F485565
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 914 | 314 | 1828 | 210 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_10390882|Ga0105248_103908821 |
| Length | 229 |
| Sequence | MALLERVSTLVRANLNDLVDRAEDPEKMLKQVILDMQNQLLQVKTQVAIAIADQHVLAKKRTEHEDKASEWSRRAELAVDKKEDDLARAALEKSIAFKRMAGGFAEQVSDQVVQVENLKQALRNLEGKLAEAQAKVDLLVAQHRRARAVGKAADIGLKVNDPDPQAAFDRMNNKVVYGEAVSRAKTELLGENMEDRLARLEKQDEIERLLAEIKAKKSFQPRINENKQE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 123 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 124 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 125 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 197 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 199 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 200 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 201 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 202 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 203 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 204 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 205 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 206 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 208 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 209 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 211 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 213 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 218 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 221 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 222 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 223 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 226 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 227 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 228 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 229 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 230 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 231 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 232 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 233 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 234 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 235 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 270 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 271 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 272 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 273 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 276 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 277 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 278 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 279 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 280 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 313 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.45 |
| Metatranscriptomes | 0.55 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.11 |
| Nodule | 0 |
| Rhizoplane | 3.06 |
| Rhizosphere | 96.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105248_10390882 | 3300009177 | Bacteria | 1566 |
| 2 | MRS1b_contig_6517721 | 2162886011 | Bacteria | 1472 |
| 3 | MRS1b_contig_8438256 | 2162886011 | Bacteria | 1328 |
| 4 | LJNas_1000010 | 3300000546 | Bacteria | 24841 |
| 5 | JGI24034J26672_10044796 | 3300002239 | Bacteria | 750 |
| 6 | JGI24751J29686_10006045 | 3300002459 | Bacteria | 2464 |
| 7 | Ga0065712_10070525 | 3300005290 | Bacteria | 5928 |
| 8 | Ga0065712_10076384 | 3300005290 | Bacteria | 3672 |
| 9 | Ga0065712_10093513 | 3300005290 | Bacteria | 2288 |
| 10 | Ga0065715_10002194 | 3300005293 | Bacteria | 6608 |
| 11 | Ga0065715_10108929 | 3300005293 | Bacteria | 2694 |
| 12 | Ga0065715_10376653 | 3300005293 | Unclassified | 913 |
| 13 | Ga0070676_10037577 | 3300005328 | Bacteria | 2793 |
| 14 | Ga0070683_100004020 | 3300005329 | Bacteria | 12043 |
| 15 | Ga0070683_100097881 | 3300005329 | Bacteria | 2760 |
| 16 | Ga0070683_100119003 | 3300005329 | Bacteria | 2494 |
| 17 | Ga0070690_100012290 | 3300005330 | Bacteria | 5037 |
| 18 | Ga0070690_100014122 | 3300005330 | Bacteria | 4734 |
| 19 | Ga0070690_100020132 | 3300005330 | Bacteria | 4061 |
| 20 | Ga0070690_100036378 | 3300005330 | Bacteria | 3094 |
| 21 | Ga0070670_100004616 | 3300005331 | Bacteria | 11557 |
| 22 | Ga0070670_100025077 | 3300005331 | Bacteria | 5130 |
| 23 | Ga0068869_100008217 | 3300005334 | Bacteria | 6715 |
| 24 | Ga0068869_100045320 | 3300005334 | Bacteria | 3165 |
| 25 | Ga0068869_100161096 | 3300005334 | Bacteria | 1747 |
| 26 | Ga0070666_10005814 | 3300005335 | Bacteria | 7579 |
| 27 | Ga0070666_10011999 | 3300005335 | Bacteria | 5453 |
| 28 | Ga0070666_10024461 | 3300005335 | Bacteria | 3934 |
| 29 | Ga0070666_10149141 | 3300005335 | Bacteria | 1631 |
| 30 | Ga0070666_10422200 | 3300005335 | Unclassified | 960 |
| 31 | Ga0070680_100007894 | 3300005336 | Bacteria | 8116 |
| 32 | Ga0070682_100243831 | 3300005337 | Bacteria | 1291 |
| 33 | Ga0068868_100002730 | 3300005338 | Bacteria | 12227 |
| 34 | Ga0068868_100004230 | 3300005338 | Bacteria | 10040 |
| 35 | Ga0068868_100048577 | 3300005338 | Bacteria | 3328 |
| 36 | Ga0068868_100050312 | 3300005338 | Bacteria | 3272 |
| 37 | Ga0068868_100095207 | 3300005338 | Bacteria | 2403 |
| 38 | Ga0068868_100154257 | 3300005338 | Bacteria | 1893 |
| 39 | Ga0070660_100019812 | 3300005339 | Unclassified | 4935 |
| 40 | Ga0070660_100023246 | 3300005339 | Bacteria | 4592 |
| 41 | Ga0070660_100078038 | 3300005339 | Bacteria | 2596 |
| 42 | Ga0070689_100001637 | 3300005340 | Bacteria | 14324 |
| 43 | Ga0070689_100071971 | 3300005340 | Bacteria | 2702 |
| 44 | Ga0070689_100155927 | 3300005340 | Bacteria | 1843 |
| 45 | Ga0070689_100174466 | 3300005340 | Bacteria | 1743 |
| 46 | Ga0070661_100010317 | 3300005344 | Bacteria | 6494 |
| 47 | Ga0070661_100022211 | 3300005344 | Bacteria | 4541 |
| 48 | Ga0070661_100089269 | 3300005344 | Unclassified | 2282 |
| 49 | Ga0070661_100219582 | 3300005344 | Bacteria | 1458 |
| 50 | Ga0070668_100002463 | 3300005347 | Bacteria | 13629 |
| 51 | Ga0070668_100177754 | 3300005347 | Unclassified | 1737 |
| 52 | Ga0070669_100099928 | 3300005353 | Bacteria | 2187 |
| 53 | Ga0070669_100120651 | 3300005353 | Bacteria | 2000 |
| 54 | Ga0070669_100738018 | 3300005353 | Bacteria | 834 |
| 55 | Ga0070675_100061022 | 3300005354 | Unclassified | 3113 |
| 56 | Ga0070675_100158461 | 3300005354 | Bacteria | 1945 |
| 57 | Ga0070675_100181054 | 3300005354 | Bacteria | 1822 |
| 58 | Ga0070671_100005001 | 3300005355 | Bacteria | 10564 |
| 59 | Ga0070671_100061036 | 3300005355 | Bacteria | 3139 |
| 60 | Ga0070671_100107982 | 3300005355 | Bacteria | 2337 |
| 61 | Ga0070671_100176122 | 3300005355 | Bacteria | 1810 |
| 62 | Ga0070671_100182997 | 3300005355 | Bacteria | 1774 |
| 63 | Ga0070671_100290945 | 3300005355 | Bacteria | 1390 |
| 64 | Ga0070674_100279204 | 3300005356 | Bacteria | 1323 |
| 65 | Ga0070674_100625135 | 3300005356 | Unclassified | 913 |
| 66 | Ga0070673_100005076 | 3300005364 | Bacteria | 8398 |
| 67 | Ga0070673_100021628 | 3300005364 | Bacteria | 4668 |
| 68 | Ga0070673_100021778 | 3300005364 | Bacteria | 4656 |
| 69 | Ga0070673_100055165 | 3300005364 | Bacteria | 3130 |
| 70 | Ga0070688_100036830 | 3300005365 | Bacteria | 2978 |
| 71 | Ga0070688_100176824 | 3300005365 | Unclassified | 1477 |
| 72 | Ga0070688_100226971 | 3300005365 | Bacteria | 1319 |
| 73 | Ga0070688_100503156 | 3300005365 | Unclassified | 914 |
| 74 | Ga0070659_100007534 | 3300005366 | Bacteria | 7909 |
| 75 | Ga0070659_100021419 | 3300005366 | Bacteria | 4923 |
| 76 | Ga0070659_100202275 | 3300005366 | Unclassified | 1635 |
| 77 | Ga0070667_100022767 | 3300005367 | Bacteria | 5195 |
| 78 | Ga0070667_100062042 | 3300005367 | Unclassified | 3166 |
| 79 | Ga0070667_100101238 | 3300005367 | Bacteria | 2488 |
| 80 | Ga0070667_100152532 | 3300005367 | Bacteria | 2030 |
| 81 | Ga0070667_100319732 | 3300005367 | Unclassified | 1400 |
| 82 | Ga0070667_100392214 | 3300005367 | Bacteria | 1262 |
| 83 | Ga0070667_100529964 | 3300005367 | Bacteria | 1081 |
| 84 | Ga0070703_10230232 | 3300005406 | Viruses | 742 |
| 85 | Ga0070709_10005256 | 3300005434 | Bacteria | 7006 |
| 86 | Ga0070709_10068914 | 3300005434 | Bacteria | 2277 |
| 87 | Ga0070709_10086425 | 3300005434 | Unclassified | 2059 |
| 88 | Ga0070709_10104834 | 3300005434 | Unclassified | 1890 |
| 89 | Ga0070709_10158271 | 3300005434 | Bacteria | 1572 |
| 90 | Ga0070714_100000154 | 3300005435 | Bacteria | 55244 |
| 91 | Ga0070714_100014696 | 3300005435 | Bacteria | 6291 |
| 92 | Ga0070714_100027108 | 3300005435 | Bacteria | 4741 |
| 93 | Ga0070714_100316375 | 3300005435 | Bacteria | 1459 |
| 94 | Ga0070713_100000113 | 3300005436 | Bacteria | 52925 |
| 95 | Ga0070713_100001107 | 3300005436 | Bacteria | 17171 |
| 96 | Ga0070713_100028357 | 3300005436 | Bacteria | 4421 |
| 97 | Ga0070713_100054750 | 3300005436 | Bacteria | 3311 |
| 98 | Ga0070713_100116004 | 3300005436 | Bacteria | 2341 |
| 99 | Ga0070713_100166614 | 3300005436 | Bacteria | 1971 |
| 100 | Ga0070713_100187135 | 3300005436 | Bacteria | 1864 |
| 101 | Ga0070713_100245151 | 3300005436 | Bacteria | 1633 |
| 102 | Ga0070713_100418775 | 3300005436 | Bacteria | 1254 |
| 103 | Ga0070713_100475560 | 3300005436 | Bacteria | 1176 |
| 104 | Ga0070710_10002900 | 3300005437 | Bacteria | 8164 |
| 105 | Ga0070710_10020263 | 3300005437 | Bacteria | 3448 |
| 106 | Ga0070710_10105331 | 3300005437 | Bacteria | 1686 |
| 107 | Ga0070710_10284963 | 3300005437 | Unclassified | 1073 |
| 108 | Ga0070710_10465882 | 3300005437 | Bacteria | 859 |
| 109 | Ga0070701_10374133 | 3300005438 | Unclassified | 896 |
| 110 | Ga0070711_100000518 | 3300005439 | Bacteria | 20014 |
| 111 | Ga0070711_100036457 | 3300005439 | Bacteria | 3294 |
| 112 | Ga0070711_100052613 | 3300005439 | Bacteria | 2803 |
| 113 | Ga0070711_100079101 | 3300005439 | Bacteria | 2338 |
| 114 | Ga0070711_100093292 | 3300005439 | Bacteria | 2173 |
| 115 | Ga0070711_100160669 | 3300005439 | Bacteria | 1703 |
| 116 | Ga0070711_100240593 | 3300005439 | Unclassified | 1415 |
| 117 | Ga0070711_100629105 | 3300005439 | Bacteria | 898 |
| 118 | Ga0070705_100609020 | 3300005440 | Unclassified | 846 |
| 119 | Ga0070700_100151157 | 3300005441 | Unclassified | 1588 |
| 120 | Ga0070694_100074203 | 3300005444 | Bacteria | 2351 |
| 121 | Ga0070694_100128165 | 3300005444 | Bacteria | 1830 |
| 122 | Ga0070694_100446273 | 3300005444 | Bacteria | 1021 |
| 123 | Ga0070708_100000099 | 3300005445 | Bacteria | 56982 |
| 124 | Ga0070708_100004535 | 3300005445 | Bacteria | 10936 |
| 125 | Ga0070708_100025278 | 3300005445 | Bacteria | 5076 |
| 126 | Ga0070708_100028665 | 3300005445 | Unclassified | 4794 |
| 127 | Ga0070708_100071955 | 3300005445 | Unclassified | 3114 |
| 128 | Ga0070708_100134515 | 3300005445 | Bacteria | 2289 |
| 129 | Ga0070708_100223332 | 3300005445 | Unclassified | 1767 |
| 130 | Ga0070708_100268748 | 3300005445 | Bacteria | 1604 |
| 131 | Ga0070708_100272971 | 3300005445 | Bacteria | 1591 |
| 132 | Ga0070708_100292362 | 3300005445 | Unclassified | 1534 |
| 133 | Ga0070708_100423769 | 3300005445 | Bacteria | 1255 |
| 134 | Ga0070663_100008619 | 3300005455 | Bacteria | 6284 |
| 135 | Ga0070663_100019001 | 3300005455 | Bacteria | 4519 |
| 136 | Ga0070663_100219080 | 3300005455 | Bacteria | 1493 |
| 137 | Ga0070678_100022384 | 3300005456 | Bacteria | 4187 |
| 138 | Ga0070678_100024025 | 3300005456 | Bacteria | 4072 |
| 139 | Ga0070678_100291682 | 3300005456 | Unclassified | 1383 |
| 140 | Ga0070662_100020306 | 3300005457 | Bacteria | 4522 |
| 141 | Ga0070662_100032687 | 3300005457 | Bacteria | 3657 |
| 142 | Ga0070681_10009604 | 3300005458 | Bacteria | 9513 |
| 143 | Ga0070681_10035376 | 3300005458 | Bacteria | 5017 |
| 144 | Ga0070681_10087011 | 3300005458 | Bacteria | 3078 |
| 145 | Ga0068867_100055666 | 3300005459 | Bacteria | 2925 |
| 146 | Ga0068867_100235414 | 3300005459 | Bacteria | 1482 |
| 147 | Ga0070685_10019143 | 3300005466 | Unclassified | 3691 |
| 148 | Ga0070685_10021175 | 3300005466 | Bacteria | 3531 |
| 149 | Ga0070706_100001042 | 3300005467 | Bacteria | 30061 |
| 150 | Ga0070706_100002036 | 3300005467 | Bacteria | 20720 |
| 151 | Ga0070706_100008125 | 3300005467 | Bacteria | 9786 |
| 152 | Ga0070706_100008677 | 3300005467 | Bacteria | 9473 |
| 153 | Ga0070706_100057976 | 3300005467 | Bacteria | 3574 |
| 154 | Ga0070706_100199503 | 3300005467 | Bacteria | 1869 |
| 155 | Ga0070707_100000091 | 3300005468 | Bacteria | 81794 |
| 156 | Ga0070707_100003096 | 3300005468 | Bacteria | 15744 |
| 157 | Ga0070707_100054061 | 3300005468 | Unclassified | 3849 |
| 158 | Ga0070707_100108792 | 3300005468 | Plasmid | 2688 |
| 159 | Ga0070707_100196197 | 3300005468 | Bacteria | 1968 |
| 160 | Ga0070707_100337319 | 3300005468 | Unclassified | 1465 |
| 161 | Ga0070707_100399233 | 3300005468 | Bacteria | 1335 |
| 162 | Ga0070707_100747235 | 3300005468 | Bacteria | 941 |
| 163 | Ga0070698_100000027 | 3300005471 | Bacteria | 98052 |
| 164 | Ga0070698_100000226 | 3300005471 | Bacteria | 55431 |
| 165 | Ga0070698_100122458 | 3300005471 | Bacteria | 2559 |
| 166 | Ga0070698_100216600 | 3300005471 | Bacteria | 1849 |
| 167 | Ga0070698_100331080 | 3300005471 | Bacteria | 1454 |
| 168 | Ga0070699_100000032 | 3300005518 | Bacteria | 136937 |
| 169 | Ga0070699_100000596 | 3300005518 | Bacteria | 34077 |
| 170 | Ga0070699_100063471 | 3300005518 | Bacteria | 3203 |
| 171 | Ga0070699_100066289 | 3300005518 | Unclassified | 3134 |
| 172 | Ga0070699_100072639 | 3300005518 | Bacteria | 2993 |
| 173 | Ga0070699_100285893 | 3300005518 | Bacteria | 1478 |
| 174 | Ga0070699_100331042 | 3300005518 | Unclassified | 1370 |
| 175 | Ga0070699_100416876 | 3300005518 | Bacteria | 1215 |
| 176 | Ga0070699_100862540 | 3300005518 | Bacteria | 829 |
| 177 | Ga0070679_100024956 | 3300005530 | Bacteria | 5860 |
| 178 | Ga0070679_100228329 | 3300005530 | Bacteria | 1821 |
| 179 | Ga0070679_101001077 | 3300005530 | Unclassified | 780 |
| 180 | Ga0070684_100001953 | 3300005535 | Bacteria | 15127 |
| 181 | Ga0070684_100131410 | 3300005535 | Bacteria | 2259 |
| 182 | Ga0070697_100000138 | 3300005536 | Bacteria | 58927 |
| 183 | Ga0070697_100000183 | 3300005536 | Bacteria | 51905 |
| 184 | Ga0070697_100001597 | 3300005536 | Bacteria | 17280 |
| 185 | Ga0070697_100006896 | 3300005536 | Bacteria | 8827 |
| 186 | Ga0070697_100097899 | 3300005536 | Unclassified | 2435 |
| 187 | Ga0070697_100109784 | 3300005536 | Bacteria | 2297 |
| 188 | Ga0070697_100243357 | 3300005536 | Unclassified | 1536 |
| 189 | Ga0070697_100246908 | 3300005536 | Bacteria | 1526 |
| 190 | Ga0070697_100337956 | 3300005536 | Bacteria | 1299 |
| 191 | Ga0070697_100355654 | 3300005536 | Unclassified | 1265 |
| 192 | Ga0070697_100504710 | 3300005536 | Unclassified | 1058 |
| 193 | Ga0070697_100706355 | 3300005536 | Bacteria | 890 |
| 194 | Ga0070697_100805050 | 3300005536 | Unclassified | 831 |
| 195 | Ga0070697_100831641 | 3300005536 | Bacteria | 818 |
| 196 | Ga0068853_100014401 | 3300005539 | Bacteria | 6475 |
| 197 | Ga0068853_100272099 | 3300005539 | Bacteria | 1560 |
| 198 | Ga0070672_100023560 | 3300005543 | Unclassified | 4540 |
| 199 | Ga0070672_100089711 | 3300005543 | Bacteria | 2477 |
| 200 | Ga0070672_100308914 | 3300005543 | Bacteria | 1342 |
| 201 | Ga0070672_100589763 | 3300005543 | Unclassified | 967 |
| 202 | Ga0070686_100025998 | 3300005544 | Bacteria | 3527 |
| 203 | Ga0070686_100026312 | 3300005544 | Bacteria | 3511 |
| 204 | Ga0070686_100281512 | 3300005544 | Unclassified | 1227 |
| 205 | Ga0070695_100032117 | 3300005545 | Bacteria | 3281 |
| 206 | Ga0070695_100349364 | 3300005545 | Unclassified | 1107 |
| 207 | Ga0070696_100010145 | 3300005546 | Bacteria | 6305 |
| 208 | Ga0070696_100101579 | 3300005546 | Bacteria | 2061 |
| 209 | Ga0070696_100333499 | 3300005546 | Unclassified | 1170 |
| 210 | Ga0070665_100125904 | 3300005548 | Bacteria | 2565 |
| 211 | Ga0070704_100194220 | 3300005549 | Unclassified | 1634 |
| 212 | Ga0070704_100257009 | 3300005549 | Bacteria | 1437 |
| 213 | Ga0068855_100167120 | 3300005563 | Bacteria | 2493 |
| 214 | Ga0068855_100379071 | 3300005563 | Unclassified | 1553 |
| 215 | Ga0068855_100475745 | 3300005563 | Bacteria | 1360 |
| 216 | Ga0068855_100568379 | 3300005563 | Unclassified | 1226 |
| 217 | Ga0068855_101379485 | 3300005563 | Bacteria | 727 |
| 218 | Ga0070664_100016901 | 3300005564 | Bacteria | 5987 |
| 219 | Ga0070664_100034964 | 3300005564 | Bacteria | 4217 |
| 220 | Ga0070664_100040838 | 3300005564 | Bacteria | 3913 |
| 221 | Ga0070664_100096808 | 3300005564 | Bacteria | 2561 |
| 222 | Ga0070664_100103748 | 3300005564 | Bacteria | 2475 |
| 223 | Ga0068857_100001007 | 3300005577 | Bacteria | 21676 |
| 224 | Ga0068857_100155788 | 3300005577 | Unclassified | 2071 |
| 225 | Ga0068854_100009000 | 3300005578 | Bacteria | 6434 |
| 226 | Ga0068854_100552493 | 3300005578 | Bacteria | 977 |
| 227 | Ga0068854_100575049 | 3300005578 | Bacteria | 959 |
| 228 | Ga0068856_100003228 | 3300005614 | Bacteria | 16600 |
| 229 | Ga0068856_100037382 | 3300005614 | Bacteria | 4765 |
| 230 | Ga0068856_100656784 | 3300005614 | Unclassified | 1069 |
| 231 | Ga0070702_100232499 | 3300005615 | Unclassified | 1239 |
| 232 | Ga0068852_100140721 | 3300005616 | Bacteria | 2232 |
| 233 | Ga0068859_100017542 | 3300005617 | Bacteria | 7197 |
| 234 | Ga0068859_100024153 | 3300005617 | Bacteria | 6099 |
| 235 | Ga0068859_100088929 | 3300005617 | Bacteria | 3138 |
| 236 | Ga0068859_100129490 | 3300005617 | Bacteria | 2595 |
| 237 | Ga0068859_100470042 | 3300005617 | Bacteria | 1353 |
| 238 | Ga0068864_100001748 | 3300005618 | Bacteria | 17856 |
| 239 | Ga0068864_100003558 | 3300005618 | Bacteria | 12876 |
| 240 | Ga0068864_100116776 | 3300005618 | Bacteria | 2381 |
| 241 | Ga0068864_100206520 | 3300005618 | Unclassified | 1807 |
| 242 | Ga0068866_10004179 | 3300005718 | Bacteria | 5923 |
| 243 | Ga0068866_10036868 | 3300005718 | Bacteria | 2398 |
| 244 | Ga0068866_10250763 | 3300005718 | Bacteria | 1083 |
| 245 | Ga0068866_10285464 | 3300005718 | Bacteria | 1024 |
| 246 | Ga0068861_100095056 | 3300005719 | Bacteria | 2359 |
| 247 | Ga0068861_100117068 | 3300005719 | Bacteria | 2144 |
| 248 | Ga0068861_101047477 | 3300005719 | Bacteria | 781 |
| 249 | Ga0068861_101071754 | 3300005719 | Unclassified | 773 |
| 250 | Ga0068851_10005986 | 3300005834 | Bacteria | 5538 |
| 251 | Ga0068851_10045532 | 3300005834 | Bacteria | 2218 |
| 252 | Ga0068851_10165938 | 3300005834 | Bacteria | 1216 |
| 253 | Ga0068870_10001845 | 3300005840 | Bacteria | 8714 |
| 254 | Ga0068863_100052570 | 3300005841 | Bacteria | 3860 |
| 255 | Ga0068863_100077719 | 3300005841 | Bacteria | 3141 |
| 256 | Ga0068863_100079878 | 3300005841 | Bacteria | 3098 |
| 257 | Ga0068863_100100511 | 3300005841 | Bacteria | 2749 |
| 258 | Ga0068863_100128873 | 3300005841 | Bacteria | 2415 |
| 259 | Ga0068863_100133484 | 3300005841 | Bacteria | 2371 |
| 260 | Ga0068863_100203970 | 3300005841 | Bacteria | 1903 |
| 261 | Ga0068863_100509016 | 3300005841 | Bacteria | 1186 |
| 262 | Ga0068858_100007549 | 3300005842 | Bacteria | 10509 |
| 263 | Ga0068858_100008063 | 3300005842 | Bacteria | 10144 |
| 264 | Ga0068858_100026960 | 3300005842 | Bacteria | 5337 |
| 265 | Ga0068858_100033742 | 3300005842 | Bacteria | 4747 |
| 266 | Ga0068858_100188509 | 3300005842 | Unclassified | 1949 |
| 267 | Ga0068858_100350200 | 3300005842 | Bacteria | 1415 |
| 268 | Ga0068858_101090390 | 3300005842 | Bacteria | 784 |
| 269 | Ga0068860_100052411 | 3300005843 | Bacteria | 3881 |
| 270 | Ga0068860_100085034 | 3300005843 | Bacteria | 3009 |
| 271 | Ga0068860_100242505 | 3300005843 | Bacteria | 1753 |
| 272 | Ga0068860_100277897 | 3300005843 | Bacteria | 1636 |
| 273 | Ga0068860_100495500 | 3300005843 | Bacteria | 1219 |
| 274 | Ga0068860_100747616 | 3300005843 | Bacteria | 989 |
| 275 | Ga0068860_100892720 | 3300005843 | Unclassified | 905 |
| 276 | Ga0068862_100115775 | 3300005844 | Bacteria | 2358 |
| 277 | Ga0068862_100129096 | 3300005844 | Unclassified | 2234 |
| 278 | Ga0068862_100129916 | 3300005844 | Bacteria | 2227 |
| 279 | Ga0068862_100184867 | 3300005844 | Bacteria | 1872 |
| 280 | Ga0081540_1080668 | 3300005983 | Bacteria | 1466 |
| 281 | Ga0070717_10001985 | 3300006028 | Bacteria | 14304 |
| 282 | Ga0070717_10003732 | 3300006028 | Bacteria | 10941 |
| 283 | Ga0070717_10006318 | 3300006028 | Bacteria | 8706 |
| 284 | Ga0070717_10011594 | 3300006028 | Bacteria | 6701 |
| 285 | Ga0070717_10043883 | 3300006028 | Bacteria | 3650 |
| 286 | Ga0070717_10085648 | 3300006028 | Bacteria | 2652 |
| 287 | Ga0070717_10102159 | 3300006028 | Bacteria | 2436 |
| 288 | Ga0070717_10109553 | 3300006028 | Unclassified | 2354 |
| 289 | Ga0070717_10121331 | 3300006028 | Unclassified | 2239 |
| 290 | Ga0070717_10168489 | 3300006028 | Bacteria | 1904 |
| 291 | Ga0070717_10245937 | 3300006028 | Unclassified | 1579 |
| 292 | Ga0070717_10247196 | 3300006028 | Bacteria | 1575 |
| 293 | Ga0075432_10058786 | 3300006058 | Unclassified | 1366 |
| 294 | Ga0070715_10090134 | 3300006163 | Unclassified | 1409 |
| 295 | Ga0070715_10105159 | 3300006163 | Bacteria | 1323 |
| 296 | Ga0070716_100001153 | 3300006173 | Bacteria | 11654 |
| 297 | Ga0070716_100013225 | 3300006173 | Bacteria | 4203 |
| 298 | Ga0070716_100022336 | 3300006173 | Bacteria | 3343 |
| 299 | Ga0070716_100039054 | 3300006173 | Bacteria | 2632 |
| 300 | Ga0070716_100045076 | 3300006173 | Bacteria | 2474 |
| 301 | Ga0070716_100061888 | 3300006173 | Bacteria | 2168 |
| 302 | Ga0070712_100000084 | 3300006175 | Bacteria | 48408 |
| 303 | Ga0070712_100001699 | 3300006175 | Bacteria | 13489 |
| 304 | Ga0070712_100003995 | 3300006175 | Bacteria | 9066 |
| 305 | Ga0070712_100010243 | 3300006175 | Bacteria | 5911 |
| 306 | Ga0070712_100014090 | 3300006175 | Bacteria | 5127 |
| 307 | Ga0070712_100019456 | 3300006175 | Bacteria | 4429 |
| 308 | Ga0070712_100156160 | 3300006175 | Bacteria | 1757 |
| 309 | Ga0097621_100001499 | 3300006237 | Bacteria | 16025 |
| 310 | Ga0097621_100069967 | 3300006237 | Bacteria | 2897 |
| 311 | Ga0097621_100158073 | 3300006237 | Unclassified | 1947 |
| 312 | Ga0097621_100379393 | 3300006237 | Bacteria | 1262 |
| 313 | Ga0097621_100504247 | 3300006237 | Unclassified | 1096 |
| 314 | Ga0097621_100736710 | 3300006237 | Unclassified | 910 |
| 315 | Ga0068871_100001120 | 3300006358 | Bacteria | 17991 |
| 316 | Ga0068871_100004299 | 3300006358 | Bacteria | 9892 |
| 317 | Ga0068871_100024370 | 3300006358 | Unclassified | 4692 |
| 318 | Ga0068871_100071731 | 3300006358 | Bacteria | 2849 |
| 319 | Ga0068871_100174829 | 3300006358 | Bacteria | 1843 |
| 320 | Ga0068871_100277077 | 3300006358 | Bacteria | 1466 |
| 321 | Ga0068871_100281635 | 3300006358 | Bacteria | 1454 |
| 322 | Ga0068871_100376477 | 3300006358 | Bacteria | 1260 |
| 323 | Ga0075428_100036657 | 3300006844 | Bacteria | 5401 |
| 324 | Ga0075428_100370504 | 3300006844 | Unclassified | 1536 |
| 325 | Ga0075430_100081009 | 3300006846 | Unclassified | 2719 |
| 326 | Ga0075430_100341607 | 3300006846 | Unclassified | 1237 |
| 327 | Ga0075431_100056694 | 3300006847 | Bacteria | 4040 |
| 328 | Ga0075431_100255783 | 3300006847 | Bacteria | 1778 |
| 329 | Ga0075433_10000915 | 3300006852 | Bacteria | 20739 |
| 330 | Ga0075433_10133239 | 3300006852 | Bacteria | 2208 |
| 331 | Ga0075434_100003011 | 3300006871 | Bacteria | 14988 |
| 332 | Ga0075434_100010220 | 3300006871 | Bacteria | 8790 |
| 333 | Ga0075434_100083762 | 3300006871 | Bacteria | 3187 |
| 334 | Ga0075434_100600380 | 3300006871 | Unclassified | 1120 |
| 335 | Ga0075429_100043479 | 3300006880 | Unclassified | 3909 |
| 336 | Ga0068865_100043579 | 3300006881 | Bacteria | 3067 |
| 337 | Ga0075436_100097592 | 3300006914 | Bacteria | 2044 |
| 338 | Ga0075436_100168172 | 3300006914 | Unclassified | 1548 |
| 339 | Ga0075436_100170566 | 3300006914 | Bacteria | 1536 |
| 340 | Ga0075436_100312223 | 3300006914 | Unclassified | 1128 |
| 341 | Ga0075436_100378719 | 3300006914 | Bacteria | 1023 |
| 342 | Ga0097620_100017540 | 3300006931 | Bacteria | 7197 |
| 343 | Ga0097620_100024152 | 3300006931 | Bacteria | 6099 |
| 344 | Ga0097620_100088927 | 3300006931 | Bacteria | 3138 |
| 345 | Ga0097620_100129485 | 3300006931 | Bacteria | 2595 |
| 346 | Ga0097620_100469973 | 3300006931 | Bacteria | 1353 |
| 347 | Ga0075435_100003469 | 3300007076 | Bacteria | 10692 |
| 348 | Ga0075435_100228782 | 3300007076 | Bacteria | 1580 |
| 349 | Ga0099795_10007298 | 3300007788 | Unclassified | 3076 |
| 350 | Ga0105240_10010282 | 3300009093 | Bacteria | 13175 |
| 351 | Ga0105240_10117089 | 3300009093 | Unclassified | 3213 |
| 352 | Ga0105245_10012108 | 3300009098 | Bacteria | 7502 |
| 353 | Ga0105245_10043787 | 3300009098 | Bacteria | 3993 |
| 354 | Ga0105245_10061874 | 3300009098 | Bacteria | 3376 |
| 355 | Ga0105245_10160874 | 3300009098 | Unclassified | 2130 |
| 356 | Ga0105245_10264545 | 3300009098 | Bacteria | 1675 |
| 357 | Ga0105245_10539964 | 3300009098 | Unclassified | 1187 |
| 358 | Ga0105245_10588541 | 3300009098 | Unclassified | 1138 |
| 359 | Ga0105245_11375257 | 3300009098 | Bacteria | 756 |
| 360 | Ga0105247_10004098 | 3300009101 | Bacteria | 9365 |
| 361 | Ga0105247_10212007 | 3300009101 | Bacteria | 1307 |
| 362 | Ga0105247_10288190 | 3300009101 | Bacteria | 1135 |
| 363 | Ga0114129_10136377 | 3300009147 | Bacteria | 3367 |
| 364 | Ga0114129_10449175 | 3300009147 | Unclassified | 1691 |
| 365 | Ga0114129_10507253 | 3300009147 | Bacteria | 1574 |
| 366 | Ga0105243_10171929 | 3300009148 | Bacteria | 1877 |
| 367 | Ga0105241_10105681 | 3300009174 | Bacteria | 2246 |
| 368 | Ga0105241_10191403 | 3300009174 | Bacteria | 1703 |
| 369 | Ga0105241_10299681 | 3300009174 | Bacteria | 1379 |
| 370 | Ga0105242_10016725 | 3300009176 | Bacteria | 5706 |
| 371 | Ga0105242_10027045 | 3300009176 | Bacteria | 4550 |
| 372 | Ga0105242_10211299 | 3300009176 | Bacteria | 1729 |
| 373 | Ga0105248_10021115 | 3300009177 | Bacteria | 7215 |
| 374 | Ga0105248_10036094 | 3300009177 | Bacteria | 5529 |
| 375 | Ga0105248_10046481 | 3300009177 | Bacteria | 4865 |
| 376 | Ga0105248_10413213 | 3300009177 | Bacteria | 1519 |
| 377 | Ga0105237_10104531 | 3300009545 | Bacteria | 2824 |
| 378 | Ga0105237_10122797 | 3300009545 | Bacteria | 2591 |
| 379 | Ga0105237_10188665 | 3300009545 | Unclassified | 2062 |
| 380 | Ga0105237_10729868 | 3300009545 | Bacteria | 997 |
| 381 | Ga0105238_10058932 | 3300009551 | Bacteria | 3848 |
| 382 | Ga0099796_10034057 | 3300010159 | Bacteria | 1680 |
| 383 | Ga0105239_10050506 | 3300010375 | Bacteria | 4561 |
| 384 | Ga0105239_10073126 | 3300010375 | Bacteria | 3769 |
| 385 | Ga0105246_10008349 | 3300011119 | Bacteria | 6361 |
| 386 | Ga0105246_10021673 | 3300011119 | Bacteria | 4137 |
| 387 | Ga0157373_10006716 | 3300013100 | Bacteria | 8566 |
| 388 | Ga0157373_10107330 | 3300013100 | Bacteria | 1963 |
| 389 | Ga0157371_10024120 | 3300013102 | Bacteria | 4443 |
| 390 | Ga0157369_10062711 | 3300013105 | Unclassified | 4005 |
| 391 | Ga0157369_10257041 | 3300013105 | Bacteria | 1822 |
| 392 | Ga0157369_10512768 | 3300013105 | Bacteria | 1241 |
| 393 | Ga0157369_11130270 | 3300013105 | Bacteria | 800 |
| 394 | Ga0157374_10007435 | 3300013296 | Bacteria | 9343 |
| 395 | Ga0157374_10042686 | 3300013296 | Bacteria | 4184 |
| 396 | Ga0157374_10069516 | 3300013296 | Bacteria | 3316 |
| 397 | Ga0157374_10071771 | 3300013296 | Bacteria | 3266 |
| 398 | Ga0157374_10196080 | 3300013296 | Bacteria | 1976 |
| 399 | Ga0157374_10269530 | 3300013296 | Bacteria | 1678 |
| 400 | Ga0157378_10000260 | 3300013297 | Bacteria | 51886 |
| 401 | Ga0157378_10046181 | 3300013297 | Bacteria | 3872 |
| 402 | Ga0157378_10130437 | 3300013297 | Bacteria | 2326 |
| 403 | Ga0157378_10187882 | 3300013297 | Bacteria | 1947 |
| 404 | Ga0157378_10240843 | 3300013297 | Bacteria | 1728 |
| 405 | Ga0163162_10001932 | 3300013306 | Bacteria | 19501 |
| 406 | Ga0163162_10004945 | 3300013306 | Bacteria | 12845 |
| 407 | Ga0163162_10042940 | 3300013306 | Bacteria | 4526 |
| 408 | Ga0163162_10063886 | 3300013306 | Bacteria | 3725 |
| 409 | Ga0163162_10172110 | 3300013306 | Bacteria | 2290 |
| 410 | Ga0163162_10208818 | 3300013306 | Bacteria | 2082 |
| 411 | Ga0163162_10284173 | 3300013306 | Unclassified | 1786 |
| 412 | Ga0163162_11763615 | 3300013306 | Bacteria | 707 |
| 413 | Ga0157372_10004647 | 3300013307 | Bacteria | 14596 |
| 414 | Ga0157372_10047804 | 3300013307 | Bacteria | 4755 |
| 415 | Ga0157372_10222059 | 3300013307 | Bacteria | 2190 |
| 416 | Ga0157375_10035315 | 3300013308 | Bacteria | 4770 |
| 417 | Ga0157375_10081068 | 3300013308 | Bacteria | 3284 |
| 418 | Ga0157375_10082002 | 3300013308 | Unclassified | 3266 |
| 419 | Ga0157375_10104676 | 3300013308 | Bacteria | 2919 |
| 420 | Ga0163163_10001699 | 3300014325 | Bacteria | 18602 |
| 421 | Ga0163163_10002554 | 3300014325 | Bacteria | 15423 |
| 422 | Ga0163163_10151736 | 3300014325 | Bacteria | 2360 |
| 423 | Ga0163163_10154514 | 3300014325 | Bacteria | 2338 |
| 424 | Ga0163163_10167677 | 3300014325 | Bacteria | 2242 |
| 425 | Ga0163163_10170869 | 3300014325 | Bacteria | 2220 |
| 426 | Ga0163163_10190926 | 3300014325 | Bacteria | 2097 |
| 427 | Ga0163163_10447693 | 3300014325 | Bacteria | 1351 |
| 428 | Ga0157377_10025486 | 3300014745 | Bacteria | 3154 |
| 429 | Ga0157379_10005151 | 3300014968 | Bacteria | 11221 |
| 430 | Ga0157379_10033615 | 3300014968 | Bacteria | 4573 |
| 431 | Ga0157379_10066847 | 3300014968 | Bacteria | 3214 |
| 432 | Ga0157379_10077259 | 3300014968 | Bacteria | 2981 |
| 433 | Ga0157379_10101130 | 3300014968 | Bacteria | 2587 |
| 434 | Ga0157379_10121252 | 3300014968 | Bacteria | 2352 |
| 435 | Ga0157379_10151006 | 3300014968 | Bacteria | 2095 |
| 436 | Ga0157376_10008851 | 3300014969 | Bacteria | 7283 |
| 437 | Ga0157376_10057820 | 3300014969 | Bacteria | 3246 |
| 438 | Ga0157376_10096830 | 3300014969 | Bacteria | 2569 |
| 439 | Ga0157376_10154354 | 3300014969 | Unclassified | 2074 |
| 440 | Ga0157376_10154536 | 3300014969 | Bacteria | 2073 |
| 441 | Ga0157376_10212995 | 3300014969 | Bacteria | 1785 |
| 442 | Ga0157376_10277365 | 3300014969 | Bacteria | 1577 |
| 443 | Ga0157376_10350778 | 3300014969 | Bacteria | 1412 |
| 444 | Ga0157376_10701447 | 3300014969 | Bacteria | 1017 |
| 445 | Ga0157376_10868047 | 3300014969 | Bacteria | 919 |
| 446 | Ga0182006_1070676 | 3300015261 | Bacteria | 1295 |
| 447 | Ga0163161_10261359 | 3300017792 | Unclassified | 1352 |
| 448 | Ga0163161_10269753 | 3300017792 | Bacteria | 1331 |
| 449 | Ga0163161_10556258 | 3300017792 | Bacteria | 941 |
| 450 | Ga0224569_100779 | 3300022732 | Unclassified | 2711 |
| 451 | Ga0224572_1000884 | 3300024225 | Bacteria | 4046 |
| 452 | Ga0224572_1004713 | 3300024225 | Bacteria | 2393 |
| 453 | Ga0228598_1006514 | 3300024227 | Bacteria | 2414 |
| 454 | Ga0228598_1010228 | 3300024227 | Unclassified | 1869 |
| 455 | Ga0207697_10037918 | 3300025315 | Bacteria | 1976 |
| 456 | Ga0207656_10055118 | 3300025321 | Bacteria | 1730 |
| 457 | Ga0207656_10058157 | 3300025321 | Bacteria | 1688 |
| 458 | Ga0207692_10015262 | 3300025898 | Bacteria | 3375 |
| 459 | Ga0207692_10023268 | 3300025898 | Bacteria | 2863 |
| 460 | Ga0207692_10026324 | 3300025898 | Unclassified | 2727 |
| 461 | Ga0207692_10090908 | 3300025898 | Unclassified | 1655 |
| 462 | Ga0207642_10025069 | 3300025899 | Unclassified | 2406 |
| 463 | Ga0207642_10061421 | 3300025899 | Unclassified | 1747 |
| 464 | Ga0207710_10142186 | 3300025900 | Unclassified | 1159 |
| 465 | Ga0207680_10012846 | 3300025903 | Bacteria | 4278 |
| 466 | Ga0207680_10014376 | 3300025903 | Bacteria | 4093 |
| 467 | Ga0207680_10286242 | 3300025903 | Unclassified | 1146 |
| 468 | Ga0207647_10005231 | 3300025904 | Bacteria | 9553 |
| 469 | Ga0207647_10108544 | 3300025904 | Bacteria | 1642 |
| 470 | Ga0207647_10190844 | 3300025904 | Unclassified | 1187 |
| 471 | Ga0207685_10035384 | 3300025905 | Unclassified | 1822 |
| 472 | Ga0207685_10048327 | 3300025905 | Bacteria | 1629 |
| 473 | Ga0207699_10008583 | 3300025906 | Bacteria | 5050 |
| 474 | Ga0207699_10024378 | 3300025906 | Bacteria | 3308 |
| 475 | Ga0207699_10082667 | 3300025906 | Bacteria | 1996 |
| 476 | Ga0207699_10126698 | 3300025906 | Unclassified | 1659 |
| 477 | Ga0207699_10204811 | 3300025906 | Bacteria | 1339 |
| 478 | Ga0207699_10249440 | 3300025906 | Bacteria | 1223 |
| 479 | Ga0207645_10000311 | 3300025907 | Bacteria | 40978 |
| 480 | Ga0207645_10020169 | 3300025907 | Bacteria | 4365 |
| 481 | Ga0207645_10025308 | 3300025907 | Unclassified | 3840 |
| 482 | Ga0207643_10000546 | 3300025908 | Bacteria | 24125 |
| 483 | Ga0207643_10165329 | 3300025908 | Unclassified | 1333 |
| 484 | Ga0207684_10000238 | 3300025910 | Bacteria | 83165 |
| 485 | Ga0207684_10002001 | 3300025910 | Bacteria | 21005 |
| 486 | Ga0207684_10054596 | 3300025910 | Unclassified | 3389 |
| 487 | Ga0207684_10055545 | 3300025910 | Unclassified | 3359 |
| 488 | Ga0207684_10154043 | 3300025910 | Bacteria | 1978 |
| 489 | Ga0207684_10365352 | 3300025910 | Bacteria | 1242 |
| 490 | Ga0207684_10645210 | 3300025910 | Bacteria | 902 |
| 491 | Ga0207654_10004712 | 3300025911 | Bacteria | 6902 |
| 492 | Ga0207654_10102590 | 3300025911 | Bacteria | 1765 |
| 493 | Ga0207707_10017650 | 3300025912 | Bacteria | 6224 |
| 494 | Ga0207707_10018544 | 3300025912 | Bacteria | 6066 |
| 495 | Ga0207707_10054558 | 3300025912 | Bacteria | 3479 |
| 496 | Ga0207707_10595588 | 3300025912 | Bacteria | 936 |
| 497 | Ga0207695_10075791 | 3300025913 | Bacteria | 3421 |
| 498 | Ga0207695_10132045 | 3300025913 | Unclassified | 2454 |
| 499 | Ga0207695_10404267 | 3300025913 | Bacteria | 1250 |
| 500 | Ga0207671_10127238 | 3300025914 | Unclassified | 1953 |
| 501 | Ga0207671_10191864 | 3300025914 | Bacteria | 1593 |
| 502 | Ga0207671_10270009 | 3300025914 | Unclassified | 1340 |
| 503 | Ga0207693_10000015 | 3300025915 | Bacteria | 147464 |
| 504 | Ga0207693_10000517 | 3300025915 | Bacteria | 34803 |
| 505 | Ga0207693_10001987 | 3300025915 | Bacteria | 17937 |
| 506 | Ga0207693_10011436 | 3300025915 | Bacteria | 7184 |
| 507 | Ga0207693_10104058 | 3300025915 | Bacteria | 2226 |
| 508 | Ga0207663_10003940 | 3300025916 | Bacteria | 7344 |
| 509 | Ga0207663_10180344 | 3300025916 | Bacteria | 1508 |
| 510 | Ga0207663_10235280 | 3300025916 | Bacteria | 1341 |
| 511 | Ga0207663_10679721 | 3300025916 | Bacteria | 814 |
| 512 | Ga0207663_10912766 | 3300025916 | Unclassified | 703 |
| 513 | Ga0207660_10386815 | 3300025917 | Unclassified | 1125 |
| 514 | Ga0207657_10002880 | 3300025919 | Bacteria | 18488 |
| 515 | Ga0207657_10003528 | 3300025919 | Bacteria | 16709 |
| 516 | Ga0207657_10033933 | 3300025919 | Bacteria | 4595 |
| 517 | Ga0207649_10000666 | 3300025920 | Bacteria | 22943 |
| 518 | Ga0207649_10024450 | 3300025920 | Bacteria | 3511 |
| 519 | Ga0207649_10251809 | 3300025920 | Unclassified | 1272 |
| 520 | Ga0207652_10052638 | 3300025921 | Bacteria | 3495 |
| 521 | Ga0207652_10412691 | 3300025921 | Bacteria | 1218 |
| 522 | Ga0207652_10869972 | 3300025921 | Unclassified | 797 |
| 523 | Ga0207646_10000073 | 3300025922 | Bacteria | 140267 |
| 524 | Ga0207646_10001845 | 3300025922 | Bacteria | 25580 |
| 525 | Ga0207646_10019424 | 3300025922 | Bacteria | 6317 |
| 526 | Ga0207646_10088344 | 3300025922 | Bacteria | 2773 |
| 527 | Ga0207646_10360690 | 3300025922 | Bacteria | 1313 |
| 528 | Ga0207646_10637161 | 3300025922 | Unclassified | 955 |
| 529 | Ga0207681_10088972 | 3300025923 | Bacteria | 2200 |
| 530 | Ga0207681_10098173 | 3300025923 | Bacteria | 2107 |
| 531 | Ga0207681_10120349 | 3300025923 | Unclassified | 1924 |
| 532 | Ga0207681_10243023 | 3300025923 | Bacteria | 1402 |
| 533 | Ga0207681_10534681 | 3300025923 | Unclassified | 963 |
| 534 | Ga0207694_10214625 | 3300025924 | Unclassified | 1568 |
| 535 | Ga0207650_10000097 | 3300025925 | Bacteria | 115583 |
| 536 | Ga0207650_10004072 | 3300025925 | Bacteria | 9992 |
| 537 | Ga0207650_10325773 | 3300025925 | Bacteria | 1259 |
| 538 | Ga0207659_10018070 | 3300025926 | Bacteria | 4616 |
| 539 | Ga0207659_10050507 | 3300025926 | Unclassified | 2955 |
| 540 | Ga0207659_10073211 | 3300025926 | Bacteria | 2508 |
| 541 | Ga0207659_10770151 | 3300025926 | Bacteria | 826 |
| 542 | Ga0207687_10003552 | 3300025927 | Bacteria | 10490 |
| 543 | Ga0207687_10017349 | 3300025927 | Bacteria | 4738 |
| 544 | Ga0207687_10044012 | 3300025927 | Bacteria | 3078 |
| 545 | Ga0207700_10000373 | 3300025928 | Bacteria | 26215 |
| 546 | Ga0207700_10000551 | 3300025928 | Bacteria | 21996 |
| 547 | Ga0207700_10101997 | 3300025928 | Bacteria | 2291 |
| 548 | Ga0207700_10160867 | 3300025928 | Bacteria | 1865 |
| 549 | Ga0207700_10386628 | 3300025928 | Bacteria | 1224 |
| 550 | Ga0207700_10431067 | 3300025928 | Unclassified | 1159 |
| 551 | Ga0207700_10434911 | 3300025928 | Bacteria | 1154 |
| 552 | Ga0207664_10000241 | 3300025929 | Bacteria | 41182 |
| 553 | Ga0207664_10047540 | 3300025929 | Bacteria | 3371 |
| 554 | Ga0207664_10146579 | 3300025929 | Bacteria | 2002 |
| 555 | Ga0207664_10217938 | 3300025929 | Unclassified | 1654 |
| 556 | Ga0207664_10223775 | 3300025929 | Bacteria | 1633 |
| 557 | Ga0207664_10435016 | 3300025929 | Bacteria | 1170 |
| 558 | Ga0207644_10007323 | 3300025931 | Bacteria | 7182 |
| 559 | Ga0207644_10013687 | 3300025931 | Bacteria | 5415 |
| 560 | Ga0207690_10002849 | 3300025932 | Bacteria | 10434 |
| 561 | Ga0207690_10020371 | 3300025932 | Bacteria | 4097 |
| 562 | Ga0207690_10376018 | 3300025932 | Unclassified | 1128 |
| 563 | Ga0207706_10000139 | 3300025933 | Bacteria | 79096 |
| 564 | Ga0207706_10113112 | 3300025933 | Bacteria | 2388 |
| 565 | Ga0207686_10473315 | 3300025934 | Unclassified | 967 |
| 566 | Ga0207709_10207821 | 3300025935 | Unclassified | 1403 |
| 567 | Ga0207670_10155039 | 3300025936 | Bacteria | 1704 |
| 568 | Ga0207670_10237513 | 3300025936 | Unclassified | 1402 |
| 569 | Ga0207669_10259893 | 3300025937 | Bacteria | 1298 |
| 570 | Ga0207669_10572106 | 3300025937 | Unclassified | 915 |
| 571 | Ga0207704_10031873 | 3300025938 | Bacteria | 2975 |
| 572 | Ga0207704_10093139 | 3300025938 | Unclassified | 1985 |
| 573 | Ga0207665_10000188 | 3300025939 | Bacteria | 41567 |
| 574 | Ga0207665_10002289 | 3300025939 | Bacteria | 12928 |
| 575 | Ga0207665_10038450 | 3300025939 | Bacteria | 3186 |
| 576 | Ga0207665_10039865 | 3300025939 | Bacteria | 3133 |
| 577 | Ga0207665_10056732 | 3300025939 | Bacteria | 2644 |
| 578 | Ga0207665_10189729 | 3300025939 | Unclassified | 1492 |
| 579 | Ga0207665_10220185 | 3300025939 | Bacteria | 1391 |
| 580 | Ga0207665_10290601 | 3300025939 | Bacteria | 1219 |
| 581 | Ga0207691_10067391 | 3300025940 | Bacteria | 3236 |
| 582 | Ga0207691_10352712 | 3300025940 | Bacteria | 1259 |
| 583 | Ga0207691_10664664 | 3300025940 | Unclassified | 880 |
| 584 | Ga0207711_10005198 | 3300025941 | Bacteria | 11021 |
| 585 | Ga0207711_10042354 | 3300025941 | Bacteria | 3880 |
| 586 | Ga0207711_10068041 | 3300025941 | Bacteria | 3084 |
| 587 | Ga0207711_10091735 | 3300025941 | Bacteria | 2672 |
| 588 | Ga0207711_10119828 | 3300025941 | Bacteria | 2348 |
| 589 | Ga0207711_10180717 | 3300025941 | Bacteria | 1918 |
| 590 | Ga0207711_10359549 | 3300025941 | Bacteria | 1349 |
| 591 | Ga0207689_10000078 | 3300025942 | Bacteria | 79810 |
| 592 | Ga0207689_10080424 | 3300025942 | Bacteria | 2679 |
| 593 | Ga0207689_10238768 | 3300025942 | Bacteria | 1502 |
| 594 | Ga0207661_10000124 | 3300025944 | Bacteria | 49095 |
| 595 | Ga0207661_10125766 | 3300025944 | Unclassified | 2189 |
| 596 | Ga0207661_10437297 | 3300025944 | Bacteria | 1190 |
| 597 | Ga0207679_10000065 | 3300025945 | Bacteria | 97825 |
| 598 | Ga0207679_10023390 | 3300025945 | Bacteria | 4225 |
| 599 | Ga0207679_10031869 | 3300025945 | Bacteria | 3694 |
| 600 | Ga0207679_10032000 | 3300025945 | Bacteria | 3687 |
| 601 | Ga0207667_10015347 | 3300025949 | Bacteria | 8707 |
| 602 | Ga0207667_10477905 | 3300025949 | Unclassified | 1265 |
| 603 | Ga0207667_10569641 | 3300025949 | Bacteria | 1144 |
| 604 | Ga0207651_10017725 | 3300025960 | Bacteria | 4214 |
| 605 | Ga0207651_10034427 | 3300025960 | Bacteria | 3280 |
| 606 | Ga0207712_10037485 | 3300025961 | Bacteria | 3308 |
| 607 | Ga0207712_10208193 | 3300025961 | Unclassified | 1556 |
| 608 | Ga0207668_10147240 | 3300025972 | Bacteria | 1818 |
| 609 | Ga0207668_10216063 | 3300025972 | Bacteria | 1536 |
| 610 | Ga0207640_10036496 | 3300025981 | Bacteria | 3086 |
| 611 | Ga0207640_10371373 | 3300025981 | Unclassified | 1156 |
| 612 | Ga0207658_10002380 | 3300025986 | Bacteria | 13779 |
| 613 | Ga0207658_10070369 | 3300025986 | Bacteria | 2646 |
| 614 | Ga0207658_10077819 | 3300025986 | Bacteria | 2532 |
| 615 | Ga0207658_10185801 | 3300025986 | Bacteria | 1724 |
| 616 | Ga0207658_10372041 | 3300025986 | Unclassified | 1249 |
| 617 | Ga0207658_10484703 | 3300025986 | Bacteria | 1099 |
| 618 | Ga0207677_10003494 | 3300026023 | Bacteria | 8327 |
| 619 | Ga0207677_10014151 | 3300026023 | Bacteria | 4648 |
| 620 | Ga0207677_10023905 | 3300026023 | Bacteria | 3784 |
| 621 | Ga0207677_10034288 | 3300026023 | Bacteria | 3285 |
| 622 | Ga0207677_10142875 | 3300026023 | Bacteria | 1835 |
| 623 | Ga0207677_10155313 | 3300026023 | Bacteria | 1771 |
| 624 | Ga0207677_10288606 | 3300026023 | Unclassified | 1350 |
| 625 | Ga0207703_10044126 | 3300026035 | Bacteria | 3581 |
| 626 | Ga0207703_10055388 | 3300026035 | Bacteria | 3226 |
| 627 | Ga0207703_10062049 | 3300026035 | Bacteria | 3062 |
| 628 | Ga0207703_10471594 | 3300026035 | Unclassified | 1175 |
| 629 | Ga0207703_10728642 | 3300026035 | Bacteria | 944 |
| 630 | Ga0207639_10134194 | 3300026041 | Bacteria | 2053 |
| 631 | Ga0207639_10222118 | 3300026041 | Bacteria | 1632 |
| 632 | Ga0207678_10002115 | 3300026067 | Bacteria | 17982 |
| 633 | Ga0207678_10014195 | 3300026067 | Bacteria | 7003 |
| 634 | Ga0207678_10111271 | 3300026067 | Bacteria | 2336 |
| 635 | Ga0207708_10442423 | 3300026075 | Unclassified | 1081 |
| 636 | Ga0207702_10027973 | 3300026078 | Bacteria | 4684 |
| 637 | Ga0207702_10039120 | 3300026078 | Bacteria | 3973 |
| 638 | Ga0207702_10253859 | 3300026078 | Bacteria | 1652 |
| 639 | Ga0207702_10958184 | 3300026078 | Unclassified | 848 |
| 640 | Ga0207641_10000183 | 3300026088 | Bacteria | 87085 |
| 641 | Ga0207641_10022805 | 3300026088 | Bacteria | 5154 |
| 642 | Ga0207641_10028155 | 3300026088 | Bacteria | 4642 |
| 643 | Ga0207641_10065511 | 3300026088 | Bacteria | 3108 |
| 644 | Ga0207641_10685273 | 3300026088 | Bacteria | 1008 |
| 645 | Ga0207641_10696803 | 3300026088 | Bacteria | 1000 |
| 646 | Ga0207648_10000618 | 3300026089 | Bacteria | 39818 |
| 647 | Ga0207648_10031892 | 3300026089 | Bacteria | 4656 |
| 648 | Ga0207648_10164384 | 3300026089 | Bacteria | 1961 |
| 649 | Ga0207676_10000428 | 3300026095 | Bacteria | 35461 |
| 650 | Ga0207676_10002661 | 3300026095 | Bacteria | 12691 |
| 651 | Ga0207676_10082628 | 3300026095 | Bacteria | 2613 |
| 652 | Ga0207676_10937951 | 3300026095 | Bacteria | 850 |
| 653 | Ga0207674_10002308 | 3300026116 | Bacteria | 24156 |
| 654 | Ga0207674_10026582 | 3300026116 | Bacteria | 6141 |
| 655 | Ga0207674_10629262 | 3300026116 | Bacteria | 1036 |
| 656 | Ga0207674_11044263 | 3300026116 | Bacteria | 786 |
| 657 | Ga0207675_100011075 | 3300026118 | Bacteria | 8449 |
| 658 | Ga0207675_100042878 | 3300026118 | Bacteria | 4225 |
| 659 | Ga0207675_100091554 | 3300026118 | Bacteria | 2859 |
| 660 | Ga0207675_100212028 | 3300026118 | Bacteria | 1863 |
| 661 | Ga0207683_10158466 | 3300026121 | Bacteria | 2045 |
| 662 | Ga0207698_10032710 | 3300026142 | Bacteria | 3771 |
| 663 | Ga0207698_10079185 | 3300026142 | Unclassified | 2642 |
| 664 | Ga0207428_10245351 | 3300027907 | Unclassified | 1337 |
| 665 | Ga0265356_1000006 | 3300028017 | Bacteria | 35167 |
| 666 | Ga0268266_10050004 | 3300028379 | Bacteria | 3585 |
| 667 | Ga0268266_10050535 | 3300028379 | Bacteria | 3567 |
| 668 | Ga0268266_10069817 | 3300028379 | Bacteria | 3045 |
| 669 | Ga0268266_10088314 | 3300028379 | Bacteria | 2713 |
| 670 | Ga0268266_11264965 | 3300028379 | Unclassified | 713 |
| 671 | Ga0268265_10005701 | 3300028380 | Bacteria | 8504 |
| 672 | Ga0268265_10012748 | 3300028380 | Bacteria | 5707 |
| 673 | Ga0268265_10223790 | 3300028380 | Bacteria | 1648 |
| 674 | Ga0268265_10288733 | 3300028380 | Bacteria | 1471 |
| 675 | Ga0268264_10011053 | 3300028381 | Bacteria | 7455 |
| 676 | Ga0268264_10069283 | 3300028381 | Bacteria | 2983 |
| 677 | Ga0268264_10171653 | 3300028381 | Bacteria | 1962 |
| 678 | Ga0268264_10465218 | 3300028381 | Bacteria | 1227 |
| 679 | Ga0268264_10869768 | 3300028381 | Bacteria | 903 |
| 680 | Ga0265338_10036612 | 3300028800 | Bacteria | 4692 |
| 681 | Ga0265338_10051576 | 3300028800 | Bacteria | 3702 |
| 682 | Ga0265338_10094089 | 3300028800 | Unclassified | 2466 |
| 683 | Ga0265770_1001275 | 3300030878 | Unclassified | 3484 |
| 684 | Ga0265760_10000622 | 3300031090 | Bacteria | 10039 |
| 685 | Ga0265760_10001888 | 3300031090 | Bacteria | 6142 |
| 686 | Ga0265760_10002340 | 3300031090 | Bacteria | 5537 |
| 687 | Ga0265760_10007244 | 3300031090 | Bacteria | 3177 |
| 688 | Ga0265325_10065780 | 3300031241 | Bacteria | 1830 |
| 689 | Ga0265339_10013023 | 3300031249 | Bacteria | 5056 |
| 690 | Ga0265339_10019669 | 3300031249 | Bacteria | 3960 |
| 691 | Ga0265339_10031617 | 3300031249 | Bacteria | 2990 |
| 692 | Ga0265339_10083270 | 3300031249 | Bacteria | 1687 |
| 693 | Ga0265316_10195426 | 3300031344 | Bacteria | 1501 |
| 694 | Ga0265342_10020058 | 3300031712 | Bacteria | 4297 |
| 695 | Ga0373930_0011324 | 3300034816 | Bacteria | 1609 |
| 696 | Ga0373938_0027380 | 3300034957 | Unclassified | 1199 |
| 697 | Ga0373926_0042254 | 3300035083 | Bacteria | 1630 |
| 698 | Ga0373926_0115545 | 3300035083 | Bacteria | 1010 |
| 699 | Ga0373934_0035890 | 3300035086 | Unclassified | 1952 |
| 700 | Ga0373934_0037519 | 3300035086 | Bacteria | 1908 |
| 701 | Ga0373934_0139551 | 3300035086 | Unclassified | 991 |
| 702 | Ga0373934_0198388 | 3300035086 | Bacteria | 826 |
| 703 | Ga0373944_0039275 | 3300035089 | Unclassified | 1457 |
| 704 | Ga0373949_0009318 | 3300035090 | Bacteria | 2151 |
| 705 | Ga0373923_0069131 | 3300035111 | Bacteria | 1514 |
| 706 | Ga0373936_0000770 | 3300035113 | Bacteria | 11281 |
| 707 | Ga0373936_0137084 | 3300035113 | Bacteria | 1055 |
| 708 | Ga0373939_0024544 | 3300035114 | Bacteria | 1681 |
| 709 | Ga0373945_0003039 | 3300035116 | Bacteria | 5275 |
| 710 | Ga0373945_0211573 | 3300035116 | Unclassified | 808 |
| 711 | Ga0373954_0026327 | 3300035118 | Bacteria | 2666 |
| 712 | Ga0373954_0065508 | 3300035118 | Bacteria | 1720 |
| 713 | Ga0373954_0159359 | 3300035118 | Bacteria | 1104 |
| 714 | Ga0373954_0242338 | 3300035118 | Bacteria | 887 |
| 715 | Ga0373956_0041444 | 3300035119 | Bacteria | 2044 |
| 716 | Ga0373957_0069858 | 3300035120 | Bacteria | 1372 |
| 717 | Ga0373960_0034554 | 3300035121 | Unclassified | 1431 |
| 718 | Ga0373943_0000323 | 3300035170 | Bacteria | 20010 |
| 719 | Ga0373943_0186401 | 3300035170 | Unclassified | 1143 |
| 720 | Ga0373946_0325296 | 3300035171 | Bacteria | 765 |
| 721 | Ga0373955_0026383 | 3300035172 | Bacteria | 2992 |
| 722 | Ga0373955_0072427 | 3300035172 | Bacteria | 1930 |
| 723 | Ga0373955_0183559 | 3300035172 | Bacteria | 1242 |
| 724 | Ga0373962_0097598 | 3300035242 | Unclassified | 913 |
| 725 | Ga0373931_0025376 | 3300035691 | Bacteria | 3010 |
| 726 | Ga0373931_0121206 | 3300035691 | Bacteria | 1495 |
| 727 | Ga0373935_0001708 | 3300035692 | Bacteria | 12282 |
| 728 | Ga0373935_0020435 | 3300035692 | Bacteria | 4046 |
| 729 | Ga0373927_0000273 | 3300035695 | Bacteria | 40643 |
| 730 | Ga0373927_0000335 | 3300035695 | Bacteria | 36911 |
| 731 | Ga0373927_0001148 | 3300035695 | Bacteria | 20042 |
| 732 | Ga0373927_0002182 | 3300035695 | Bacteria | 14382 |
| 733 | Ga0373927_0009881 | 3300035695 | Bacteria | 6397 |
| 734 | Ga0373927_0103657 | 3300035695 | Bacteria | 1851 |
| 735 | Ga0373933_0027662 | 3300035724 | Bacteria | 3267 |
| 736 | Ga0373933_0223538 | 3300035724 | Bacteria | 1208 |
| 737 | Ga0373933_0453891 | 3300035724 | Bacteria | 838 |
| 738 | Ga0373947_0001524 | 3300035725 | Bacteria | 14206 |
| 739 | Ga0373947_0005592 | 3300035725 | Bacteria | 7329 |
| 740 | Ga0373937_0027621 | 3300036401 | Bacteria | 5133 |
| 741 | Ga0373937_0036572 | 3300036401 | Bacteria | 4475 |
| 742 | Ga0373937_0038116 | 3300036401 | Bacteria | 4381 |
| 743 | Ga0373937_0053502 | 3300036401 | Bacteria | 3703 |
| 744 | Ga0373937_0135841 | 3300036401 | Unclassified | 2299 |
| 745 | Ga0373937_0136128 | 3300036401 | Bacteria | 2297 |
| 746 | Ga0373937_0250515 | 3300036401 | Bacteria | 1670 |
| 747 | Ga0373937_0323608 | 3300036401 | Bacteria | 1459 |
| 748 | Ga0373925_0000437 | 3300037068 | Bacteria | 42142 |
| 749 | Ga0373925_0002175 | 3300037068 | Bacteria | 15972 |
| 750 | Ga0373925_0010338 | 3300037068 | Bacteria | 6771 |
| 751 | Ga0373925_0019946 | 3300037068 | Bacteria | 4877 |
| 752 | Ga0395901_0360092 | 3300038443 | Unclassified | 1500 |
| 753 | Ga0436365_1783947 | 3300039437 | Bacteria | 2225 |
| 754 | Ga0436360_0877677 | 3300039438 | Bacteria | 2035 |
| 755 | Ga0436362_0854104 | 3300039453 | Bacteria | 3262 |
| 756 | Ga0451577_0351781 | 3300042876 | Unclassified | 1337 |
| 757 | Ga0466963_0078731 | 3300044694 | Bacteria | 2229 |
| 758 | Ga0466963_0869940 | 3300044694 | Bacteria | 635 |
| 759 | Ga0466964_0191289 | 3300044706 | Unclassified | 977 |
| 760 | Ga0466968_0310734 | 3300044735 | Bacteria | 760 |
| 761 | Ga0451576_0331150 | 3300045051 | Unclassified | 1594 |
| 762 | Ga0466967_0171779 | 3300045976 | Bacteria | 2040 |
| 763 | Ga0495592_0077196 | 3300046454 | Bacteria | 2415 |
| 764 | Ga0495592_0102205 | 3300046454 | Bacteria | 2041 |
| 765 | Ga0495629_0020687 | 3300046459 | Bacteria | 4699 |
| 766 | Ga0495629_0101921 | 3300046459 | Bacteria | 2003 |
| 767 | Ga0495651_0058336 | 3300046462 | Bacteria | 2962 |
| 768 | Ga0495653_0050649 | 3300046463 | Bacteria | 3193 |
| 769 | Ga0495653_0141102 | 3300046463 | Bacteria | 1694 |
| 770 | Ga0495580_0005752 | 3300046472 | Bacteria | 10184 |
| 771 | Ga0495580_0008789 | 3300046472 | Bacteria | 7997 |
| 772 | Ga0495580_0011178 | 3300046472 | Bacteria | 6950 |
| 773 | Ga0495580_0020647 | 3300046472 | Bacteria | 4872 |
| 774 | Ga0495580_0050519 | 3300046472 | Unclassified | 2940 |
| 775 | Ga0495580_0066173 | 3300046472 | Bacteria | 2530 |
| 776 | Ga0495580_0080381 | 3300046472 | Unclassified | 2273 |
| 777 | Ga0495580_0092156 | 3300046472 | Bacteria | 2109 |
| 778 | Ga0495580_0183209 | 3300046472 | Bacteria | 1446 |
| 779 | Ga0495580_0239267 | 3300046472 | Bacteria | 1245 |
| 780 | Ga0495580_0254716 | 3300046472 | Bacteria | 1201 |
| 781 | Ga0495580_0413911 | 3300046472 | Bacteria | 908 |
| 782 | Ga0495580_0599603 | 3300046472 | Bacteria | 728 |
| 783 | Ga0495582_0009060 | 3300046473 | Bacteria | 5492 |
| 784 | Ga0495582_0134171 | 3300046473 | Bacteria | 1400 |
| 785 | Ga0495582_0174739 | 3300046473 | Bacteria | 1223 |
| 786 | Ga0495639_0020359 | 3300046475 | Bacteria | 2900 |
| 787 | Ga0495664_0025498 | 3300046477 | Bacteria | 3442 |
| 788 | Ga0495608_0006025 | 3300046511 | Bacteria | 8617 |
| 789 | Ga0495608_0115636 | 3300046511 | Bacteria | 1722 |
| 790 | Ga0495618_0045897 | 3300046514 | Bacteria | 2757 |
| 791 | Ga0495618_0057687 | 3300046514 | Bacteria | 2459 |
| 792 | Ga0495618_0331969 | 3300046514 | Bacteria | 940 |
| 793 | Ga0495628_0145955 | 3300046516 | Bacteria | 1804 |
| 794 | Ga0495630_0034467 | 3300046517 | Bacteria | 3780 |
| 795 | Ga0495630_0194930 | 3300046517 | Bacteria | 1546 |
| 796 | Ga0495630_0250659 | 3300046517 | Bacteria | 1353 |
| 797 | Ga0495630_0299879 | 3300046517 | Bacteria | 1228 |
| 798 | Ga0495652_0131089 | 3300046529 | Bacteria | 1984 |
| 799 | Ga0495587_0069881 | 3300046536 | Bacteria | 2044 |
| 800 | Ga0495645_0009103 | 3300046543 | Bacteria | 6937 |
| 801 | Ga0495645_0250305 | 3300046543 | Bacteria | 1178 |
| 802 | Ga0495667_0000663 | 3300046559 | Bacteria | 21978 |
| 803 | Ga0495667_0075729 | 3300046559 | Bacteria | 2189 |
| 804 | Ga0495667_0188806 | 3300046559 | Bacteria | 1321 |
| 805 | Ga0495634_0072092 | 3300046642 | Bacteria | 2272 |
| 806 | Ga0495635_0237145 | 3300046663 | Bacteria | 1231 |
| 807 | Ga0495657_0377219 | 3300046675 | Unclassified | 837 |
| 808 | Ga0495599_0084665 | 3300046678 | Bacteria | 1980 |
| 809 | Ga0495599_0093551 | 3300046678 | Bacteria | 1875 |
| 810 | Ga0495623_0049909 | 3300046679 | Bacteria | 2651 |
| 811 | Ga0495669_0124623 | 3300046684 | Bacteria | 1210 |
| 812 | Ga0495613_0021825 | 3300046689 | Bacteria | 4772 |
| 813 | Ga0495613_0025959 | 3300046689 | Bacteria | 4365 |
| 814 | Ga0495613_0051848 | 3300046689 | Bacteria | 3023 |
| 815 | Ga0495670_0184425 | 3300046691 | Unclassified | 1103 |
| 816 | Ga0495600_0134006 | 3300046809 | Bacteria | 1609 |
| 817 | Ga0495581_0118536 | 3300047315 | Bacteria | 1540 |
| 818 | Ga0495604_0062911 | 3300047317 | Bacteria | 2833 |
| 819 | Ga0495636_0248677 | 3300047318 | Bacteria | 822 |
| 820 | Ga0495674_0046621 | 3300047319 | Bacteria | 3846 |
| 821 | Ga0495674_0110276 | 3300047319 | Bacteria | 2334 |
| 822 | Ga0495674_0144808 | 3300047319 | Bacteria | 1995 |
| 823 | Ga0495674_0226102 | 3300047319 | Bacteria | 1546 |
| 824 | Ga0495674_0276818 | 3300047319 | Bacteria | 1376 |
| 825 | Ga0495674_0473841 | 3300047319 | Bacteria | 1004 |
| 826 | Ga0495674_0677222 | 3300047319 | Unclassified | 811 |
| 827 | Ga0495680_0120821 | 3300047322 | Bacteria | 1934 |
| 828 | Ga0495680_0247049 | 3300047322 | Bacteria | 1266 |
| 829 | Ga0495675_0256846 | 3300047444 | Unclassified | 1048 |
| 830 | Ga0495684_0019426 | 3300047471 | Bacteria | 5232 |
| 831 | Ga0495684_0029371 | 3300047471 | Bacteria | 4220 |
| 832 | Ga0495684_0082474 | 3300047471 | Bacteria | 2439 |
| 833 | Ga0495684_0119835 | 3300047471 | Bacteria | 1983 |
| 834 | Ga0495684_0138962 | 3300047471 | Unclassified | 1822 |
| 835 | Ga0495593_0328313 | 3300047673 | Bacteria | 765 |
| 836 | Ga0495602_0146753 | 3300048088 | Bacteria | 1860 |
| 837 | Ga0496102_0209997 | 3300048905 | Unclassified | 1836 |
| 838 | Ga0496102_0349841 | 3300048905 | Unclassified | 1391 |
| 839 | Ga0496104_0052215 | 3300048907 | Bacteria | 3861 |
| 840 | Ga0496104_0297776 | 3300048907 | Unclassified | 1525 |
| 841 | Ga0496104_1165578 | 3300048907 | Unclassified | 674 |
| 842 | Ga0496105_0516060 | 3300048908 | Unclassified | 936 |
| 843 | Ga0496106_0171176 | 3300048909 | Unclassified | 1721 |
| 844 | Ga0496106_0179448 | 3300048909 | Unclassified | 1681 |
| 845 | Ga0496106_0411945 | 3300048909 | Unclassified | 1086 |
| 846 | Ga0496108_0000263 | 3300048911 | Bacteria | 45358 |
| 847 | Ga0496108_0539259 | 3300048911 | Unclassified | 1018 |
| 848 | Ga0496109_0000335 | 3300048912 | Bacteria | 43760 |
| 849 | Ga0496109_0520684 | 3300048912 | Unclassified | 1122 |
| 850 | Ga0496110_0001842 | 3300048913 | Bacteria | 15640 |
| 851 | Ga0496110_0143507 | 3300048913 | Bacteria | 2159 |
| 852 | Ga0496110_0495410 | 3300048913 | Unclassified | 1113 |
| 853 | Ga0496111_0009746 | 3300048914 | Bacteria | 6421 |
| 854 | Ga0496112_0005770 | 3300048915 | Bacteria | 10768 |
| 855 | Ga0496112_0006803 | 3300048915 | Bacteria | 10076 |
| 856 | Ga0496112_0007995 | 3300048915 | Bacteria | 9433 |
| 857 | Ga0496112_0041497 | 3300048915 | Bacteria | 4503 |
| 858 | Ga0496112_0087916 | 3300048915 | Unclassified | 3075 |
| 859 | Ga0496112_0340791 | 3300048915 | Unclassified | 1442 |
| 860 | Ga0496112_0848973 | 3300048915 | Unclassified | 837 |
| 861 | Ga0496114_0602577 | 3300048917 | Bacteria | 969 |
| 862 | Ga0496114_1001922 | 3300048917 | Unclassified | 719 |
| 863 | Ga0496115_0023064 | 3300048918 | Bacteria | 4828 |
| 864 | Ga0496115_0203166 | 3300048918 | Unclassified | 1637 |
| 865 | Ga0501032_0001129 | 3300049569 | Bacteria | 21346 |
| 866 | Ga0501033_0003504 | 3300049570 | Bacteria | 12863 |
| 867 | Ga0501034_0152142 | 3300049571 | Bacteria | 2289 |
| 868 | Ga0501036_0000754 | 3300049572 | Bacteria | 23971 |
| 869 | Ga0501037_0002378 | 3300049573 | Bacteria | 13582 |
| 870 | Ga0501038_0003812 | 3300049574 | Bacteria | 14019 |
| 871 | Ga0501039_0003317 | 3300049575 | Bacteria | 12041 |
| 872 | Ga0501043_0008597 | 3300049579 | Bacteria | 8047 |
| 873 | Ga0501046_0002933 | 3300049580 | Bacteria | 15779 |
| 874 | Ga0501047_0013786 | 3300049581 | Bacteria | 7677 |
| 875 | Ga0501048_0050348 | 3300049582 | Bacteria | 2967 |
| 876 | Ga0501067_0004070 | 3300049583 | Bacteria | 8065 |
| 877 | Ga0501068_0001857 | 3300049584 | Bacteria | 11215 |
| 878 | Ga0501069_0002347 | 3300049585 | Bacteria | 9584 |
| 879 | Ga0501070_0006464 | 3300049586 | Bacteria | 9976 |
| 880 | Ga0501072_0000214 | 3300049588 | Bacteria | 42273 |
| 881 | Ga0501076_0012013 | 3300049592 | Bacteria | 6470 |
| 882 | Ga0501077_0110769 | 3300049593 | Bacteria | 1739 |
| 883 | Ga0501079_0003914 | 3300049741 | Bacteria | 10998 |
| 884 | Ga0501080_0000221 | 3300049742 | Bacteria | 42495 |
| 885 | Ga0501083_0000648 | 3300049744 | Bacteria | 22482 |
| 886 | Ga0501035_0013979 | 3300049822 | Bacteria | 7405 |
| 887 | Ga0501044_0046677 | 3300049823 | Bacteria | 4483 |
| 888 | nmdc:mga05p37_312178_c1 | 3300050507 | Bacteria | 1863 |
| 889 | nmdc:mga05p37_439832_c1 | 3300050507 | Unclassified | 1513 |
| 890 | nmdc:mga05p37_513611_c1 | 3300050507 | Bacteria | 1372 |
| 891 | nmdc:mga05p37_706370_c1 | 3300050507 | Bacteria | 1119 |
| 892 | nmdc:mga09592_244939_c1 | 3300050508 | Bacteria | 1554 |
| 893 | nmdc:mga06r32_10940_c1 | 3300050510 | Bacteria | 8171 |
| 894 | nmdc:mga06r32_17697_c1 | 3300050510 | Bacteria | 6510 |
| 895 | nmdc:mga0n895_2188_c1 | 3300050512 | Bacteria | 15118 |
| 896 | nmdc:mga0n895_26314_c1 | 3300050512 | Bacteria | 5508 |
| 897 | nmdc:mga0n895_77594_c1 | 3300050512 | Bacteria | 3305 |
| 898 | nmdc:mga0n895_869486_c1 | 3300050512 | Unclassified | 888 |
| 899 | nmdc:mga0rr50_200_c1 | 3300050513 | Bacteria | 32649 |
| 900 | nmdc:mga0rr50_289710_c1 | 3300050513 | Bacteria | 1368 |
| 901 | nmdc:mga08x19_149004_c1 | 3300050514 | Unclassified | 1583 |
| 902 | nmdc:mga08x19_22033_c1 | 3300050514 | Bacteria | 3941 |
| 903 | nmdc:mga08x19_303703_c1 | 3300050514 | Unclassified | 1109 |
| 904 | nmdc:mga08x19_30597_c1 | 3300050514 | Bacteria | 3383 |
| 905 | nmdc:mga08x19_335347_c1 | 3300050514 | Unclassified | 1054 |
| 906 | nmdc:mga08x19_487963_c1 | 3300050514 | Bacteria | 869 |
| 907 | nmdc:mga08x19_716862_c1 | 3300050514 | Bacteria | 710 |
| 908 | nmdc:mga0a205_23670_c1 | 3300050515 | Bacteria | 5825 |
| 909 | nmdc:mga0a205_3819_c1 | 3300050515 | Bacteria | 13499 |
| 910 | Ga0495601_0017381 | 3300053077 | Bacteria | 4365 |
| 911 | Ga0495619_0359827 | 3300053085 | Unclassified | 1006 |
| 912 | Ga0500590_140892 | 3300053148 | Unclassified | 1102 |
| 913 | Ga0501084_0001446 | 3300054114 | Bacteria | 18876 |
| 914 | Ga0501082_0020856 | 3300060353 | Bacteria | 5652 |
| 915 | Ga0105248_10390882 | |||
| 916 | MRS1b_contig_6517721 | |||
| 917 | MRS1b_contig_8438256 | |||
| 918 | LJNas_1000010 | |||
| 919 | JGI24034J26672_10044796 | |||
| 920 | JGI24751J29686_10006045 | |||
| 921 | Ga0065712_10070525 | |||
| 922 | Ga0065712_10076384 | |||
| 923 | Ga0065712_10093513 | |||
| 924 | Ga0065715_10002194 | |||
| 925 | Ga0065715_10108929 | |||
| 926 | Ga0065715_10376653 | |||
| 927 | Ga0070676_10037577 | |||
| 928 | Ga0070683_100004020 | |||
| 929 | Ga0070683_100097881 | |||
| 930 | Ga0070683_100119003 | |||
| 931 | Ga0070690_100012290 | |||
| 932 | Ga0070690_100014122 | |||
| 933 | Ga0070690_100020132 | |||
| 934 | Ga0070690_100036378 | |||
| 935 | Ga0070670_100004616 | |||
| 936 | Ga0070670_100025077 | |||
| 937 | Ga0068869_100008217 | |||
| 938 | Ga0068869_100045320 | |||
| 939 | Ga0068869_100161096 | |||
| 940 | Ga0070666_10005814 | |||
| 941 | Ga0070666_10011999 | |||
| 942 | Ga0070666_10024461 | |||
| 943 | Ga0070666_10149141 | |||
| 944 | Ga0070666_10422200 | |||
| 945 | Ga0070680_100007894 | |||
| 946 | Ga0070682_100243831 | |||
| 947 | Ga0068868_100002730 | |||
| 948 | Ga0068868_100004230 | |||
| 949 | Ga0068868_100048577 | |||
| 950 | Ga0068868_100050312 | |||
| 951 | Ga0068868_100095207 | |||
| 952 | Ga0068868_100154257 | |||
| 953 | Ga0070660_100019812 | |||
| 954 | Ga0070660_100023246 | |||
| 955 | Ga0070660_100078038 | |||
| 956 | Ga0070689_100001637 | |||
| 957 | Ga0070689_100071971 | |||
| 958 | Ga0070689_100155927 | |||
| 959 | Ga0070689_100174466 | |||
| 960 | Ga0070661_100010317 | |||
| 961 | Ga0070661_100022211 | |||
| 962 | Ga0070661_100089269 | |||
| 963 | Ga0070661_100219582 | |||
| 964 | Ga0070668_100002463 | |||
| 965 | Ga0070668_100177754 | |||
| 966 | Ga0070669_100099928 | |||
| 967 | Ga0070669_100120651 | |||
| 968 | Ga0070669_100738018 | |||
| 969 | Ga0070675_100061022 | |||
| 970 | Ga0070675_100158461 | |||
| 971 | Ga0070675_100181054 | |||
| 972 | Ga0070671_100005001 | |||
| 973 | Ga0070671_100061036 | |||
| 974 | Ga0070671_100107982 | |||
| 975 | Ga0070671_100176122 | |||
| 976 | Ga0070671_100182997 | |||
| 977 | Ga0070671_100290945 | |||
| 978 | Ga0070674_100279204 | |||
| 979 | Ga0070674_100625135 | |||
| 980 | Ga0070673_100005076 | |||
| 981 | Ga0070673_100021628 | |||
| 982 | Ga0070673_100021778 | |||
| 983 | Ga0070673_100055165 | |||
| 984 | Ga0070688_100036830 | |||
| 985 | Ga0070688_100176824 | |||
| 986 | Ga0070688_100226971 | |||
| 987 | Ga0070688_100503156 | |||
| 988 | Ga0070659_100007534 | |||
| 989 | Ga0070659_100021419 | |||
| 990 | Ga0070659_100202275 | |||
| 991 | Ga0070667_100022767 | |||
| 992 | Ga0070667_100062042 | |||
| 993 | Ga0070667_100101238 | |||
| 994 | Ga0070667_100152532 | |||
| 995 | Ga0070667_100319732 | |||
| 996 | Ga0070667_100392214 | |||
| 997 | Ga0070667_100529964 | |||
| 998 | Ga0070703_10230232 | |||
| 999 | Ga0070709_10005256 | |||
| 1000 | Ga0070709_10068914 | |||
| 1001 | Ga0070709_10086425 | |||
| 1002 | Ga0070709_10104834 | |||
| 1003 | Ga0070709_10158271 | |||
| 1004 | Ga0070714_100000154 | |||
| 1005 | Ga0070714_100014696 | |||
| 1006 | Ga0070714_100027108 | |||
| 1007 | Ga0070714_100316375 | |||
| 1008 | Ga0070713_100000113 | |||
| 1009 | Ga0070713_100001107 | |||
| 1010 | Ga0070713_100028357 | |||
| 1011 | Ga0070713_100054750 | |||
| 1012 | Ga0070713_100116004 | |||
| 1013 | Ga0070713_100166614 | |||
| 1014 | Ga0070713_100187135 | |||
| 1015 | Ga0070713_100245151 | |||
| 1016 | Ga0070713_100418775 | |||
| 1017 | Ga0070713_100475560 | |||
| 1018 | Ga0070710_10002900 | |||
| 1019 | Ga0070710_10020263 | |||
| 1020 | Ga0070710_10105331 | |||
| 1021 | Ga0070710_10284963 | |||
| 1022 | Ga0070710_10465882 | |||
| 1023 | Ga0070701_10374133 | |||
| 1024 | Ga0070711_100000518 | |||
| 1025 | Ga0070711_100036457 | |||
| 1026 | Ga0070711_100052613 | |||
| 1027 | Ga0070711_100079101 | |||
| 1028 | Ga0070711_100093292 | |||
| 1029 | Ga0070711_100160669 | |||
| 1030 | Ga0070711_100240593 | |||
| 1031 | Ga0070711_100629105 | |||
| 1032 | Ga0070705_100609020 | |||
| 1033 | Ga0070700_100151157 | |||
| 1034 | Ga0070694_100074203 | |||
| 1035 | Ga0070694_100128165 | |||
| 1036 | Ga0070694_100446273 | |||
| 1037 | Ga0070708_100000099 | |||
| 1038 | Ga0070708_100004535 | |||
| 1039 | Ga0070708_100025278 | |||
| 1040 | Ga0070708_100028665 | |||
| 1041 | Ga0070708_100071955 | |||
| 1042 | Ga0070708_100134515 | |||
| 1043 | Ga0070708_100223332 | |||
| 1044 | Ga0070708_100268748 | |||
| 1045 | Ga0070708_100272971 | |||
| 1046 | Ga0070708_100292362 | |||
| 1047 | Ga0070708_100423769 | |||
| 1048 | Ga0070663_100008619 | |||
| 1049 | Ga0070663_100019001 | |||
| 1050 | Ga0070663_100219080 | |||
| 1051 | Ga0070678_100022384 | |||
| 1052 | Ga0070678_100024025 | |||
| 1053 | Ga0070678_100291682 | |||
| 1054 | Ga0070662_100020306 | |||
| 1055 | Ga0070662_100032687 | |||
| 1056 | Ga0070681_10009604 | |||
| 1057 | Ga0070681_10035376 | |||
| 1058 | Ga0070681_10087011 | |||
| 1059 | Ga0068867_100055666 | |||
| 1060 | Ga0068867_100235414 | |||
| 1061 | Ga0070685_10019143 | |||
| 1062 | Ga0070685_10021175 | |||
| 1063 | Ga0070706_100001042 | |||
| 1064 | Ga0070706_100002036 | |||
| 1065 | Ga0070706_100008125 | |||
| 1066 | Ga0070706_100008677 | |||
| 1067 | Ga0070706_100057976 | |||
| 1068 | Ga0070706_100199503 | |||
| 1069 | Ga0070707_100000091 | |||
| 1070 | Ga0070707_100003096 | |||
| 1071 | Ga0070707_100054061 | |||
| 1072 | Ga0070707_100108792 | |||
| 1073 | Ga0070707_100196197 | |||
| 1074 | Ga0070707_100337319 | |||
| 1075 | Ga0070707_100399233 | |||
| 1076 | Ga0070707_100747235 | |||
| 1077 | Ga0070698_100000027 | |||
| 1078 | Ga0070698_100000226 | |||
| 1079 | Ga0070698_100122458 | |||
| 1080 | Ga0070698_100216600 | |||
| 1081 | Ga0070698_100331080 | |||
| 1082 | Ga0070699_100000032 | |||
| 1083 | Ga0070699_100000596 | |||
| 1084 | Ga0070699_100063471 | |||
| 1085 | Ga0070699_100066289 | |||
| 1086 | Ga0070699_100072639 | |||
| 1087 | Ga0070699_100285893 | |||
| 1088 | Ga0070699_100331042 | |||
| 1089 | Ga0070699_100416876 | |||
| 1090 | Ga0070699_100862540 | |||
| 1091 | Ga0070679_100024956 | |||
| 1092 | Ga0070679_100228329 | |||
| 1093 | Ga0070679_101001077 | |||
| 1094 | Ga0070684_100001953 | |||
| 1095 | Ga0070684_100131410 | |||
| 1096 | Ga0070697_100000138 | |||
| 1097 | Ga0070697_100000183 | |||
| 1098 | Ga0070697_100001597 | |||
| 1099 | Ga0070697_100006896 | |||
| 1100 | Ga0070697_100097899 | |||
| 1101 | Ga0070697_100109784 | |||
| 1102 | Ga0070697_100243357 | |||
| 1103 | Ga0070697_100246908 | |||
| 1104 | Ga0070697_100337956 | |||
| 1105 | Ga0070697_100355654 | |||
| 1106 | Ga0070697_100504710 | |||
| 1107 | Ga0070697_100706355 | |||
| 1108 | Ga0070697_100805050 | |||
| 1109 | Ga0070697_100831641 | |||
| 1110 | Ga0068853_100014401 | |||
| 1111 | Ga0068853_100272099 | |||
| 1112 | Ga0070672_100023560 | |||
| 1113 | Ga0070672_100089711 | |||
| 1114 | Ga0070672_100308914 | |||
| 1115 | Ga0070672_100589763 | |||
| 1116 | Ga0070686_100025998 | |||
| 1117 | Ga0070686_100026312 | |||
| 1118 | Ga0070686_100281512 | |||
| 1119 | Ga0070695_100032117 | |||
| 1120 | Ga0070695_100349364 | |||
| 1121 | Ga0070696_100010145 | |||
| 1122 | Ga0070696_100101579 | |||
| 1123 | Ga0070696_100333499 | |||
| 1124 | Ga0070665_100125904 | |||
| 1125 | Ga0070704_100194220 | |||
| 1126 | Ga0070704_100257009 | |||
| 1127 | Ga0068855_100167120 | |||
| 1128 | Ga0068855_100379071 | |||
| 1129 | Ga0068855_100475745 | |||
| 1130 | Ga0068855_100568379 | |||
| 1131 | Ga0068855_101379485 | |||
| 1132 | Ga0070664_100016901 | |||
| 1133 | Ga0070664_100034964 | |||
| 1134 | Ga0070664_100040838 | |||
| 1135 | Ga0070664_100096808 | |||
| 1136 | Ga0070664_100103748 | |||
| 1137 | Ga0068857_100001007 | |||
| 1138 | Ga0068857_100155788 | |||
| 1139 | Ga0068854_100009000 | |||
| 1140 | Ga0068854_100552493 | |||
| 1141 | Ga0068854_100575049 | |||
| 1142 | Ga0068856_100003228 | |||
| 1143 | Ga0068856_100037382 | |||
| 1144 | Ga0068856_100656784 | |||
| 1145 | Ga0070702_100232499 | |||
| 1146 | Ga0068852_100140721 | |||
| 1147 | Ga0068859_100017542 | |||
| 1148 | Ga0068859_100024153 | |||
| 1149 | Ga0068859_100088929 | |||
| 1150 | Ga0068859_100129490 | |||
| 1151 | Ga0068859_100470042 | |||
| 1152 | Ga0068864_100001748 | |||
| 1153 | Ga0068864_100003558 | |||
| 1154 | Ga0068864_100116776 | |||
| 1155 | Ga0068864_100206520 | |||
| 1156 | Ga0068866_10004179 | |||
| 1157 | Ga0068866_10036868 | |||
| 1158 | Ga0068866_10250763 | |||
| 1159 | Ga0068866_10285464 | |||
| 1160 | Ga0068861_100095056 | |||
| 1161 | Ga0068861_100117068 | |||
| 1162 | Ga0068861_101047477 | |||
| 1163 | Ga0068861_101071754 | |||
| 1164 | Ga0068851_10005986 | |||
| 1165 | Ga0068851_10045532 | |||
| 1166 | Ga0068851_10165938 | |||
| 1167 | Ga0068870_10001845 | |||
| 1168 | Ga0068863_100052570 | |||
| 1169 | Ga0068863_100077719 | |||
| 1170 | Ga0068863_100079878 | |||
| 1171 | Ga0068863_100100511 | |||
| 1172 | Ga0068863_100128873 | |||
| 1173 | Ga0068863_100133484 | |||
| 1174 | Ga0068863_100203970 | |||
| 1175 | Ga0068863_100509016 | |||
| 1176 | Ga0068858_100007549 | |||
| 1177 | Ga0068858_100008063 | |||
| 1178 | Ga0068858_100026960 | |||
| 1179 | Ga0068858_100033742 | |||
| 1180 | Ga0068858_100188509 | |||
| 1181 | Ga0068858_100350200 | |||
| 1182 | Ga0068858_101090390 | |||
| 1183 | Ga0068860_100052411 | |||
| 1184 | Ga0068860_100085034 | |||
| 1185 | Ga0068860_100242505 | |||
| 1186 | Ga0068860_100277897 | |||
| 1187 | Ga0068860_100495500 | |||
| 1188 | Ga0068860_100747616 | |||
| 1189 | Ga0068860_100892720 | |||
| 1190 | Ga0068862_100115775 | |||
| 1191 | Ga0068862_100129096 | |||
| 1192 | Ga0068862_100129916 | |||
| 1193 | Ga0068862_100184867 | |||
| 1194 | Ga0081540_1080668 | |||
| 1195 | Ga0070717_10001985 | |||
| 1196 | Ga0070717_10003732 | |||
| 1197 | Ga0070717_10006318 | |||
| 1198 | Ga0070717_10011594 | |||
| 1199 | Ga0070717_10043883 | |||
| 1200 | Ga0070717_10085648 | |||
| 1201 | Ga0070717_10102159 | |||
| 1202 | Ga0070717_10109553 | |||
| 1203 | Ga0070717_10121331 | |||
| 1204 | Ga0070717_10168489 | |||
| 1205 | Ga0070717_10245937 | |||
| 1206 | Ga0070717_10247196 | |||
| 1207 | Ga0075432_10058786 | |||
| 1208 | Ga0070715_10090134 | |||
| 1209 | Ga0070715_10105159 | |||
| 1210 | Ga0070716_100001153 | |||
| 1211 | Ga0070716_100013225 | |||
| 1212 | Ga0070716_100022336 | |||
| 1213 | Ga0070716_100039054 | |||
| 1214 | Ga0070716_100045076 | |||
| 1215 | Ga0070716_100061888 | |||
| 1216 | Ga0070712_100000084 | |||
| 1217 | Ga0070712_100001699 | |||
| 1218 | Ga0070712_100003995 | |||
| 1219 | Ga0070712_100010243 | |||
| 1220 | Ga0070712_100014090 | |||
| 1221 | Ga0070712_100019456 | |||
| 1222 | Ga0070712_100156160 | |||
| 1223 | Ga0097621_100001499 | |||
| 1224 | Ga0097621_100069967 | |||
| 1225 | Ga0097621_100158073 | |||
| 1226 | Ga0097621_100379393 | |||
| 1227 | Ga0097621_100504247 | |||
| 1228 | Ga0097621_100736710 | |||
| 1229 | Ga0068871_100001120 | |||
| 1230 | Ga0068871_100004299 | |||
| 1231 | Ga0068871_100024370 | |||
| 1232 | Ga0068871_100071731 | |||
| 1233 | Ga0068871_100174829 | |||
| 1234 | Ga0068871_100277077 | |||
| 1235 | Ga0068871_100281635 | |||
| 1236 | Ga0068871_100376477 | |||
| 1237 | Ga0075428_100036657 | |||
| 1238 | Ga0075428_100370504 | |||
| 1239 | Ga0075430_100081009 | |||
| 1240 | Ga0075430_100341607 | |||
| 1241 | Ga0075431_100056694 | |||
| 1242 | Ga0075431_100255783 | |||
| 1243 | Ga0075433_10000915 | |||
| 1244 | Ga0075433_10133239 | |||
| 1245 | Ga0075434_100003011 | |||
| 1246 | Ga0075434_100010220 | |||
| 1247 | Ga0075434_100083762 | |||
| 1248 | Ga0075434_100600380 | |||
| 1249 | Ga0075429_100043479 | |||
| 1250 | Ga0068865_100043579 | |||
| 1251 | Ga0075436_100097592 | |||
| 1252 | Ga0075436_100168172 | |||
| 1253 | Ga0075436_100170566 | |||
| 1254 | Ga0075436_100312223 | |||
| 1255 | Ga0075436_100378719 | |||
| 1256 | Ga0097620_100017540 | |||
| 1257 | Ga0097620_100024152 | |||
| 1258 | Ga0097620_100088927 | |||
| 1259 | Ga0097620_100129485 | |||
| 1260 | Ga0097620_100469973 | |||
| 1261 | Ga0075435_100003469 | |||
| 1262 | Ga0075435_100228782 | |||
| 1263 | Ga0099795_10007298 | |||
| 1264 | Ga0105240_10010282 | |||
| 1265 | Ga0105240_10117089 | |||
| 1266 | Ga0105245_10012108 | |||
| 1267 | Ga0105245_10043787 | |||
| 1268 | Ga0105245_10061874 | |||
| 1269 | Ga0105245_10160874 | |||
| 1270 | Ga0105245_10264545 | |||
| 1271 | Ga0105245_10539964 | |||
| 1272 | Ga0105245_10588541 | |||
| 1273 | Ga0105245_11375257 | |||
| 1274 | Ga0105247_10004098 | |||
| 1275 | Ga0105247_10212007 | |||
| 1276 | Ga0105247_10288190 | |||
| 1277 | Ga0114129_10136377 | |||
| 1278 | Ga0114129_10449175 | |||
| 1279 | Ga0114129_10507253 | |||
| 1280 | Ga0105243_10171929 | |||
| 1281 | Ga0105241_10105681 | |||
| 1282 | Ga0105241_10191403 | |||
| 1283 | Ga0105241_10299681 | |||
| 1284 | Ga0105242_10016725 | |||
| 1285 | Ga0105242_10027045 | |||
| 1286 | Ga0105242_10211299 | |||
| 1287 | Ga0105248_10021115 | |||
| 1288 | Ga0105248_10036094 | |||
| 1289 | Ga0105248_10046481 | |||
| 1290 | Ga0105248_10413213 | |||
| 1291 | Ga0105237_10104531 | |||
| 1292 | Ga0105237_10122797 | |||
| 1293 | Ga0105237_10188665 | |||
| 1294 | Ga0105237_10729868 | |||
| 1295 | Ga0105238_10058932 | |||
| 1296 | Ga0099796_10034057 | |||
| 1297 | Ga0105239_10050506 | |||
| 1298 | Ga0105239_10073126 | |||
| 1299 | Ga0105246_10008349 | |||
| 1300 | Ga0105246_10021673 | |||
| 1301 | Ga0157373_10006716 | |||
| 1302 | Ga0157373_10107330 | |||
| 1303 | Ga0157371_10024120 | |||
| 1304 | Ga0157369_10062711 | |||
| 1305 | Ga0157369_10257041 | |||
| 1306 | Ga0157369_10512768 | |||
| 1307 | Ga0157369_11130270 | |||
| 1308 | Ga0157374_10007435 | |||
| 1309 | Ga0157374_10042686 | |||
| 1310 | Ga0157374_10069516 | |||
| 1311 | Ga0157374_10071771 | |||
| 1312 | Ga0157374_10196080 | |||
| 1313 | Ga0157374_10269530 | |||
| 1314 | Ga0157378_10000260 | |||
| 1315 | Ga0157378_10046181 | |||
| 1316 | Ga0157378_10130437 | |||
| 1317 | Ga0157378_10187882 | |||
| 1318 | Ga0157378_10240843 | |||
| 1319 | Ga0163162_10001932 | |||
| 1320 | Ga0163162_10004945 | |||
| 1321 | Ga0163162_10042940 | |||
| 1322 | Ga0163162_10063886 | |||
| 1323 | Ga0163162_10172110 | |||
| 1324 | Ga0163162_10208818 | |||
| 1325 | Ga0163162_10284173 | |||
| 1326 | Ga0163162_11763615 | |||
| 1327 | Ga0157372_10004647 | |||
| 1328 | Ga0157372_10047804 | |||
| 1329 | Ga0157372_10222059 | |||
| 1330 | Ga0157375_10035315 | |||
| 1331 | Ga0157375_10081068 | |||
| 1332 | Ga0157375_10082002 | |||
| 1333 | Ga0157375_10104676 | |||
| 1334 | Ga0163163_10001699 | |||
| 1335 | Ga0163163_10002554 | |||
| 1336 | Ga0163163_10151736 | |||
| 1337 | Ga0163163_10154514 | |||
| 1338 | Ga0163163_10167677 | |||
| 1339 | Ga0163163_10170869 | |||
| 1340 | Ga0163163_10190926 | |||
| 1341 | Ga0163163_10447693 | |||
| 1342 | Ga0157377_10025486 | |||
| 1343 | Ga0157379_10005151 | |||
| 1344 | Ga0157379_10033615 | |||
| 1345 | Ga0157379_10066847 | |||
| 1346 | Ga0157379_10077259 | |||
| 1347 | Ga0157379_10101130 | |||
| 1348 | Ga0157379_10121252 | |||
| 1349 | Ga0157379_10151006 | |||
| 1350 | Ga0157376_10008851 | |||
| 1351 | Ga0157376_10057820 | |||
| 1352 | Ga0157376_10096830 | |||
| 1353 | Ga0157376_10154354 | |||
| 1354 | Ga0157376_10154536 | |||
| 1355 | Ga0157376_10212995 | |||
| 1356 | Ga0157376_10277365 | |||
| 1357 | Ga0157376_10350778 | |||
| 1358 | Ga0157376_10701447 | |||
| 1359 | Ga0157376_10868047 | |||
| 1360 | Ga0182006_1070676 | |||
| 1361 | Ga0163161_10261359 | |||
| 1362 | Ga0163161_10269753 | |||
| 1363 | Ga0163161_10556258 | |||
| 1364 | Ga0224569_100779 | |||
| 1365 | Ga0224572_1000884 | |||
| 1366 | Ga0224572_1004713 | |||
| 1367 | Ga0228598_1006514 | |||
| 1368 | Ga0228598_1010228 | |||
| 1369 | Ga0207697_10037918 | |||
| 1370 | Ga0207656_10055118 | |||
| 1371 | Ga0207656_10058157 | |||
| 1372 | Ga0207692_10015262 | |||
| 1373 | Ga0207692_10023268 | |||
| 1374 | Ga0207692_10026324 | |||
| 1375 | Ga0207692_10090908 | |||
| 1376 | Ga0207642_10025069 | |||
| 1377 | Ga0207642_10061421 | |||
| 1378 | Ga0207710_10142186 | |||
| 1379 | Ga0207680_10012846 | |||
| 1380 | Ga0207680_10014376 | |||
| 1381 | Ga0207680_10286242 | |||
| 1382 | Ga0207647_10005231 | |||
| 1383 | Ga0207647_10108544 | |||
| 1384 | Ga0207647_10190844 | |||
| 1385 | Ga0207685_10035384 | |||
| 1386 | Ga0207685_10048327 | |||
| 1387 | Ga0207699_10008583 | |||
| 1388 | Ga0207699_10024378 | |||
| 1389 | Ga0207699_10082667 | |||
| 1390 | Ga0207699_10126698 | |||
| 1391 | Ga0207699_10204811 | |||
| 1392 | Ga0207699_10249440 | |||
| 1393 | Ga0207645_10000311 | |||
| 1394 | Ga0207645_10020169 | |||
| 1395 | Ga0207645_10025308 | |||
| 1396 | Ga0207643_10000546 | |||
| 1397 | Ga0207643_10165329 | |||
| 1398 | Ga0207684_10000238 | |||
| 1399 | Ga0207684_10002001 | |||
| 1400 | Ga0207684_10054596 | |||
| 1401 | Ga0207684_10055545 | |||
| 1402 | Ga0207684_10154043 | |||
| 1403 | Ga0207684_10365352 | |||
| 1404 | Ga0207684_10645210 | |||
| 1405 | Ga0207654_10004712 | |||
| 1406 | Ga0207654_10102590 | |||
| 1407 | Ga0207707_10017650 | |||
| 1408 | Ga0207707_10018544 | |||
| 1409 | Ga0207707_10054558 | |||
| 1410 | Ga0207707_10595588 | |||
| 1411 | Ga0207695_10075791 | |||
| 1412 | Ga0207695_10132045 | |||
| 1413 | Ga0207695_10404267 | |||
| 1414 | Ga0207671_10127238 | |||
| 1415 | Ga0207671_10191864 | |||
| 1416 | Ga0207671_10270009 | |||
| 1417 | Ga0207693_10000015 | |||
| 1418 | Ga0207693_10000517 | |||
| 1419 | Ga0207693_10001987 | |||
| 1420 | Ga0207693_10011436 | |||
| 1421 | Ga0207693_10104058 | |||
| 1422 | Ga0207663_10003940 | |||
| 1423 | Ga0207663_10180344 | |||
| 1424 | Ga0207663_10235280 | |||
| 1425 | Ga0207663_10679721 | |||
| 1426 | Ga0207663_10912766 | |||
| 1427 | Ga0207660_10386815 | |||
| 1428 | Ga0207657_10002880 | |||
| 1429 | Ga0207657_10003528 | |||
| 1430 | Ga0207657_10033933 | |||
| 1431 | Ga0207649_10000666 | |||
| 1432 | Ga0207649_10024450 | |||
| 1433 | Ga0207649_10251809 | |||
| 1434 | Ga0207652_10052638 | |||
| 1435 | Ga0207652_10412691 | |||
| 1436 | Ga0207652_10869972 | |||
| 1437 | Ga0207646_10000073 | |||
| 1438 | Ga0207646_10001845 | |||
| 1439 | Ga0207646_10019424 | |||
| 1440 | Ga0207646_10088344 | |||
| 1441 | Ga0207646_10360690 | |||
| 1442 | Ga0207646_10637161 | |||
| 1443 | Ga0207681_10088972 | |||
| 1444 | Ga0207681_10098173 | |||
| 1445 | Ga0207681_10120349 | |||
| 1446 | Ga0207681_10243023 | |||
| 1447 | Ga0207681_10534681 | |||
| 1448 | Ga0207694_10214625 | |||
| 1449 | Ga0207650_10000097 | |||
| 1450 | Ga0207650_10004072 | |||
| 1451 | Ga0207650_10325773 | |||
| 1452 | Ga0207659_10018070 | |||
| 1453 | Ga0207659_10050507 | |||
| 1454 | Ga0207659_10073211 | |||
| 1455 | Ga0207659_10770151 | |||
| 1456 | Ga0207687_10003552 | |||
| 1457 | Ga0207687_10017349 | |||
| 1458 | Ga0207687_10044012 | |||
| 1459 | Ga0207700_10000373 | |||
| 1460 | Ga0207700_10000551 | |||
| 1461 | Ga0207700_10101997 | |||
| 1462 | Ga0207700_10160867 | |||
| 1463 | Ga0207700_10386628 | |||
| 1464 | Ga0207700_10431067 | |||
| 1465 | Ga0207700_10434911 | |||
| 1466 | Ga0207664_10000241 | |||
| 1467 | Ga0207664_10047540 | |||
| 1468 | Ga0207664_10146579 | |||
| 1469 | Ga0207664_10217938 | |||
| 1470 | Ga0207664_10223775 | |||
| 1471 | Ga0207664_10435016 | |||
| 1472 | Ga0207644_10007323 | |||
| 1473 | Ga0207644_10013687 | |||
| 1474 | Ga0207690_10002849 | |||
| 1475 | Ga0207690_10020371 | |||
| 1476 | Ga0207690_10376018 | |||
| 1477 | Ga0207706_10000139 | |||
| 1478 | Ga0207706_10113112 | |||
| 1479 | Ga0207686_10473315 | |||
| 1480 | Ga0207709_10207821 | |||
| 1481 | Ga0207670_10155039 | |||
| 1482 | Ga0207670_10237513 | |||
| 1483 | Ga0207669_10259893 | |||
| 1484 | Ga0207669_10572106 | |||
| 1485 | Ga0207704_10031873 | |||
| 1486 | Ga0207704_10093139 | |||
| 1487 | Ga0207665_10000188 | |||
| 1488 | Ga0207665_10002289 | |||
| 1489 | Ga0207665_10038450 | |||
| 1490 | Ga0207665_10039865 | |||
| 1491 | Ga0207665_10056732 | |||
| 1492 | Ga0207665_10189729 | |||
| 1493 | Ga0207665_10220185 | |||
| 1494 | Ga0207665_10290601 | |||
| 1495 | Ga0207691_10067391 | |||
| 1496 | Ga0207691_10352712 | |||
| 1497 | Ga0207691_10664664 | |||
| 1498 | Ga0207711_10005198 | |||
| 1499 | Ga0207711_10042354 | |||
| 1500 | Ga0207711_10068041 | |||
| 1501 | Ga0207711_10091735 | |||
| 1502 | Ga0207711_10119828 | |||
| 1503 | Ga0207711_10180717 | |||
| 1504 | Ga0207711_10359549 | |||
| 1505 | Ga0207689_10000078 | |||
| 1506 | Ga0207689_10080424 | |||
| 1507 | Ga0207689_10238768 | |||
| 1508 | Ga0207661_10000124 | |||
| 1509 | Ga0207661_10125766 | |||
| 1510 | Ga0207661_10437297 | |||
| 1511 | Ga0207679_10000065 | |||
| 1512 | Ga0207679_10023390 | |||
| 1513 | Ga0207679_10031869 | |||
| 1514 | Ga0207679_10032000 | |||
| 1515 | Ga0207667_10015347 | |||
| 1516 | Ga0207667_10477905 | |||
| 1517 | Ga0207667_10569641 | |||
| 1518 | Ga0207651_10017725 | |||
| 1519 | Ga0207651_10034427 | |||
| 1520 | Ga0207712_10037485 | |||
| 1521 | Ga0207712_10208193 | |||
| 1522 | Ga0207668_10147240 | |||
| 1523 | Ga0207668_10216063 | |||
| 1524 | Ga0207640_10036496 | |||
| 1525 | Ga0207640_10371373 | |||
| 1526 | Ga0207658_10002380 | |||
| 1527 | Ga0207658_10070369 | |||
| 1528 | Ga0207658_10077819 | |||
| 1529 | Ga0207658_10185801 | |||
| 1530 | Ga0207658_10372041 | |||
| 1531 | Ga0207658_10484703 | |||
| 1532 | Ga0207677_10003494 | |||
| 1533 | Ga0207677_10014151 | |||
| 1534 | Ga0207677_10023905 | |||
| 1535 | Ga0207677_10034288 | |||
| 1536 | Ga0207677_10142875 | |||
| 1537 | Ga0207677_10155313 | |||
| 1538 | Ga0207677_10288606 | |||
| 1539 | Ga0207703_10044126 | |||
| 1540 | Ga0207703_10055388 | |||
| 1541 | Ga0207703_10062049 | |||
| 1542 | Ga0207703_10471594 | |||
| 1543 | Ga0207703_10728642 | |||
| 1544 | Ga0207639_10134194 | |||
| 1545 | Ga0207639_10222118 | |||
| 1546 | Ga0207678_10002115 | |||
| 1547 | Ga0207678_10014195 | |||
| 1548 | Ga0207678_10111271 | |||
| 1549 | Ga0207708_10442423 | |||
| 1550 | Ga0207702_10027973 | |||
| 1551 | Ga0207702_10039120 | |||
| 1552 | Ga0207702_10253859 | |||
| 1553 | Ga0207702_10958184 | |||
| 1554 | Ga0207641_10000183 | |||
| 1555 | Ga0207641_10022805 | |||
| 1556 | Ga0207641_10028155 | |||
| 1557 | Ga0207641_10065511 | |||
| 1558 | Ga0207641_10685273 | |||
| 1559 | Ga0207641_10696803 | |||
| 1560 | Ga0207648_10000618 | |||
| 1561 | Ga0207648_10031892 | |||
| 1562 | Ga0207648_10164384 | |||
| 1563 | Ga0207676_10000428 | |||
| 1564 | Ga0207676_10002661 | |||
| 1565 | Ga0207676_10082628 | |||
| 1566 | Ga0207676_10937951 | |||
| 1567 | Ga0207674_10002308 | |||
| 1568 | Ga0207674_10026582 | |||
| 1569 | Ga0207674_10629262 | |||
| 1570 | Ga0207674_11044263 | |||
| 1571 | Ga0207675_100011075 | |||
| 1572 | Ga0207675_100042878 | |||
| 1573 | Ga0207675_100091554 | |||
| 1574 | Ga0207675_100212028 | |||
| 1575 | Ga0207683_10158466 | |||
| 1576 | Ga0207698_10032710 | |||
| 1577 | Ga0207698_10079185 | |||
| 1578 | Ga0207428_10245351 | |||
| 1579 | Ga0265356_1000006 | |||
| 1580 | Ga0268266_10050004 | |||
| 1581 | Ga0268266_10050535 | |||
| 1582 | Ga0268266_10069817 | |||
| 1583 | Ga0268266_10088314 | |||
| 1584 | Ga0268266_11264965 | |||
| 1585 | Ga0268265_10005701 | |||
| 1586 | Ga0268265_10012748 | |||
| 1587 | Ga0268265_10223790 | |||
| 1588 | Ga0268265_10288733 | |||
| 1589 | Ga0268264_10011053 | |||
| 1590 | Ga0268264_10069283 | |||
| 1591 | Ga0268264_10171653 | |||
| 1592 | Ga0268264_10465218 | |||
| 1593 | Ga0268264_10869768 | |||
| 1594 | Ga0265338_10036612 | |||
| 1595 | Ga0265338_10051576 | |||
| 1596 | Ga0265338_10094089 | |||
| 1597 | Ga0265770_1001275 | |||
| 1598 | Ga0265760_10000622 | |||
| 1599 | Ga0265760_10001888 | |||
| 1600 | Ga0265760_10002340 | |||
| 1601 | Ga0265760_10007244 | |||
| 1602 | Ga0265325_10065780 | |||
| 1603 | Ga0265339_10013023 | |||
| 1604 | Ga0265339_10019669 | |||
| 1605 | Ga0265339_10031617 | |||
| 1606 | Ga0265339_10083270 | |||
| 1607 | Ga0265316_10195426 | |||
| 1608 | Ga0265342_10020058 | |||
| 1609 | Ga0373930_0011324 | |||
| 1610 | Ga0373938_0027380 | |||
| 1611 | Ga0373926_0042254 | |||
| 1612 | Ga0373926_0115545 | |||
| 1613 | Ga0373934_0035890 | |||
| 1614 | Ga0373934_0037519 | |||
| 1615 | Ga0373934_0139551 | |||
| 1616 | Ga0373934_0198388 | |||
| 1617 | Ga0373944_0039275 | |||
| 1618 | Ga0373949_0009318 | |||
| 1619 | Ga0373923_0069131 | |||
| 1620 | Ga0373936_0000770 | |||
| 1621 | Ga0373936_0137084 | |||
| 1622 | Ga0373939_0024544 | |||
| 1623 | Ga0373945_0003039 | |||
| 1624 | Ga0373945_0211573 | |||
| 1625 | Ga0373954_0026327 | |||
| 1626 | Ga0373954_0065508 | |||
| 1627 | Ga0373954_0159359 | |||
| 1628 | Ga0373954_0242338 | |||
| 1629 | Ga0373956_0041444 | |||
| 1630 | Ga0373957_0069858 | |||
| 1631 | Ga0373960_0034554 | |||
| 1632 | Ga0373943_0000323 | |||
| 1633 | Ga0373943_0186401 | |||
| 1634 | Ga0373946_0325296 | |||
| 1635 | Ga0373955_0026383 | |||
| 1636 | Ga0373955_0072427 | |||
| 1637 | Ga0373955_0183559 | |||
| 1638 | Ga0373962_0097598 | |||
| 1639 | Ga0373931_0025376 | |||
| 1640 | Ga0373931_0121206 | |||
| 1641 | Ga0373935_0001708 | |||
| 1642 | Ga0373935_0020435 | |||
| 1643 | Ga0373927_0000273 | |||
| 1644 | Ga0373927_0000335 | |||
| 1645 | Ga0373927_0001148 | |||
| 1646 | Ga0373927_0002182 | |||
| 1647 | Ga0373927_0009881 | |||
| 1648 | Ga0373927_0103657 | |||
| 1649 | Ga0373933_0027662 | |||
| 1650 | Ga0373933_0223538 | |||
| 1651 | Ga0373933_0453891 | |||
| 1652 | Ga0373947_0001524 | |||
| 1653 | Ga0373947_0005592 | |||
| 1654 | Ga0373937_0027621 | |||
| 1655 | Ga0373937_0036572 | |||
| 1656 | Ga0373937_0038116 | |||
| 1657 | Ga0373937_0053502 | |||
| 1658 | Ga0373937_0135841 | |||
| 1659 | Ga0373937_0136128 | |||
| 1660 | Ga0373937_0250515 | |||
| 1661 | Ga0373937_0323608 | |||
| 1662 | Ga0373925_0000437 | |||
| 1663 | Ga0373925_0002175 | |||
| 1664 | Ga0373925_0010338 | |||
| 1665 | Ga0373925_0019946 | |||
| 1666 | Ga0395901_0360092 | |||
| 1667 | Ga0436365_1783947 | |||
| 1668 | Ga0436360_0877677 | |||
| 1669 | Ga0436362_0854104 | |||
| 1670 | Ga0451577_0351781 | |||
| 1671 | Ga0466963_0078731 | |||
| 1672 | Ga0466963_0869940 | |||
| 1673 | Ga0466964_0191289 | |||
| 1674 | Ga0466968_0310734 | |||
| 1675 | Ga0451576_0331150 | |||
| 1676 | Ga0466967_0171779 | |||
| 1677 | Ga0495592_0077196 | |||
| 1678 | Ga0495592_0102205 | |||
| 1679 | Ga0495629_0020687 | |||
| 1680 | Ga0495629_0101921 | |||
| 1681 | Ga0495651_0058336 | |||
| 1682 | Ga0495653_0050649 | |||
| 1683 | Ga0495653_0141102 | |||
| 1684 | Ga0495580_0005752 | |||
| 1685 | Ga0495580_0008789 | |||
| 1686 | Ga0495580_0011178 | |||
| 1687 | Ga0495580_0020647 | |||
| 1688 | Ga0495580_0050519 | |||
| 1689 | Ga0495580_0066173 | |||
| 1690 | Ga0495580_0080381 | |||
| 1691 | Ga0495580_0092156 | |||
| 1692 | Ga0495580_0183209 | |||
| 1693 | Ga0495580_0239267 | |||
| 1694 | Ga0495580_0254716 | |||
| 1695 | Ga0495580_0413911 | |||
| 1696 | Ga0495580_0599603 | |||
| 1697 | Ga0495582_0009060 | |||
| 1698 | Ga0495582_0134171 | |||
| 1699 | Ga0495582_0174739 | |||
| 1700 | Ga0495639_0020359 | |||
| 1701 | Ga0495664_0025498 | |||
| 1702 | Ga0495608_0006025 | |||
| 1703 | Ga0495608_0115636 | |||
| 1704 | Ga0495618_0045897 | |||
| 1705 | Ga0495618_0057687 | |||
| 1706 | Ga0495618_0331969 | |||
| 1707 | Ga0495628_0145955 | |||
| 1708 | Ga0495630_0034467 | |||
| 1709 | Ga0495630_0194930 | |||
| 1710 | Ga0495630_0250659 | |||
| 1711 | Ga0495630_0299879 | |||
| 1712 | Ga0495652_0131089 | |||
| 1713 | Ga0495587_0069881 | |||
| 1714 | Ga0495645_0009103 | |||
| 1715 | Ga0495645_0250305 | |||
| 1716 | Ga0495667_0000663 | |||
| 1717 | Ga0495667_0075729 | |||
| 1718 | Ga0495667_0188806 | |||
| 1719 | Ga0495634_0072092 | |||
| 1720 | Ga0495635_0237145 | |||
| 1721 | Ga0495657_0377219 | |||
| 1722 | Ga0495599_0084665 | |||
| 1723 | Ga0495599_0093551 | |||
| 1724 | Ga0495623_0049909 | |||
| 1725 | Ga0495669_0124623 | |||
| 1726 | Ga0495613_0021825 | |||
| 1727 | Ga0495613_0025959 | |||
| 1728 | Ga0495613_0051848 | |||
| 1729 | Ga0495670_0184425 | |||
| 1730 | Ga0495600_0134006 | |||
| 1731 | Ga0495581_0118536 | |||
| 1732 | Ga0495604_0062911 | |||
| 1733 | Ga0495636_0248677 | |||
| 1734 | Ga0495674_0046621 | |||
| 1735 | Ga0495674_0110276 | |||
| 1736 | Ga0495674_0144808 | |||
| 1737 | Ga0495674_0226102 | |||
| 1738 | Ga0495674_0276818 | |||
| 1739 | Ga0495674_0473841 | |||
| 1740 | Ga0495674_0677222 | |||
| 1741 | Ga0495680_0120821 | |||
| 1742 | Ga0495680_0247049 | |||
| 1743 | Ga0495675_0256846 | |||
| 1744 | Ga0495684_0019426 | |||
| 1745 | Ga0495684_0029371 | |||
| 1746 | Ga0495684_0082474 | |||
| 1747 | Ga0495684_0119835 | |||
| 1748 | Ga0495684_0138962 | |||
| 1749 | Ga0495593_0328313 | |||
| 1750 | Ga0495602_0146753 | |||
| 1751 | Ga0496102_0209997 | |||
| 1752 | Ga0496102_0349841 | |||
| 1753 | Ga0496104_0052215 | |||
| 1754 | Ga0496104_0297776 | |||
| 1755 | Ga0496104_1165578 | |||
| 1756 | Ga0496105_0516060 | |||
| 1757 | Ga0496106_0171176 | |||
| 1758 | Ga0496106_0179448 | |||
| 1759 | Ga0496106_0411945 | |||
| 1760 | Ga0496108_0000263 | |||
| 1761 | Ga0496108_0539259 | |||
| 1762 | Ga0496109_0000335 | |||
| 1763 | Ga0496109_0520684 | |||
| 1764 | Ga0496110_0001842 | |||
| 1765 | Ga0496110_0143507 | |||
| 1766 | Ga0496110_0495410 | |||
| 1767 | Ga0496111_0009746 | |||
| 1768 | Ga0496112_0005770 | |||
| 1769 | Ga0496112_0006803 | |||
| 1770 | Ga0496112_0007995 | |||
| 1771 | Ga0496112_0041497 | |||
| 1772 | Ga0496112_0087916 | |||
| 1773 | Ga0496112_0340791 | |||
| 1774 | Ga0496112_0848973 | |||
| 1775 | Ga0496114_0602577 | |||
| 1776 | Ga0496114_1001922 | |||
| 1777 | Ga0496115_0023064 | |||
| 1778 | Ga0496115_0203166 | |||
| 1779 | Ga0501032_0001129 | |||
| 1780 | Ga0501033_0003504 | |||
| 1781 | Ga0501034_0152142 | |||
| 1782 | Ga0501036_0000754 | |||
| 1783 | Ga0501037_0002378 | |||
| 1784 | Ga0501038_0003812 | |||
| 1785 | Ga0501039_0003317 | |||
| 1786 | Ga0501043_0008597 | |||
| 1787 | Ga0501046_0002933 | |||
| 1788 | Ga0501047_0013786 | |||
| 1789 | Ga0501048_0050348 | |||
| 1790 | Ga0501067_0004070 | |||
| 1791 | Ga0501068_0001857 | |||
| 1792 | Ga0501069_0002347 | |||
| 1793 | Ga0501070_0006464 | |||
| 1794 | Ga0501072_0000214 | |||
| 1795 | Ga0501076_0012013 | |||
| 1796 | Ga0501077_0110769 | |||
| 1797 | Ga0501079_0003914 | |||
| 1798 | Ga0501080_0000221 | |||
| 1799 | Ga0501083_0000648 | |||
| 1800 | Ga0501035_0013979 | |||
| 1801 | Ga0501044_0046677 | |||
| 1802 | nmdc:mga05p37_312178_c1 | |||
| 1803 | nmdc:mga05p37_439832_c1 | |||
| 1804 | nmdc:mga05p37_513611_c1 | |||
| 1805 | nmdc:mga05p37_706370_c1 | |||
| 1806 | nmdc:mga09592_244939_c1 | |||
| 1807 | nmdc:mga06r32_10940_c1 | |||
| 1808 | nmdc:mga06r32_17697_c1 | |||
| 1809 | nmdc:mga0n895_2188_c1 | |||
| 1810 | nmdc:mga0n895_26314_c1 | |||
| 1811 | nmdc:mga0n895_77594_c1 | |||
| 1812 | nmdc:mga0n895_869486_c1 | |||
| 1813 | nmdc:mga0rr50_200_c1 | |||
| 1814 | nmdc:mga0rr50_289710_c1 | |||
| 1815 | nmdc:mga08x19_149004_c1 | |||
| 1816 | nmdc:mga08x19_22033_c1 | |||
| 1817 | nmdc:mga08x19_303703_c1 | |||
| 1818 | nmdc:mga08x19_30597_c1 | |||
| 1819 | nmdc:mga08x19_335347_c1 | |||
| 1820 | nmdc:mga08x19_487963_c1 | |||
| 1821 | nmdc:mga08x19_716862_c1 | |||
| 1822 | nmdc:mga0a205_23670_c1 | |||
| 1823 | nmdc:mga0a205_3819_c1 | |||
| 1824 | Ga0495601_0017381 | |||
| 1825 | Ga0495619_0359827 | |||
| 1826 | Ga0500590_140892 | |||
| 1827 | Ga0501084_0001446 | |||
| 1828 | Ga0501082_0020856 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5lbh-assembly1.cif.gz_A | crystal structure of helicobacter cinaedi caip | 0.9007 | 54 | 108 |
| 6zw4-assembly1.cif.gz_A | c14 symmetry: bacterial vipp1 and pspa are members of the ancient escrt-iii membrane-remodeling superfamily. | 0.8748 | 27 | 153 |
| 6zw5-assembly1.cif.gz_A | c15 symmetry: bacterial vipp1 and pspa are members of the ancient escrt-iii membrane-remodeling superfamily. | 0.8742 | 27 | 153 |
| 6zw6-assembly1.cif.gz_A | c16 symmetry: bacterial vipp1 and pspa are members of the ancient escrt-iii membrane-remodeling superfamily. | 0.8662 | 27 | 153 |
| 6zvt-assembly1.cif.gz_A | c13 symmetry: bacterial vipp1 and pspa are members of the ancient escrt-iii membrane-remodeling superfamily. | 0.8623 | 27 | 153 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58144_7_159_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9305 | 57 | 116 | 1.20.1260.10 |
| af_Q58156_13_77_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9131 | 54 | 109 | 1.20.1260.10 |
| af_Q9NAD6_1_199_1.20.1050.20 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2;STAT transcription factor, all-alpha domain | 0.8821 | 33 | 125 | 1.20.1050.20 |
| af_Q9VGQ8_135_333_1.20.1270.60 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain | 0.8357 | 28 | 129 | 1.20.1270.60 |
| 1i4dA00 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain | 0.8323 | 28 | 134 | 1.20.1270.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I7QX39-F1-model_v4 | PspA/IM30 family protein | 0.9762 | 25 | 138 |
|
| AF-A0A524E8G4-F1-model_v4 | Serine--tRNA ligase | 0.9572 | 25 | 137 |
|
| AF-A0A7S0Y0P3-F1-model_v4 | Uncharacterized protein | 0.9487 | 28 | 137 |
|
| AF-A0A552F735-F1-model_v4 | PspA/IM30 family protein | 0.9456 | 33 | 136 |
|
| AF-A0A5E4NTE7-F1-model_v4 | PspA/IM30 family protein | 0.9245 | 26 | 138 |
|