F485565

General Info

Members Datasets Scaffolds Average Seq Length
914 314 1828 210

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10390882|Ga0105248_103908821
Length 229
Sequence MALLERVSTLVRANLNDLVDRAEDPEKMLKQVILDMQNQLLQVKTQVAIAIADQHVLAKKRTEHEDKASEWSRRAELAVDKKEDDLARAALEKSIAFKRMAGGFAEQVSDQVVQVENLKQALRNLEGKLAEAQAKVDLLVAQHRRARAVGKAADIGLKVNDPDPQAAFDRMNNKVVYGEAVSRAKTELLGENMEDRLARLEKQDEIERLLAEIKAKKSFQPRINENKQE

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
123 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
124 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
194 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
197 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
198 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
199 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
200 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
201 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
202 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
203 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
204 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
205 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
206 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
208 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
209 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
210 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
211 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
212 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
213 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
216 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
217 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
218 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
219 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
221 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
222 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
223 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
227 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
228 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
229 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
230 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
231 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
232 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
233 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
234 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
235 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
236 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
237 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
238 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
239 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
240 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
241 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
242 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
243 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
244 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
245 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
246 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
247 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
248 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
249 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
250 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
251 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
252 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
253 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
254 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
255 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
256 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
257 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
258 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
259 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
260 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
261 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
262 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
263 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
264 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
265 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
266 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
267 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
268 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
269 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
270 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
271 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
277 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
278 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
279 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
280 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
292 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
293 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
294 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
295 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
296 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
297 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
298 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
299 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
300 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
301 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
303 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
304 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
305 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
306 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
307 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
308 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
309 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
310 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
311 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
312 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
313 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
314 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.45
Metatranscriptomes 0.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0
Rhizoplane 3.06
Rhizosphere 96.72
Stem 0
Stem Tuber 0
Unclassified 18.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10390882 3300009177 Bacteria 1566
2 MRS1b_contig_6517721 2162886011 Bacteria 1472
3 MRS1b_contig_8438256 2162886011 Bacteria 1328
4 LJNas_1000010 3300000546 Bacteria 24841
5 JGI24034J26672_10044796 3300002239 Bacteria 750
6 JGI24751J29686_10006045 3300002459 Bacteria 2464
7 Ga0065712_10070525 3300005290 Bacteria 5928
8 Ga0065712_10076384 3300005290 Bacteria 3672
9 Ga0065712_10093513 3300005290 Bacteria 2288
10 Ga0065715_10002194 3300005293 Bacteria 6608
11 Ga0065715_10108929 3300005293 Bacteria 2694
12 Ga0065715_10376653 3300005293 Unclassified 913
13 Ga0070676_10037577 3300005328 Bacteria 2793
14 Ga0070683_100004020 3300005329 Bacteria 12043
15 Ga0070683_100097881 3300005329 Bacteria 2760
16 Ga0070683_100119003 3300005329 Bacteria 2494
17 Ga0070690_100012290 3300005330 Bacteria 5037
18 Ga0070690_100014122 3300005330 Bacteria 4734
19 Ga0070690_100020132 3300005330 Bacteria 4061
20 Ga0070690_100036378 3300005330 Bacteria 3094
21 Ga0070670_100004616 3300005331 Bacteria 11557
22 Ga0070670_100025077 3300005331 Bacteria 5130
23 Ga0068869_100008217 3300005334 Bacteria 6715
24 Ga0068869_100045320 3300005334 Bacteria 3165
25 Ga0068869_100161096 3300005334 Bacteria 1747
26 Ga0070666_10005814 3300005335 Bacteria 7579
27 Ga0070666_10011999 3300005335 Bacteria 5453
28 Ga0070666_10024461 3300005335 Bacteria 3934
29 Ga0070666_10149141 3300005335 Bacteria 1631
30 Ga0070666_10422200 3300005335 Unclassified 960
31 Ga0070680_100007894 3300005336 Bacteria 8116
32 Ga0070682_100243831 3300005337 Bacteria 1291
33 Ga0068868_100002730 3300005338 Bacteria 12227
34 Ga0068868_100004230 3300005338 Bacteria 10040
35 Ga0068868_100048577 3300005338 Bacteria 3328
36 Ga0068868_100050312 3300005338 Bacteria 3272
37 Ga0068868_100095207 3300005338 Bacteria 2403
38 Ga0068868_100154257 3300005338 Bacteria 1893
39 Ga0070660_100019812 3300005339 Unclassified 4935
40 Ga0070660_100023246 3300005339 Bacteria 4592
41 Ga0070660_100078038 3300005339 Bacteria 2596
42 Ga0070689_100001637 3300005340 Bacteria 14324
43 Ga0070689_100071971 3300005340 Bacteria 2702
44 Ga0070689_100155927 3300005340 Bacteria 1843
45 Ga0070689_100174466 3300005340 Bacteria 1743
46 Ga0070661_100010317 3300005344 Bacteria 6494
47 Ga0070661_100022211 3300005344 Bacteria 4541
48 Ga0070661_100089269 3300005344 Unclassified 2282
49 Ga0070661_100219582 3300005344 Bacteria 1458
50 Ga0070668_100002463 3300005347 Bacteria 13629
51 Ga0070668_100177754 3300005347 Unclassified 1737
52 Ga0070669_100099928 3300005353 Bacteria 2187
53 Ga0070669_100120651 3300005353 Bacteria 2000
54 Ga0070669_100738018 3300005353 Bacteria 834
55 Ga0070675_100061022 3300005354 Unclassified 3113
56 Ga0070675_100158461 3300005354 Bacteria 1945
57 Ga0070675_100181054 3300005354 Bacteria 1822
58 Ga0070671_100005001 3300005355 Bacteria 10564
59 Ga0070671_100061036 3300005355 Bacteria 3139
60 Ga0070671_100107982 3300005355 Bacteria 2337
61 Ga0070671_100176122 3300005355 Bacteria 1810
62 Ga0070671_100182997 3300005355 Bacteria 1774
63 Ga0070671_100290945 3300005355 Bacteria 1390
64 Ga0070674_100279204 3300005356 Bacteria 1323
65 Ga0070674_100625135 3300005356 Unclassified 913
66 Ga0070673_100005076 3300005364 Bacteria 8398
67 Ga0070673_100021628 3300005364 Bacteria 4668
68 Ga0070673_100021778 3300005364 Bacteria 4656
69 Ga0070673_100055165 3300005364 Bacteria 3130
70 Ga0070688_100036830 3300005365 Bacteria 2978
71 Ga0070688_100176824 3300005365 Unclassified 1477
72 Ga0070688_100226971 3300005365 Bacteria 1319
73 Ga0070688_100503156 3300005365 Unclassified 914
74 Ga0070659_100007534 3300005366 Bacteria 7909
75 Ga0070659_100021419 3300005366 Bacteria 4923
76 Ga0070659_100202275 3300005366 Unclassified 1635
77 Ga0070667_100022767 3300005367 Bacteria 5195
78 Ga0070667_100062042 3300005367 Unclassified 3166
79 Ga0070667_100101238 3300005367 Bacteria 2488
80 Ga0070667_100152532 3300005367 Bacteria 2030
81 Ga0070667_100319732 3300005367 Unclassified 1400
82 Ga0070667_100392214 3300005367 Bacteria 1262
83 Ga0070667_100529964 3300005367 Bacteria 1081
84 Ga0070703_10230232 3300005406 Viruses 742
85 Ga0070709_10005256 3300005434 Bacteria 7006
86 Ga0070709_10068914 3300005434 Bacteria 2277
87 Ga0070709_10086425 3300005434 Unclassified 2059
88 Ga0070709_10104834 3300005434 Unclassified 1890
89 Ga0070709_10158271 3300005434 Bacteria 1572
90 Ga0070714_100000154 3300005435 Bacteria 55244
91 Ga0070714_100014696 3300005435 Bacteria 6291
92 Ga0070714_100027108 3300005435 Bacteria 4741
93 Ga0070714_100316375 3300005435 Bacteria 1459
94 Ga0070713_100000113 3300005436 Bacteria 52925
95 Ga0070713_100001107 3300005436 Bacteria 17171
96 Ga0070713_100028357 3300005436 Bacteria 4421
97 Ga0070713_100054750 3300005436 Bacteria 3311
98 Ga0070713_100116004 3300005436 Bacteria 2341
99 Ga0070713_100166614 3300005436 Bacteria 1971
100 Ga0070713_100187135 3300005436 Bacteria 1864
101 Ga0070713_100245151 3300005436 Bacteria 1633
102 Ga0070713_100418775 3300005436 Bacteria 1254
103 Ga0070713_100475560 3300005436 Bacteria 1176
104 Ga0070710_10002900 3300005437 Bacteria 8164
105 Ga0070710_10020263 3300005437 Bacteria 3448
106 Ga0070710_10105331 3300005437 Bacteria 1686
107 Ga0070710_10284963 3300005437 Unclassified 1073
108 Ga0070710_10465882 3300005437 Bacteria 859
109 Ga0070701_10374133 3300005438 Unclassified 896
110 Ga0070711_100000518 3300005439 Bacteria 20014
111 Ga0070711_100036457 3300005439 Bacteria 3294
112 Ga0070711_100052613 3300005439 Bacteria 2803
113 Ga0070711_100079101 3300005439 Bacteria 2338
114 Ga0070711_100093292 3300005439 Bacteria 2173
115 Ga0070711_100160669 3300005439 Bacteria 1703
116 Ga0070711_100240593 3300005439 Unclassified 1415
117 Ga0070711_100629105 3300005439 Bacteria 898
118 Ga0070705_100609020 3300005440 Unclassified 846
119 Ga0070700_100151157 3300005441 Unclassified 1588
120 Ga0070694_100074203 3300005444 Bacteria 2351
121 Ga0070694_100128165 3300005444 Bacteria 1830
122 Ga0070694_100446273 3300005444 Bacteria 1021
123 Ga0070708_100000099 3300005445 Bacteria 56982
124 Ga0070708_100004535 3300005445 Bacteria 10936
125 Ga0070708_100025278 3300005445 Bacteria 5076
126 Ga0070708_100028665 3300005445 Unclassified 4794
127 Ga0070708_100071955 3300005445 Unclassified 3114
128 Ga0070708_100134515 3300005445 Bacteria 2289
129 Ga0070708_100223332 3300005445 Unclassified 1767
130 Ga0070708_100268748 3300005445 Bacteria 1604
131 Ga0070708_100272971 3300005445 Bacteria 1591
132 Ga0070708_100292362 3300005445 Unclassified 1534
133 Ga0070708_100423769 3300005445 Bacteria 1255
134 Ga0070663_100008619 3300005455 Bacteria 6284
135 Ga0070663_100019001 3300005455 Bacteria 4519
136 Ga0070663_100219080 3300005455 Bacteria 1493
137 Ga0070678_100022384 3300005456 Bacteria 4187
138 Ga0070678_100024025 3300005456 Bacteria 4072
139 Ga0070678_100291682 3300005456 Unclassified 1383
140 Ga0070662_100020306 3300005457 Bacteria 4522
141 Ga0070662_100032687 3300005457 Bacteria 3657
142 Ga0070681_10009604 3300005458 Bacteria 9513
143 Ga0070681_10035376 3300005458 Bacteria 5017
144 Ga0070681_10087011 3300005458 Bacteria 3078
145 Ga0068867_100055666 3300005459 Bacteria 2925
146 Ga0068867_100235414 3300005459 Bacteria 1482
147 Ga0070685_10019143 3300005466 Unclassified 3691
148 Ga0070685_10021175 3300005466 Bacteria 3531
149 Ga0070706_100001042 3300005467 Bacteria 30061
150 Ga0070706_100002036 3300005467 Bacteria 20720
151 Ga0070706_100008125 3300005467 Bacteria 9786
152 Ga0070706_100008677 3300005467 Bacteria 9473
153 Ga0070706_100057976 3300005467 Bacteria 3574
154 Ga0070706_100199503 3300005467 Bacteria 1869
155 Ga0070707_100000091 3300005468 Bacteria 81794
156 Ga0070707_100003096 3300005468 Bacteria 15744
157 Ga0070707_100054061 3300005468 Unclassified 3849
158 Ga0070707_100108792 3300005468 Plasmid 2688
159 Ga0070707_100196197 3300005468 Bacteria 1968
160 Ga0070707_100337319 3300005468 Unclassified 1465
161 Ga0070707_100399233 3300005468 Bacteria 1335
162 Ga0070707_100747235 3300005468 Bacteria 941
163 Ga0070698_100000027 3300005471 Bacteria 98052
164 Ga0070698_100000226 3300005471 Bacteria 55431
165 Ga0070698_100122458 3300005471 Bacteria 2559
166 Ga0070698_100216600 3300005471 Bacteria 1849
167 Ga0070698_100331080 3300005471 Bacteria 1454
168 Ga0070699_100000032 3300005518 Bacteria 136937
169 Ga0070699_100000596 3300005518 Bacteria 34077
170 Ga0070699_100063471 3300005518 Bacteria 3203
171 Ga0070699_100066289 3300005518 Unclassified 3134
172 Ga0070699_100072639 3300005518 Bacteria 2993
173 Ga0070699_100285893 3300005518 Bacteria 1478
174 Ga0070699_100331042 3300005518 Unclassified 1370
175 Ga0070699_100416876 3300005518 Bacteria 1215
176 Ga0070699_100862540 3300005518 Bacteria 829
177 Ga0070679_100024956 3300005530 Bacteria 5860
178 Ga0070679_100228329 3300005530 Bacteria 1821
179 Ga0070679_101001077 3300005530 Unclassified 780
180 Ga0070684_100001953 3300005535 Bacteria 15127
181 Ga0070684_100131410 3300005535 Bacteria 2259
182 Ga0070697_100000138 3300005536 Bacteria 58927
183 Ga0070697_100000183 3300005536 Bacteria 51905
184 Ga0070697_100001597 3300005536 Bacteria 17280
185 Ga0070697_100006896 3300005536 Bacteria 8827
186 Ga0070697_100097899 3300005536 Unclassified 2435
187 Ga0070697_100109784 3300005536 Bacteria 2297
188 Ga0070697_100243357 3300005536 Unclassified 1536
189 Ga0070697_100246908 3300005536 Bacteria 1526
190 Ga0070697_100337956 3300005536 Bacteria 1299
191 Ga0070697_100355654 3300005536 Unclassified 1265
192 Ga0070697_100504710 3300005536 Unclassified 1058
193 Ga0070697_100706355 3300005536 Bacteria 890
194 Ga0070697_100805050 3300005536 Unclassified 831
195 Ga0070697_100831641 3300005536 Bacteria 818
196 Ga0068853_100014401 3300005539 Bacteria 6475
197 Ga0068853_100272099 3300005539 Bacteria 1560
198 Ga0070672_100023560 3300005543 Unclassified 4540
199 Ga0070672_100089711 3300005543 Bacteria 2477
200 Ga0070672_100308914 3300005543 Bacteria 1342
201 Ga0070672_100589763 3300005543 Unclassified 967
202 Ga0070686_100025998 3300005544 Bacteria 3527
203 Ga0070686_100026312 3300005544 Bacteria 3511
204 Ga0070686_100281512 3300005544 Unclassified 1227
205 Ga0070695_100032117 3300005545 Bacteria 3281
206 Ga0070695_100349364 3300005545 Unclassified 1107
207 Ga0070696_100010145 3300005546 Bacteria 6305
208 Ga0070696_100101579 3300005546 Bacteria 2061
209 Ga0070696_100333499 3300005546 Unclassified 1170
210 Ga0070665_100125904 3300005548 Bacteria 2565
211 Ga0070704_100194220 3300005549 Unclassified 1634
212 Ga0070704_100257009 3300005549 Bacteria 1437
213 Ga0068855_100167120 3300005563 Bacteria 2493
214 Ga0068855_100379071 3300005563 Unclassified 1553
215 Ga0068855_100475745 3300005563 Bacteria 1360
216 Ga0068855_100568379 3300005563 Unclassified 1226
217 Ga0068855_101379485 3300005563 Bacteria 727
218 Ga0070664_100016901 3300005564 Bacteria 5987
219 Ga0070664_100034964 3300005564 Bacteria 4217
220 Ga0070664_100040838 3300005564 Bacteria 3913
221 Ga0070664_100096808 3300005564 Bacteria 2561
222 Ga0070664_100103748 3300005564 Bacteria 2475
223 Ga0068857_100001007 3300005577 Bacteria 21676
224 Ga0068857_100155788 3300005577 Unclassified 2071
225 Ga0068854_100009000 3300005578 Bacteria 6434
226 Ga0068854_100552493 3300005578 Bacteria 977
227 Ga0068854_100575049 3300005578 Bacteria 959
228 Ga0068856_100003228 3300005614 Bacteria 16600
229 Ga0068856_100037382 3300005614 Bacteria 4765
230 Ga0068856_100656784 3300005614 Unclassified 1069
231 Ga0070702_100232499 3300005615 Unclassified 1239
232 Ga0068852_100140721 3300005616 Bacteria 2232
233 Ga0068859_100017542 3300005617 Bacteria 7197
234 Ga0068859_100024153 3300005617 Bacteria 6099
235 Ga0068859_100088929 3300005617 Bacteria 3138
236 Ga0068859_100129490 3300005617 Bacteria 2595
237 Ga0068859_100470042 3300005617 Bacteria 1353
238 Ga0068864_100001748 3300005618 Bacteria 17856
239 Ga0068864_100003558 3300005618 Bacteria 12876
240 Ga0068864_100116776 3300005618 Bacteria 2381
241 Ga0068864_100206520 3300005618 Unclassified 1807
242 Ga0068866_10004179 3300005718 Bacteria 5923
243 Ga0068866_10036868 3300005718 Bacteria 2398
244 Ga0068866_10250763 3300005718 Bacteria 1083
245 Ga0068866_10285464 3300005718 Bacteria 1024
246 Ga0068861_100095056 3300005719 Bacteria 2359
247 Ga0068861_100117068 3300005719 Bacteria 2144
248 Ga0068861_101047477 3300005719 Bacteria 781
249 Ga0068861_101071754 3300005719 Unclassified 773
250 Ga0068851_10005986 3300005834 Bacteria 5538
251 Ga0068851_10045532 3300005834 Bacteria 2218
252 Ga0068851_10165938 3300005834 Bacteria 1216
253 Ga0068870_10001845 3300005840 Bacteria 8714
254 Ga0068863_100052570 3300005841 Bacteria 3860
255 Ga0068863_100077719 3300005841 Bacteria 3141
256 Ga0068863_100079878 3300005841 Bacteria 3098
257 Ga0068863_100100511 3300005841 Bacteria 2749
258 Ga0068863_100128873 3300005841 Bacteria 2415
259 Ga0068863_100133484 3300005841 Bacteria 2371
260 Ga0068863_100203970 3300005841 Bacteria 1903
261 Ga0068863_100509016 3300005841 Bacteria 1186
262 Ga0068858_100007549 3300005842 Bacteria 10509
263 Ga0068858_100008063 3300005842 Bacteria 10144
264 Ga0068858_100026960 3300005842 Bacteria 5337
265 Ga0068858_100033742 3300005842 Bacteria 4747
266 Ga0068858_100188509 3300005842 Unclassified 1949
267 Ga0068858_100350200 3300005842 Bacteria 1415
268 Ga0068858_101090390 3300005842 Bacteria 784
269 Ga0068860_100052411 3300005843 Bacteria 3881
270 Ga0068860_100085034 3300005843 Bacteria 3009
271 Ga0068860_100242505 3300005843 Bacteria 1753
272 Ga0068860_100277897 3300005843 Bacteria 1636
273 Ga0068860_100495500 3300005843 Bacteria 1219
274 Ga0068860_100747616 3300005843 Bacteria 989
275 Ga0068860_100892720 3300005843 Unclassified 905
276 Ga0068862_100115775 3300005844 Bacteria 2358
277 Ga0068862_100129096 3300005844 Unclassified 2234
278 Ga0068862_100129916 3300005844 Bacteria 2227
279 Ga0068862_100184867 3300005844 Bacteria 1872
280 Ga0081540_1080668 3300005983 Bacteria 1466
281 Ga0070717_10001985 3300006028 Bacteria 14304
282 Ga0070717_10003732 3300006028 Bacteria 10941
283 Ga0070717_10006318 3300006028 Bacteria 8706
284 Ga0070717_10011594 3300006028 Bacteria 6701
285 Ga0070717_10043883 3300006028 Bacteria 3650
286 Ga0070717_10085648 3300006028 Bacteria 2652
287 Ga0070717_10102159 3300006028 Bacteria 2436
288 Ga0070717_10109553 3300006028 Unclassified 2354
289 Ga0070717_10121331 3300006028 Unclassified 2239
290 Ga0070717_10168489 3300006028 Bacteria 1904
291 Ga0070717_10245937 3300006028 Unclassified 1579
292 Ga0070717_10247196 3300006028 Bacteria 1575
293 Ga0075432_10058786 3300006058 Unclassified 1366
294 Ga0070715_10090134 3300006163 Unclassified 1409
295 Ga0070715_10105159 3300006163 Bacteria 1323
296 Ga0070716_100001153 3300006173 Bacteria 11654
297 Ga0070716_100013225 3300006173 Bacteria 4203
298 Ga0070716_100022336 3300006173 Bacteria 3343
299 Ga0070716_100039054 3300006173 Bacteria 2632
300 Ga0070716_100045076 3300006173 Bacteria 2474
301 Ga0070716_100061888 3300006173 Bacteria 2168
302 Ga0070712_100000084 3300006175 Bacteria 48408
303 Ga0070712_100001699 3300006175 Bacteria 13489
304 Ga0070712_100003995 3300006175 Bacteria 9066
305 Ga0070712_100010243 3300006175 Bacteria 5911
306 Ga0070712_100014090 3300006175 Bacteria 5127
307 Ga0070712_100019456 3300006175 Bacteria 4429
308 Ga0070712_100156160 3300006175 Bacteria 1757
309 Ga0097621_100001499 3300006237 Bacteria 16025
310 Ga0097621_100069967 3300006237 Bacteria 2897
311 Ga0097621_100158073 3300006237 Unclassified 1947
312 Ga0097621_100379393 3300006237 Bacteria 1262
313 Ga0097621_100504247 3300006237 Unclassified 1096
314 Ga0097621_100736710 3300006237 Unclassified 910
315 Ga0068871_100001120 3300006358 Bacteria 17991
316 Ga0068871_100004299 3300006358 Bacteria 9892
317 Ga0068871_100024370 3300006358 Unclassified 4692
318 Ga0068871_100071731 3300006358 Bacteria 2849
319 Ga0068871_100174829 3300006358 Bacteria 1843
320 Ga0068871_100277077 3300006358 Bacteria 1466
321 Ga0068871_100281635 3300006358 Bacteria 1454
322 Ga0068871_100376477 3300006358 Bacteria 1260
323 Ga0075428_100036657 3300006844 Bacteria 5401
324 Ga0075428_100370504 3300006844 Unclassified 1536
325 Ga0075430_100081009 3300006846 Unclassified 2719
326 Ga0075430_100341607 3300006846 Unclassified 1237
327 Ga0075431_100056694 3300006847 Bacteria 4040
328 Ga0075431_100255783 3300006847 Bacteria 1778
329 Ga0075433_10000915 3300006852 Bacteria 20739
330 Ga0075433_10133239 3300006852 Bacteria 2208
331 Ga0075434_100003011 3300006871 Bacteria 14988
332 Ga0075434_100010220 3300006871 Bacteria 8790
333 Ga0075434_100083762 3300006871 Bacteria 3187
334 Ga0075434_100600380 3300006871 Unclassified 1120
335 Ga0075429_100043479 3300006880 Unclassified 3909
336 Ga0068865_100043579 3300006881 Bacteria 3067
337 Ga0075436_100097592 3300006914 Bacteria 2044
338 Ga0075436_100168172 3300006914 Unclassified 1548
339 Ga0075436_100170566 3300006914 Bacteria 1536
340 Ga0075436_100312223 3300006914 Unclassified 1128
341 Ga0075436_100378719 3300006914 Bacteria 1023
342 Ga0097620_100017540 3300006931 Bacteria 7197
343 Ga0097620_100024152 3300006931 Bacteria 6099
344 Ga0097620_100088927 3300006931 Bacteria 3138
345 Ga0097620_100129485 3300006931 Bacteria 2595
346 Ga0097620_100469973 3300006931 Bacteria 1353
347 Ga0075435_100003469 3300007076 Bacteria 10692
348 Ga0075435_100228782 3300007076 Bacteria 1580
349 Ga0099795_10007298 3300007788 Unclassified 3076
350 Ga0105240_10010282 3300009093 Bacteria 13175
351 Ga0105240_10117089 3300009093 Unclassified 3213
352 Ga0105245_10012108 3300009098 Bacteria 7502
353 Ga0105245_10043787 3300009098 Bacteria 3993
354 Ga0105245_10061874 3300009098 Bacteria 3376
355 Ga0105245_10160874 3300009098 Unclassified 2130
356 Ga0105245_10264545 3300009098 Bacteria 1675
357 Ga0105245_10539964 3300009098 Unclassified 1187
358 Ga0105245_10588541 3300009098 Unclassified 1138
359 Ga0105245_11375257 3300009098 Bacteria 756
360 Ga0105247_10004098 3300009101 Bacteria 9365
361 Ga0105247_10212007 3300009101 Bacteria 1307
362 Ga0105247_10288190 3300009101 Bacteria 1135
363 Ga0114129_10136377 3300009147 Bacteria 3367
364 Ga0114129_10449175 3300009147 Unclassified 1691
365 Ga0114129_10507253 3300009147 Bacteria 1574
366 Ga0105243_10171929 3300009148 Bacteria 1877
367 Ga0105241_10105681 3300009174 Bacteria 2246
368 Ga0105241_10191403 3300009174 Bacteria 1703
369 Ga0105241_10299681 3300009174 Bacteria 1379
370 Ga0105242_10016725 3300009176 Bacteria 5706
371 Ga0105242_10027045 3300009176 Bacteria 4550
372 Ga0105242_10211299 3300009176 Bacteria 1729
373 Ga0105248_10021115 3300009177 Bacteria 7215
374 Ga0105248_10036094 3300009177 Bacteria 5529
375 Ga0105248_10046481 3300009177 Bacteria 4865
376 Ga0105248_10413213 3300009177 Bacteria 1519
377 Ga0105237_10104531 3300009545 Bacteria 2824
378 Ga0105237_10122797 3300009545 Bacteria 2591
379 Ga0105237_10188665 3300009545 Unclassified 2062
380 Ga0105237_10729868 3300009545 Bacteria 997
381 Ga0105238_10058932 3300009551 Bacteria 3848
382 Ga0099796_10034057 3300010159 Bacteria 1680
383 Ga0105239_10050506 3300010375 Bacteria 4561
384 Ga0105239_10073126 3300010375 Bacteria 3769
385 Ga0105246_10008349 3300011119 Bacteria 6361
386 Ga0105246_10021673 3300011119 Bacteria 4137
387 Ga0157373_10006716 3300013100 Bacteria 8566
388 Ga0157373_10107330 3300013100 Bacteria 1963
389 Ga0157371_10024120 3300013102 Bacteria 4443
390 Ga0157369_10062711 3300013105 Unclassified 4005
391 Ga0157369_10257041 3300013105 Bacteria 1822
392 Ga0157369_10512768 3300013105 Bacteria 1241
393 Ga0157369_11130270 3300013105 Bacteria 800
394 Ga0157374_10007435 3300013296 Bacteria 9343
395 Ga0157374_10042686 3300013296 Bacteria 4184
396 Ga0157374_10069516 3300013296 Bacteria 3316
397 Ga0157374_10071771 3300013296 Bacteria 3266
398 Ga0157374_10196080 3300013296 Bacteria 1976
399 Ga0157374_10269530 3300013296 Bacteria 1678
400 Ga0157378_10000260 3300013297 Bacteria 51886
401 Ga0157378_10046181 3300013297 Bacteria 3872
402 Ga0157378_10130437 3300013297 Bacteria 2326
403 Ga0157378_10187882 3300013297 Bacteria 1947
404 Ga0157378_10240843 3300013297 Bacteria 1728
405 Ga0163162_10001932 3300013306 Bacteria 19501
406 Ga0163162_10004945 3300013306 Bacteria 12845
407 Ga0163162_10042940 3300013306 Bacteria 4526
408 Ga0163162_10063886 3300013306 Bacteria 3725
409 Ga0163162_10172110 3300013306 Bacteria 2290
410 Ga0163162_10208818 3300013306 Bacteria 2082
411 Ga0163162_10284173 3300013306 Unclassified 1786
412 Ga0163162_11763615 3300013306 Bacteria 707
413 Ga0157372_10004647 3300013307 Bacteria 14596
414 Ga0157372_10047804 3300013307 Bacteria 4755
415 Ga0157372_10222059 3300013307 Bacteria 2190
416 Ga0157375_10035315 3300013308 Bacteria 4770
417 Ga0157375_10081068 3300013308 Bacteria 3284
418 Ga0157375_10082002 3300013308 Unclassified 3266
419 Ga0157375_10104676 3300013308 Bacteria 2919
420 Ga0163163_10001699 3300014325 Bacteria 18602
421 Ga0163163_10002554 3300014325 Bacteria 15423
422 Ga0163163_10151736 3300014325 Bacteria 2360
423 Ga0163163_10154514 3300014325 Bacteria 2338
424 Ga0163163_10167677 3300014325 Bacteria 2242
425 Ga0163163_10170869 3300014325 Bacteria 2220
426 Ga0163163_10190926 3300014325 Bacteria 2097
427 Ga0163163_10447693 3300014325 Bacteria 1351
428 Ga0157377_10025486 3300014745 Bacteria 3154
429 Ga0157379_10005151 3300014968 Bacteria 11221
430 Ga0157379_10033615 3300014968 Bacteria 4573
431 Ga0157379_10066847 3300014968 Bacteria 3214
432 Ga0157379_10077259 3300014968 Bacteria 2981
433 Ga0157379_10101130 3300014968 Bacteria 2587
434 Ga0157379_10121252 3300014968 Bacteria 2352
435 Ga0157379_10151006 3300014968 Bacteria 2095
436 Ga0157376_10008851 3300014969 Bacteria 7283
437 Ga0157376_10057820 3300014969 Bacteria 3246
438 Ga0157376_10096830 3300014969 Bacteria 2569
439 Ga0157376_10154354 3300014969 Unclassified 2074
440 Ga0157376_10154536 3300014969 Bacteria 2073
441 Ga0157376_10212995 3300014969 Bacteria 1785
442 Ga0157376_10277365 3300014969 Bacteria 1577
443 Ga0157376_10350778 3300014969 Bacteria 1412
444 Ga0157376_10701447 3300014969 Bacteria 1017
445 Ga0157376_10868047 3300014969 Bacteria 919
446 Ga0182006_1070676 3300015261 Bacteria 1295
447 Ga0163161_10261359 3300017792 Unclassified 1352
448 Ga0163161_10269753 3300017792 Bacteria 1331
449 Ga0163161_10556258 3300017792 Bacteria 941
450 Ga0224569_100779 3300022732 Unclassified 2711
451 Ga0224572_1000884 3300024225 Bacteria 4046
452 Ga0224572_1004713 3300024225 Bacteria 2393
453 Ga0228598_1006514 3300024227 Bacteria 2414
454 Ga0228598_1010228 3300024227 Unclassified 1869
455 Ga0207697_10037918 3300025315 Bacteria 1976
456 Ga0207656_10055118 3300025321 Bacteria 1730
457 Ga0207656_10058157 3300025321 Bacteria 1688
458 Ga0207692_10015262 3300025898 Bacteria 3375
459 Ga0207692_10023268 3300025898 Bacteria 2863
460 Ga0207692_10026324 3300025898 Unclassified 2727
461 Ga0207692_10090908 3300025898 Unclassified 1655
462 Ga0207642_10025069 3300025899 Unclassified 2406
463 Ga0207642_10061421 3300025899 Unclassified 1747
464 Ga0207710_10142186 3300025900 Unclassified 1159
465 Ga0207680_10012846 3300025903 Bacteria 4278
466 Ga0207680_10014376 3300025903 Bacteria 4093
467 Ga0207680_10286242 3300025903 Unclassified 1146
468 Ga0207647_10005231 3300025904 Bacteria 9553
469 Ga0207647_10108544 3300025904 Bacteria 1642
470 Ga0207647_10190844 3300025904 Unclassified 1187
471 Ga0207685_10035384 3300025905 Unclassified 1822
472 Ga0207685_10048327 3300025905 Bacteria 1629
473 Ga0207699_10008583 3300025906 Bacteria 5050
474 Ga0207699_10024378 3300025906 Bacteria 3308
475 Ga0207699_10082667 3300025906 Bacteria 1996
476 Ga0207699_10126698 3300025906 Unclassified 1659
477 Ga0207699_10204811 3300025906 Bacteria 1339
478 Ga0207699_10249440 3300025906 Bacteria 1223
479 Ga0207645_10000311 3300025907 Bacteria 40978
480 Ga0207645_10020169 3300025907 Bacteria 4365
481 Ga0207645_10025308 3300025907 Unclassified 3840
482 Ga0207643_10000546 3300025908 Bacteria 24125
483 Ga0207643_10165329 3300025908 Unclassified 1333
484 Ga0207684_10000238 3300025910 Bacteria 83165
485 Ga0207684_10002001 3300025910 Bacteria 21005
486 Ga0207684_10054596 3300025910 Unclassified 3389
487 Ga0207684_10055545 3300025910 Unclassified 3359
488 Ga0207684_10154043 3300025910 Bacteria 1978
489 Ga0207684_10365352 3300025910 Bacteria 1242
490 Ga0207684_10645210 3300025910 Bacteria 902
491 Ga0207654_10004712 3300025911 Bacteria 6902
492 Ga0207654_10102590 3300025911 Bacteria 1765
493 Ga0207707_10017650 3300025912 Bacteria 6224
494 Ga0207707_10018544 3300025912 Bacteria 6066
495 Ga0207707_10054558 3300025912 Bacteria 3479
496 Ga0207707_10595588 3300025912 Bacteria 936
497 Ga0207695_10075791 3300025913 Bacteria 3421
498 Ga0207695_10132045 3300025913 Unclassified 2454
499 Ga0207695_10404267 3300025913 Bacteria 1250
500 Ga0207671_10127238 3300025914 Unclassified 1953
501 Ga0207671_10191864 3300025914 Bacteria 1593
502 Ga0207671_10270009 3300025914 Unclassified 1340
503 Ga0207693_10000015 3300025915 Bacteria 147464
504 Ga0207693_10000517 3300025915 Bacteria 34803
505 Ga0207693_10001987 3300025915 Bacteria 17937
506 Ga0207693_10011436 3300025915 Bacteria 7184
507 Ga0207693_10104058 3300025915 Bacteria 2226
508 Ga0207663_10003940 3300025916 Bacteria 7344
509 Ga0207663_10180344 3300025916 Bacteria 1508
510 Ga0207663_10235280 3300025916 Bacteria 1341
511 Ga0207663_10679721 3300025916 Bacteria 814
512 Ga0207663_10912766 3300025916 Unclassified 703
513 Ga0207660_10386815 3300025917 Unclassified 1125
514 Ga0207657_10002880 3300025919 Bacteria 18488
515 Ga0207657_10003528 3300025919 Bacteria 16709
516 Ga0207657_10033933 3300025919 Bacteria 4595
517 Ga0207649_10000666 3300025920 Bacteria 22943
518 Ga0207649_10024450 3300025920 Bacteria 3511
519 Ga0207649_10251809 3300025920 Unclassified 1272
520 Ga0207652_10052638 3300025921 Bacteria 3495
521 Ga0207652_10412691 3300025921 Bacteria 1218
522 Ga0207652_10869972 3300025921 Unclassified 797
523 Ga0207646_10000073 3300025922 Bacteria 140267
524 Ga0207646_10001845 3300025922 Bacteria 25580
525 Ga0207646_10019424 3300025922 Bacteria 6317
526 Ga0207646_10088344 3300025922 Bacteria 2773
527 Ga0207646_10360690 3300025922 Bacteria 1313
528 Ga0207646_10637161 3300025922 Unclassified 955
529 Ga0207681_10088972 3300025923 Bacteria 2200
530 Ga0207681_10098173 3300025923 Bacteria 2107
531 Ga0207681_10120349 3300025923 Unclassified 1924
532 Ga0207681_10243023 3300025923 Bacteria 1402
533 Ga0207681_10534681 3300025923 Unclassified 963
534 Ga0207694_10214625 3300025924 Unclassified 1568
535 Ga0207650_10000097 3300025925 Bacteria 115583
536 Ga0207650_10004072 3300025925 Bacteria 9992
537 Ga0207650_10325773 3300025925 Bacteria 1259
538 Ga0207659_10018070 3300025926 Bacteria 4616
539 Ga0207659_10050507 3300025926 Unclassified 2955
540 Ga0207659_10073211 3300025926 Bacteria 2508
541 Ga0207659_10770151 3300025926 Bacteria 826
542 Ga0207687_10003552 3300025927 Bacteria 10490
543 Ga0207687_10017349 3300025927 Bacteria 4738
544 Ga0207687_10044012 3300025927 Bacteria 3078
545 Ga0207700_10000373 3300025928 Bacteria 26215
546 Ga0207700_10000551 3300025928 Bacteria 21996
547 Ga0207700_10101997 3300025928 Bacteria 2291
548 Ga0207700_10160867 3300025928 Bacteria 1865
549 Ga0207700_10386628 3300025928 Bacteria 1224
550 Ga0207700_10431067 3300025928 Unclassified 1159
551 Ga0207700_10434911 3300025928 Bacteria 1154
552 Ga0207664_10000241 3300025929 Bacteria 41182
553 Ga0207664_10047540 3300025929 Bacteria 3371
554 Ga0207664_10146579 3300025929 Bacteria 2002
555 Ga0207664_10217938 3300025929 Unclassified 1654
556 Ga0207664_10223775 3300025929 Bacteria 1633
557 Ga0207664_10435016 3300025929 Bacteria 1170
558 Ga0207644_10007323 3300025931 Bacteria 7182
559 Ga0207644_10013687 3300025931 Bacteria 5415
560 Ga0207690_10002849 3300025932 Bacteria 10434
561 Ga0207690_10020371 3300025932 Bacteria 4097
562 Ga0207690_10376018 3300025932 Unclassified 1128
563 Ga0207706_10000139 3300025933 Bacteria 79096
564 Ga0207706_10113112 3300025933 Bacteria 2388
565 Ga0207686_10473315 3300025934 Unclassified 967
566 Ga0207709_10207821 3300025935 Unclassified 1403
567 Ga0207670_10155039 3300025936 Bacteria 1704
568 Ga0207670_10237513 3300025936 Unclassified 1402
569 Ga0207669_10259893 3300025937 Bacteria 1298
570 Ga0207669_10572106 3300025937 Unclassified 915
571 Ga0207704_10031873 3300025938 Bacteria 2975
572 Ga0207704_10093139 3300025938 Unclassified 1985
573 Ga0207665_10000188 3300025939 Bacteria 41567
574 Ga0207665_10002289 3300025939 Bacteria 12928
575 Ga0207665_10038450 3300025939 Bacteria 3186
576 Ga0207665_10039865 3300025939 Bacteria 3133
577 Ga0207665_10056732 3300025939 Bacteria 2644
578 Ga0207665_10189729 3300025939 Unclassified 1492
579 Ga0207665_10220185 3300025939 Bacteria 1391
580 Ga0207665_10290601 3300025939 Bacteria 1219
581 Ga0207691_10067391 3300025940 Bacteria 3236
582 Ga0207691_10352712 3300025940 Bacteria 1259
583 Ga0207691_10664664 3300025940 Unclassified 880
584 Ga0207711_10005198 3300025941 Bacteria 11021
585 Ga0207711_10042354 3300025941 Bacteria 3880
586 Ga0207711_10068041 3300025941 Bacteria 3084
587 Ga0207711_10091735 3300025941 Bacteria 2672
588 Ga0207711_10119828 3300025941 Bacteria 2348
589 Ga0207711_10180717 3300025941 Bacteria 1918
590 Ga0207711_10359549 3300025941 Bacteria 1349
591 Ga0207689_10000078 3300025942 Bacteria 79810
592 Ga0207689_10080424 3300025942 Bacteria 2679
593 Ga0207689_10238768 3300025942 Bacteria 1502
594 Ga0207661_10000124 3300025944 Bacteria 49095
595 Ga0207661_10125766 3300025944 Unclassified 2189
596 Ga0207661_10437297 3300025944 Bacteria 1190
597 Ga0207679_10000065 3300025945 Bacteria 97825
598 Ga0207679_10023390 3300025945 Bacteria 4225
599 Ga0207679_10031869 3300025945 Bacteria 3694
600 Ga0207679_10032000 3300025945 Bacteria 3687
601 Ga0207667_10015347 3300025949 Bacteria 8707
602 Ga0207667_10477905 3300025949 Unclassified 1265
603 Ga0207667_10569641 3300025949 Bacteria 1144
604 Ga0207651_10017725 3300025960 Bacteria 4214
605 Ga0207651_10034427 3300025960 Bacteria 3280
606 Ga0207712_10037485 3300025961 Bacteria 3308
607 Ga0207712_10208193 3300025961 Unclassified 1556
608 Ga0207668_10147240 3300025972 Bacteria 1818
609 Ga0207668_10216063 3300025972 Bacteria 1536
610 Ga0207640_10036496 3300025981 Bacteria 3086
611 Ga0207640_10371373 3300025981 Unclassified 1156
612 Ga0207658_10002380 3300025986 Bacteria 13779
613 Ga0207658_10070369 3300025986 Bacteria 2646
614 Ga0207658_10077819 3300025986 Bacteria 2532
615 Ga0207658_10185801 3300025986 Bacteria 1724
616 Ga0207658_10372041 3300025986 Unclassified 1249
617 Ga0207658_10484703 3300025986 Bacteria 1099
618 Ga0207677_10003494 3300026023 Bacteria 8327
619 Ga0207677_10014151 3300026023 Bacteria 4648
620 Ga0207677_10023905 3300026023 Bacteria 3784
621 Ga0207677_10034288 3300026023 Bacteria 3285
622 Ga0207677_10142875 3300026023 Bacteria 1835
623 Ga0207677_10155313 3300026023 Bacteria 1771
624 Ga0207677_10288606 3300026023 Unclassified 1350
625 Ga0207703_10044126 3300026035 Bacteria 3581
626 Ga0207703_10055388 3300026035 Bacteria 3226
627 Ga0207703_10062049 3300026035 Bacteria 3062
628 Ga0207703_10471594 3300026035 Unclassified 1175
629 Ga0207703_10728642 3300026035 Bacteria 944
630 Ga0207639_10134194 3300026041 Bacteria 2053
631 Ga0207639_10222118 3300026041 Bacteria 1632
632 Ga0207678_10002115 3300026067 Bacteria 17982
633 Ga0207678_10014195 3300026067 Bacteria 7003
634 Ga0207678_10111271 3300026067 Bacteria 2336
635 Ga0207708_10442423 3300026075 Unclassified 1081
636 Ga0207702_10027973 3300026078 Bacteria 4684
637 Ga0207702_10039120 3300026078 Bacteria 3973
638 Ga0207702_10253859 3300026078 Bacteria 1652
639 Ga0207702_10958184 3300026078 Unclassified 848
640 Ga0207641_10000183 3300026088 Bacteria 87085
641 Ga0207641_10022805 3300026088 Bacteria 5154
642 Ga0207641_10028155 3300026088 Bacteria 4642
643 Ga0207641_10065511 3300026088 Bacteria 3108
644 Ga0207641_10685273 3300026088 Bacteria 1008
645 Ga0207641_10696803 3300026088 Bacteria 1000
646 Ga0207648_10000618 3300026089 Bacteria 39818
647 Ga0207648_10031892 3300026089 Bacteria 4656
648 Ga0207648_10164384 3300026089 Bacteria 1961
649 Ga0207676_10000428 3300026095 Bacteria 35461
650 Ga0207676_10002661 3300026095 Bacteria 12691
651 Ga0207676_10082628 3300026095 Bacteria 2613
652 Ga0207676_10937951 3300026095 Bacteria 850
653 Ga0207674_10002308 3300026116 Bacteria 24156
654 Ga0207674_10026582 3300026116 Bacteria 6141
655 Ga0207674_10629262 3300026116 Bacteria 1036
656 Ga0207674_11044263 3300026116 Bacteria 786
657 Ga0207675_100011075 3300026118 Bacteria 8449
658 Ga0207675_100042878 3300026118 Bacteria 4225
659 Ga0207675_100091554 3300026118 Bacteria 2859
660 Ga0207675_100212028 3300026118 Bacteria 1863
661 Ga0207683_10158466 3300026121 Bacteria 2045
662 Ga0207698_10032710 3300026142 Bacteria 3771
663 Ga0207698_10079185 3300026142 Unclassified 2642
664 Ga0207428_10245351 3300027907 Unclassified 1337
665 Ga0265356_1000006 3300028017 Bacteria 35167
666 Ga0268266_10050004 3300028379 Bacteria 3585
667 Ga0268266_10050535 3300028379 Bacteria 3567
668 Ga0268266_10069817 3300028379 Bacteria 3045
669 Ga0268266_10088314 3300028379 Bacteria 2713
670 Ga0268266_11264965 3300028379 Unclassified 713
671 Ga0268265_10005701 3300028380 Bacteria 8504
672 Ga0268265_10012748 3300028380 Bacteria 5707
673 Ga0268265_10223790 3300028380 Bacteria 1648
674 Ga0268265_10288733 3300028380 Bacteria 1471
675 Ga0268264_10011053 3300028381 Bacteria 7455
676 Ga0268264_10069283 3300028381 Bacteria 2983
677 Ga0268264_10171653 3300028381 Bacteria 1962
678 Ga0268264_10465218 3300028381 Bacteria 1227
679 Ga0268264_10869768 3300028381 Bacteria 903
680 Ga0265338_10036612 3300028800 Bacteria 4692
681 Ga0265338_10051576 3300028800 Bacteria 3702
682 Ga0265338_10094089 3300028800 Unclassified 2466
683 Ga0265770_1001275 3300030878 Unclassified 3484
684 Ga0265760_10000622 3300031090 Bacteria 10039
685 Ga0265760_10001888 3300031090 Bacteria 6142
686 Ga0265760_10002340 3300031090 Bacteria 5537
687 Ga0265760_10007244 3300031090 Bacteria 3177
688 Ga0265325_10065780 3300031241 Bacteria 1830
689 Ga0265339_10013023 3300031249 Bacteria 5056
690 Ga0265339_10019669 3300031249 Bacteria 3960
691 Ga0265339_10031617 3300031249 Bacteria 2990
692 Ga0265339_10083270 3300031249 Bacteria 1687
693 Ga0265316_10195426 3300031344 Bacteria 1501
694 Ga0265342_10020058 3300031712 Bacteria 4297
695 Ga0373930_0011324 3300034816 Bacteria 1609
696 Ga0373938_0027380 3300034957 Unclassified 1199
697 Ga0373926_0042254 3300035083 Bacteria 1630
698 Ga0373926_0115545 3300035083 Bacteria 1010
699 Ga0373934_0035890 3300035086 Unclassified 1952
700 Ga0373934_0037519 3300035086 Bacteria 1908
701 Ga0373934_0139551 3300035086 Unclassified 991
702 Ga0373934_0198388 3300035086 Bacteria 826
703 Ga0373944_0039275 3300035089 Unclassified 1457
704 Ga0373949_0009318 3300035090 Bacteria 2151
705 Ga0373923_0069131 3300035111 Bacteria 1514
706 Ga0373936_0000770 3300035113 Bacteria 11281
707 Ga0373936_0137084 3300035113 Bacteria 1055
708 Ga0373939_0024544 3300035114 Bacteria 1681
709 Ga0373945_0003039 3300035116 Bacteria 5275
710 Ga0373945_0211573 3300035116 Unclassified 808
711 Ga0373954_0026327 3300035118 Bacteria 2666
712 Ga0373954_0065508 3300035118 Bacteria 1720
713 Ga0373954_0159359 3300035118 Bacteria 1104
714 Ga0373954_0242338 3300035118 Bacteria 887
715 Ga0373956_0041444 3300035119 Bacteria 2044
716 Ga0373957_0069858 3300035120 Bacteria 1372
717 Ga0373960_0034554 3300035121 Unclassified 1431
718 Ga0373943_0000323 3300035170 Bacteria 20010
719 Ga0373943_0186401 3300035170 Unclassified 1143
720 Ga0373946_0325296 3300035171 Bacteria 765
721 Ga0373955_0026383 3300035172 Bacteria 2992
722 Ga0373955_0072427 3300035172 Bacteria 1930
723 Ga0373955_0183559 3300035172 Bacteria 1242
724 Ga0373962_0097598 3300035242 Unclassified 913
725 Ga0373931_0025376 3300035691 Bacteria 3010
726 Ga0373931_0121206 3300035691 Bacteria 1495
727 Ga0373935_0001708 3300035692 Bacteria 12282
728 Ga0373935_0020435 3300035692 Bacteria 4046
729 Ga0373927_0000273 3300035695 Bacteria 40643
730 Ga0373927_0000335 3300035695 Bacteria 36911
731 Ga0373927_0001148 3300035695 Bacteria 20042
732 Ga0373927_0002182 3300035695 Bacteria 14382
733 Ga0373927_0009881 3300035695 Bacteria 6397
734 Ga0373927_0103657 3300035695 Bacteria 1851
735 Ga0373933_0027662 3300035724 Bacteria 3267
736 Ga0373933_0223538 3300035724 Bacteria 1208
737 Ga0373933_0453891 3300035724 Bacteria 838
738 Ga0373947_0001524 3300035725 Bacteria 14206
739 Ga0373947_0005592 3300035725 Bacteria 7329
740 Ga0373937_0027621 3300036401 Bacteria 5133
741 Ga0373937_0036572 3300036401 Bacteria 4475
742 Ga0373937_0038116 3300036401 Bacteria 4381
743 Ga0373937_0053502 3300036401 Bacteria 3703
744 Ga0373937_0135841 3300036401 Unclassified 2299
745 Ga0373937_0136128 3300036401 Bacteria 2297
746 Ga0373937_0250515 3300036401 Bacteria 1670
747 Ga0373937_0323608 3300036401 Bacteria 1459
748 Ga0373925_0000437 3300037068 Bacteria 42142
749 Ga0373925_0002175 3300037068 Bacteria 15972
750 Ga0373925_0010338 3300037068 Bacteria 6771
751 Ga0373925_0019946 3300037068 Bacteria 4877
752 Ga0395901_0360092 3300038443 Unclassified 1500
753 Ga0436365_1783947 3300039437 Bacteria 2225
754 Ga0436360_0877677 3300039438 Bacteria 2035
755 Ga0436362_0854104 3300039453 Bacteria 3262
756 Ga0451577_0351781 3300042876 Unclassified 1337
757 Ga0466963_0078731 3300044694 Bacteria 2229
758 Ga0466963_0869940 3300044694 Bacteria 635
759 Ga0466964_0191289 3300044706 Unclassified 977
760 Ga0466968_0310734 3300044735 Bacteria 760
761 Ga0451576_0331150 3300045051 Unclassified 1594
762 Ga0466967_0171779 3300045976 Bacteria 2040
763 Ga0495592_0077196 3300046454 Bacteria 2415
764 Ga0495592_0102205 3300046454 Bacteria 2041
765 Ga0495629_0020687 3300046459 Bacteria 4699
766 Ga0495629_0101921 3300046459 Bacteria 2003
767 Ga0495651_0058336 3300046462 Bacteria 2962
768 Ga0495653_0050649 3300046463 Bacteria 3193
769 Ga0495653_0141102 3300046463 Bacteria 1694
770 Ga0495580_0005752 3300046472 Bacteria 10184
771 Ga0495580_0008789 3300046472 Bacteria 7997
772 Ga0495580_0011178 3300046472 Bacteria 6950
773 Ga0495580_0020647 3300046472 Bacteria 4872
774 Ga0495580_0050519 3300046472 Unclassified 2940
775 Ga0495580_0066173 3300046472 Bacteria 2530
776 Ga0495580_0080381 3300046472 Unclassified 2273
777 Ga0495580_0092156 3300046472 Bacteria 2109
778 Ga0495580_0183209 3300046472 Bacteria 1446
779 Ga0495580_0239267 3300046472 Bacteria 1245
780 Ga0495580_0254716 3300046472 Bacteria 1201
781 Ga0495580_0413911 3300046472 Bacteria 908
782 Ga0495580_0599603 3300046472 Bacteria 728
783 Ga0495582_0009060 3300046473 Bacteria 5492
784 Ga0495582_0134171 3300046473 Bacteria 1400
785 Ga0495582_0174739 3300046473 Bacteria 1223
786 Ga0495639_0020359 3300046475 Bacteria 2900
787 Ga0495664_0025498 3300046477 Bacteria 3442
788 Ga0495608_0006025 3300046511 Bacteria 8617
789 Ga0495608_0115636 3300046511 Bacteria 1722
790 Ga0495618_0045897 3300046514 Bacteria 2757
791 Ga0495618_0057687 3300046514 Bacteria 2459
792 Ga0495618_0331969 3300046514 Bacteria 940
793 Ga0495628_0145955 3300046516 Bacteria 1804
794 Ga0495630_0034467 3300046517 Bacteria 3780
795 Ga0495630_0194930 3300046517 Bacteria 1546
796 Ga0495630_0250659 3300046517 Bacteria 1353
797 Ga0495630_0299879 3300046517 Bacteria 1228
798 Ga0495652_0131089 3300046529 Bacteria 1984
799 Ga0495587_0069881 3300046536 Bacteria 2044
800 Ga0495645_0009103 3300046543 Bacteria 6937
801 Ga0495645_0250305 3300046543 Bacteria 1178
802 Ga0495667_0000663 3300046559 Bacteria 21978
803 Ga0495667_0075729 3300046559 Bacteria 2189
804 Ga0495667_0188806 3300046559 Bacteria 1321
805 Ga0495634_0072092 3300046642 Bacteria 2272
806 Ga0495635_0237145 3300046663 Bacteria 1231
807 Ga0495657_0377219 3300046675 Unclassified 837
808 Ga0495599_0084665 3300046678 Bacteria 1980
809 Ga0495599_0093551 3300046678 Bacteria 1875
810 Ga0495623_0049909 3300046679 Bacteria 2651
811 Ga0495669_0124623 3300046684 Bacteria 1210
812 Ga0495613_0021825 3300046689 Bacteria 4772
813 Ga0495613_0025959 3300046689 Bacteria 4365
814 Ga0495613_0051848 3300046689 Bacteria 3023
815 Ga0495670_0184425 3300046691 Unclassified 1103
816 Ga0495600_0134006 3300046809 Bacteria 1609
817 Ga0495581_0118536 3300047315 Bacteria 1540
818 Ga0495604_0062911 3300047317 Bacteria 2833
819 Ga0495636_0248677 3300047318 Bacteria 822
820 Ga0495674_0046621 3300047319 Bacteria 3846
821 Ga0495674_0110276 3300047319 Bacteria 2334
822 Ga0495674_0144808 3300047319 Bacteria 1995
823 Ga0495674_0226102 3300047319 Bacteria 1546
824 Ga0495674_0276818 3300047319 Bacteria 1376
825 Ga0495674_0473841 3300047319 Bacteria 1004
826 Ga0495674_0677222 3300047319 Unclassified 811
827 Ga0495680_0120821 3300047322 Bacteria 1934
828 Ga0495680_0247049 3300047322 Bacteria 1266
829 Ga0495675_0256846 3300047444 Unclassified 1048
830 Ga0495684_0019426 3300047471 Bacteria 5232
831 Ga0495684_0029371 3300047471 Bacteria 4220
832 Ga0495684_0082474 3300047471 Bacteria 2439
833 Ga0495684_0119835 3300047471 Bacteria 1983
834 Ga0495684_0138962 3300047471 Unclassified 1822
835 Ga0495593_0328313 3300047673 Bacteria 765
836 Ga0495602_0146753 3300048088 Bacteria 1860
837 Ga0496102_0209997 3300048905 Unclassified 1836
838 Ga0496102_0349841 3300048905 Unclassified 1391
839 Ga0496104_0052215 3300048907 Bacteria 3861
840 Ga0496104_0297776 3300048907 Unclassified 1525
841 Ga0496104_1165578 3300048907 Unclassified 674
842 Ga0496105_0516060 3300048908 Unclassified 936
843 Ga0496106_0171176 3300048909 Unclassified 1721
844 Ga0496106_0179448 3300048909 Unclassified 1681
845 Ga0496106_0411945 3300048909 Unclassified 1086
846 Ga0496108_0000263 3300048911 Bacteria 45358
847 Ga0496108_0539259 3300048911 Unclassified 1018
848 Ga0496109_0000335 3300048912 Bacteria 43760
849 Ga0496109_0520684 3300048912 Unclassified 1122
850 Ga0496110_0001842 3300048913 Bacteria 15640
851 Ga0496110_0143507 3300048913 Bacteria 2159
852 Ga0496110_0495410 3300048913 Unclassified 1113
853 Ga0496111_0009746 3300048914 Bacteria 6421
854 Ga0496112_0005770 3300048915 Bacteria 10768
855 Ga0496112_0006803 3300048915 Bacteria 10076
856 Ga0496112_0007995 3300048915 Bacteria 9433
857 Ga0496112_0041497 3300048915 Bacteria 4503
858 Ga0496112_0087916 3300048915 Unclassified 3075
859 Ga0496112_0340791 3300048915 Unclassified 1442
860 Ga0496112_0848973 3300048915 Unclassified 837
861 Ga0496114_0602577 3300048917 Bacteria 969
862 Ga0496114_1001922 3300048917 Unclassified 719
863 Ga0496115_0023064 3300048918 Bacteria 4828
864 Ga0496115_0203166 3300048918 Unclassified 1637
865 Ga0501032_0001129 3300049569 Bacteria 21346
866 Ga0501033_0003504 3300049570 Bacteria 12863
867 Ga0501034_0152142 3300049571 Bacteria 2289
868 Ga0501036_0000754 3300049572 Bacteria 23971
869 Ga0501037_0002378 3300049573 Bacteria 13582
870 Ga0501038_0003812 3300049574 Bacteria 14019
871 Ga0501039_0003317 3300049575 Bacteria 12041
872 Ga0501043_0008597 3300049579 Bacteria 8047
873 Ga0501046_0002933 3300049580 Bacteria 15779
874 Ga0501047_0013786 3300049581 Bacteria 7677
875 Ga0501048_0050348 3300049582 Bacteria 2967
876 Ga0501067_0004070 3300049583 Bacteria 8065
877 Ga0501068_0001857 3300049584 Bacteria 11215
878 Ga0501069_0002347 3300049585 Bacteria 9584
879 Ga0501070_0006464 3300049586 Bacteria 9976
880 Ga0501072_0000214 3300049588 Bacteria 42273
881 Ga0501076_0012013 3300049592 Bacteria 6470
882 Ga0501077_0110769 3300049593 Bacteria 1739
883 Ga0501079_0003914 3300049741 Bacteria 10998
884 Ga0501080_0000221 3300049742 Bacteria 42495
885 Ga0501083_0000648 3300049744 Bacteria 22482
886 Ga0501035_0013979 3300049822 Bacteria 7405
887 Ga0501044_0046677 3300049823 Bacteria 4483
888 nmdc:mga05p37_312178_c1 3300050507 Bacteria 1863
889 nmdc:mga05p37_439832_c1 3300050507 Unclassified 1513
890 nmdc:mga05p37_513611_c1 3300050507 Bacteria 1372
891 nmdc:mga05p37_706370_c1 3300050507 Bacteria 1119
892 nmdc:mga09592_244939_c1 3300050508 Bacteria 1554
893 nmdc:mga06r32_10940_c1 3300050510 Bacteria 8171
894 nmdc:mga06r32_17697_c1 3300050510 Bacteria 6510
895 nmdc:mga0n895_2188_c1 3300050512 Bacteria 15118
896 nmdc:mga0n895_26314_c1 3300050512 Bacteria 5508
897 nmdc:mga0n895_77594_c1 3300050512 Bacteria 3305
898 nmdc:mga0n895_869486_c1 3300050512 Unclassified 888
899 nmdc:mga0rr50_200_c1 3300050513 Bacteria 32649
900 nmdc:mga0rr50_289710_c1 3300050513 Bacteria 1368
901 nmdc:mga08x19_149004_c1 3300050514 Unclassified 1583
902 nmdc:mga08x19_22033_c1 3300050514 Bacteria 3941
903 nmdc:mga08x19_303703_c1 3300050514 Unclassified 1109
904 nmdc:mga08x19_30597_c1 3300050514 Bacteria 3383
905 nmdc:mga08x19_335347_c1 3300050514 Unclassified 1054
906 nmdc:mga08x19_487963_c1 3300050514 Bacteria 869
907 nmdc:mga08x19_716862_c1 3300050514 Bacteria 710
908 nmdc:mga0a205_23670_c1 3300050515 Bacteria 5825
909 nmdc:mga0a205_3819_c1 3300050515 Bacteria 13499
910 Ga0495601_0017381 3300053077 Bacteria 4365
911 Ga0495619_0359827 3300053085 Unclassified 1006
912 Ga0500590_140892 3300053148 Unclassified 1102
913 Ga0501084_0001446 3300054114 Bacteria 18876
914 Ga0501082_0020856 3300060353 Bacteria 5652
915 Ga0105248_10390882
916 MRS1b_contig_6517721
917 MRS1b_contig_8438256
918 LJNas_1000010
919 JGI24034J26672_10044796
920 JGI24751J29686_10006045
921 Ga0065712_10070525
922 Ga0065712_10076384
923 Ga0065712_10093513
924 Ga0065715_10002194
925 Ga0065715_10108929
926 Ga0065715_10376653
927 Ga0070676_10037577
928 Ga0070683_100004020
929 Ga0070683_100097881
930 Ga0070683_100119003
931 Ga0070690_100012290
932 Ga0070690_100014122
933 Ga0070690_100020132
934 Ga0070690_100036378
935 Ga0070670_100004616
936 Ga0070670_100025077
937 Ga0068869_100008217
938 Ga0068869_100045320
939 Ga0068869_100161096
940 Ga0070666_10005814
941 Ga0070666_10011999
942 Ga0070666_10024461
943 Ga0070666_10149141
944 Ga0070666_10422200
945 Ga0070680_100007894
946 Ga0070682_100243831
947 Ga0068868_100002730
948 Ga0068868_100004230
949 Ga0068868_100048577
950 Ga0068868_100050312
951 Ga0068868_100095207
952 Ga0068868_100154257
953 Ga0070660_100019812
954 Ga0070660_100023246
955 Ga0070660_100078038
956 Ga0070689_100001637
957 Ga0070689_100071971
958 Ga0070689_100155927
959 Ga0070689_100174466
960 Ga0070661_100010317
961 Ga0070661_100022211
962 Ga0070661_100089269
963 Ga0070661_100219582
964 Ga0070668_100002463
965 Ga0070668_100177754
966 Ga0070669_100099928
967 Ga0070669_100120651
968 Ga0070669_100738018
969 Ga0070675_100061022
970 Ga0070675_100158461
971 Ga0070675_100181054
972 Ga0070671_100005001
973 Ga0070671_100061036
974 Ga0070671_100107982
975 Ga0070671_100176122
976 Ga0070671_100182997
977 Ga0070671_100290945
978 Ga0070674_100279204
979 Ga0070674_100625135
980 Ga0070673_100005076
981 Ga0070673_100021628
982 Ga0070673_100021778
983 Ga0070673_100055165
984 Ga0070688_100036830
985 Ga0070688_100176824
986 Ga0070688_100226971
987 Ga0070688_100503156
988 Ga0070659_100007534
989 Ga0070659_100021419
990 Ga0070659_100202275
991 Ga0070667_100022767
992 Ga0070667_100062042
993 Ga0070667_100101238
994 Ga0070667_100152532
995 Ga0070667_100319732
996 Ga0070667_100392214
997 Ga0070667_100529964
998 Ga0070703_10230232
999 Ga0070709_10005256
1000 Ga0070709_10068914
1001 Ga0070709_10086425
1002 Ga0070709_10104834
1003 Ga0070709_10158271
1004 Ga0070714_100000154
1005 Ga0070714_100014696
1006 Ga0070714_100027108
1007 Ga0070714_100316375
1008 Ga0070713_100000113
1009 Ga0070713_100001107
1010 Ga0070713_100028357
1011 Ga0070713_100054750
1012 Ga0070713_100116004
1013 Ga0070713_100166614
1014 Ga0070713_100187135
1015 Ga0070713_100245151
1016 Ga0070713_100418775
1017 Ga0070713_100475560
1018 Ga0070710_10002900
1019 Ga0070710_10020263
1020 Ga0070710_10105331
1021 Ga0070710_10284963
1022 Ga0070710_10465882
1023 Ga0070701_10374133
1024 Ga0070711_100000518
1025 Ga0070711_100036457
1026 Ga0070711_100052613
1027 Ga0070711_100079101
1028 Ga0070711_100093292
1029 Ga0070711_100160669
1030 Ga0070711_100240593
1031 Ga0070711_100629105
1032 Ga0070705_100609020
1033 Ga0070700_100151157
1034 Ga0070694_100074203
1035 Ga0070694_100128165
1036 Ga0070694_100446273
1037 Ga0070708_100000099
1038 Ga0070708_100004535
1039 Ga0070708_100025278
1040 Ga0070708_100028665
1041 Ga0070708_100071955
1042 Ga0070708_100134515
1043 Ga0070708_100223332
1044 Ga0070708_100268748
1045 Ga0070708_100272971
1046 Ga0070708_100292362
1047 Ga0070708_100423769
1048 Ga0070663_100008619
1049 Ga0070663_100019001
1050 Ga0070663_100219080
1051 Ga0070678_100022384
1052 Ga0070678_100024025
1053 Ga0070678_100291682
1054 Ga0070662_100020306
1055 Ga0070662_100032687
1056 Ga0070681_10009604
1057 Ga0070681_10035376
1058 Ga0070681_10087011
1059 Ga0068867_100055666
1060 Ga0068867_100235414
1061 Ga0070685_10019143
1062 Ga0070685_10021175
1063 Ga0070706_100001042
1064 Ga0070706_100002036
1065 Ga0070706_100008125
1066 Ga0070706_100008677
1067 Ga0070706_100057976
1068 Ga0070706_100199503
1069 Ga0070707_100000091
1070 Ga0070707_100003096
1071 Ga0070707_100054061
1072 Ga0070707_100108792
1073 Ga0070707_100196197
1074 Ga0070707_100337319
1075 Ga0070707_100399233
1076 Ga0070707_100747235
1077 Ga0070698_100000027
1078 Ga0070698_100000226
1079 Ga0070698_100122458
1080 Ga0070698_100216600
1081 Ga0070698_100331080
1082 Ga0070699_100000032
1083 Ga0070699_100000596
1084 Ga0070699_100063471
1085 Ga0070699_100066289
1086 Ga0070699_100072639
1087 Ga0070699_100285893
1088 Ga0070699_100331042
1089 Ga0070699_100416876
1090 Ga0070699_100862540
1091 Ga0070679_100024956
1092 Ga0070679_100228329
1093 Ga0070679_101001077
1094 Ga0070684_100001953
1095 Ga0070684_100131410
1096 Ga0070697_100000138
1097 Ga0070697_100000183
1098 Ga0070697_100001597
1099 Ga0070697_100006896
1100 Ga0070697_100097899
1101 Ga0070697_100109784
1102 Ga0070697_100243357
1103 Ga0070697_100246908
1104 Ga0070697_100337956
1105 Ga0070697_100355654
1106 Ga0070697_100504710
1107 Ga0070697_100706355
1108 Ga0070697_100805050
1109 Ga0070697_100831641
1110 Ga0068853_100014401
1111 Ga0068853_100272099
1112 Ga0070672_100023560
1113 Ga0070672_100089711
1114 Ga0070672_100308914
1115 Ga0070672_100589763
1116 Ga0070686_100025998
1117 Ga0070686_100026312
1118 Ga0070686_100281512
1119 Ga0070695_100032117
1120 Ga0070695_100349364
1121 Ga0070696_100010145
1122 Ga0070696_100101579
1123 Ga0070696_100333499
1124 Ga0070665_100125904
1125 Ga0070704_100194220
1126 Ga0070704_100257009
1127 Ga0068855_100167120
1128 Ga0068855_100379071
1129 Ga0068855_100475745
1130 Ga0068855_100568379
1131 Ga0068855_101379485
1132 Ga0070664_100016901
1133 Ga0070664_100034964
1134 Ga0070664_100040838
1135 Ga0070664_100096808
1136 Ga0070664_100103748
1137 Ga0068857_100001007
1138 Ga0068857_100155788
1139 Ga0068854_100009000
1140 Ga0068854_100552493
1141 Ga0068854_100575049
1142 Ga0068856_100003228
1143 Ga0068856_100037382
1144 Ga0068856_100656784
1145 Ga0070702_100232499
1146 Ga0068852_100140721
1147 Ga0068859_100017542
1148 Ga0068859_100024153
1149 Ga0068859_100088929
1150 Ga0068859_100129490
1151 Ga0068859_100470042
1152 Ga0068864_100001748
1153 Ga0068864_100003558
1154 Ga0068864_100116776
1155 Ga0068864_100206520
1156 Ga0068866_10004179
1157 Ga0068866_10036868
1158 Ga0068866_10250763
1159 Ga0068866_10285464
1160 Ga0068861_100095056
1161 Ga0068861_100117068
1162 Ga0068861_101047477
1163 Ga0068861_101071754
1164 Ga0068851_10005986
1165 Ga0068851_10045532
1166 Ga0068851_10165938
1167 Ga0068870_10001845
1168 Ga0068863_100052570
1169 Ga0068863_100077719
1170 Ga0068863_100079878
1171 Ga0068863_100100511
1172 Ga0068863_100128873
1173 Ga0068863_100133484
1174 Ga0068863_100203970
1175 Ga0068863_100509016
1176 Ga0068858_100007549
1177 Ga0068858_100008063
1178 Ga0068858_100026960
1179 Ga0068858_100033742
1180 Ga0068858_100188509
1181 Ga0068858_100350200
1182 Ga0068858_101090390
1183 Ga0068860_100052411
1184 Ga0068860_100085034
1185 Ga0068860_100242505
1186 Ga0068860_100277897
1187 Ga0068860_100495500
1188 Ga0068860_100747616
1189 Ga0068860_100892720
1190 Ga0068862_100115775
1191 Ga0068862_100129096
1192 Ga0068862_100129916
1193 Ga0068862_100184867
1194 Ga0081540_1080668
1195 Ga0070717_10001985
1196 Ga0070717_10003732
1197 Ga0070717_10006318
1198 Ga0070717_10011594
1199 Ga0070717_10043883
1200 Ga0070717_10085648
1201 Ga0070717_10102159
1202 Ga0070717_10109553
1203 Ga0070717_10121331
1204 Ga0070717_10168489
1205 Ga0070717_10245937
1206 Ga0070717_10247196
1207 Ga0075432_10058786
1208 Ga0070715_10090134
1209 Ga0070715_10105159
1210 Ga0070716_100001153
1211 Ga0070716_100013225
1212 Ga0070716_100022336
1213 Ga0070716_100039054
1214 Ga0070716_100045076
1215 Ga0070716_100061888
1216 Ga0070712_100000084
1217 Ga0070712_100001699
1218 Ga0070712_100003995
1219 Ga0070712_100010243
1220 Ga0070712_100014090
1221 Ga0070712_100019456
1222 Ga0070712_100156160
1223 Ga0097621_100001499
1224 Ga0097621_100069967
1225 Ga0097621_100158073
1226 Ga0097621_100379393
1227 Ga0097621_100504247
1228 Ga0097621_100736710
1229 Ga0068871_100001120
1230 Ga0068871_100004299
1231 Ga0068871_100024370
1232 Ga0068871_100071731
1233 Ga0068871_100174829
1234 Ga0068871_100277077
1235 Ga0068871_100281635
1236 Ga0068871_100376477
1237 Ga0075428_100036657
1238 Ga0075428_100370504
1239 Ga0075430_100081009
1240 Ga0075430_100341607
1241 Ga0075431_100056694
1242 Ga0075431_100255783
1243 Ga0075433_10000915
1244 Ga0075433_10133239
1245 Ga0075434_100003011
1246 Ga0075434_100010220
1247 Ga0075434_100083762
1248 Ga0075434_100600380
1249 Ga0075429_100043479
1250 Ga0068865_100043579
1251 Ga0075436_100097592
1252 Ga0075436_100168172
1253 Ga0075436_100170566
1254 Ga0075436_100312223
1255 Ga0075436_100378719
1256 Ga0097620_100017540
1257 Ga0097620_100024152
1258 Ga0097620_100088927
1259 Ga0097620_100129485
1260 Ga0097620_100469973
1261 Ga0075435_100003469
1262 Ga0075435_100228782
1263 Ga0099795_10007298
1264 Ga0105240_10010282
1265 Ga0105240_10117089
1266 Ga0105245_10012108
1267 Ga0105245_10043787
1268 Ga0105245_10061874
1269 Ga0105245_10160874
1270 Ga0105245_10264545
1271 Ga0105245_10539964
1272 Ga0105245_10588541
1273 Ga0105245_11375257
1274 Ga0105247_10004098
1275 Ga0105247_10212007
1276 Ga0105247_10288190
1277 Ga0114129_10136377
1278 Ga0114129_10449175
1279 Ga0114129_10507253
1280 Ga0105243_10171929
1281 Ga0105241_10105681
1282 Ga0105241_10191403
1283 Ga0105241_10299681
1284 Ga0105242_10016725
1285 Ga0105242_10027045
1286 Ga0105242_10211299
1287 Ga0105248_10021115
1288 Ga0105248_10036094
1289 Ga0105248_10046481
1290 Ga0105248_10413213
1291 Ga0105237_10104531
1292 Ga0105237_10122797
1293 Ga0105237_10188665
1294 Ga0105237_10729868
1295 Ga0105238_10058932
1296 Ga0099796_10034057
1297 Ga0105239_10050506
1298 Ga0105239_10073126
1299 Ga0105246_10008349
1300 Ga0105246_10021673
1301 Ga0157373_10006716
1302 Ga0157373_10107330
1303 Ga0157371_10024120
1304 Ga0157369_10062711
1305 Ga0157369_10257041
1306 Ga0157369_10512768
1307 Ga0157369_11130270
1308 Ga0157374_10007435
1309 Ga0157374_10042686
1310 Ga0157374_10069516
1311 Ga0157374_10071771
1312 Ga0157374_10196080
1313 Ga0157374_10269530
1314 Ga0157378_10000260
1315 Ga0157378_10046181
1316 Ga0157378_10130437
1317 Ga0157378_10187882
1318 Ga0157378_10240843
1319 Ga0163162_10001932
1320 Ga0163162_10004945
1321 Ga0163162_10042940
1322 Ga0163162_10063886
1323 Ga0163162_10172110
1324 Ga0163162_10208818
1325 Ga0163162_10284173
1326 Ga0163162_11763615
1327 Ga0157372_10004647
1328 Ga0157372_10047804
1329 Ga0157372_10222059
1330 Ga0157375_10035315
1331 Ga0157375_10081068
1332 Ga0157375_10082002
1333 Ga0157375_10104676
1334 Ga0163163_10001699
1335 Ga0163163_10002554
1336 Ga0163163_10151736
1337 Ga0163163_10154514
1338 Ga0163163_10167677
1339 Ga0163163_10170869
1340 Ga0163163_10190926
1341 Ga0163163_10447693
1342 Ga0157377_10025486
1343 Ga0157379_10005151
1344 Ga0157379_10033615
1345 Ga0157379_10066847
1346 Ga0157379_10077259
1347 Ga0157379_10101130
1348 Ga0157379_10121252
1349 Ga0157379_10151006
1350 Ga0157376_10008851
1351 Ga0157376_10057820
1352 Ga0157376_10096830
1353 Ga0157376_10154354
1354 Ga0157376_10154536
1355 Ga0157376_10212995
1356 Ga0157376_10277365
1357 Ga0157376_10350778
1358 Ga0157376_10701447
1359 Ga0157376_10868047
1360 Ga0182006_1070676
1361 Ga0163161_10261359
1362 Ga0163161_10269753
1363 Ga0163161_10556258
1364 Ga0224569_100779
1365 Ga0224572_1000884
1366 Ga0224572_1004713
1367 Ga0228598_1006514
1368 Ga0228598_1010228
1369 Ga0207697_10037918
1370 Ga0207656_10055118
1371 Ga0207656_10058157
1372 Ga0207692_10015262
1373 Ga0207692_10023268
1374 Ga0207692_10026324
1375 Ga0207692_10090908
1376 Ga0207642_10025069
1377 Ga0207642_10061421
1378 Ga0207710_10142186
1379 Ga0207680_10012846
1380 Ga0207680_10014376
1381 Ga0207680_10286242
1382 Ga0207647_10005231
1383 Ga0207647_10108544
1384 Ga0207647_10190844
1385 Ga0207685_10035384
1386 Ga0207685_10048327
1387 Ga0207699_10008583
1388 Ga0207699_10024378
1389 Ga0207699_10082667
1390 Ga0207699_10126698
1391 Ga0207699_10204811
1392 Ga0207699_10249440
1393 Ga0207645_10000311
1394 Ga0207645_10020169
1395 Ga0207645_10025308
1396 Ga0207643_10000546
1397 Ga0207643_10165329
1398 Ga0207684_10000238
1399 Ga0207684_10002001
1400 Ga0207684_10054596
1401 Ga0207684_10055545
1402 Ga0207684_10154043
1403 Ga0207684_10365352
1404 Ga0207684_10645210
1405 Ga0207654_10004712
1406 Ga0207654_10102590
1407 Ga0207707_10017650
1408 Ga0207707_10018544
1409 Ga0207707_10054558
1410 Ga0207707_10595588
1411 Ga0207695_10075791
1412 Ga0207695_10132045
1413 Ga0207695_10404267
1414 Ga0207671_10127238
1415 Ga0207671_10191864
1416 Ga0207671_10270009
1417 Ga0207693_10000015
1418 Ga0207693_10000517
1419 Ga0207693_10001987
1420 Ga0207693_10011436
1421 Ga0207693_10104058
1422 Ga0207663_10003940
1423 Ga0207663_10180344
1424 Ga0207663_10235280
1425 Ga0207663_10679721
1426 Ga0207663_10912766
1427 Ga0207660_10386815
1428 Ga0207657_10002880
1429 Ga0207657_10003528
1430 Ga0207657_10033933
1431 Ga0207649_10000666
1432 Ga0207649_10024450
1433 Ga0207649_10251809
1434 Ga0207652_10052638
1435 Ga0207652_10412691
1436 Ga0207652_10869972
1437 Ga0207646_10000073
1438 Ga0207646_10001845
1439 Ga0207646_10019424
1440 Ga0207646_10088344
1441 Ga0207646_10360690
1442 Ga0207646_10637161
1443 Ga0207681_10088972
1444 Ga0207681_10098173
1445 Ga0207681_10120349
1446 Ga0207681_10243023
1447 Ga0207681_10534681
1448 Ga0207694_10214625
1449 Ga0207650_10000097
1450 Ga0207650_10004072
1451 Ga0207650_10325773
1452 Ga0207659_10018070
1453 Ga0207659_10050507
1454 Ga0207659_10073211
1455 Ga0207659_10770151
1456 Ga0207687_10003552
1457 Ga0207687_10017349
1458 Ga0207687_10044012
1459 Ga0207700_10000373
1460 Ga0207700_10000551
1461 Ga0207700_10101997
1462 Ga0207700_10160867
1463 Ga0207700_10386628
1464 Ga0207700_10431067
1465 Ga0207700_10434911
1466 Ga0207664_10000241
1467 Ga0207664_10047540
1468 Ga0207664_10146579
1469 Ga0207664_10217938
1470 Ga0207664_10223775
1471 Ga0207664_10435016
1472 Ga0207644_10007323
1473 Ga0207644_10013687
1474 Ga0207690_10002849
1475 Ga0207690_10020371
1476 Ga0207690_10376018
1477 Ga0207706_10000139
1478 Ga0207706_10113112
1479 Ga0207686_10473315
1480 Ga0207709_10207821
1481 Ga0207670_10155039
1482 Ga0207670_10237513
1483 Ga0207669_10259893
1484 Ga0207669_10572106
1485 Ga0207704_10031873
1486 Ga0207704_10093139
1487 Ga0207665_10000188
1488 Ga0207665_10002289
1489 Ga0207665_10038450
1490 Ga0207665_10039865
1491 Ga0207665_10056732
1492 Ga0207665_10189729
1493 Ga0207665_10220185
1494 Ga0207665_10290601
1495 Ga0207691_10067391
1496 Ga0207691_10352712
1497 Ga0207691_10664664
1498 Ga0207711_10005198
1499 Ga0207711_10042354
1500 Ga0207711_10068041
1501 Ga0207711_10091735
1502 Ga0207711_10119828
1503 Ga0207711_10180717
1504 Ga0207711_10359549
1505 Ga0207689_10000078
1506 Ga0207689_10080424
1507 Ga0207689_10238768
1508 Ga0207661_10000124
1509 Ga0207661_10125766
1510 Ga0207661_10437297
1511 Ga0207679_10000065
1512 Ga0207679_10023390
1513 Ga0207679_10031869
1514 Ga0207679_10032000
1515 Ga0207667_10015347
1516 Ga0207667_10477905
1517 Ga0207667_10569641
1518 Ga0207651_10017725
1519 Ga0207651_10034427
1520 Ga0207712_10037485
1521 Ga0207712_10208193
1522 Ga0207668_10147240
1523 Ga0207668_10216063
1524 Ga0207640_10036496
1525 Ga0207640_10371373
1526 Ga0207658_10002380
1527 Ga0207658_10070369
1528 Ga0207658_10077819
1529 Ga0207658_10185801
1530 Ga0207658_10372041
1531 Ga0207658_10484703
1532 Ga0207677_10003494
1533 Ga0207677_10014151
1534 Ga0207677_10023905
1535 Ga0207677_10034288
1536 Ga0207677_10142875
1537 Ga0207677_10155313
1538 Ga0207677_10288606
1539 Ga0207703_10044126
1540 Ga0207703_10055388
1541 Ga0207703_10062049
1542 Ga0207703_10471594
1543 Ga0207703_10728642
1544 Ga0207639_10134194
1545 Ga0207639_10222118
1546 Ga0207678_10002115
1547 Ga0207678_10014195
1548 Ga0207678_10111271
1549 Ga0207708_10442423
1550 Ga0207702_10027973
1551 Ga0207702_10039120
1552 Ga0207702_10253859
1553 Ga0207702_10958184
1554 Ga0207641_10000183
1555 Ga0207641_10022805
1556 Ga0207641_10028155
1557 Ga0207641_10065511
1558 Ga0207641_10685273
1559 Ga0207641_10696803
1560 Ga0207648_10000618
1561 Ga0207648_10031892
1562 Ga0207648_10164384
1563 Ga0207676_10000428
1564 Ga0207676_10002661
1565 Ga0207676_10082628
1566 Ga0207676_10937951
1567 Ga0207674_10002308
1568 Ga0207674_10026582
1569 Ga0207674_10629262
1570 Ga0207674_11044263
1571 Ga0207675_100011075
1572 Ga0207675_100042878
1573 Ga0207675_100091554
1574 Ga0207675_100212028
1575 Ga0207683_10158466
1576 Ga0207698_10032710
1577 Ga0207698_10079185
1578 Ga0207428_10245351
1579 Ga0265356_1000006
1580 Ga0268266_10050004
1581 Ga0268266_10050535
1582 Ga0268266_10069817
1583 Ga0268266_10088314
1584 Ga0268266_11264965
1585 Ga0268265_10005701
1586 Ga0268265_10012748
1587 Ga0268265_10223790
1588 Ga0268265_10288733
1589 Ga0268264_10011053
1590 Ga0268264_10069283
1591 Ga0268264_10171653
1592 Ga0268264_10465218
1593 Ga0268264_10869768
1594 Ga0265338_10036612
1595 Ga0265338_10051576
1596 Ga0265338_10094089
1597 Ga0265770_1001275
1598 Ga0265760_10000622
1599 Ga0265760_10001888
1600 Ga0265760_10002340
1601 Ga0265760_10007244
1602 Ga0265325_10065780
1603 Ga0265339_10013023
1604 Ga0265339_10019669
1605 Ga0265339_10031617
1606 Ga0265339_10083270
1607 Ga0265316_10195426
1608 Ga0265342_10020058
1609 Ga0373930_0011324
1610 Ga0373938_0027380
1611 Ga0373926_0042254
1612 Ga0373926_0115545
1613 Ga0373934_0035890
1614 Ga0373934_0037519
1615 Ga0373934_0139551
1616 Ga0373934_0198388
1617 Ga0373944_0039275
1618 Ga0373949_0009318
1619 Ga0373923_0069131
1620 Ga0373936_0000770
1621 Ga0373936_0137084
1622 Ga0373939_0024544
1623 Ga0373945_0003039
1624 Ga0373945_0211573
1625 Ga0373954_0026327
1626 Ga0373954_0065508
1627 Ga0373954_0159359
1628 Ga0373954_0242338
1629 Ga0373956_0041444
1630 Ga0373957_0069858
1631 Ga0373960_0034554
1632 Ga0373943_0000323
1633 Ga0373943_0186401
1634 Ga0373946_0325296
1635 Ga0373955_0026383
1636 Ga0373955_0072427
1637 Ga0373955_0183559
1638 Ga0373962_0097598
1639 Ga0373931_0025376
1640 Ga0373931_0121206
1641 Ga0373935_0001708
1642 Ga0373935_0020435
1643 Ga0373927_0000273
1644 Ga0373927_0000335
1645 Ga0373927_0001148
1646 Ga0373927_0002182
1647 Ga0373927_0009881
1648 Ga0373927_0103657
1649 Ga0373933_0027662
1650 Ga0373933_0223538
1651 Ga0373933_0453891
1652 Ga0373947_0001524
1653 Ga0373947_0005592
1654 Ga0373937_0027621
1655 Ga0373937_0036572
1656 Ga0373937_0038116
1657 Ga0373937_0053502
1658 Ga0373937_0135841
1659 Ga0373937_0136128
1660 Ga0373937_0250515
1661 Ga0373937_0323608
1662 Ga0373925_0000437
1663 Ga0373925_0002175
1664 Ga0373925_0010338
1665 Ga0373925_0019946
1666 Ga0395901_0360092
1667 Ga0436365_1783947
1668 Ga0436360_0877677
1669 Ga0436362_0854104
1670 Ga0451577_0351781
1671 Ga0466963_0078731
1672 Ga0466963_0869940
1673 Ga0466964_0191289
1674 Ga0466968_0310734
1675 Ga0451576_0331150
1676 Ga0466967_0171779
1677 Ga0495592_0077196
1678 Ga0495592_0102205
1679 Ga0495629_0020687
1680 Ga0495629_0101921
1681 Ga0495651_0058336
1682 Ga0495653_0050649
1683 Ga0495653_0141102
1684 Ga0495580_0005752
1685 Ga0495580_0008789
1686 Ga0495580_0011178
1687 Ga0495580_0020647
1688 Ga0495580_0050519
1689 Ga0495580_0066173
1690 Ga0495580_0080381
1691 Ga0495580_0092156
1692 Ga0495580_0183209
1693 Ga0495580_0239267
1694 Ga0495580_0254716
1695 Ga0495580_0413911
1696 Ga0495580_0599603
1697 Ga0495582_0009060
1698 Ga0495582_0134171
1699 Ga0495582_0174739
1700 Ga0495639_0020359
1701 Ga0495664_0025498
1702 Ga0495608_0006025
1703 Ga0495608_0115636
1704 Ga0495618_0045897
1705 Ga0495618_0057687
1706 Ga0495618_0331969
1707 Ga0495628_0145955
1708 Ga0495630_0034467
1709 Ga0495630_0194930
1710 Ga0495630_0250659
1711 Ga0495630_0299879
1712 Ga0495652_0131089
1713 Ga0495587_0069881
1714 Ga0495645_0009103
1715 Ga0495645_0250305
1716 Ga0495667_0000663
1717 Ga0495667_0075729
1718 Ga0495667_0188806
1719 Ga0495634_0072092
1720 Ga0495635_0237145
1721 Ga0495657_0377219
1722 Ga0495599_0084665
1723 Ga0495599_0093551
1724 Ga0495623_0049909
1725 Ga0495669_0124623
1726 Ga0495613_0021825
1727 Ga0495613_0025959
1728 Ga0495613_0051848
1729 Ga0495670_0184425
1730 Ga0495600_0134006
1731 Ga0495581_0118536
1732 Ga0495604_0062911
1733 Ga0495636_0248677
1734 Ga0495674_0046621
1735 Ga0495674_0110276
1736 Ga0495674_0144808
1737 Ga0495674_0226102
1738 Ga0495674_0276818
1739 Ga0495674_0473841
1740 Ga0495674_0677222
1741 Ga0495680_0120821
1742 Ga0495680_0247049
1743 Ga0495675_0256846
1744 Ga0495684_0019426
1745 Ga0495684_0029371
1746 Ga0495684_0082474
1747 Ga0495684_0119835
1748 Ga0495684_0138962
1749 Ga0495593_0328313
1750 Ga0495602_0146753
1751 Ga0496102_0209997
1752 Ga0496102_0349841
1753 Ga0496104_0052215
1754 Ga0496104_0297776
1755 Ga0496104_1165578
1756 Ga0496105_0516060
1757 Ga0496106_0171176
1758 Ga0496106_0179448
1759 Ga0496106_0411945
1760 Ga0496108_0000263
1761 Ga0496108_0539259
1762 Ga0496109_0000335
1763 Ga0496109_0520684
1764 Ga0496110_0001842
1765 Ga0496110_0143507
1766 Ga0496110_0495410
1767 Ga0496111_0009746
1768 Ga0496112_0005770
1769 Ga0496112_0006803
1770 Ga0496112_0007995
1771 Ga0496112_0041497
1772 Ga0496112_0087916
1773 Ga0496112_0340791
1774 Ga0496112_0848973
1775 Ga0496114_0602577
1776 Ga0496114_1001922
1777 Ga0496115_0023064
1778 Ga0496115_0203166
1779 Ga0501032_0001129
1780 Ga0501033_0003504
1781 Ga0501034_0152142
1782 Ga0501036_0000754
1783 Ga0501037_0002378
1784 Ga0501038_0003812
1785 Ga0501039_0003317
1786 Ga0501043_0008597
1787 Ga0501046_0002933
1788 Ga0501047_0013786
1789 Ga0501048_0050348
1790 Ga0501067_0004070
1791 Ga0501068_0001857
1792 Ga0501069_0002347
1793 Ga0501070_0006464
1794 Ga0501072_0000214
1795 Ga0501076_0012013
1796 Ga0501077_0110769
1797 Ga0501079_0003914
1798 Ga0501080_0000221
1799 Ga0501083_0000648
1800 Ga0501035_0013979
1801 Ga0501044_0046677
1802 nmdc:mga05p37_312178_c1
1803 nmdc:mga05p37_439832_c1
1804 nmdc:mga05p37_513611_c1
1805 nmdc:mga05p37_706370_c1
1806 nmdc:mga09592_244939_c1
1807 nmdc:mga06r32_10940_c1
1808 nmdc:mga06r32_17697_c1
1809 nmdc:mga0n895_2188_c1
1810 nmdc:mga0n895_26314_c1
1811 nmdc:mga0n895_77594_c1
1812 nmdc:mga0n895_869486_c1
1813 nmdc:mga0rr50_200_c1
1814 nmdc:mga0rr50_289710_c1
1815 nmdc:mga08x19_149004_c1
1816 nmdc:mga08x19_22033_c1
1817 nmdc:mga08x19_303703_c1
1818 nmdc:mga08x19_30597_c1
1819 nmdc:mga08x19_335347_c1
1820 nmdc:mga08x19_487963_c1
1821 nmdc:mga08x19_716862_c1
1822 nmdc:mga0a205_23670_c1
1823 nmdc:mga0a205_3819_c1
1824 Ga0495601_0017381
1825 Ga0495619_0359827
1826 Ga0500590_140892
1827 Ga0501084_0001446
1828 Ga0501082_0020856

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04012

PspA_IM30

PspA/IM30 family

2

218

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lbh-assembly1.cif.gz_A crystal structure of helicobacter cinaedi caip 0.9007 54 108
6zw4-assembly1.cif.gz_A c14 symmetry: bacterial vipp1 and pspa are members of the ancient escrt-iii membrane-remodeling superfamily. 0.8748 27 153
6zw5-assembly1.cif.gz_A c15 symmetry: bacterial vipp1 and pspa are members of the ancient escrt-iii membrane-remodeling superfamily. 0.8742 27 153
6zw6-assembly1.cif.gz_A c16 symmetry: bacterial vipp1 and pspa are members of the ancient escrt-iii membrane-remodeling superfamily. 0.8662 27 153
6zvt-assembly1.cif.gz_A c13 symmetry: bacterial vipp1 and pspa are members of the ancient escrt-iii membrane-remodeling superfamily. 0.8623 27 153
ID Description Score Start End Superfamily
af_Q58144_7_159_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9305 57 116 1.20.1260.10
af_Q58156_13_77_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9131 54 109 1.20.1260.10
af_Q9NAD6_1_199_1.20.1050.20 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2;STAT transcription factor, all-alpha domain 0.8821 33 125 1.20.1050.20
af_Q9VGQ8_135_333_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.8357 28 129 1.20.1270.60
1i4dA00 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.8323 28 134 1.20.1270.60
ID Description Score Start End GO Terms
AF-A0A6I7QX39-F1-model_v4 PspA/IM30 family protein 0.9762 25 138
AF-A0A524E8G4-F1-model_v4 Serine--tRNA ligase 0.9572 25 137
AF-A0A7S0Y0P3-F1-model_v4 Uncharacterized protein 0.9487 28 137
AF-A0A552F735-F1-model_v4 PspA/IM30 family protein 0.9456 33 136
AF-A0A5E4NTE7-F1-model_v4 PspA/IM30 family protein 0.9245 26 138

Map