Ga0495663_0057601_172_489 104
622 3300046526 Ga0495666_0231368 Ga0495666_0231368_239_556 104
623 3300046529 Ga0495652_0111683 Ga0495652_0111683_713_1027 104
624 3300046530 Ga0495654_0114022 Ga0495654_0114022_684_998 104
625 3300046530 Ga0495654_0176616 Ga0495654_0176616_349_663 104
626 3300046536 Ga0495587_0219184 Ga0495587_0219184_476_790 104
627 3300046537 Ga0495598_0106697 Ga0495598_0106697_374_688 104
628 3300046537 Ga0495598_0213037 Ga0495598_0213037_102_419 104
629 3300046538 Ga0495609_0082805 Ga0495609_0082805_742_1059 104
630 3300046538 Ga0495609_0243715 Ga0495609_0243715_252_566 104
631 3300046539 Ga0495621_0104389 Ga0495621_0104389_368_685 104
632 3300046542 Ga0495597_0077349 Ga0495597_0077349_130_444 104
633 3300046543 Ga0495645_0005428 Ga0495645_0005428_6436_6750 104
634 3300046543 Ga0495645_0271759 Ga0495645_0271759_429_743 104
635 3300046557 Ga0495622_0179375 Ga0495622_0179375_458_775 104
636 3300046558 Ga0495633_0165467 Ga0495633_0165467_527_841 104
637 3300046559 Ga0495667_0038917 Ga0495667_0038917_1606_1920 104
638 3300046615 Ga0495656_0065604 Ga0495656_0065604_274_588 104
639 3300046615 Ga0495656_0065673 Ga0495656_0065673_282_596 104
640 3300046615 Ga0495656_0648005 Ga0495656_0648005_146_460 104
641 3300046616 Ga0495668_0010544 Ga0495668_0010544_3762_4076 104
642 3300046616 Ga0495668_0162294 Ga0495668_0162294_792_1106 104
643 3300046616 Ga0495668_0198652 Ga0495668_0198652_282_596 104
644 3300046616 Ga0495668_0322551 Ga0495668_0322551_168_482 104
645 3300046616 Ga0495668_0687770 Ga0495668_0687770_94_417 104
646 3300046642 Ga0495634_0115841 Ga0495634_0115841_693_1007 104
647 3300046648 Ga0495611_0055449 Ga0495611_0055449_1066_1380 104
648 3300046648 Ga0495611_0245141 Ga0495611_0245141_97_411 104
649 3300046660 Ga0495625_0006043 Ga0495625_0006043_8067_8381 104
650 3300046660 Ga0495625_0334995 Ga0495625_0334995_237_551 104
651 3300046660 Ga0495625_0711140 Ga0495625_0711140_184_507 104
652 3300046663 Ga0495635_0019609 Ga0495635_0019609_795_1109 104
653 3300046664 Ga0495659_0000001 Ga0495659_0000001_275509_275823 104
654 3300046664 Ga0495659_0200695 Ga0495659_0200695_127_441 104
655 3300046674 Ga0495588_0005074 Ga0495588_0005074_2431_2748 104
656 3300046675 Ga0495657_0005171 Ga0495657_0005171_6203_6517 104
657 3300046678 Ga0495599_0034262 Ga0495599_0034262_1157_1471 104
658 3300046678 Ga0495599_0065984 Ga0495599_0065984_813_1127 104
659 3300046679 Ga0495623_0016633 Ga0495623_0016633_2121_2435 104
660 3300046680 Ga0495646_0037433 Ga0495646_0037433_342_656 104
661 3300046680 Ga0495646_0087925 Ga0495646_0087925_1457_1771 104
662 3300046683 Ga0495658_0080762 Ga0495658_0080762_652_966 104
663 3300046684 Ga0495669_0051414 Ga0495669_0051414_189_503 104
664 3300046689 Ga0495613_0014966 Ga0495613_0014966_3202_3516 104
665 3300046690 Ga0495624_0273011 Ga0495624_0273011_24_338 104
666 3300046690 Ga0495624_0308663 Ga0495624_0308663_614_931 104
667 3300046690 Ga0495624_0351621 Ga0495624_0351621_172_486 104
668 3300046691 Ga0495670_0024618 Ga0495670_0024618_1260_1574 104
669 3300046692 Ga0495671_0000035 Ga0495671_0000035_132479_132793 104
670 3300046692 Ga0495671_0198892 Ga0495671_0198892_435_758 104
671 3300046692 Ga0495671_0475106 Ga0495671_0475106_147_464 104
672 3300046694 Ga0495649_0024030 Ga0495649_0024030_1572_1889 104
673 3300046794 Ga0495589_0441862 Ga0495589_0441862_136_450 104
674 3300046809 Ga0495600_0058255 Ga0495600_0058255_511_825 104
675 3300046810 Ga0495660_0009064 Ga0495660_0009064_5017_5331 104
676 3300046810 Ga0495660_0017169 Ga0495660_0017169_1693_2007 104
677 3300046810 Ga0495660_0080596 Ga0495660_0080596_762_1076 104
678 3300047317 Ga0495604_0019135 Ga0495604_0019135_3559_3873 104
679 3300047317 Ga0495604_0230915 Ga0495604_0230915_221_535 104
680 3300047318 Ga0495636_0090785 Ga0495636_0090785_514_828 104
681 3300047319 Ga0495674_0010589 Ga0495674_0010589_4737_5051 104
682 3300047320 Ga0495672_0000066 Ga0495672_0000066_76823_77137 104
683 3300047320 Ga0495672_0012040 Ga0495672_0012040_2381_2695 104
684 3300047320 Ga0495672_0052403 Ga0495672_0052403_1348_1662 104
685 3300047320 Ga0495672_0175862 Ga0495672_0175862_318_632 104
686 3300047320 Ga0495672_0335535 Ga0495672_0335535_357_671 104
687 3300047321 Ga0495676_0293471 Ga0495676_0293471_720_1034 104
688 3300047322 Ga0495680_0008649 Ga0495680_0008649_393_707 104
689 3300047323 Ga0495683_0391727 Ga0495683_0391727_189_506 104
690 3300047444 Ga0495675_0003429 Ga0495675_0003429_8788_9102 104
691 3300047445 Ga0495677_0045869 Ga0495677_0045869_1081_1395 104
692 3300047469 Ga0495673_0141652 Ga0495673_0141652_143_457 104
693 3300047469 Ga0495673_0183913 Ga0495673_0183913_453_767 104
694 3300047469 Ga0495673_0198737 Ga0495673_0198737_413_736 104
695 3300047470 Ga0495681_0166983 Ga0495681_0166983_21_335 104
696 3300047471 Ga0495684_0087439 Ga0495684_0087439_615_929 104
697 3300047472 Ga0495686_0084708 Ga0495686_0084708_716_1030 104
698 3300047472 Ga0495686_0179669 Ga0495686_0179669_417_731 104
699 3300047472 Ga0495686_0216632 Ga0495686_0216632_456_770 104
700 3300048088 Ga0495602_0009971 Ga0495602_0009971_6227_6541 104
701 3300048090 Ga0495615_0056467 Ga0495615_0056467_692_1006 104
702 3300048090 Ga0495615_0238906 Ga0495615_0238906_88_405 104
703 3300048091 Ga0495626_0053772 Ga0495626_0053772_873_1190 104
704 3300048091 Ga0495626_0301367 Ga0495626_0301367_284_598 104
705 3300048903 Ga0496100_0018898 Ga0496100_0018898_3331_3645 104
706 3300048903 Ga0496100_0624579 Ga0496100_0624579_102_416 104
707 3300048903 Ga0496100_1139752 Ga0496100_1139752_238_552 104
708 3300048904 Ga0496101_0553999 Ga0496101_0553999_399_713 104
709 3300048904 Ga0496101_0772542 Ga0496101_0772542_11_325 104
710 3300048905 Ga0496102_0264305 Ga0496102_0264305_753_1067 104
711 3300048905 Ga0496102_0843607 Ga0496102_0843607_332_646 104
712 3300048905 Ga0496102_0897480 Ga0496102_0897480_122_436 104
713 3300048905 Ga0496102_1428297 Ga0496102_1428297_242_556 104
714 3300048906 Ga0496103_0082121 Ga0496103_0082121_1696_2010 104
715 3300048907 Ga0496104_0254219 Ga0496104_0254219_215_529 104
716 3300048907 Ga0496104_0414267 Ga0496104_0414267_725_1039 104
717 3300048909 Ga0496106_0227948 Ga0496106_0227948_602_916 104
718 3300048909 Ga0496106_0349388 Ga0496106_0349388_788_1102 104
719 3300048909 Ga0496106_0685787 Ga0496106_0685787_339_653 104
720 3300048909 Ga0496106_1170744 Ga0496106_1170744_114_428 104
721 3300048910 Ga0496107_0022694 Ga0496107_0022694_1164_1478 104
722 3300048911 Ga0496108_0287153 Ga0496108_0287153_829_1143 104
723 3300048912 Ga0496109_0074991 Ga0496109_0074991_2574_2888 104
724 3300048915 Ga0496112_0759066 Ga0496112_0759066_544_858 104
725 3300048917 Ga0496114_0990009 Ga0496114_0990009_326_640 104
726 3300048918 Ga0496115_0475818 Ga0496115_0475818_357_671 104
727 3300048918 Ga0496115_1153571 Ga0496115_1153571_41_355 104
728 3300048919 Ga0496116_0042554 Ga0496116_0042554_2703_3020 104
729 3300048920 Ga0496117_0076506 Ga0496117_0076506_1202_1516 104
730 3300048920 Ga0496117_0590343 Ga0496117_0590343_159_476 104
731 3300048921 Ga0496118_0046965 Ga0496118_0046965_2703_3020 104
732 3300048921 Ga0496118_0060931 Ga0496118_0060931_691_1005 104
733 3300048921 Ga0496118_0337355 Ga0496118_0337355_329_643 104
734 3300048921 Ga0496118_0398540 Ga0496118_0398540_60_374 104
735 3300048923 Ga0496120_0114125 Ga0496120_0114125_731_1045 104
736 3300048924 Ga0496121_0007499 Ga0496121_0007499_7528_7842 104
737 3300048924 Ga0496121_0042459 Ga0496121_0042459_3593_3907 104
738 3300048924 Ga0496121_0048693 Ga0496121_0048693_2252_2566 104
739 3300048924 Ga0496121_0090484 Ga0496121_0090484_1631_1948 104
740 3300048924 Ga0496121_0165387 Ga0496121_0165387_344_661 104
741 3300048924 Ga0496121_0197453 Ga0496121_0197453_820_1134 104
742 3300048924 Ga0496121_0381963 Ga0496121_0381963_155_469 104
743 3300048924 Ga0496121_0430740 Ga0496121_0430740_419_733 104
744 3300048925 Ga0496122_0029922 Ga0496122_0029922_787_1104 104
745 3300048926 Ga0496123_0131374 Ga0496123_0131374_970_1287 104
746 3300048926 Ga0496123_0283718 Ga0496123_0283718_225_539 104
747 3300048927 Ga0496124_0455107 Ga0496124_0455107_215_532 104
748 3300048927 Ga0496124_0549259 Ga0496124_0549259_385_699 104
749 3300048927 Ga0496124_0737022 Ga0496124_0737022_181_495 104
750 3300048928 Ga0496125_0000272 Ga0496125_0000272_222_536 104
751 3300048928 Ga0496125_0003504 Ga0496125_0003504_15865_16179 104
752 3300048928 Ga0496125_0242611 Ga0496125_0242611_662_976 104
753 3300048928 Ga0496125_0396184 Ga0496125_0396184_137_451 104
754 3300048929 Ga0496126_0157364 Ga0496126_0157364_1182_1496 104
755 3300048929 Ga0496126_0223066 Ga0496126_0223066_21_335 104
756 3300048929 Ga0496126_0566258 Ga0496126_0566258_327_641 104
757 3300048929 Ga0496126_0820230 Ga0496126_0820230_226_540 104
758 3300048929 Ga0496126_1310803 Ga0496126_1310803_179_493 104
759 3300049459 Ga0495678_054826 Ga0495678_054826_24_338 104
760 3300049460 Ga0495682_0027769 Ga0495682_0027769_1431_1745 104
761 3300049460 Ga0495682_0124187 Ga0495682_0124187_534_848 104
762 3300049568 Ga0501031_0080173 Ga0501031_0080173_851_1165 104
763 3300049568 Ga0501031_0275193 Ga0501031_0275193_679_993 104
764 3300049569 Ga0501032_0000129 Ga0501032_0000129_45305_45619 104
765 3300049570 Ga0501033_0001179 Ga0501033_0001179_14650_14964 104
766 3300049570 Ga0501033_0116995 Ga0501033_0116995_553_867 104
767 3300049570 Ga0501033_0133485 Ga0501033_0133485_1041_1355 104
768 3300049570 Ga0501033_0652720 Ga0501033_0652720_302_616 104
769 3300049570 Ga0501033_0873357 Ga0501033_0873357_41_355 104
770 3300049571 Ga0501034_0000503 Ga0501034_0000503_25217_25531 104
771 3300049571 Ga0501034_0239638 Ga0501034_0239638_1223_1537 104
772 3300049571 Ga0501034_0586247 Ga0501034_0586247_474_788 104
773 3300049571 Ga0501034_0777062 Ga0501034_0777062_85_399 104
774 3300049572 Ga0501036_0001453 Ga0501036_0001453_17373_17687 104
775 3300049572 Ga0501036_0171015 Ga0501036_0171015_833_1147 104
776 3300049572 Ga0501036_0213443 Ga0501036_0213443_962_1276 104
777 3300049573 Ga0501037_0000106 Ga0501037_0000106_61964_62278 104
778 3300049573 Ga0501037_0108472 Ga0501037_0108472_554_868 104
779 3300049573 Ga0501037_0143047 Ga0501037_0143047_465_779 104
780 3300049573 Ga0501037_0254999 Ga0501037_0254999_455_784 104
781 3300049574 Ga0501038_0001655 Ga0501038_0001655_17309_17623 104
782 3300049574 Ga0501038_0095220 Ga0501038_0095220_491_805 104
783 3300049574 Ga0501038_0576133 Ga0501038_0576133_143_472 104
784 3300049574 Ga0501038_0995126 Ga0501038_0995126_162_479 104
785 3300049575 Ga0501039_0000416 Ga0501039_0000416_18315_18629 104
786 3300049575 Ga0501039_0361693 Ga0501039_0361693_137_451 104
787 3300049575 Ga0501039_0870684 Ga0501039_0870684_104_418 104
788 3300049575 Ga0501039_1082497 Ga0501039_1082497_130_444 104
789 3300049577 Ga0501041_0614810 Ga0501041_0614810_97_411 104
790 3300049578 Ga0501042_0320311 Ga0501042_0320311_151_465 104
791 3300049579 Ga0501043_0000035 Ga0501043_0000035_132178_132492 104
792 3300049579 Ga0501043_0074841 Ga0501043_0074841_1286_1600 104
793 3300049579 Ga0501043_0116718 Ga0501043_0116718_572_901 104
794 3300049579 Ga0501043_0184225 Ga0501043_0184225_373_687 104
795 3300049579 Ga0501043_0861069 Ga0501043_0861069_302_619 104
796 3300049580 Ga0501046_0000235 Ga0501046_0000235_32664_32978 104
797 3300049580 Ga0501046_0069988 Ga0501046_0069988_799_1116 104
798 3300049581 Ga0501047_0000844 Ga0501047_0000844_17203_17517 104
799 3300049581 Ga0501047_0014131 Ga0501047_0014131_75_404 104
800 3300049581 Ga0501047_0187014 Ga0501047_0187014_853_1170 104
801 3300049581 Ga0501047_1114838 Ga0501047_1114838_16_330 104
802 3300049582 Ga0501048_0001444 Ga0501048_0001444_687_1001 104
803 3300049582 Ga0501048_0093360 Ga0501048_0093360_974_1288 104
804 3300049583 Ga0501067_0000160 Ga0501067_0000160_24312_24626 104
805 3300049584 Ga0501068_0000014 Ga0501068_0000014_10473_10787 104
806 3300049585 Ga0501069_0004593 Ga0501069_0004593_6589_6903 104
807 3300049586 Ga0501070_0043404 Ga0501070_0043404_1849_2163 104
808 3300049586 Ga0501070_0067819 Ga0501070_0067819_251_580 104
809 3300049587 Ga0501071_0052208 Ga0501071_0052208_272_586 104
810 3300049588 Ga0501072_0001159 Ga0501072_0001159_175_489 104
811 3300049589 Ga0501073_0000417 Ga0501073_0000417_3551_3865 104
812 3300049589 Ga0501073_0700938 Ga0501073_0700938_119_436 104
813 3300049590 Ga0501074_0001839 Ga0501074_0001839_3418_3732 104
814 3300049592 Ga0501076_0991825 Ga0501076_0991825_351_665 104
815 3300049741 Ga0501079_0000261 Ga0501079_0000261_6828_7142 104
816 3300049742 Ga0501080_0000917 Ga0501080_0000917_8710_9024 104
817 3300049743 Ga0501081_1238644 Ga0501081_1238644_221_535 104
818 3300049743 Ga0501081_1365144 Ga0501081_1365144_160_474 104
819 3300049744 Ga0501083_0000301 Ga0501083_0000301_24201_24515 104
820 3300049744 Ga0501083_0334581 Ga0501083_0334581_170_487 104
821 3300049766 Ga0501269_007654 Ga0501269_007654_606_920 104
822 3300049822 Ga0501035_0000324 Ga0501035_0000324_29767_30081 104
823 3300049822 Ga0501035_0041846 Ga0501035_0041846_806_1120 104
824 3300049822 Ga0501035_0183194 Ga0501035_0183194_744_1058 104
825 3300049822 Ga0501035_0209110 Ga0501035_0209110_872_1186 104
826 3300049823 Ga0501044_0000051 Ga0501044_0000051_126062_126376 104
827 3300049823 Ga0501044_0301936 Ga0501044_0301936_661_975 104
828 3300049823 Ga0501044_1203345 Ga0501044_1203345_286_600 104
829 3300049824 Ga0501045_0040080 Ga0501045_0040080_780_1094 104
830 3300049824 Ga0501045_0563915 Ga0501045_0563915_62_376 104
831 3300050489 nmdc:mga03683_471999_c1 nmdc:mga03683_471999_c1_205_519 104
832 3300050489 nmdc:mga03683_612453_c1 nmdc:mga03683_612453_c1_102_416 104
833 3300050490 nmdc:mga03n38_106245_c1 nmdc:mga03n38_106245_c1_232_546 104
834 3300050490 nmdc:mga03n38_128379_c1 nmdc:mga03n38_128379_c1_909_1223 104
835 3300050490 nmdc:mga03n38_273834_c2 nmdc:mga03n38_273834_c2_41_358 104
836 3300050491 nmdc:mga00v17_263510_c1 nmdc:mga00v17_263510_c1_649_963 104
837 3300050491 nmdc:mga00v17_289371_c1 nmdc:mga00v17_289371_c1_281_598 104
838 3300050492 nmdc:mga0yw44_121480_c1 nmdc:mga0yw44_121480_c1_1155_1469 104
839 3300050492 nmdc:mga0yw44_1241_c1 nmdc:mga0yw44_1241_c1_3700_4014 104
840 3300050492 nmdc:mga0yw44_152714_c1 nmdc:mga0yw44_152714_c1_457_771 104
841 3300050492 nmdc:mga0yw44_284549_c1 nmdc:mga0yw44_284549_c1_302_616 104
842 3300050492 nmdc:mga0yw44_45937_c1 nmdc:mga0yw44_45937_c1_419_736 104
843 3300050492 nmdc:mga0yw44_547448_c1 nmdc:mga0yw44_547448_c1_96_410 104
844 3300050492 nmdc:mga0yw44_793716_c1 nmdc:mga0yw44_793716_c1_19_333 104
845 3300050493 nmdc:mga0k408_110552_c1 nmdc:mga0k408_110552_c1_549_869 104
846 3300050493 nmdc:mga0k408_135884_c1 nmdc:mga0k408_135884_c1_593_907 104
847 3300050493 nmdc:mga0k408_331466_c1 nmdc:mga0k408_331466_c1_185_499 104
848 3300050493 nmdc:mga0k408_640343_c1 nmdc:mga0k408_640343_c1_241_564 104
849 3300050494 nmdc:mga06z11_636333_c1 nmdc:mga06z11_636333_c1_314_628 104
850 3300050494 nmdc:mga06z11_745189_c1 nmdc:mga06z11_745189_c1_68_391 104
851 3300050495 nmdc:mga04h51_111064_c1 nmdc:mga04h51_111064_c1_81_395 104
852 3300050495 nmdc:mga04h51_149357_c1 nmdc:mga04h51_149357_c1_440_754 104
853 3300050496 nmdc:mga07m45_118877_c1 nmdc:mga07m45_118877_c1_564_878 104
854 3300050507 nmdc:mga05p37_1096040_c1 nmdc:mga05p37_1096040_c1_74_397 104
855 3300050507 nmdc:mga05p37_91569_c1 nmdc:mga05p37_91569_c1_390_707 104
856 3300050512 nmdc:mga0n895_437936_c1 nmdc:mga0n895_437936_c1_408_722 104
857 3300050513 nmdc:mga0rr50_638421_c1 nmdc:mga0rr50_638421_c1_53_367 104
858 3300050516 nmdc:mga0sz30_163093_c1 nmdc:mga0sz30_163093_c1_101_421 104
859 3300050516 nmdc:mga0sz30_414884_c1 nmdc:mga0sz30_414884_c1_58_381 104
860 3300050516 nmdc:mga0sz30_6813_c3 nmdc:mga0sz30_6813_c3_234_551 104
861 3300053077 Ga0495601_0387858 Ga0495601_0387858_38_352 104
862 3300053078 Ga0495612_0010268 Ga0495612_0010268_3428_3742 104
863 3300053078 Ga0495612_0041356 Ga0495612_0041356_300_614 104
864 3300053084 Ga0495595_0318258 Ga0495595_0318258_425_739 104
865 3300053087 Ga0500643_000032 Ga0500643_000032_88067_88381 104
866 3300053088 Ga0500644_0304405 Ga0500644_0304405_356_670 104
867 3300053090 Ga0500646_0053575 Ga0500646_0053575_767_1081 104
868 3300053092 Ga0500583_0048511 Ga0500583_0048511_1035_1349 104
869 3300053092 Ga0500583_0133509 Ga0500583_0133509_165_479 104
870 3300053092 Ga0500583_0517724 Ga0500583_0517724_110_424 104
871 3300053094 Ga0500566_0004691 Ga0500566_0004691_2796_3110 104
872 3300053096 Ga0500641_0089183 Ga0500641_0089183_435_749 104
873 3300053096 Ga0500641_0164785 Ga0500641_0164785_223_537 104
874 3300053096 Ga0500641_0415350 Ga0500641_0415350_58_372 104
875 3300053103 Ga0500555_008642 Ga0500555_008642_731_1045 104
876 3300053104 Ga0500556_0244505 Ga0500556_0244505_142_456 104
877 3300053105 Ga0500557_021384 Ga0500557_021384_1499_1813 104
878 3300053108 Ga0500562_027034 Ga0500562_027034_735_1052 104
879 3300053109 Ga0500569_050034 Ga0500569_050034_122_436 104
880 3300053116 Ga0500592_014572 Ga0500592_014572_386_700 104
881 3300053118 Ga0500594_0002401 Ga0500594_0002401_2117_2431 104
882 3300053118 Ga0500594_0103937 Ga0500594_0103937_486_800 104
883 3300053119 Ga0500595_021164 Ga0500595_021164_26_340 104
884 3300053119 Ga0500595_032344 Ga0500595_032344_1351_1665 104
885 3300053122 Ga0500608_204478 Ga0500608_204478_341_655 104
886 3300053126 Ga0500621_144765 Ga0500621_144765_98_412 104
887 3300053128 Ga0500626_136979 Ga0500626_136979_332_646 104
888 3300053130 Ga0500642_0000173 Ga0500642_0000173_12737_13051 104
889 3300053130 Ga0500642_0247371 Ga0500642_0247371_433_747 104
890 3300053131 Ga0500652_280158 Ga0500652_280158_248_562 104
891 3300053133 Ga0500655_036468 Ga0500655_036468_77_391 104
892 3300053133 Ga0500655_083723 Ga0500655_083723_140_454 104
893 3300053136 Ga0500559_0346537 Ga0500559_0346537_131_445 104
894 3300053139 Ga0500568_0000411 Ga0500568_0000411_1527_1841 104
895 3300053139 Ga0500568_0020317 Ga0500568_0020317_591_905 104
896 3300053139 Ga0500568_0042194 Ga0500568_0042194_1093_1407 104
897 3300053139 Ga0500568_0237144 Ga0500568_0237144_280_594 104
898 3300053146 Ga0500588_0067660 Ga0500588_0067660_303_617 104
899 3300053146 Ga0500588_0225933 Ga0500588_0225933_325_639 104
900 3300053147 Ga0500589_050279 Ga0500589_050279_447_761 104
901 3300053147 Ga0500589_110811 Ga0500589_110811_104_418 104
902 3300053151 Ga0500604_0086442 Ga0500604_0086442_653_967 104
903 3300053151 Ga0500604_0097467 Ga0500604_0097467_261_575 104
904 3300053153 Ga0500616_0006355 Ga0500616_0006355_2198_2512 104
905 3300053153 Ga0500616_0258737 Ga0500616_0258737_350_664 104
906 3300053156 Ga0500622_0000428 Ga0500622_0000428_29297_29614 104
907 3300053156 Ga0500622_0006595 Ga0500622_0006595_2202_2516 104
908 3300053158 Ga0500627_0092747 Ga0500627_0092747_347_661 104
909 3300053161 Ga0500634_0210020 Ga0500634_0210020_22_336 104
910 3300053731 Ga0500609_036270 Ga0500609_036270_56_370 104
911 3300053736 Ga0500599_003267 Ga0500599_003267_527_841 104
912 3300054114 Ga0501084_0429030 Ga0501084_0429030_162_476 104
913 3300054114 Ga0501084_0903347 Ga0501084_0903347_52_369 104
914 3300054114 Ga0501084_1196225 Ga0501084_1196225_163_477 104
915 3300060353 Ga0501082_0018584 Ga0501082_0018584_648_962 104
916 3300060353 Ga0501082_0133402 Ga0501082_0133402_788_1105 104

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00893

Multi_Drug_Res

Small Multidrug Resistance protein

1

93

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8tgy-assembly1.cif.gz_E crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea 0.9589 1 103
8tgy-assembly1.cif.gz_E crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea 0.95 1 103
7ssu-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.8904 1 97
7mgx-assembly2.cif.gz_F structure of emre-d3 mutant in complex with monobody l10 and methyl viologen 0.8807 1 97
7mgx-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and methyl viologen 0.8592 1 97
ID Description Score Start End Superfamily
af_P69937_1_105_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 1.002 1 103 1.10.3730.20
af_P69937_1_105_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9921 1 103 1.10.3730.20
af_P9WGF1_2_106_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8984 3 102 1.10.3730.20
af_I1KSB6_13_116_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8838 1 100 1.10.3730.20
af_P23895_1_110_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8704 2 103 1.10.3730.20
ID Description Score Start End GO Terms
AF-Q328H6-F1-model_v4 Guanidinium exporter 1.002 1 101 GO:0005886
GO:0022857
AF-A0A4R7PG08-F1-model_v4 deleted 0.9979 1 103
AF-I6Z3E1-F1-model_v4 Cation membrane transporter 0.9918 1 101 GO:0005886
GO:0022857
AF-A0A561VJF6-F1-model_v4 Quaternary ammonium compound-resistance protein SugE 0.9883 1 103 GO:0005886
GO:0022857
AF-A0A4R7PG08-F1-model_v4 deleted 0.9883 1 103

Feature Viewer

pLDDT pTM Quality
95.88 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map