F485529
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 913 | 308 | 1826 | 116 |
Family's Representative Sequence
| Representative Sequence | 3300005439|Ga0070711_100593138|Ga0070711_1005931383 |
| Length | 124 |
| Sequence | VAQTMKVKKGDVVRVLRGKDAGKQGRVIEALPKQGRVVVENINVNKRHRRPRPIQNTTGLGGGGMTPGGIIDLPAPLPVSNVMVVCPTCGKPTRVATVEKTVKDRVVRVRVCKQPGCGQEIDPT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 50 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 51 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 52 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 56 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 57 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 63 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 64 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 65 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 89 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 92 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 96 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 97 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 98 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 136 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 137 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 138 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 139 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 140 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 141 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 142 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 143 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 144 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 145 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 146 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 147 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 148 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 149 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 150 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 151 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 152 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 153 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 154 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 155 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 156 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 157 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 158 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 159 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 160 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 161 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 162 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 163 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 164 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 166 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 168 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 169 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 170 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 173 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 174 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 175 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 176 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 177 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 178 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 179 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 180 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 181 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 182 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 183 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 184 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 185 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 186 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 187 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 188 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 189 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 190 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 191 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 192 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 193 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 194 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 195 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 259 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 260 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 261 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 262 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 263 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 264 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 267 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 268 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 269 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 270 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 271 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 272 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.41 |
| Metatranscriptomes | 5.59 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.55 |
| Nodule | 0 |
| Rhizoplane | 8.65 |
| Rhizosphere | 90.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070711_100593138 | 3300005439 | Bacteria | 923 |
| 2 | Ga0058863_10034036 | 3300004799 | Bacteria | 1759 |
| 3 | Ga0058863_11909291 | 3300004799 | Bacteria | 610 |
| 4 | Ga0058861_11767971 | 3300004800 | Bacteria | 590 |
| 5 | Ga0058861_11855680 | 3300004800 | Bacteria | 1020 |
| 6 | Ga0058862_10109718 | 3300004803 | Bacteria | 2825 |
| 7 | Ga0058862_12460894 | 3300004803 | Bacteria | 1440 |
| 8 | Ga0070658_10182830 | 3300005327 | Bacteria | 1764 |
| 9 | Ga0070683_100053944 | 3300005329 | Bacteria | 3726 |
| 10 | Ga0070683_100167030 | 3300005329 | Bacteria | 2088 |
| 11 | Ga0070683_100226293 | 3300005329 | Bacteria | 1777 |
| 12 | Ga0070683_100260469 | 3300005329 | Bacteria | 1649 |
| 13 | Ga0070683_100329097 | 3300005329 | Bacteria | 1455 |
| 14 | Ga0070690_101290689 | 3300005330 | Bacteria | 585 |
| 15 | Ga0070680_100012157 | 3300005336 | Bacteria | 6685 |
| 16 | Ga0070680_100075346 | 3300005336 | Bacteria | 2777 |
| 17 | Ga0070680_100330437 | 3300005336 | Bacteria | 1295 |
| 18 | Ga0070680_101051327 | 3300005336 | Bacteria | 703 |
| 19 | Ga0070682_100122110 | 3300005337 | Bacteria | 1751 |
| 20 | Ga0070682_100439148 | 3300005337 | Bacteria | 997 |
| 21 | Ga0070682_100759766 | 3300005337 | Bacteria | 783 |
| 22 | Ga0070682_100891581 | 3300005337 | Bacteria | 730 |
| 23 | Ga0070682_101775313 | 3300005337 | Bacteria | 537 |
| 24 | Ga0068868_100118699 | 3300005338 | Bacteria | 2156 |
| 25 | Ga0068868_100212391 | 3300005338 | Bacteria | 1618 |
| 26 | Ga0070687_100840424 | 3300005343 | Bacteria | 654 |
| 27 | Ga0070661_100040522 | 3300005344 | Bacteria | 3398 |
| 28 | Ga0070661_101681172 | 3300005344 | Bacteria | 537 |
| 29 | Ga0070692_10584284 | 3300005345 | Bacteria | 737 |
| 30 | Ga0070671_100196104 | 3300005355 | Bacteria | 1712 |
| 31 | Ga0070671_100343971 | 3300005355 | Bacteria | 1272 |
| 32 | Ga0070673_101410040 | 3300005364 | Bacteria | 656 |
| 33 | Ga0070688_101457107 | 3300005365 | Bacteria | 556 |
| 34 | Ga0070659_100092398 | 3300005366 | Bacteria | 2426 |
| 35 | Ga0070659_100604590 | 3300005366 | Bacteria | 943 |
| 36 | Ga0070709_10017436 | 3300005434 | Bacteria | 4119 |
| 37 | Ga0070709_10461595 | 3300005434 | Bacteria | 958 |
| 38 | Ga0070709_11690090 | 3300005434 | Bacteria | 517 |
| 39 | Ga0070714_100110722 | 3300005435 | Bacteria | 2431 |
| 40 | Ga0070714_100136979 | 3300005435 | Bacteria | 2193 |
| 41 | Ga0070714_100151639 | 3300005435 | Bacteria | 2089 |
| 42 | Ga0070714_100176148 | 3300005435 | Bacteria | 1943 |
| 43 | Ga0070714_100344436 | 3300005435 | Bacteria | 1399 |
| 44 | Ga0070714_100467554 | 3300005435 | Bacteria | 1199 |
| 45 | Ga0070714_101144122 | 3300005435 | Bacteria | 759 |
| 46 | Ga0070713_100001889 | 3300005436 | Bacteria | 13509 |
| 47 | Ga0070713_100164425 | 3300005436 | Bacteria | 1983 |
| 48 | Ga0070713_100216112 | 3300005436 | Bacteria | 1738 |
| 49 | Ga0070713_100300977 | 3300005436 | Bacteria | 1476 |
| 50 | Ga0070713_100515576 | 3300005436 | Bacteria | 1129 |
| 51 | Ga0070713_100558017 | 3300005436 | Bacteria | 1085 |
| 52 | Ga0070713_100781926 | 3300005436 | Bacteria | 914 |
| 53 | Ga0070713_100950975 | 3300005436 | Bacteria | 827 |
| 54 | Ga0070710_10010919 | 3300005437 | Bacteria | 4473 |
| 55 | Ga0070710_10146806 | 3300005437 | Bacteria | 1451 |
| 56 | Ga0070710_10255805 | 3300005437 | Bacteria | 1127 |
| 57 | Ga0070710_10691417 | 3300005437 | Bacteria | 719 |
| 58 | Ga0070710_11385746 | 3300005437 | Bacteria | 525 |
| 59 | Ga0070710_11423166 | 3300005437 | Bacteria | 519 |
| 60 | Ga0070711_100070624 | 3300005439 | Bacteria | 2459 |
| 61 | Ga0070711_100156742 | 3300005439 | Bacteria | 1722 |
| 62 | Ga0070711_100211761 | 3300005439 | Bacteria | 1501 |
| 63 | Ga0070711_100558421 | 3300005439 | Bacteria | 950 |
| 64 | Ga0070711_100672278 | 3300005439 | Bacteria | 870 |
| 65 | Ga0070711_100779369 | 3300005439 | Bacteria | 810 |
| 66 | Ga0070694_100430754 | 3300005444 | Bacteria | 1038 |
| 67 | Ga0070678_100861860 | 3300005456 | Bacteria | 826 |
| 68 | Ga0070681_10058143 | 3300005458 | Bacteria | 3847 |
| 69 | Ga0070681_10058693 | 3300005458 | Bacteria | 3828 |
| 70 | Ga0070681_10305342 | 3300005458 | Bacteria | 1501 |
| 71 | Ga0070681_10430288 | 3300005458 | Bacteria | 1232 |
| 72 | Ga0070681_10458078 | 3300005458 | Bacteria | 1188 |
| 73 | Ga0070681_10507286 | 3300005458 | Bacteria | 1119 |
| 74 | Ga0070681_10845706 | 3300005458 | Bacteria | 833 |
| 75 | Ga0070681_11182514 | 3300005458 | Bacteria | 686 |
| 76 | Ga0070706_101230138 | 3300005467 | Bacteria | 688 |
| 77 | Ga0070707_100001557 | 3300005468 | Bacteria | 22299 |
| 78 | Ga0070707_100219784 | 3300005468 | Bacteria | 1851 |
| 79 | Ga0070707_101110774 | 3300005468 | Bacteria | 757 |
| 80 | Ga0070707_101667398 | 3300005468 | Bacteria | 605 |
| 81 | Ga0070698_100704677 | 3300005471 | Bacteria | 952 |
| 82 | Ga0070699_100226417 | 3300005518 | Bacteria | 1667 |
| 83 | Ga0070699_101515360 | 3300005518 | Bacteria | 615 |
| 84 | Ga0070679_100029555 | 3300005530 | Bacteria | 5407 |
| 85 | Ga0070679_100031685 | 3300005530 | Bacteria | 5226 |
| 86 | Ga0070679_100211648 | 3300005530 | Bacteria | 1902 |
| 87 | Ga0070679_100440155 | 3300005530 | Bacteria | 1248 |
| 88 | Ga0070679_100777713 | 3300005530 | Bacteria | 900 |
| 89 | Ga0070679_100914897 | 3300005530 | Bacteria | 821 |
| 90 | Ga0070684_100219583 | 3300005535 | Bacteria | 1734 |
| 91 | Ga0070684_100235722 | 3300005535 | Bacteria | 1671 |
| 92 | Ga0070684_101138250 | 3300005535 | Bacteria | 734 |
| 93 | Ga0070697_101852114 | 3300005536 | Bacteria | 540 |
| 94 | Ga0068853_100101556 | 3300005539 | Bacteria | 2544 |
| 95 | Ga0068853_100105591 | 3300005539 | Bacteria | 2495 |
| 96 | Ga0068853_100241477 | 3300005539 | Bacteria | 1656 |
| 97 | Ga0070686_100476086 | 3300005544 | Bacteria | 965 |
| 98 | Ga0070695_100001595 | 3300005545 | Bacteria | 12688 |
| 99 | Ga0070696_100271892 | 3300005546 | Bacteria | 1289 |
| 100 | Ga0070696_101629837 | 3300005546 | Bacteria | 555 |
| 101 | Ga0070693_100112718 | 3300005547 | Bacteria | 1675 |
| 102 | Ga0070693_101085746 | 3300005547 | Bacteria | 609 |
| 103 | Ga0070665_101965948 | 3300005548 | Bacteria | 590 |
| 104 | Ga0068855_100134657 | 3300005563 | Bacteria | 2819 |
| 105 | Ga0068855_100337830 | 3300005563 | Bacteria | 1661 |
| 106 | Ga0068855_101046333 | 3300005563 | Bacteria | 856 |
| 107 | Ga0068855_101188660 | 3300005563 | Bacteria | 793 |
| 108 | Ga0068855_102193783 | 3300005563 | Bacteria | 554 |
| 109 | Ga0070664_100573869 | 3300005564 | Bacteria | 1045 |
| 110 | Ga0070664_100801225 | 3300005564 | Bacteria | 881 |
| 111 | Ga0068857_102382655 | 3300005577 | Bacteria | 520 |
| 112 | Ga0068854_100148807 | 3300005578 | Bacteria | 1803 |
| 113 | Ga0068856_100044555 | 3300005614 | Bacteria | 4366 |
| 114 | Ga0068856_100516157 | 3300005614 | Bacteria | 1216 |
| 115 | Ga0068856_100713547 | 3300005614 | Bacteria | 1023 |
| 116 | Ga0068856_100726016 | 3300005614 | Bacteria | 1014 |
| 117 | Ga0068856_102304928 | 3300005614 | Bacteria | 546 |
| 118 | Ga0068856_102682464 | 3300005614 | Bacteria | 504 |
| 119 | Ga0070702_100747547 | 3300005615 | Bacteria | 750 |
| 120 | Ga0070702_100939370 | 3300005615 | Bacteria | 680 |
| 121 | Ga0068852_101801721 | 3300005616 | Bacteria | 634 |
| 122 | Ga0068851_10015329 | 3300005834 | Bacteria | 3651 |
| 123 | Ga0068863_100995561 | 3300005841 | Bacteria | 841 |
| 124 | Ga0068858_100676985 | 3300005842 | Bacteria | 1003 |
| 125 | Ga0070717_10024999 | 3300006028 | Bacteria | 4744 |
| 126 | Ga0070717_10032247 | 3300006028 | Bacteria | 4221 |
| 127 | Ga0070717_10066861 | 3300006028 | Bacteria | 2989 |
| 128 | Ga0070717_10155594 | 3300006028 | Bacteria | 1980 |
| 129 | Ga0070717_10218267 | 3300006028 | Bacteria | 1675 |
| 130 | Ga0070717_10496628 | 3300006028 | Bacteria | 1102 |
| 131 | Ga0070717_10599239 | 3300006028 | Bacteria | 999 |
| 132 | Ga0070717_10614097 | 3300006028 | Bacteria | 986 |
| 133 | Ga0070717_11193205 | 3300006028 | Bacteria | 693 |
| 134 | Ga0070717_11829314 | 3300006028 | Bacteria | 549 |
| 135 | Ga0075365_10122569 | 3300006038 | Bacteria | 1794 |
| 136 | Ga0075363_100728631 | 3300006048 | Bacteria | 600 |
| 137 | Ga0075364_10058360 | 3300006051 | Bacteria | 2529 |
| 138 | Ga0070715_10009632 | 3300006163 | Bacteria | 3412 |
| 139 | Ga0070715_10413735 | 3300006163 | Bacteria | 752 |
| 140 | Ga0070715_10514279 | 3300006163 | Bacteria | 688 |
| 141 | Ga0070715_10590096 | 3300006163 | Bacteria | 650 |
| 142 | Ga0070715_10723898 | 3300006163 | Bacteria | 597 |
| 143 | Ga0070715_10775942 | 3300006163 | Bacteria | 579 |
| 144 | Ga0070715_10949007 | 3300006163 | Bacteria | 533 |
| 145 | Ga0070716_100092506 | 3300006173 | Bacteria | 1833 |
| 146 | Ga0070716_100350558 | 3300006173 | Bacteria | 1045 |
| 147 | Ga0070716_101366597 | 3300006173 | Bacteria | 575 |
| 148 | Ga0070712_100039318 | 3300006175 | Bacteria | 3237 |
| 149 | Ga0070712_100053818 | 3300006175 | Bacteria | 2811 |
| 150 | Ga0070712_100296916 | 3300006175 | Bacteria | 1306 |
| 151 | Ga0070712_100398211 | 3300006175 | Bacteria | 1136 |
| 152 | Ga0070712_100403627 | 3300006175 | Bacteria | 1129 |
| 153 | Ga0070712_100883850 | 3300006175 | Unclassified | 770 |
| 154 | Ga0070712_101134944 | 3300006175 | Bacteria | 679 |
| 155 | Ga0070712_101341917 | 3300006175 | Bacteria | 623 |
| 156 | Ga0075362_10231437 | 3300006177 | Bacteria | 905 |
| 157 | Ga0075427_10009962 | 3300006194 | Bacteria | 1419 |
| 158 | Ga0075366_10498016 | 3300006195 | Bacteria | 753 |
| 159 | Ga0097621_100337206 | 3300006237 | Bacteria | 1338 |
| 160 | Ga0097621_100452781 | 3300006237 | Bacteria | 1156 |
| 161 | Ga0068871_100787433 | 3300006358 | Bacteria | 876 |
| 162 | Ga0075431_100478487 | 3300006847 | Bacteria | 1238 |
| 163 | Ga0075434_100023313 | 3300006871 | Bacteria | 6029 |
| 164 | Ga0075434_100442008 | 3300006871 | Bacteria | 1322 |
| 165 | Ga0075429_100121893 | 3300006880 | Bacteria | 2279 |
| 166 | Ga0075436_100163299 | 3300006914 | Bacteria | 1571 |
| 167 | Ga0075436_100206199 | 3300006914 | Bacteria | 1393 |
| 168 | Ga0075435_100233597 | 3300007076 | Bacteria | 1563 |
| 169 | Ga0099795_10184457 | 3300007788 | Bacteria | 873 |
| 170 | Ga0099795_10264282 | 3300007788 | Bacteria | 746 |
| 171 | Ga0099795_10635403 | 3300007788 | Unclassified | 510 |
| 172 | Ga0105240_10134085 | 3300009093 | Bacteria | 2967 |
| 173 | Ga0105240_10171261 | 3300009093 | Bacteria | 2571 |
| 174 | Ga0105240_10223171 | 3300009093 | Bacteria | 2194 |
| 175 | Ga0105240_10328903 | 3300009093 | Bacteria | 1740 |
| 176 | Ga0105240_11753127 | 3300009093 | Bacteria | 648 |
| 177 | Ga0105240_12571101 | 3300009093 | Bacteria | 526 |
| 178 | Ga0111539_10470861 | 3300009094 | Bacteria | 1463 |
| 179 | Ga0105245_10119830 | 3300009098 | Bacteria | 2457 |
| 180 | Ga0105245_10122426 | 3300009098 | Bacteria | 2431 |
| 181 | Ga0105245_11500571 | 3300009098 | Bacteria | 725 |
| 182 | Ga0105245_13258598 | 3300009098 | Bacteria | 503 |
| 183 | Ga0105247_10691037 | 3300009101 | Bacteria | 767 |
| 184 | Ga0105241_10147872 | 3300009174 | Bacteria | 1919 |
| 185 | Ga0105241_10230726 | 3300009174 | Bacteria | 1560 |
| 186 | Ga0105241_10487278 | 3300009174 | Bacteria | 1097 |
| 187 | Ga0105241_10700830 | 3300009174 | Bacteria | 924 |
| 188 | Ga0105241_11364802 | 3300009174 | Bacteria | 677 |
| 189 | Ga0105241_11738871 | 3300009174 | Bacteria | 607 |
| 190 | Ga0105242_11295320 | 3300009176 | Bacteria | 752 |
| 191 | Ga0105242_11334161 | 3300009176 | Bacteria | 742 |
| 192 | Ga0105248_10212531 | 3300009177 | Bacteria | 2179 |
| 193 | Ga0105248_11178993 | 3300009177 | Bacteria | 866 |
| 194 | Ga0105248_11903165 | 3300009177 | Bacteria | 675 |
| 195 | Ga0105237_10043483 | 3300009545 | Bacteria | 4524 |
| 196 | Ga0105237_10325447 | 3300009545 | Bacteria | 1541 |
| 197 | Ga0105237_11210027 | 3300009545 | Bacteria | 762 |
| 198 | Ga0105237_11322894 | 3300009545 | Bacteria | 727 |
| 199 | Ga0105237_11411287 | 3300009545 | Bacteria | 703 |
| 200 | Ga0105238_10330845 | 3300009551 | Bacteria | 1510 |
| 201 | Ga0105238_10777340 | 3300009551 | Bacteria | 972 |
| 202 | Ga0099796_10010934 | 3300010159 | Bacteria | 2514 |
| 203 | Ga0099796_10203718 | 3300010159 | Bacteria | 804 |
| 204 | Ga0105239_12500776 | 3300010375 | Bacteria | 602 |
| 205 | Ga0105246_10241971 | 3300011119 | Bacteria | 1427 |
| 206 | Ga0105246_10585402 | 3300011119 | Bacteria | 962 |
| 207 | Ga0157373_10014976 | 3300013100 | Bacteria | 5674 |
| 208 | Ga0157370_10604266 | 3300013104 | Bacteria | 1004 |
| 209 | Ga0157369_10087346 | 3300013105 | Bacteria | 3330 |
| 210 | Ga0157369_10142418 | 3300013105 | Bacteria | 2536 |
| 211 | Ga0157369_10216222 | 3300013105 | Bacteria | 2007 |
| 212 | Ga0157369_10445493 | 3300013105 | Bacteria | 1341 |
| 213 | Ga0157369_10828456 | 3300013105 | Bacteria | 950 |
| 214 | Ga0157374_10125955 | 3300013296 | Bacteria | 2476 |
| 215 | Ga0157374_11490207 | 3300013296 | Bacteria | 700 |
| 216 | Ga0157374_11685697 | 3300013296 | Bacteria | 658 |
| 217 | Ga0157378_11152502 | 3300013297 | Bacteria | 814 |
| 218 | Ga0157378_11203224 | 3300013297 | Bacteria | 797 |
| 219 | Ga0157372_10064522 | 3300013307 | Bacteria | 4109 |
| 220 | Ga0157372_10561157 | 3300013307 | Bacteria | 1331 |
| 221 | Ga0157372_10662525 | 3300013307 | Bacteria | 1215 |
| 222 | Ga0157372_11116218 | 3300013307 | Bacteria | 912 |
| 223 | Ga0157372_11909731 | 3300013307 | Bacteria | 682 |
| 224 | Ga0157372_12330397 | 3300013307 | Bacteria | 615 |
| 225 | Ga0157375_13065081 | 3300013308 | Bacteria | 558 |
| 226 | Ga0163163_10762053 | 3300014325 | Bacteria | 1031 |
| 227 | Ga0157379_10933442 | 3300014968 | Unclassified | 824 |
| 228 | Ga0157379_12673584 | 3300014968 | Bacteria | 500 |
| 229 | Ga0157376_10744035 | 3300014969 | Bacteria | 989 |
| 230 | Ga0157376_12696163 | 3300014969 | Bacteria | 537 |
| 231 | Ga0182005_1106346 | 3300015265 | Bacteria | 790 |
| 232 | Ga0197907_10312120 | 3300020069 | Bacteria | 1940 |
| 233 | Ga0197907_10546277 | 3300020069 | Bacteria | 1826 |
| 234 | Ga0206356_10086887 | 3300020070 | Bacteria | 1596 |
| 235 | Ga0206356_10301690 | 3300020070 | Bacteria | 1113 |
| 236 | Ga0206356_11063222 | 3300020070 | Bacteria | 1003 |
| 237 | Ga0206355_1497636 | 3300020076 | Bacteria | 2365 |
| 238 | Ga0206352_10739254 | 3300020078 | Bacteria | 1053 |
| 239 | Ga0206350_10708420 | 3300020080 | Bacteria | 1308 |
| 240 | Ga0206350_11467011 | 3300020080 | Bacteria | 1459 |
| 241 | Ga0206354_10689420 | 3300020081 | Bacteria | 3821 |
| 242 | Ga0154015_1460751 | 3300020610 | Bacteria | 2633 |
| 243 | Ga0213873_10275428 | 3300021358 | Unclassified | 538 |
| 244 | Ga0213871_10050588 | 3300021441 | Bacteria | 1137 |
| 245 | Ga0224712_10018428 | 3300022467 | Bacteria | 2334 |
| 246 | Ga0224712_10122916 | 3300022467 | Bacteria | 1126 |
| 247 | Ga0224712_10602683 | 3300022467 | Bacteria | 536 |
| 248 | Ga0207692_10159266 | 3300025898 | Bacteria | 1300 |
| 249 | Ga0207692_10213019 | 3300025898 | Bacteria | 1142 |
| 250 | Ga0207692_10225369 | 3300025898 | Bacteria | 1113 |
| 251 | Ga0207692_10327167 | 3300025898 | Bacteria | 939 |
| 252 | Ga0207692_10522475 | 3300025898 | Bacteria | 755 |
| 253 | Ga0207692_10796425 | 3300025898 | Bacteria | 618 |
| 254 | Ga0207692_10941877 | 3300025898 | Unclassified | 569 |
| 255 | Ga0207685_10183933 | 3300025905 | Bacteria | 971 |
| 256 | Ga0207685_10455323 | 3300025905 | Bacteria | 666 |
| 257 | Ga0207685_10815975 | 3300025905 | Bacteria | 515 |
| 258 | Ga0207699_10084159 | 3300025906 | Bacteria | 1981 |
| 259 | Ga0207699_10667703 | 3300025906 | Bacteria | 760 |
| 260 | Ga0207705_10204804 | 3300025909 | Bacteria | 1495 |
| 261 | Ga0207684_10992048 | 3300025910 | Bacteria | 703 |
| 262 | Ga0207654_10247649 | 3300025911 | Bacteria | 1193 |
| 263 | Ga0207707_10060228 | 3300025912 | Bacteria | 3303 |
| 264 | Ga0207707_10112950 | 3300025912 | Bacteria | 2374 |
| 265 | Ga0207707_10118902 | 3300025912 | Bacteria | 2309 |
| 266 | Ga0207707_10397296 | 3300025912 | Bacteria | 1184 |
| 267 | Ga0207707_10687968 | 3300025912 | Bacteria | 860 |
| 268 | Ga0207707_10791687 | 3300025912 | Bacteria | 790 |
| 269 | Ga0207707_11445662 | 3300025912 | Bacteria | 547 |
| 270 | Ga0207695_10019365 | 3300025913 | Bacteria | 7837 |
| 271 | Ga0207695_10165626 | 3300025913 | Bacteria | 2139 |
| 272 | Ga0207695_10316508 | 3300025913 | Bacteria | 1450 |
| 273 | Ga0207695_10577350 | 3300025913 | Bacteria | 1006 |
| 274 | Ga0207695_11522045 | 3300025913 | Unclassified | 549 |
| 275 | Ga0207671_10305695 | 3300025914 | Bacteria | 1257 |
| 276 | Ga0207671_10430651 | 3300025914 | Bacteria | 1050 |
| 277 | Ga0207671_10563954 | 3300025914 | Bacteria | 908 |
| 278 | Ga0207693_10010040 | 3300025915 | Bacteria | 7692 |
| 279 | Ga0207693_10211632 | 3300025915 | Bacteria | 1524 |
| 280 | Ga0207693_10323591 | 3300025915 | Bacteria | 1207 |
| 281 | Ga0207693_10635009 | 3300025915 | Bacteria | 830 |
| 282 | Ga0207693_11370070 | 3300025915 | Bacteria | 526 |
| 283 | Ga0207663_10007294 | 3300025916 | Bacteria | 5724 |
| 284 | Ga0207663_10014665 | 3300025916 | Bacteria | 4299 |
| 285 | Ga0207663_10038998 | 3300025916 | Bacteria | 2875 |
| 286 | Ga0207663_10297633 | 3300025916 | Bacteria | 1204 |
| 287 | Ga0207663_10584439 | 3300025916 | Bacteria | 876 |
| 288 | Ga0207663_11242103 | 3300025916 | Bacteria | 600 |
| 289 | Ga0207660_10185962 | 3300025917 | Bacteria | 1616 |
| 290 | Ga0207660_10211949 | 3300025917 | Bacteria | 1517 |
| 291 | Ga0207660_10388022 | 3300025917 | Bacteria | 1123 |
| 292 | Ga0207660_10743714 | 3300025917 | Bacteria | 800 |
| 293 | Ga0207657_10009472 | 3300025919 | Bacteria | 9785 |
| 294 | Ga0207649_10909873 | 3300025920 | Bacteria | 690 |
| 295 | Ga0207652_10018101 | 3300025921 | Bacteria | 5776 |
| 296 | Ga0207652_10141070 | 3300025921 | Bacteria | 2155 |
| 297 | Ga0207652_10401758 | 3300025921 | Bacteria | 1236 |
| 298 | Ga0207652_10440567 | 3300025921 | Bacteria | 1174 |
| 299 | Ga0207652_10640341 | 3300025921 | Bacteria | 951 |
| 300 | Ga0207646_10000851 | 3300025922 | Bacteria | 39515 |
| 301 | Ga0207646_10446619 | 3300025922 | Bacteria | 1167 |
| 302 | Ga0207646_10557226 | 3300025922 | Bacteria | 1030 |
| 303 | Ga0207646_10680199 | 3300025922 | Bacteria | 921 |
| 304 | Ga0207694_10061850 | 3300025924 | Bacteria | 2914 |
| 305 | Ga0207694_10078228 | 3300025924 | Bacteria | 2592 |
| 306 | Ga0207687_10028606 | 3300025927 | Bacteria | 3745 |
| 307 | Ga0207687_10425289 | 3300025927 | Bacteria | 1097 |
| 308 | Ga0207687_11115484 | 3300025927 | Bacteria | 678 |
| 309 | Ga0207700_10043503 | 3300025928 | Bacteria | 3299 |
| 310 | Ga0207700_10045665 | 3300025928 | Bacteria | 3234 |
| 311 | Ga0207700_10047734 | 3300025928 | Bacteria | 3175 |
| 312 | Ga0207700_10154238 | 3300025928 | Bacteria | 1901 |
| 313 | Ga0207700_10344566 | 3300025928 | Bacteria | 1296 |
| 314 | Ga0207700_10414976 | 3300025928 | Bacteria | 1181 |
| 315 | Ga0207700_10456893 | 3300025928 | Bacteria | 1126 |
| 316 | Ga0207700_10876813 | 3300025928 | Bacteria | 803 |
| 317 | Ga0207700_11654402 | 3300025928 | Bacteria | 565 |
| 318 | Ga0207664_10120724 | 3300025929 | Bacteria | 2193 |
| 319 | Ga0207664_10134023 | 3300025929 | Bacteria | 2088 |
| 320 | Ga0207664_10177968 | 3300025929 | Bacteria | 1825 |
| 321 | Ga0207664_10255740 | 3300025929 | Bacteria | 1530 |
| 322 | Ga0207664_10551342 | 3300025929 | Bacteria | 1034 |
| 323 | Ga0207664_10744017 | 3300025929 | Bacteria | 882 |
| 324 | Ga0207664_10842197 | 3300025929 | Bacteria | 824 |
| 325 | Ga0207644_10145086 | 3300025931 | Bacteria | 1832 |
| 326 | Ga0207644_10175378 | 3300025931 | Bacteria | 1677 |
| 327 | Ga0207644_10563246 | 3300025931 | Bacteria | 944 |
| 328 | Ga0207690_10048034 | 3300025932 | Bacteria | 2835 |
| 329 | Ga0207686_11034469 | 3300025934 | Bacteria | 667 |
| 330 | Ga0207665_10006320 | 3300025939 | Bacteria | 7857 |
| 331 | Ga0207665_10145603 | 3300025939 | Bacteria | 1693 |
| 332 | Ga0207665_11144831 | 3300025939 | Bacteria | 620 |
| 333 | Ga0207711_10216478 | 3300025941 | Bacteria | 1750 |
| 334 | Ga0207711_10870950 | 3300025941 | Bacteria | 838 |
| 335 | Ga0207661_10055949 | 3300025944 | Bacteria | 3165 |
| 336 | Ga0207661_10097453 | 3300025944 | Bacteria | 2462 |
| 337 | Ga0207661_10129745 | 3300025944 | Bacteria | 2157 |
| 338 | Ga0207661_10283287 | 3300025944 | Bacteria | 1482 |
| 339 | Ga0207679_10054481 | 3300025945 | Bacteria | 2945 |
| 340 | Ga0207667_10042321 | 3300025949 | Bacteria | 4842 |
| 341 | Ga0207667_10795286 | 3300025949 | Bacteria | 943 |
| 342 | Ga0207667_11812427 | 3300025949 | Bacteria | 574 |
| 343 | Ga0207640_10035391 | 3300025981 | Bacteria | 3125 |
| 344 | Ga0207640_10081556 | 3300025981 | Bacteria | 2212 |
| 345 | Ga0207640_10777329 | 3300025981 | Bacteria | 828 |
| 346 | Ga0207677_11801609 | 3300026023 | Bacteria | 568 |
| 347 | Ga0207639_10072514 | 3300026041 | Bacteria | 2696 |
| 348 | Ga0207639_11004436 | 3300026041 | Bacteria | 781 |
| 349 | Ga0207678_10225189 | 3300026067 | Bacteria | 1605 |
| 350 | Ga0207702_10229248 | 3300026078 | Bacteria | 1735 |
| 351 | Ga0207702_11463146 | 3300026078 | Bacteria | 677 |
| 352 | Ga0207702_12337275 | 3300026078 | Bacteria | 522 |
| 353 | Ga0207674_10163490 | 3300026116 | Bacteria | 2180 |
| 354 | Ga0207674_10712070 | 3300026116 | Bacteria | 969 |
| 355 | Ga0207683_10532378 | 3300026121 | Bacteria | 1086 |
| 356 | Ga0207698_10850727 | 3300026142 | Bacteria | 917 |
| 357 | Ga0207428_10012556 | 3300027907 | Bacteria | 7436 |
| 358 | Ga0265337_1090291 | 3300028556 | Bacteria | 836 |
| 359 | Ga0265334_10010285 | 3300028573 | Bacteria | 3949 |
| 360 | Ga0265334_10192451 | 3300028573 | Bacteria | 710 |
| 361 | Ga0265323_10192547 | 3300028653 | Bacteria | 643 |
| 362 | Ga0265336_10001318 | 3300028666 | Bacteria | 11596 |
| 363 | Ga0265336_10051112 | 3300028666 | Bacteria | 1248 |
| 364 | Ga0265338_10012206 | 3300028800 | Bacteria | 9811 |
| 365 | Ga0265338_10045719 | 3300028800 | Bacteria | 4021 |
| 366 | Ga0265338_10061846 | 3300028800 | Bacteria | 3278 |
| 367 | Ga0265338_10132885 | 3300028800 | Bacteria | 1961 |
| 368 | Ga0265338_10216954 | 3300028800 | Bacteria | 1432 |
| 369 | Ga0265324_10018390 | 3300029957 | Bacteria | 2528 |
| 370 | Ga0265324_10024649 | 3300029957 | Bacteria | 2135 |
| 371 | Ga0265328_10327880 | 3300031239 | Bacteria | 594 |
| 372 | Ga0265320_10128667 | 3300031240 | Bacteria | 1151 |
| 373 | Ga0265327_10043865 | 3300031251 | Bacteria | 2389 |
| 374 | Ga0265327_10149635 | 3300031251 | Bacteria | 1085 |
| 375 | Ga0316575_10439971 | 3300031665 | Bacteria | 562 |
| 376 | Ga0307411_11588659 | 3300032005 | Bacteria | 603 |
| 377 | Ga0307415_100573123 | 3300032126 | Bacteria | 1000 |
| 378 | Ga0316583_10048556 | 3300032133 | Bacteria | 1494 |
| 379 | Ga0373926_0068448 | 3300035083 | Bacteria | 1301 |
| 380 | Ga0373928_0041285 | 3300035084 | Bacteria | 1060 |
| 381 | Ga0373934_0250118 | 3300035086 | Bacteria | 733 |
| 382 | Ga0373944_0028895 | 3300035089 | Bacteria | 1653 |
| 383 | Ga0373944_0051275 | 3300035089 | Bacteria | 1301 |
| 384 | Ga0373944_0085947 | 3300035089 | Bacteria | 1045 |
| 385 | Ga0373951_0068695 | 3300035091 | Bacteria | 899 |
| 386 | Ga0373923_0016587 | 3300035111 | Bacteria | 2801 |
| 387 | Ga0373923_0108662 | 3300035111 | Bacteria | 1230 |
| 388 | Ga0373936_0038606 | 3300035113 | Bacteria | 1909 |
| 389 | Ga0373945_0011792 | 3300035116 | Bacteria | 2894 |
| 390 | Ga0373945_0033929 | 3300035116 | Bacteria | 1816 |
| 391 | Ga0373953_0241629 | 3300035117 | Bacteria | 784 |
| 392 | Ga0373954_0217393 | 3300035118 | Bacteria | 940 |
| 393 | Ga0373954_0271068 | 3300035118 | Bacteria | 836 |
| 394 | Ga0373956_0020669 | 3300035119 | Bacteria | 2804 |
| 395 | Ga0373956_0045074 | 3300035119 | Bacteria | 1967 |
| 396 | Ga0373956_0108562 | 3300035119 | Bacteria | 1291 |
| 397 | Ga0373956_0137216 | 3300035119 | Bacteria | 1147 |
| 398 | Ga0373956_0171054 | 3300035119 | Bacteria | 1025 |
| 399 | Ga0373957_0037499 | 3300035120 | Bacteria | 1811 |
| 400 | Ga0373943_0056727 | 3300035170 | Bacteria | 1944 |
| 401 | Ga0373943_0090022 | 3300035170 | Bacteria | 1588 |
| 402 | Ga0373943_0400542 | 3300035170 | Bacteria | 792 |
| 403 | Ga0373946_0032271 | 3300035171 | Bacteria | 2102 |
| 404 | Ga0373946_0038632 | 3300035171 | Bacteria | 1945 |
| 405 | Ga0373946_0092261 | 3300035171 | Bacteria | 1344 |
| 406 | Ga0373946_0751966 | 3300035171 | Bacteria | 512 |
| 407 | Ga0373955_0205328 | 3300035172 | Bacteria | 1174 |
| 408 | Ga0373955_1055306 | 3300035172 | Bacteria | 501 |
| 409 | Ga0373942_0320235 | 3300035207 | Bacteria | 542 |
| 410 | Ga0373924_0000242 | 3300035410 | Bacteria | 16693 |
| 411 | Ga0373924_0048788 | 3300035410 | Bacteria | 1750 |
| 412 | Ga0373924_0054251 | 3300035410 | Bacteria | 1666 |
| 413 | Ga0373924_0197822 | 3300035410 | Bacteria | 886 |
| 414 | Ga0373924_0305434 | 3300035410 | Bacteria | 707 |
| 415 | Ga0373935_0072373 | 3300035692 | Bacteria | 2225 |
| 416 | Ga0373935_0128877 | 3300035692 | Bacteria | 1698 |
| 417 | Ga0373935_0148989 | 3300035692 | Bacteria | 1586 |
| 418 | Ga0373935_0194177 | 3300035692 | Bacteria | 1400 |
| 419 | Ga0373935_0243245 | 3300035692 | Bacteria | 1257 |
| 420 | Ga0373927_0096694 | 3300035695 | Bacteria | 1919 |
| 421 | Ga0373927_0688197 | 3300035695 | Bacteria | 676 |
| 422 | Ga0373933_0173499 | 3300035724 | Bacteria | 1373 |
| 423 | Ga0373933_0467701 | 3300035724 | Bacteria | 825 |
| 424 | Ga0373933_0572731 | 3300035724 | Bacteria | 741 |
| 425 | Ga0373933_0648975 | 3300035724 | Bacteria | 694 |
| 426 | Ga0373947_0013858 | 3300035725 | Bacteria | 4622 |
| 427 | Ga0373947_0017628 | 3300035725 | Bacteria | 4108 |
| 428 | Ga0373947_0465749 | 3300035725 | Bacteria | 857 |
| 429 | Ga0373937_0000317 | 3300036401 | Bacteria | 45743 |
| 430 | Ga0373937_0001944 | 3300036401 | Bacteria | 17289 |
| 431 | Ga0373937_0096763 | 3300036401 | Unclassified | 2738 |
| 432 | Ga0373937_0256233 | 3300036401 | Bacteria | 1649 |
| 433 | Ga0373937_0265433 | 3300036401 | Bacteria | 1619 |
| 434 | Ga0373937_0327505 | 3300036401 | Bacteria | 1450 |
| 435 | Ga0373937_1132295 | 3300036401 | Bacteria | 731 |
| 436 | Ga0373925_0002218 | 3300037068 | Bacteria | 15763 |
| 437 | Ga0373925_0003717 | 3300037068 | Bacteria | 11714 |
| 438 | Ga0373925_0089873 | 3300037068 | Bacteria | 2347 |
| 439 | Ga0373925_0232196 | 3300037068 | Bacteria | 1475 |
| 440 | Ga0373925_0329070 | 3300037068 | Bacteria | 1237 |
| 441 | Ga0373925_0928899 | 3300037068 | Bacteria | 717 |
| 442 | Ga0395899_0803237 | 3300037312 | Bacteria | 581 |
| 443 | Ga0395900_0118402 | 3300037418 | Bacteria | 2718 |
| 444 | Ga0395900_0736249 | 3300037418 | Bacteria | 917 |
| 445 | Ga0395900_1122443 | 3300037418 | Bacteria | 703 |
| 446 | Ga0395898_0309293 | 3300037466 | Bacteria | 1507 |
| 447 | Ga0395898_1135631 | 3300037466 | Bacteria | 714 |
| 448 | Ga0395901_0062267 | 3300038443 | Bacteria | 3883 |
| 449 | Ga0395901_1631285 | 3300038443 | Bacteria | 598 |
| 450 | Ga0436360_0135324 | 3300039438 | Bacteria | 849 |
| 451 | Ga0436360_0905307 | 3300039438 | Bacteria | 2670 |
| 452 | Ga0436363_0540326 | 3300039450 | Bacteria | 830 |
| 453 | Ga0436363_0679308 | 3300039450 | Bacteria | 708 |
| 454 | Ga0436362_0433861 | 3300039453 | Bacteria | 1097 |
| 455 | Ga0436362_0726135 | 3300039453 | Unclassified | 693 |
| 456 | Ga0451853_1876438 | 3300041512 | Bacteria | 978 |
| 457 | Ga0466969_0003758 | 3300044656 | Bacteria | 8068 |
| 458 | Ga0466969_0208345 | 3300044656 | Bacteria | 891 |
| 459 | Ga0466969_0257256 | 3300044656 | Bacteria | 791 |
| 460 | Ga0466969_0358769 | 3300044656 | Bacteria | 660 |
| 461 | Ga0466969_0406828 | 3300044656 | Bacteria | 618 |
| 462 | Ga0466972_0028090 | 3300044658 | Bacteria | 2779 |
| 463 | Ga0466965_0099802 | 3300044683 | Bacteria | 1484 |
| 464 | Ga0466965_0118199 | 3300044683 | Bacteria | 1367 |
| 465 | Ga0466965_0140467 | 3300044683 | Bacteria | 1257 |
| 466 | Ga0466966_0034146 | 3300044684 | Bacteria | 3291 |
| 467 | Ga0466966_0232314 | 3300044684 | Bacteria | 1112 |
| 468 | Ga0466961_0000463 | 3300044693 | Bacteria | 25666 |
| 469 | Ga0466961_0111236 | 3300044693 | Bacteria | 1723 |
| 470 | Ga0466961_0180385 | 3300044693 | Bacteria | 1311 |
| 471 | Ga0466961_0458119 | 3300044693 | Bacteria | 771 |
| 472 | Ga0466963_0000055 | 3300044694 | Bacteria | 37968 |
| 473 | Ga0466963_0002044 | 3300044694 | Bacteria | 11114 |
| 474 | Ga0466963_0003206 | 3300044694 | Bacteria | 9303 |
| 475 | Ga0466963_0004340 | 3300044694 | Bacteria | 8227 |
| 476 | Ga0466963_0006350 | 3300044694 | Bacteria | 6990 |
| 477 | Ga0466963_0006417 | 3300044694 | Bacteria | 6956 |
| 478 | Ga0466963_0017674 | 3300044694 | Bacteria | 4447 |
| 479 | Ga0466963_0026186 | 3300044694 | Bacteria | 3728 |
| 480 | Ga0466963_0098547 | 3300044694 | Bacteria | 1998 |
| 481 | Ga0466963_0100589 | 3300044694 | Bacteria | 1978 |
| 482 | Ga0466963_0117325 | 3300044694 | Bacteria | 1829 |
| 483 | Ga0466963_0136794 | 3300044694 | Bacteria | 1695 |
| 484 | Ga0466963_0149658 | 3300044694 | Bacteria | 1621 |
| 485 | Ga0466963_0157911 | 3300044694 | Bacteria | 1577 |
| 486 | Ga0466963_0297617 | 3300044694 | Bacteria | 1134 |
| 487 | Ga0466963_0715756 | 3300044694 | Bacteria | 706 |
| 488 | Ga0466963_1111911 | 3300044694 | Bacteria | 556 |
| 489 | Ga0466964_0002221 | 3300044706 | Bacteria | 6874 |
| 490 | Ga0466964_0004788 | 3300044706 | Bacteria | 5004 |
| 491 | Ga0466964_0007061 | 3300044706 | Bacteria | 4200 |
| 492 | Ga0466964_0032250 | 3300044706 | Bacteria | 2081 |
| 493 | Ga0466964_0040834 | 3300044706 | Bacteria | 1874 |
| 494 | Ga0466964_0118674 | 3300044706 | Bacteria | 1189 |
| 495 | Ga0466964_0550564 | 3300044706 | Bacteria | 626 |
| 496 | Ga0466971_0009943 | 3300044719 | Bacteria | 4155 |
| 497 | Ga0466971_0014877 | 3300044719 | Bacteria | 3424 |
| 498 | Ga0466971_0028795 | 3300044719 | Bacteria | 2484 |
| 499 | Ga0466971_0197881 | 3300044719 | Bacteria | 948 |
| 500 | Ga0466971_0627822 | 3300044719 | Bacteria | 537 |
| 501 | Ga0466968_0006506 | 3300044735 | Bacteria | 4407 |
| 502 | Ga0466968_0026161 | 3300044735 | Bacteria | 2393 |
| 503 | Ga0466968_0078858 | 3300044735 | Bacteria | 1444 |
| 504 | Ga0466968_0102939 | 3300044735 | Bacteria | 1276 |
| 505 | Ga0466968_0103843 | 3300044735 | Bacteria | 1271 |
| 506 | Ga0466968_0119909 | 3300044735 | Bacteria | 1189 |
| 507 | Ga0466968_0324786 | 3300044735 | Bacteria | 744 |
| 508 | Ga0466968_0594711 | 3300044735 | Bacteria | 558 |
| 509 | Ga0466970_0007299 | 3300044765 | Bacteria | 5538 |
| 510 | Ga0466970_0099572 | 3300044765 | Bacteria | 1582 |
| 511 | Ga0466970_0302138 | 3300044765 | Bacteria | 903 |
| 512 | Ga0466957_0000324 | 3300044842 | Bacteria | 23180 |
| 513 | Ga0466957_0014101 | 3300044842 | Bacteria | 4649 |
| 514 | Ga0466957_0016697 | 3300044842 | Bacteria | 4294 |
| 515 | Ga0466957_0020584 | 3300044842 | Bacteria | 3882 |
| 516 | Ga0466957_0029951 | 3300044842 | Bacteria | 3248 |
| 517 | Ga0466957_0051051 | 3300044842 | Bacteria | 2517 |
| 518 | Ga0466957_0087280 | 3300044842 | Bacteria | 1950 |
| 519 | Ga0466957_0088331 | 3300044842 | Bacteria | 1939 |
| 520 | Ga0466957_0089357 | 3300044842 | Bacteria | 1928 |
| 521 | Ga0466957_0157461 | 3300044842 | Bacteria | 1473 |
| 522 | Ga0466960_0010755 | 3300044901 | Bacteria | 3809 |
| 523 | Ga0466960_0293544 | 3300044901 | Bacteria | 914 |
| 524 | Ga0466960_0645135 | 3300044901 | Bacteria | 632 |
| 525 | Ga0466959_0000761 | 3300045049 | Bacteria | 18843 |
| 526 | Ga0466959_0006516 | 3300045049 | Bacteria | 8094 |
| 527 | Ga0466959_0022832 | 3300045049 | Bacteria | 4624 |
| 528 | Ga0466959_0024892 | 3300045049 | Bacteria | 4433 |
| 529 | Ga0466959_0081167 | 3300045049 | Bacteria | 2337 |
| 530 | Ga0466959_0770358 | 3300045049 | Bacteria | 644 |
| 531 | Ga0466958_0010924 | 3300045836 | Bacteria | 5100 |
| 532 | Ga0466958_0013846 | 3300045836 | Bacteria | 4599 |
| 533 | Ga0466958_0017011 | 3300045836 | Bacteria | 4196 |
| 534 | Ga0466958_0032328 | 3300045836 | Bacteria | 3112 |
| 535 | Ga0466958_0046813 | 3300045836 | Bacteria | 2610 |
| 536 | Ga0466958_0059711 | 3300045836 | Bacteria | 2320 |
| 537 | Ga0466958_0114187 | 3300045836 | Bacteria | 1687 |
| 538 | Ga0466958_0132994 | 3300045836 | Bacteria | 1563 |
| 539 | Ga0466958_0156288 | 3300045836 | Bacteria | 1439 |
| 540 | Ga0466958_0162661 | 3300045836 | Unclassified | 1411 |
| 541 | Ga0466958_0365792 | 3300045836 | Bacteria | 929 |
| 542 | Ga0466967_0002348 | 3300045976 | Bacteria | 11708 |
| 543 | Ga0466967_0008064 | 3300045976 | Bacteria | 7678 |
| 544 | Ga0466967_0028564 | 3300045976 | Bacteria | 4657 |
| 545 | Ga0466967_0041723 | 3300045976 | Bacteria | 3959 |
| 546 | Ga0466967_0043171 | 3300045976 | Bacteria | 3902 |
| 547 | Ga0466967_0053112 | 3300045976 | Bacteria | 3560 |
| 548 | Ga0466967_0054454 | 3300045976 | Bacteria | 3520 |
| 549 | Ga0466967_0055672 | 3300045976 | Bacteria | 3484 |
| 550 | Ga0466967_0065217 | 3300045976 | Bacteria | 3240 |
| 551 | Ga0466967_0078419 | 3300045976 | Bacteria | 2975 |
| 552 | Ga0466967_0154583 | 3300045976 | Bacteria | 2147 |
| 553 | Ga0466967_0237209 | 3300045976 | Bacteria | 1738 |
| 554 | Ga0466967_0662966 | 3300045976 | Bacteria | 1032 |
| 555 | Ga0466967_0798822 | 3300045976 | Bacteria | 937 |
| 556 | Ga0466967_0867123 | 3300045976 | Bacteria | 897 |
| 557 | Ga0466967_1155581 | 3300045976 | Bacteria | 771 |
| 558 | Ga0466967_1554092 | 3300045976 | Bacteria | 659 |
| 559 | Ga0495592_0000082 | 3300046454 | Bacteria | 83312 |
| 560 | Ga0495592_0005470 | 3300046454 | Bacteria | 9382 |
| 561 | Ga0495592_0924366 | 3300046454 | Unclassified | 511 |
| 562 | Ga0495603_0023747 | 3300046455 | Bacteria | 3709 |
| 563 | Ga0495603_0171058 | 3300046455 | Bacteria | 1258 |
| 564 | Ga0495629_0010441 | 3300046459 | Bacteria | 6755 |
| 565 | Ga0495629_0226670 | 3300046459 | Bacteria | 1288 |
| 566 | Ga0495629_0239139 | 3300046459 | Bacteria | 1250 |
| 567 | Ga0495641_0003735 | 3300046461 | Bacteria | 11202 |
| 568 | Ga0495641_0016679 | 3300046461 | Bacteria | 3859 |
| 569 | Ga0495641_0038273 | 3300046461 | Bacteria | 2241 |
| 570 | Ga0495641_0040370 | 3300046461 | Bacteria | 2170 |
| 571 | Ga0495641_0066121 | 3300046461 | Bacteria | 1627 |
| 572 | Ga0495641_0427807 | 3300046461 | Bacteria | 601 |
| 573 | Ga0495651_0000254 | 3300046462 | Bacteria | 41379 |
| 574 | Ga0495651_0054813 | 3300046462 | Bacteria | 3064 |
| 575 | Ga0495651_0151270 | 3300046462 | Bacteria | 1672 |
| 576 | Ga0495651_0172922 | 3300046462 | Bacteria | 1536 |
| 577 | Ga0495651_0364724 | 3300046462 | Bacteria | 951 |
| 578 | Ga0495653_0026259 | 3300046463 | Bacteria | 4673 |
| 579 | Ga0495653_0064924 | 3300046463 | Bacteria | 2749 |
| 580 | Ga0495653_0085887 | 3300046463 | Bacteria | 2313 |
| 581 | Ga0495653_0230533 | 3300046463 | Bacteria | 1239 |
| 582 | Ga0495653_0251795 | 3300046463 | Bacteria | 1172 |
| 583 | Ga0495653_0379087 | 3300046463 | Bacteria | 904 |
| 584 | Ga0495653_0436549 | 3300046463 | Bacteria | 826 |
| 585 | Ga0495580_0009973 | 3300046472 | Bacteria | 7427 |
| 586 | Ga0495580_0043132 | 3300046472 | Bacteria | 3211 |
| 587 | Ga0495580_0233122 | 3300046472 | Bacteria | 1263 |
| 588 | Ga0495582_0000026 | 3300046473 | Bacteria | 81238 |
| 589 | Ga0495582_0001703 | 3300046473 | Bacteria | 12403 |
| 590 | Ga0495582_0032710 | 3300046473 | Bacteria | 2859 |
| 591 | Ga0495582_0053130 | 3300046473 | Bacteria | 2234 |
| 592 | Ga0495582_0434783 | 3300046473 | Bacteria | 757 |
| 593 | Ga0495639_0000828 | 3300046475 | Bacteria | 14100 |
| 594 | Ga0495639_0003360 | 3300046475 | Bacteria | 6937 |
| 595 | Ga0495639_0109177 | 3300046475 | Bacteria | 1311 |
| 596 | Ga0495662_0002737 | 3300046476 | Bacteria | 8908 |
| 597 | Ga0495662_0115791 | 3300046476 | Bacteria | 1314 |
| 598 | Ga0495662_0205708 | 3300046476 | Bacteria | 970 |
| 599 | Ga0495664_0018869 | 3300046477 | Bacteria | 3958 |
| 600 | Ga0495664_0121953 | 3300046477 | Bacteria | 1576 |
| 601 | Ga0495664_0430044 | 3300046477 | Bacteria | 791 |
| 602 | Ga0495584_0126223 | 3300046491 | Bacteria | 1297 |
| 603 | Ga0495585_0274213 | 3300046492 | Bacteria | 835 |
| 604 | Ga0495594_0160050 | 3300046499 | Bacteria | 1280 |
| 605 | Ga0495596_0339715 | 3300046500 | Bacteria | 584 |
| 606 | Ga0495607_0111187 | 3300046501 | Bacteria | 1452 |
| 607 | Ga0495608_0003029 | 3300046511 | Bacteria | 11991 |
| 608 | Ga0495608_0096022 | 3300046511 | Bacteria | 1914 |
| 609 | Ga0495608_0130761 | 3300046511 | Bacteria | 1607 |
| 610 | Ga0495608_0336028 | 3300046511 | Bacteria | 931 |
| 611 | Ga0495618_0010074 | 3300046514 | Bacteria | 5714 |
| 612 | Ga0495618_0011530 | 3300046514 | Bacteria | 5362 |
| 613 | Ga0495618_0319775 | 3300046514 | Bacteria | 961 |
| 614 | Ga0495628_0008466 | 3300046516 | Bacteria | 8819 |
| 615 | Ga0495628_0013181 | 3300046516 | Bacteria | 6956 |
| 616 | Ga0495628_0232494 | 3300046516 | Bacteria | 1381 |
| 617 | Ga0495628_0382310 | 3300046516 | Bacteria | 1031 |
| 618 | Ga0495630_0018065 | 3300046517 | Bacteria | 5175 |
| 619 | Ga0495630_0021645 | 3300046517 | Bacteria | 4748 |
| 620 | Ga0495630_0150508 | 3300046517 | Bacteria | 1770 |
| 621 | Ga0495630_0375412 | 3300046517 | Bacteria | 1089 |
| 622 | Ga0495630_0467636 | 3300046517 | Bacteria | 966 |
| 623 | Ga0495630_0767403 | 3300046517 | Bacteria | 737 |
| 624 | Ga0495644_0014389 | 3300046523 | Bacteria | 3032 |
| 625 | Ga0495666_0000309 | 3300046526 | Bacteria | 21203 |
| 626 | Ga0495666_0034605 | 3300046526 | Bacteria | 2465 |
| 627 | Ga0495666_0165952 | 3300046526 | Bacteria | 1023 |
| 628 | Ga0495652_0000144 | 3300046529 | Bacteria | 80486 |
| 629 | Ga0495652_0005095 | 3300046529 | Bacteria | 12426 |
| 630 | Ga0495652_0155329 | 3300046529 | Bacteria | 1782 |
| 631 | Ga0495652_0167697 | 3300046529 | Bacteria | 1698 |
| 632 | Ga0495652_0250606 | 3300046529 | Bacteria | 1312 |
| 633 | Ga0495652_0357436 | 3300046529 | Bacteria | 1044 |
| 634 | Ga0495665_0003045 | 3300046531 | Bacteria | 9054 |
| 635 | Ga0495665_0034039 | 3300046531 | Bacteria | 2724 |
| 636 | Ga0495665_0039621 | 3300046531 | Bacteria | 2509 |
| 637 | Ga0495665_0163882 | 3300046531 | Bacteria | 1158 |
| 638 | Ga0495665_0280197 | 3300046531 | Bacteria | 855 |
| 639 | Ga0495640_0002828 | 3300046533 | Bacteria | 13955 |
| 640 | Ga0495640_0016017 | 3300046533 | Bacteria | 5621 |
| 641 | Ga0495586_0009993 | 3300046535 | Bacteria | 5056 |
| 642 | Ga0495586_0052645 | 3300046535 | Bacteria | 2204 |
| 643 | Ga0495586_0103455 | 3300046535 | Bacteria | 1582 |
| 644 | Ga0495586_0498505 | 3300046535 | Bacteria | 703 |
| 645 | Ga0495586_0870078 | 3300046535 | Bacteria | 519 |
| 646 | Ga0495587_0000060 | 3300046536 | Bacteria | 93780 |
| 647 | Ga0495587_0085570 | 3300046536 | Bacteria | 1825 |
| 648 | Ga0495587_0103806 | 3300046536 | Bacteria | 1636 |
| 649 | Ga0495645_0000038 | 3300046543 | Bacteria | 96124 |
| 650 | Ga0495645_0039870 | 3300046543 | Bacteria | 3425 |
| 651 | Ga0495645_0053801 | 3300046543 | Bacteria | 2925 |
| 652 | Ga0495645_0300345 | 3300046543 | Bacteria | 1049 |
| 653 | Ga0495645_0342188 | 3300046543 | Bacteria | 966 |
| 654 | Ga0495667_0008738 | 3300046559 | Bacteria | 6882 |
| 655 | Ga0495667_0024410 | 3300046559 | Bacteria | 4071 |
| 656 | Ga0495667_0363556 | 3300046559 | Bacteria | 913 |
| 657 | Ga0495667_0491190 | 3300046559 | Bacteria | 769 |
| 658 | Ga0495667_0644265 | 3300046559 | Bacteria | 658 |
| 659 | Ga0495656_0001194 | 3300046615 | Bacteria | 8463 |
| 660 | Ga0495668_0195081 | 3300046616 | Bacteria | 1109 |
| 661 | Ga0495634_0004455 | 3300046642 | Bacteria | 10990 |
| 662 | Ga0495634_0176455 | 3300046642 | Bacteria | 1340 |
| 663 | Ga0495634_0249060 | 3300046642 | Bacteria | 1087 |
| 664 | Ga0495634_0304457 | 3300046642 | Bacteria | 963 |
| 665 | Ga0495635_0054288 | 3300046663 | Bacteria | 2760 |
| 666 | Ga0495635_0105560 | 3300046663 | Bacteria | 1924 |
| 667 | Ga0495635_0145839 | 3300046663 | Bacteria | 1611 |
| 668 | Ga0495635_0199213 | 3300046663 | Bacteria | 1358 |
| 669 | Ga0495635_0533008 | 3300046663 | Bacteria | 771 |
| 670 | Ga0495635_0902373 | 3300046663 | Bacteria | 566 |
| 671 | Ga0495659_0159427 | 3300046664 | Bacteria | 910 |
| 672 | Ga0495659_0296734 | 3300046664 | Bacteria | 682 |
| 673 | Ga0495661_0184971 | 3300046665 | Bacteria | 1101 |
| 674 | Ga0495657_0021956 | 3300046675 | Bacteria | 4576 |
| 675 | Ga0495657_0029234 | 3300046675 | Bacteria | 3867 |
| 676 | Ga0495657_0047144 | 3300046675 | Bacteria | 2915 |
| 677 | Ga0495657_0430490 | 3300046675 | Bacteria | 774 |
| 678 | Ga0495657_0586943 | 3300046675 | Bacteria | 645 |
| 679 | Ga0495599_0003010 | 3300046678 | Bacteria | 9810 |
| 680 | Ga0495599_0042100 | 3300046678 | Bacteria | 2866 |
| 681 | Ga0495599_0089955 | 3300046678 | Bacteria | 1915 |
| 682 | Ga0495599_0202184 | 3300046678 | Bacteria | 1220 |
| 683 | Ga0495599_0409659 | 3300046678 | Bacteria | 806 |
| 684 | Ga0495623_0003795 | 3300046679 | Bacteria | 9954 |
| 685 | Ga0495623_0055744 | 3300046679 | Bacteria | 2490 |
| 686 | Ga0495623_0150041 | 3300046679 | Bacteria | 1379 |
| 687 | Ga0495623_0697149 | 3300046679 | Bacteria | 520 |
| 688 | Ga0495646_0016747 | 3300046680 | Bacteria | 4654 |
| 689 | Ga0495646_0027797 | 3300046680 | Bacteria | 3546 |
| 690 | Ga0495646_0156942 | 3300046680 | Bacteria | 1262 |
| 691 | Ga0495646_0226276 | 3300046680 | Bacteria | 1009 |
| 692 | Ga0495646_0627982 | 3300046680 | Bacteria | 544 |
| 693 | Ga0495647_0004236 | 3300046681 | Bacteria | 4644 |
| 694 | Ga0495647_0005065 | 3300046681 | Bacteria | 4314 |
| 695 | Ga0495647_0099172 | 3300046681 | Bacteria | 1204 |
| 696 | Ga0495647_0232320 | 3300046681 | Bacteria | 817 |
| 697 | Ga0495647_0264356 | 3300046681 | Bacteria | 768 |
| 698 | Ga0495658_0000498 | 3300046683 | Bacteria | 21575 |
| 699 | Ga0495658_0000984 | 3300046683 | Bacteria | 15108 |
| 700 | Ga0495658_0047423 | 3300046683 | Bacteria | 2420 |
| 701 | Ga0495658_0332836 | 3300046683 | Bacteria | 964 |
| 702 | Ga0495669_0408158 | 3300046684 | Bacteria | 658 |
| 703 | Ga0495613_0001744 | 3300046689 | Bacteria | 16553 |
| 704 | Ga0495613_0128745 | 3300046689 | Bacteria | 1813 |
| 705 | Ga0495613_0213996 | 3300046689 | Bacteria | 1354 |
| 706 | Ga0495613_0455603 | 3300046689 | Bacteria | 866 |
| 707 | Ga0495613_1017999 | 3300046689 | Bacteria | 531 |
| 708 | Ga0495624_0009825 | 3300046690 | Bacteria | 6618 |
| 709 | Ga0495624_0049047 | 3300046690 | Bacteria | 2678 |
| 710 | Ga0495624_0283882 | 3300046690 | Bacteria | 999 |
| 711 | Ga0495670_0514210 | 3300046691 | Bacteria | 651 |
| 712 | Ga0495671_0107132 | 3300046692 | Bacteria | 1365 |
| 713 | Ga0495589_0041461 | 3300046794 | Bacteria | 2297 |
| 714 | Ga0495600_0078080 | 3300046809 | Bacteria | 2162 |
| 715 | Ga0495600_0153794 | 3300046809 | Bacteria | 1488 |
| 716 | Ga0495600_0221860 | 3300046809 | Bacteria | 1209 |
| 717 | Ga0495600_0333773 | 3300046809 | Bacteria | 952 |
| 718 | Ga0495600_0361027 | 3300046809 | Bacteria | 909 |
| 719 | Ga0495600_0663369 | 3300046809 | Bacteria | 630 |
| 720 | Ga0495581_0017975 | 3300047315 | Bacteria | 4108 |
| 721 | Ga0495581_0165899 | 3300047315 | Bacteria | 1291 |
| 722 | Ga0495581_0577898 | 3300047315 | Bacteria | 651 |
| 723 | Ga0495604_0000043 | 3300047317 | Bacteria | 116335 |
| 724 | Ga0495604_0197841 | 3300047317 | Bacteria | 1396 |
| 725 | Ga0495604_0796393 | 3300047317 | Bacteria | 595 |
| 726 | Ga0495636_0239882 | 3300047318 | Bacteria | 836 |
| 727 | Ga0495674_0007325 | 3300047319 | Bacteria | 10549 |
| 728 | Ga0495674_0140659 | 3300047319 | Bacteria | 2029 |
| 729 | Ga0495674_0257624 | 3300047319 | Bacteria | 1434 |
| 730 | Ga0495674_0275889 | 3300047319 | Bacteria | 1378 |
| 731 | Ga0495674_1018773 | 3300047319 | Bacteria | 634 |
| 732 | Ga0495676_0036425 | 3300047321 | Bacteria | 4108 |
| 733 | Ga0495676_0055381 | 3300047321 | Bacteria | 3145 |
| 734 | Ga0495676_0127381 | 3300047321 | Bacteria | 1843 |
| 735 | Ga0495676_0216718 | 3300047321 | Bacteria | 1321 |
| 736 | Ga0495676_0258931 | 3300047321 | Bacteria | 1184 |
| 737 | Ga0495680_0005229 | 3300047322 | Bacteria | 12252 |
| 738 | Ga0495680_0009827 | 3300047322 | Bacteria | 8578 |
| 739 | Ga0495680_0010993 | 3300047322 | Bacteria | 8042 |
| 740 | Ga0495680_0063962 | 3300047322 | Bacteria | 2823 |
| 741 | Ga0495680_0077267 | 3300047322 | Bacteria | 2522 |
| 742 | Ga0495680_0530118 | 3300047322 | Bacteria | 796 |
| 743 | Ga0495680_0549402 | 3300047322 | Bacteria | 778 |
| 744 | Ga0495675_0000413 | 3300047444 | Bacteria | 29216 |
| 745 | Ga0495675_0382911 | 3300047444 | Bacteria | 822 |
| 746 | Ga0495677_0030197 | 3300047445 | Bacteria | 1972 |
| 747 | Ga0495679_106867 | 3300047446 | Bacteria | 773 |
| 748 | Ga0495684_0001111 | 3300047471 | Bacteria | 21659 |
| 749 | Ga0495684_0099178 | 3300047471 | Bacteria | 2202 |
| 750 | Ga0495684_0108121 | 3300047471 | Bacteria | 2100 |
| 751 | Ga0495684_0206246 | 3300047471 | Bacteria | 1447 |
| 752 | Ga0495593_0001256 | 3300047673 | Bacteria | 14872 |
| 753 | Ga0495593_0286655 | 3300047673 | Bacteria | 823 |
| 754 | Ga0495602_0022762 | 3300048088 | Bacteria | 6126 |
| 755 | Ga0495602_0105660 | 3300048088 | Bacteria | 2300 |
| 756 | Ga0495602_0239673 | 3300048088 | Bacteria | 1357 |
| 757 | Ga0495602_0268964 | 3300048088 | Bacteria | 1261 |
| 758 | Ga0495602_0295947 | 3300048088 | Bacteria | 1186 |
| 759 | Ga0495602_0463206 | 3300048088 | Bacteria | 893 |
| 760 | Ga0495602_0598781 | 3300048088 | Bacteria | 758 |
| 761 | Ga0495614_0011701 | 3300048089 | Bacteria | 3858 |
| 762 | Ga0495614_0015057 | 3300048089 | Bacteria | 3376 |
| 763 | Ga0495614_0026807 | 3300048089 | Bacteria | 2484 |
| 764 | Ga0495614_0389455 | 3300048089 | Bacteria | 653 |
| 765 | Ga0496100_0281157 | 3300048903 | Bacteria | 1240 |
| 766 | Ga0496100_1050046 | 3300048903 | Bacteria | 641 |
| 767 | Ga0496101_0006702 | 3300048904 | Bacteria | 7426 |
| 768 | Ga0496101_0120860 | 3300048904 | Bacteria | 1980 |
| 769 | Ga0496101_0181290 | 3300048904 | Bacteria | 1622 |
| 770 | Ga0496101_0224207 | 3300048904 | Bacteria | 1459 |
| 771 | Ga0496102_0008253 | 3300048905 | Bacteria | 8919 |
| 772 | Ga0496102_0033886 | 3300048905 | Bacteria | 4592 |
| 773 | Ga0496102_0235144 | 3300048905 | Bacteria | 1727 |
| 774 | Ga0496102_0344860 | 3300048905 | Bacteria | 1402 |
| 775 | Ga0496102_1327456 | 3300048905 | Bacteria | 638 |
| 776 | Ga0496103_0014004 | 3300048906 | Bacteria | 4761 |
| 777 | Ga0496103_0014605 | 3300048906 | Bacteria | 4666 |
| 778 | Ga0496103_0023874 | 3300048906 | Bacteria | 3689 |
| 779 | Ga0496104_0016980 | 3300048907 | Bacteria | 6621 |
| 780 | Ga0496104_0051298 | 3300048907 | Bacteria | 3893 |
| 781 | Ga0496104_0199048 | 3300048907 | Bacteria | 1915 |
| 782 | Ga0496104_0563054 | 3300048907 | Bacteria | 1050 |
| 783 | Ga0496105_0001128 | 3300048908 | Bacteria | 18606 |
| 784 | Ga0496105_0019672 | 3300048908 | Bacteria | 5446 |
| 785 | Ga0496105_0023605 | 3300048908 | Bacteria | 4990 |
| 786 | Ga0496105_0029069 | 3300048908 | Bacteria | 4523 |
| 787 | Ga0496105_0078938 | 3300048908 | Bacteria | 2718 |
| 788 | Ga0496105_0431356 | 3300048908 | Bacteria | 1042 |
| 789 | Ga0496105_1284798 | 3300048908 | Bacteria | 535 |
| 790 | Ga0496106_0144554 | 3300048909 | Bacteria | 1872 |
| 791 | Ga0496106_1012200 | 3300048909 | Bacteria | 653 |
| 792 | Ga0496107_0017701 | 3300048910 | Bacteria | 5013 |
| 793 | Ga0496107_0083102 | 3300048910 | Bacteria | 2335 |
| 794 | Ga0496107_0957903 | 3300048910 | Bacteria | 622 |
| 795 | Ga0496107_1164253 | 3300048910 | Bacteria | 555 |
| 796 | Ga0496107_1274392 | 3300048910 | Bacteria | 526 |
| 797 | Ga0496108_0024612 | 3300048911 | Bacteria | 4957 |
| 798 | Ga0496108_0050354 | 3300048911 | Bacteria | 3486 |
| 799 | Ga0496108_0058486 | 3300048911 | Bacteria | 3240 |
| 800 | Ga0496108_0408082 | 3300048911 | Bacteria | 1186 |
| 801 | Ga0496109_0040631 | 3300048912 | Bacteria | 4212 |
| 802 | Ga0496109_0113923 | 3300048912 | Bacteria | 2515 |
| 803 | Ga0496109_0210733 | 3300048912 | Bacteria | 1827 |
| 804 | Ga0496109_1160561 | 3300048912 | Bacteria | 709 |
| 805 | Ga0496109_1242564 | 3300048912 | Bacteria | 681 |
| 806 | Ga0496109_1298571 | 3300048912 | Bacteria | 664 |
| 807 | Ga0496109_1450675 | 3300048912 | Bacteria | 621 |
| 808 | Ga0496109_1635336 | 3300048912 | Bacteria | 578 |
| 809 | Ga0496110_0006968 | 3300048913 | Bacteria | 8993 |
| 810 | Ga0496110_0197095 | 3300048913 | Bacteria | 1829 |
| 811 | Ga0496110_0374762 | 3300048913 | Bacteria | 1297 |
| 812 | Ga0496110_0625153 | 3300048913 | Bacteria | 976 |
| 813 | Ga0496110_1018689 | 3300048913 | Bacteria | 735 |
| 814 | Ga0496110_1076392 | 3300048913 | Bacteria | 712 |
| 815 | Ga0496111_0003910 | 3300048914 | Bacteria | 9335 |
| 816 | Ga0496111_0011827 | 3300048914 | Bacteria | 5892 |
| 817 | Ga0496111_0084083 | 3300048914 | Bacteria | 2326 |
| 818 | Ga0496111_0194566 | 3300048914 | Bacteria | 1507 |
| 819 | Ga0496112_0000784 | 3300048915 | Bacteria | 22427 |
| 820 | Ga0496112_0064736 | 3300048915 | Bacteria | 3608 |
| 821 | Ga0496112_0224801 | 3300048915 | Bacteria | 1832 |
| 822 | Ga0496112_0380191 | 3300048915 | Bacteria | 1353 |
| 823 | Ga0496112_0457725 | 3300048915 | Bacteria | 1213 |
| 824 | Ga0496112_0694869 | 3300048915 | Bacteria | 945 |
| 825 | Ga0496112_0804901 | 3300048915 | Bacteria | 864 |
| 826 | Ga0496113_0005436 | 3300048916 | Bacteria | 7942 |
| 827 | Ga0496113_0131938 | 3300048916 | Bacteria | 1961 |
| 828 | Ga0496113_0211096 | 3300048916 | Bacteria | 1545 |
| 829 | Ga0496113_0959715 | 3300048916 | Bacteria | 674 |
| 830 | Ga0496114_0006185 | 3300048917 | Bacteria | 9424 |
| 831 | Ga0496114_0103270 | 3300048917 | Bacteria | 2436 |
| 832 | Ga0496114_0283771 | 3300048917 | Bacteria | 1460 |
| 833 | Ga0496114_0287895 | 3300048917 | Bacteria | 1449 |
| 834 | Ga0496114_0566131 | 3300048917 | Bacteria | 1003 |
| 835 | Ga0496115_0025749 | 3300048918 | Bacteria | 4584 |
| 836 | Ga0496115_0074971 | 3300048918 | Bacteria | 2747 |
| 837 | Ga0496115_0090233 | 3300048918 | Bacteria | 2503 |
| 838 | Ga0496115_0101048 | 3300048918 | Bacteria | 2364 |
| 839 | Ga0496115_0120815 | 3300048918 | Bacteria | 2156 |
| 840 | Ga0496115_0172141 | 3300048918 | Bacteria | 1790 |
| 841 | Ga0496115_0376840 | 3300048918 | Bacteria | 1154 |
| 842 | Ga0496115_0404621 | 3300048918 | Bacteria | 1107 |
| 843 | Ga0496115_0990093 | 3300048918 | Bacteria | 643 |
| 844 | Ga0501067_0026731 | 3300049583 | Bacteria | 3195 |
| 845 | Ga0501067_0097285 | 3300049583 | Bacteria | 1635 |
| 846 | nmdc:mga08y16_293463_c1 | 3300050511 | Bacteria | 1676 |
| 847 | nmdc:mga0n895_106199_c1 | 3300050512 | Bacteria | 2821 |
| 848 | nmdc:mga0n895_361774_c1 | 3300050512 | Bacteria | 1469 |
| 849 | nmdc:mga0rr50_87290_c1 | 3300050513 | Bacteria | 2421 |
| 850 | nmdc:mga08x19_284968_c1 | 3300050514 | Bacteria | 1145 |
| 851 | nmdc:mga08x19_488519_c1 | 3300050514 | Bacteria | 868 |
| 852 | nmdc:mga08x19_96779_c1 | 3300050514 | Bacteria | 1954 |
| 853 | nmdc:mga0a205_301697_c1 | 3300050515 | Bacteria | 1475 |
| 854 | Ga0495601_0012252 | 3300053077 | Bacteria | 5141 |
| 855 | Ga0495601_0089871 | 3300053077 | Bacteria | 1975 |
| 856 | Ga0495601_0095008 | 3300053077 | Bacteria | 1921 |
| 857 | Ga0495601_0193415 | 3300053077 | Bacteria | 1329 |
| 858 | Ga0495601_0552820 | 3300053077 | Bacteria | 740 |
| 859 | Ga0495601_0735573 | 3300053077 | Unclassified | 628 |
| 860 | Ga0495601_0792089 | 3300053077 | Bacteria | 602 |
| 861 | Ga0495612_0039191 | 3300053078 | Bacteria | 1926 |
| 862 | Ga0495612_0120054 | 3300053078 | Bacteria | 1130 |
| 863 | Ga0495612_0120460 | 3300053078 | Bacteria | 1128 |
| 864 | Ga0495612_0247953 | 3300053078 | Bacteria | 792 |
| 865 | Ga0495612_0250014 | 3300053078 | Bacteria | 788 |
| 866 | Ga0495595_0008486 | 3300053084 | Bacteria | 4218 |
| 867 | Ga0495595_0015490 | 3300053084 | Bacteria | 3252 |
| 868 | Ga0495595_0045351 | 3300053084 | Bacteria | 2022 |
| 869 | Ga0495595_0046722 | 3300053084 | Bacteria | 1995 |
| 870 | Ga0495595_0137177 | 3300053084 | Bacteria | 1198 |
| 871 | Ga0495595_0255532 | 3300053084 | Bacteria | 878 |
| 872 | Ga0495595_0533035 | 3300053084 | Bacteria | 599 |
| 873 | Ga0495619_0015579 | 3300053085 | Bacteria | 4811 |
| 874 | Ga0495619_0036099 | 3300053085 | Bacteria | 3217 |
| 875 | Ga0495619_0160969 | 3300053085 | Bacteria | 1550 |
| 876 | Ga0495619_0198067 | 3300053085 | Bacteria | 1390 |
| 877 | Ga0495619_0291703 | 3300053085 | Bacteria | 1130 |
| 878 | Ga0495619_0861149 | 3300053085 | Bacteria | 611 |
| 879 | Ga0495619_0875750 | 3300053085 | Bacteria | 605 |
| 880 | Ga0587084_083549 | 3300059477 | Bacteria | 622 |
| 881 | Ga0587093_004598 | 3300059478 | Bacteria | 1416 |
| 882 | Ga0587066_003399 | 3300059490 | Bacteria | 1866 |
| 883 | Ga0587070_036098 | 3300059491 | Bacteria | 923 |
| 884 | Ga0587070_116130 | 3300059491 | Bacteria | 634 |
| 885 | Ga0587073_0045665 | 3300059492 | Bacteria | 973 |
| 886 | Ga0587073_0253379 | 3300059492 | Bacteria | 553 |
| 887 | Ga0587077_013617 | 3300059493 | Bacteria | 1323 |
| 888 | Ga0587080_016333 | 3300059503 | Bacteria | 1171 |
| 889 | Ga0587082_040804 | 3300059504 | Bacteria | 850 |
| 890 | Ga0587083_0017472 | 3300059505 | Bacteria | 1283 |
| 891 | Ga0587091_017544 | 3300059511 | Bacteria | 1207 |
| 892 | Ga0587091_227942 | 3300059511 | Bacteria | 513 |
| 893 | Ga0587092_141637 | 3300059512 | Bacteria | 530 |
| 894 | Ga0587094_100316 | 3300059513 | Bacteria | 558 |
| 895 | Ga0587095_034152 | 3300059514 | Bacteria | 536 |
| 896 | Ga0587098_050366 | 3300059604 | Bacteria | 631 |
| 897 | Ga0587106_143625 | 3300059605 | Bacteria | 525 |
| 898 | Ga0587101_019781 | 3300059623 | Bacteria | 957 |
| 899 | Ga0587113_007713 | 3300059625 | Bacteria | 943 |
| 900 | Ga0587128_025778 | 3300059630 | Bacteria | 939 |
| 901 | Ga0587128_034818 | 3300059630 | Bacteria | 854 |
| 902 | Ga0587069_099660 | 3300059642 | Bacteria | 592 |
| 903 | Ga0587072_092623 | 3300059643 | Bacteria | 668 |
| 904 | Ga0587075_015933 | 3300059644 | Bacteria | 1063 |
| 905 | Ga0587076_016640 | 3300059645 | Bacteria | 1163 |
| 906 | Ga0587076_180546 | 3300059645 | Unclassified | 531 |
| 907 | Ga0587079_085088 | 3300059647 | Bacteria | 730 |
| 908 | Ga0587114_035975 | 3300059655 | Bacteria | 781 |
| 909 | Ga0587071_124155 | 3300060344 | Bacteria | 620 |
| 910 | Ga0587111_0168740 | 3300060346 | Bacteria | 600 |
| 911 | Ga0466962_0016173 | 3300061719 | Bacteria | 3598 |
| 912 | Ga0466962_0024543 | 3300061719 | Bacteria | 2896 |
| 913 | Ga0466962_0040609 | 3300061719 | Bacteria | 2226 |
| 914 | Ga0070711_100593138 | |||
| 915 | Ga0058863_10034036 | |||
| 916 | Ga0058863_11909291 | |||
| 917 | Ga0058861_11767971 | |||
| 918 | Ga0058861_11855680 | |||
| 919 | Ga0058862_10109718 | |||
| 920 | Ga0058862_12460894 | |||
| 921 | Ga0070658_10182830 | |||
| 922 | Ga0070683_100053944 | |||
| 923 | Ga0070683_100167030 | |||
| 924 | Ga0070683_100226293 | |||
| 925 | Ga0070683_100260469 | |||
| 926 | Ga0070683_100329097 | |||
| 927 | Ga0070690_101290689 | |||
| 928 | Ga0070680_100012157 | |||
| 929 | Ga0070680_100075346 | |||
| 930 | Ga0070680_100330437 | |||
| 931 | Ga0070680_101051327 | |||
| 932 | Ga0070682_100122110 | |||
| 933 | Ga0070682_100439148 | |||
| 934 | Ga0070682_100759766 | |||
| 935 | Ga0070682_100891581 | |||
| 936 | Ga0070682_101775313 | |||
| 937 | Ga0068868_100118699 | |||
| 938 | Ga0068868_100212391 | |||
| 939 | Ga0070687_100840424 | |||
| 940 | Ga0070661_100040522 | |||
| 941 | Ga0070661_101681172 | |||
| 942 | Ga0070692_10584284 | |||
| 943 | Ga0070671_100196104 | |||
| 944 | Ga0070671_100343971 | |||
| 945 | Ga0070673_101410040 | |||
| 946 | Ga0070688_101457107 | |||
| 947 | Ga0070659_100092398 | |||
| 948 | Ga0070659_100604590 | |||
| 949 | Ga0070709_10017436 | |||
| 950 | Ga0070709_10461595 | |||
| 951 | Ga0070709_11690090 | |||
| 952 | Ga0070714_100110722 | |||
| 953 | Ga0070714_100136979 | |||
| 954 | Ga0070714_100151639 | |||
| 955 | Ga0070714_100176148 | |||
| 956 | Ga0070714_100344436 | |||
| 957 | Ga0070714_100467554 | |||
| 958 | Ga0070714_101144122 | |||
| 959 | Ga0070713_100001889 | |||
| 960 | Ga0070713_100164425 | |||
| 961 | Ga0070713_100216112 | |||
| 962 | Ga0070713_100300977 | |||
| 963 | Ga0070713_100515576 | |||
| 964 | Ga0070713_100558017 | |||
| 965 | Ga0070713_100781926 | |||
| 966 | Ga0070713_100950975 | |||
| 967 | Ga0070710_10010919 | |||
| 968 | Ga0070710_10146806 | |||
| 969 | Ga0070710_10255805 | |||
| 970 | Ga0070710_10691417 | |||
| 971 | Ga0070710_11385746 | |||
| 972 | Ga0070710_11423166 | |||
| 973 | Ga0070711_100070624 | |||
| 974 | Ga0070711_100156742 | |||
| 975 | Ga0070711_100211761 | |||
| 976 | Ga0070711_100558421 | |||
| 977 | Ga0070711_100672278 | |||
| 978 | Ga0070711_100779369 | |||
| 979 | Ga0070694_100430754 | |||
| 980 | Ga0070678_100861860 | |||
| 981 | Ga0070681_10058143 | |||
| 982 | Ga0070681_10058693 | |||
| 983 | Ga0070681_10305342 | |||
| 984 | Ga0070681_10430288 | |||
| 985 | Ga0070681_10458078 | |||
| 986 | Ga0070681_10507286 | |||
| 987 | Ga0070681_10845706 | |||
| 988 | Ga0070681_11182514 | |||
| 989 | Ga0070706_101230138 | |||
| 990 | Ga0070707_100001557 | |||
| 991 | Ga0070707_100219784 | |||
| 992 | Ga0070707_101110774 | |||
| 993 | Ga0070707_101667398 | |||
| 994 | Ga0070698_100704677 | |||
| 995 | Ga0070699_100226417 | |||
| 996 | Ga0070699_101515360 | |||
| 997 | Ga0070679_100029555 | |||
| 998 | Ga0070679_100031685 | |||
| 999 | Ga0070679_100211648 | |||
| 1000 | Ga0070679_100440155 | |||
| 1001 | Ga0070679_100777713 | |||
| 1002 | Ga0070679_100914897 | |||
| 1003 | Ga0070684_100219583 | |||
| 1004 | Ga0070684_100235722 | |||
| 1005 | Ga0070684_101138250 | |||
| 1006 | Ga0070697_101852114 | |||
| 1007 | Ga0068853_100101556 | |||
| 1008 | Ga0068853_100105591 | |||
| 1009 | Ga0068853_100241477 | |||
| 1010 | Ga0070686_100476086 | |||
| 1011 | Ga0070695_100001595 | |||
| 1012 | Ga0070696_100271892 | |||
| 1013 | Ga0070696_101629837 | |||
| 1014 | Ga0070693_100112718 | |||
| 1015 | Ga0070693_101085746 | |||
| 1016 | Ga0070665_101965948 | |||
| 1017 | Ga0068855_100134657 | |||
| 1018 | Ga0068855_100337830 | |||
| 1019 | Ga0068855_101046333 | |||
| 1020 | Ga0068855_101188660 | |||
| 1021 | Ga0068855_102193783 | |||
| 1022 | Ga0070664_100573869 | |||
| 1023 | Ga0070664_100801225 | |||
| 1024 | Ga0068857_102382655 | |||
| 1025 | Ga0068854_100148807 | |||
| 1026 | Ga0068856_100044555 | |||
| 1027 | Ga0068856_100516157 | |||
| 1028 | Ga0068856_100713547 | |||
| 1029 | Ga0068856_100726016 | |||
| 1030 | Ga0068856_102304928 | |||
| 1031 | Ga0068856_102682464 | |||
| 1032 | Ga0070702_100747547 | |||
| 1033 | Ga0070702_100939370 | |||
| 1034 | Ga0068852_101801721 | |||
| 1035 | Ga0068851_10015329 | |||
| 1036 | Ga0068863_100995561 | |||
| 1037 | Ga0068858_100676985 | |||
| 1038 | Ga0070717_10024999 | |||
| 1039 | Ga0070717_10032247 | |||
| 1040 | Ga0070717_10066861 | |||
| 1041 | Ga0070717_10155594 | |||
| 1042 | Ga0070717_10218267 | |||
| 1043 | Ga0070717_10496628 | |||
| 1044 | Ga0070717_10599239 | |||
| 1045 | Ga0070717_10614097 | |||
| 1046 | Ga0070717_11193205 | |||
| 1047 | Ga0070717_11829314 | |||
| 1048 | Ga0075365_10122569 | |||
| 1049 | Ga0075363_100728631 | |||
| 1050 | Ga0075364_10058360 | |||
| 1051 | Ga0070715_10009632 | |||
| 1052 | Ga0070715_10413735 | |||
| 1053 | Ga0070715_10514279 | |||
| 1054 | Ga0070715_10590096 | |||
| 1055 | Ga0070715_10723898 | |||
| 1056 | Ga0070715_10775942 | |||
| 1057 | Ga0070715_10949007 | |||
| 1058 | Ga0070716_100092506 | |||
| 1059 | Ga0070716_100350558 | |||
| 1060 | Ga0070716_101366597 | |||
| 1061 | Ga0070712_100039318 | |||
| 1062 | Ga0070712_100053818 | |||
| 1063 | Ga0070712_100296916 | |||
| 1064 | Ga0070712_100398211 | |||
| 1065 | Ga0070712_100403627 | |||
| 1066 | Ga0070712_100883850 | |||
| 1067 | Ga0070712_101134944 | |||
| 1068 | Ga0070712_101341917 | |||
| 1069 | Ga0075362_10231437 | |||
| 1070 | Ga0075427_10009962 | |||
| 1071 | Ga0075366_10498016 | |||
| 1072 | Ga0097621_100337206 | |||
| 1073 | Ga0097621_100452781 | |||
| 1074 | Ga0068871_100787433 | |||
| 1075 | Ga0075431_100478487 | |||
| 1076 | Ga0075434_100023313 | |||
| 1077 | Ga0075434_100442008 | |||
| 1078 | Ga0075429_100121893 | |||
| 1079 | Ga0075436_100163299 | |||
| 1080 | Ga0075436_100206199 | |||
| 1081 | Ga0075435_100233597 | |||
| 1082 | Ga0099795_10184457 | |||
| 1083 | Ga0099795_10264282 | |||
| 1084 | Ga0099795_10635403 | |||
| 1085 | Ga0105240_10134085 | |||
| 1086 | Ga0105240_10171261 | |||
| 1087 | Ga0105240_10223171 | |||
| 1088 | Ga0105240_10328903 | |||
| 1089 | Ga0105240_11753127 | |||
| 1090 | Ga0105240_12571101 | |||
| 1091 | Ga0111539_10470861 | |||
| 1092 | Ga0105245_10119830 | |||
| 1093 | Ga0105245_10122426 | |||
| 1094 | Ga0105245_11500571 | |||
| 1095 | Ga0105245_13258598 | |||
| 1096 | Ga0105247_10691037 | |||
| 1097 | Ga0105241_10147872 | |||
| 1098 | Ga0105241_10230726 | |||
| 1099 | Ga0105241_10487278 | |||
| 1100 | Ga0105241_10700830 | |||
| 1101 | Ga0105241_11364802 | |||
| 1102 | Ga0105241_11738871 | |||
| 1103 | Ga0105242_11295320 | |||
| 1104 | Ga0105242_11334161 | |||
| 1105 | Ga0105248_10212531 | |||
| 1106 | Ga0105248_11178993 | |||
| 1107 | Ga0105248_11903165 | |||
| 1108 | Ga0105237_10043483 | |||
| 1109 | Ga0105237_10325447 | |||
| 1110 | Ga0105237_11210027 | |||
| 1111 | Ga0105237_11322894 | |||
| 1112 | Ga0105237_11411287 | |||
| 1113 | Ga0105238_10330845 | |||
| 1114 | Ga0105238_10777340 | |||
| 1115 | Ga0099796_10010934 | |||
| 1116 | Ga0099796_10203718 | |||
| 1117 | Ga0105239_12500776 | |||
| 1118 | Ga0105246_10241971 | |||
| 1119 | Ga0105246_10585402 | |||
| 1120 | Ga0157373_10014976 | |||
| 1121 | Ga0157370_10604266 | |||
| 1122 | Ga0157369_10087346 | |||
| 1123 | Ga0157369_10142418 | |||
| 1124 | Ga0157369_10216222 | |||
| 1125 | Ga0157369_10445493 | |||
| 1126 | Ga0157369_10828456 | |||
| 1127 | Ga0157374_10125955 | |||
| 1128 | Ga0157374_11490207 | |||
| 1129 | Ga0157374_11685697 | |||
| 1130 | Ga0157378_11152502 | |||
| 1131 | Ga0157378_11203224 | |||
| 1132 | Ga0157372_10064522 | |||
| 1133 | Ga0157372_10561157 | |||
| 1134 | Ga0157372_10662525 | |||
| 1135 | Ga0157372_11116218 | |||
| 1136 | Ga0157372_11909731 | |||
| 1137 | Ga0157372_12330397 | |||
| 1138 | Ga0157375_13065081 | |||
| 1139 | Ga0163163_10762053 | |||
| 1140 | Ga0157379_10933442 | |||
| 1141 | Ga0157379_12673584 | |||
| 1142 | Ga0157376_10744035 | |||
| 1143 | Ga0157376_12696163 | |||
| 1144 | Ga0182005_1106346 | |||
| 1145 | Ga0197907_10312120 | |||
| 1146 | Ga0197907_10546277 | |||
| 1147 | Ga0206356_10086887 | |||
| 1148 | Ga0206356_10301690 | |||
| 1149 | Ga0206356_11063222 | |||
| 1150 | Ga0206355_1497636 | |||
| 1151 | Ga0206352_10739254 | |||
| 1152 | Ga0206350_10708420 | |||
| 1153 | Ga0206350_11467011 | |||
| 1154 | Ga0206354_10689420 | |||
| 1155 | Ga0154015_1460751 | |||
| 1156 | Ga0213873_10275428 | |||
| 1157 | Ga0213871_10050588 | |||
| 1158 | Ga0224712_10018428 | |||
| 1159 | Ga0224712_10122916 | |||
| 1160 | Ga0224712_10602683 | |||
| 1161 | Ga0207692_10159266 | |||
| 1162 | Ga0207692_10213019 | |||
| 1163 | Ga0207692_10225369 | |||
| 1164 | Ga0207692_10327167 | |||
| 1165 | Ga0207692_10522475 | |||
| 1166 | Ga0207692_10796425 | |||
| 1167 | Ga0207692_10941877 | |||
| 1168 | Ga0207685_10183933 | |||
| 1169 | Ga0207685_10455323 | |||
| 1170 | Ga0207685_10815975 | |||
| 1171 | Ga0207699_10084159 | |||
| 1172 | Ga0207699_10667703 | |||
| 1173 | Ga0207705_10204804 | |||
| 1174 | Ga0207684_10992048 | |||
| 1175 | Ga0207654_10247649 | |||
| 1176 | Ga0207707_10060228 | |||
| 1177 | Ga0207707_10112950 | |||
| 1178 | Ga0207707_10118902 | |||
| 1179 | Ga0207707_10397296 | |||
| 1180 | Ga0207707_10687968 | |||
| 1181 | Ga0207707_10791687 | |||
| 1182 | Ga0207707_11445662 | |||
| 1183 | Ga0207695_10019365 | |||
| 1184 | Ga0207695_10165626 | |||
| 1185 | Ga0207695_10316508 | |||
| 1186 | Ga0207695_10577350 | |||
| 1187 | Ga0207695_11522045 | |||
| 1188 | Ga0207671_10305695 | |||
| 1189 | Ga0207671_10430651 | |||
| 1190 | Ga0207671_10563954 | |||
| 1191 | Ga0207693_10010040 | |||
| 1192 | Ga0207693_10211632 | |||
| 1193 | Ga0207693_10323591 | |||
| 1194 | Ga0207693_10635009 | |||
| 1195 | Ga0207693_11370070 | |||
| 1196 | Ga0207663_10007294 | |||
| 1197 | Ga0207663_10014665 | |||
| 1198 | Ga0207663_10038998 | |||
| 1199 | Ga0207663_10297633 | |||
| 1200 | Ga0207663_10584439 | |||
| 1201 | Ga0207663_11242103 | |||
| 1202 | Ga0207660_10185962 | |||
| 1203 | Ga0207660_10211949 | |||
| 1204 | Ga0207660_10388022 | |||
| 1205 | Ga0207660_10743714 | |||
| 1206 | Ga0207657_10009472 | |||
| 1207 | Ga0207649_10909873 | |||
| 1208 | Ga0207652_10018101 | |||
| 1209 | Ga0207652_10141070 | |||
| 1210 | Ga0207652_10401758 | |||
| 1211 | Ga0207652_10440567 | |||
| 1212 | Ga0207652_10640341 | |||
| 1213 | Ga0207646_10000851 | |||
| 1214 | Ga0207646_10446619 | |||
| 1215 | Ga0207646_10557226 | |||
| 1216 | Ga0207646_10680199 | |||
| 1217 | Ga0207694_10061850 | |||
| 1218 | Ga0207694_10078228 | |||
| 1219 | Ga0207687_10028606 | |||
| 1220 | Ga0207687_10425289 | |||
| 1221 | Ga0207687_11115484 | |||
| 1222 | Ga0207700_10043503 | |||
| 1223 | Ga0207700_10045665 | |||
| 1224 | Ga0207700_10047734 | |||
| 1225 | Ga0207700_10154238 | |||
| 1226 | Ga0207700_10344566 | |||
| 1227 | Ga0207700_10414976 | |||
| 1228 | Ga0207700_10456893 | |||
| 1229 | Ga0207700_10876813 | |||
| 1230 | Ga0207700_11654402 | |||
| 1231 | Ga0207664_10120724 | |||
| 1232 | Ga0207664_10134023 | |||
| 1233 | Ga0207664_10177968 | |||
| 1234 | Ga0207664_10255740 | |||
| 1235 | Ga0207664_10551342 | |||
| 1236 | Ga0207664_10744017 | |||
| 1237 | Ga0207664_10842197 | |||
| 1238 | Ga0207644_10145086 | |||
| 1239 | Ga0207644_10175378 | |||
| 1240 | Ga0207644_10563246 | |||
| 1241 | Ga0207690_10048034 | |||
| 1242 | Ga0207686_11034469 | |||
| 1243 | Ga0207665_10006320 | |||
| 1244 | Ga0207665_10145603 | |||
| 1245 | Ga0207665_11144831 | |||
| 1246 | Ga0207711_10216478 | |||
| 1247 | Ga0207711_10870950 | |||
| 1248 | Ga0207661_10055949 | |||
| 1249 | Ga0207661_10097453 | |||
| 1250 | Ga0207661_10129745 | |||
| 1251 | Ga0207661_10283287 | |||
| 1252 | Ga0207679_10054481 | |||
| 1253 | Ga0207667_10042321 | |||
| 1254 | Ga0207667_10795286 | |||
| 1255 | Ga0207667_11812427 | |||
| 1256 | Ga0207640_10035391 | |||
| 1257 | Ga0207640_10081556 | |||
| 1258 | Ga0207640_10777329 | |||
| 1259 | Ga0207677_11801609 | |||
| 1260 | Ga0207639_10072514 | |||
| 1261 | Ga0207639_11004436 | |||
| 1262 | Ga0207678_10225189 | |||
| 1263 | Ga0207702_10229248 | |||
| 1264 | Ga0207702_11463146 | |||
| 1265 | Ga0207702_12337275 | |||
| 1266 | Ga0207674_10163490 | |||
| 1267 | Ga0207674_10712070 | |||
| 1268 | Ga0207683_10532378 | |||
| 1269 | Ga0207698_10850727 | |||
| 1270 | Ga0207428_10012556 | |||
| 1271 | Ga0265337_1090291 | |||
| 1272 | Ga0265334_10010285 | |||
| 1273 | Ga0265334_10192451 | |||
| 1274 | Ga0265323_10192547 | |||
| 1275 | Ga0265336_10001318 | |||
| 1276 | Ga0265336_10051112 | |||
| 1277 | Ga0265338_10012206 | |||
| 1278 | Ga0265338_10045719 | |||
| 1279 | Ga0265338_10061846 | |||
| 1280 | Ga0265338_10132885 | |||
| 1281 | Ga0265338_10216954 | |||
| 1282 | Ga0265324_10018390 | |||
| 1283 | Ga0265324_10024649 | |||
| 1284 | Ga0265328_10327880 | |||
| 1285 | Ga0265320_10128667 | |||
| 1286 | Ga0265327_10043865 | |||
| 1287 | Ga0265327_10149635 | |||
| 1288 | Ga0316575_10439971 | |||
| 1289 | Ga0307411_11588659 | |||
| 1290 | Ga0307415_100573123 | |||
| 1291 | Ga0316583_10048556 | |||
| 1292 | Ga0373926_0068448 | |||
| 1293 | Ga0373928_0041285 | |||
| 1294 | Ga0373934_0250118 | |||
| 1295 | Ga0373944_0028895 | |||
| 1296 | Ga0373944_0051275 | |||
| 1297 | Ga0373944_0085947 | |||
| 1298 | Ga0373951_0068695 | |||
| 1299 | Ga0373923_0016587 | |||
| 1300 | Ga0373923_0108662 | |||
| 1301 | Ga0373936_0038606 | |||
| 1302 | Ga0373945_0011792 | |||
| 1303 | Ga0373945_0033929 | |||
| 1304 | Ga0373953_0241629 | |||
| 1305 | Ga0373954_0217393 | |||
| 1306 | Ga0373954_0271068 | |||
| 1307 | Ga0373956_0020669 | |||
| 1308 | Ga0373956_0045074 | |||
| 1309 | Ga0373956_0108562 | |||
| 1310 | Ga0373956_0137216 | |||
| 1311 | Ga0373956_0171054 | |||
| 1312 | Ga0373957_0037499 | |||
| 1313 | Ga0373943_0056727 | |||
| 1314 | Ga0373943_0090022 | |||
| 1315 | Ga0373943_0400542 | |||
| 1316 | Ga0373946_0032271 | |||
| 1317 | Ga0373946_0038632 | |||
| 1318 | Ga0373946_0092261 | |||
| 1319 | Ga0373946_0751966 | |||
| 1320 | Ga0373955_0205328 | |||
| 1321 | Ga0373955_1055306 | |||
| 1322 | Ga0373942_0320235 | |||
| 1323 | Ga0373924_0000242 | |||
| 1324 | Ga0373924_0048788 | |||
| 1325 | Ga0373924_0054251 | |||
| 1326 | Ga0373924_0197822 | |||
| 1327 | Ga0373924_0305434 | |||
| 1328 | Ga0373935_0072373 | |||
| 1329 | Ga0373935_0128877 | |||
| 1330 | Ga0373935_0148989 | |||
| 1331 | Ga0373935_0194177 | |||
| 1332 | Ga0373935_0243245 | |||
| 1333 | Ga0373927_0096694 | |||
| 1334 | Ga0373927_0688197 | |||
| 1335 | Ga0373933_0173499 | |||
| 1336 | Ga0373933_0467701 | |||
| 1337 | Ga0373933_0572731 | |||
| 1338 | Ga0373933_0648975 | |||
| 1339 | Ga0373947_0013858 | |||
| 1340 | Ga0373947_0017628 | |||
| 1341 | Ga0373947_0465749 | |||
| 1342 | Ga0373937_0000317 | |||
| 1343 | Ga0373937_0001944 | |||
| 1344 | Ga0373937_0096763 | |||
| 1345 | Ga0373937_0256233 | |||
| 1346 | Ga0373937_0265433 | |||
| 1347 | Ga0373937_0327505 | |||
| 1348 | Ga0373937_1132295 | |||
| 1349 | Ga0373925_0002218 | |||
| 1350 | Ga0373925_0003717 | |||
| 1351 | Ga0373925_0089873 | |||
| 1352 | Ga0373925_0232196 | |||
| 1353 | Ga0373925_0329070 | |||
| 1354 | Ga0373925_0928899 | |||
| 1355 | Ga0395899_0803237 | |||
| 1356 | Ga0395900_0118402 | |||
| 1357 | Ga0395900_0736249 | |||
| 1358 | Ga0395900_1122443 | |||
| 1359 | Ga0395898_0309293 | |||
| 1360 | Ga0395898_1135631 | |||
| 1361 | Ga0395901_0062267 | |||
| 1362 | Ga0395901_1631285 | |||
| 1363 | Ga0436360_0135324 | |||
| 1364 | Ga0436360_0905307 | |||
| 1365 | Ga0436363_0540326 | |||
| 1366 | Ga0436363_0679308 | |||
| 1367 | Ga0436362_0433861 | |||
| 1368 | Ga0436362_0726135 | |||
| 1369 | Ga0451853_1876438 | |||
| 1370 | Ga0466969_0003758 | |||
| 1371 | Ga0466969_0208345 | |||
| 1372 | Ga0466969_0257256 | |||
| 1373 | Ga0466969_0358769 | |||
| 1374 | Ga0466969_0406828 | |||
| 1375 | Ga0466972_0028090 | |||
| 1376 | Ga0466965_0099802 | |||
| 1377 | Ga0466965_0118199 | |||
| 1378 | Ga0466965_0140467 | |||
| 1379 | Ga0466966_0034146 | |||
| 1380 | Ga0466966_0232314 | |||
| 1381 | Ga0466961_0000463 | |||
| 1382 | Ga0466961_0111236 | |||
| 1383 | Ga0466961_0180385 | |||
| 1384 | Ga0466961_0458119 | |||
| 1385 | Ga0466963_0000055 | |||
| 1386 | Ga0466963_0002044 | |||
| 1387 | Ga0466963_0003206 | |||
| 1388 | Ga0466963_0004340 | |||
| 1389 | Ga0466963_0006350 | |||
| 1390 | Ga0466963_0006417 | |||
| 1391 | Ga0466963_0017674 | |||
| 1392 | Ga0466963_0026186 | |||
| 1393 | Ga0466963_0098547 | |||
| 1394 | Ga0466963_0100589 | |||
| 1395 | Ga0466963_0117325 | |||
| 1396 | Ga0466963_0136794 | |||
| 1397 | Ga0466963_0149658 | |||
| 1398 | Ga0466963_0157911 | |||
| 1399 | Ga0466963_0297617 | |||
| 1400 | Ga0466963_0715756 | |||
| 1401 | Ga0466963_1111911 | |||
| 1402 | Ga0466964_0002221 | |||
| 1403 | Ga0466964_0004788 | |||
| 1404 | Ga0466964_0007061 | |||
| 1405 | Ga0466964_0032250 | |||
| 1406 | Ga0466964_0040834 | |||
| 1407 | Ga0466964_0118674 | |||
| 1408 | Ga0466964_0550564 | |||
| 1409 | Ga0466971_0009943 | |||
| 1410 | Ga0466971_0014877 | |||
| 1411 | Ga0466971_0028795 | |||
| 1412 | Ga0466971_0197881 | |||
| 1413 | Ga0466971_0627822 | |||
| 1414 | Ga0466968_0006506 | |||
| 1415 | Ga0466968_0026161 | |||
| 1416 | Ga0466968_0078858 | |||
| 1417 | Ga0466968_0102939 | |||
| 1418 | Ga0466968_0103843 | |||
| 1419 | Ga0466968_0119909 | |||
| 1420 | Ga0466968_0324786 | |||
| 1421 | Ga0466968_0594711 | |||
| 1422 | Ga0466970_0007299 | |||
| 1423 | Ga0466970_0099572 | |||
| 1424 | Ga0466970_0302138 | |||
| 1425 | Ga0466957_0000324 | |||
| 1426 | Ga0466957_0014101 | |||
| 1427 | Ga0466957_0016697 | |||
| 1428 | Ga0466957_0020584 | |||
| 1429 | Ga0466957_0029951 | |||
| 1430 | Ga0466957_0051051 | |||
| 1431 | Ga0466957_0087280 | |||
| 1432 | Ga0466957_0088331 | |||
| 1433 | Ga0466957_0089357 | |||
| 1434 | Ga0466957_0157461 | |||
| 1435 | Ga0466960_0010755 | |||
| 1436 | Ga0466960_0293544 | |||
| 1437 | Ga0466960_0645135 | |||
| 1438 | Ga0466959_0000761 | |||
| 1439 | Ga0466959_0006516 | |||
| 1440 | Ga0466959_0022832 | |||
| 1441 | Ga0466959_0024892 | |||
| 1442 | Ga0466959_0081167 | |||
| 1443 | Ga0466959_0770358 | |||
| 1444 | Ga0466958_0010924 | |||
| 1445 | Ga0466958_0013846 | |||
| 1446 | Ga0466958_0017011 | |||
| 1447 | Ga0466958_0032328 | |||
| 1448 | Ga0466958_0046813 | |||
| 1449 | Ga0466958_0059711 | |||
| 1450 | Ga0466958_0114187 | |||
| 1451 | Ga0466958_0132994 | |||
| 1452 | Ga0466958_0156288 | |||
| 1453 | Ga0466958_0162661 | |||
| 1454 | Ga0466958_0365792 | |||
| 1455 | Ga0466967_0002348 | |||
| 1456 | Ga0466967_0008064 | |||
| 1457 | Ga0466967_0028564 | |||
| 1458 | Ga0466967_0041723 | |||
| 1459 | Ga0466967_0043171 | |||
| 1460 | Ga0466967_0053112 | |||
| 1461 | Ga0466967_0054454 | |||
| 1462 | Ga0466967_0055672 | |||
| 1463 | Ga0466967_0065217 | |||
| 1464 | Ga0466967_0078419 | |||
| 1465 | Ga0466967_0154583 | |||
| 1466 | Ga0466967_0237209 | |||
| 1467 | Ga0466967_0662966 | |||
| 1468 | Ga0466967_0798822 | |||
| 1469 | Ga0466967_0867123 | |||
| 1470 | Ga0466967_1155581 | |||
| 1471 | Ga0466967_1554092 | |||
| 1472 | Ga0495592_0000082 | |||
| 1473 | Ga0495592_0005470 | |||
| 1474 | Ga0495592_0924366 | |||
| 1475 | Ga0495603_0023747 | |||
| 1476 | Ga0495603_0171058 | |||
| 1477 | Ga0495629_0010441 | |||
| 1478 | Ga0495629_0226670 | |||
| 1479 | Ga0495629_0239139 | |||
| 1480 | Ga0495641_0003735 | |||
| 1481 | Ga0495641_0016679 | |||
| 1482 | Ga0495641_0038273 | |||
| 1483 | Ga0495641_0040370 | |||
| 1484 | Ga0495641_0066121 | |||
| 1485 | Ga0495641_0427807 | |||
| 1486 | Ga0495651_0000254 | |||
| 1487 | Ga0495651_0054813 | |||
| 1488 | Ga0495651_0151270 | |||
| 1489 | Ga0495651_0172922 | |||
| 1490 | Ga0495651_0364724 | |||
| 1491 | Ga0495653_0026259 | |||
| 1492 | Ga0495653_0064924 | |||
| 1493 | Ga0495653_0085887 | |||
| 1494 | Ga0495653_0230533 | |||
| 1495 | Ga0495653_0251795 | |||
| 1496 | Ga0495653_0379087 | |||
| 1497 | Ga0495653_0436549 | |||
| 1498 | Ga0495580_0009973 | |||
| 1499 | Ga0495580_0043132 | |||
| 1500 | Ga0495580_0233122 | |||
| 1501 | Ga0495582_0000026 | |||
| 1502 | Ga0495582_0001703 | |||
| 1503 | Ga0495582_0032710 | |||
| 1504 | Ga0495582_0053130 | |||
| 1505 | Ga0495582_0434783 | |||
| 1506 | Ga0495639_0000828 | |||
| 1507 | Ga0495639_0003360 | |||
| 1508 | Ga0495639_0109177 | |||
| 1509 | Ga0495662_0002737 | |||
| 1510 | Ga0495662_0115791 | |||
| 1511 | Ga0495662_0205708 | |||
| 1512 | Ga0495664_0018869 | |||
| 1513 | Ga0495664_0121953 | |||
| 1514 | Ga0495664_0430044 | |||
| 1515 | Ga0495584_0126223 | |||
| 1516 | Ga0495585_0274213 | |||
| 1517 | Ga0495594_0160050 | |||
| 1518 | Ga0495596_0339715 | |||
| 1519 | Ga0495607_0111187 | |||
| 1520 | Ga0495608_0003029 | |||
| 1521 | Ga0495608_0096022 | |||
| 1522 | Ga0495608_0130761 | |||
| 1523 | Ga0495608_0336028 | |||
| 1524 | Ga0495618_0010074 | |||
| 1525 | Ga0495618_0011530 | |||
| 1526 | Ga0495618_0319775 | |||
| 1527 | Ga0495628_0008466 | |||
| 1528 | Ga0495628_0013181 | |||
| 1529 | Ga0495628_0232494 | |||
| 1530 | Ga0495628_0382310 | |||
| 1531 | Ga0495630_0018065 | |||
| 1532 | Ga0495630_0021645 | |||
| 1533 | Ga0495630_0150508 | |||
| 1534 | Ga0495630_0375412 | |||
| 1535 | Ga0495630_0467636 | |||
| 1536 | Ga0495630_0767403 | |||
| 1537 | Ga0495644_0014389 | |||
| 1538 | Ga0495666_0000309 | |||
| 1539 | Ga0495666_0034605 | |||
| 1540 | Ga0495666_0165952 | |||
| 1541 | Ga0495652_0000144 | |||
| 1542 | Ga0495652_0005095 | |||
| 1543 | Ga0495652_0155329 | |||
| 1544 | Ga0495652_0167697 | |||
| 1545 | Ga0495652_0250606 | |||
| 1546 | Ga0495652_0357436 | |||
| 1547 | Ga0495665_0003045 | |||
| 1548 | Ga0495665_0034039 | |||
| 1549 | Ga0495665_0039621 | |||
| 1550 | Ga0495665_0163882 | |||
| 1551 | Ga0495665_0280197 | |||
| 1552 | Ga0495640_0002828 | |||
| 1553 | Ga0495640_0016017 | |||
| 1554 | Ga0495586_0009993 | |||
| 1555 | Ga0495586_0052645 | |||
| 1556 | Ga0495586_0103455 | |||
| 1557 | Ga0495586_0498505 | |||
| 1558 | Ga0495586_0870078 | |||
| 1559 | Ga0495587_0000060 | |||
| 1560 | Ga0495587_0085570 | |||
| 1561 | Ga0495587_0103806 | |||
| 1562 | Ga0495645_0000038 | |||
| 1563 | Ga0495645_0039870 | |||
| 1564 | Ga0495645_0053801 | |||
| 1565 | Ga0495645_0300345 | |||
| 1566 | Ga0495645_0342188 | |||
| 1567 | Ga0495667_0008738 | |||
| 1568 | Ga0495667_0024410 | |||
| 1569 | Ga0495667_0363556 | |||
| 1570 | Ga0495667_0491190 | |||
| 1571 | Ga0495667_0644265 | |||
| 1572 | Ga0495656_0001194 | |||
| 1573 | Ga0495668_0195081 | |||
| 1574 | Ga0495634_0004455 | |||
| 1575 | Ga0495634_0176455 | |||
| 1576 | Ga0495634_0249060 | |||
| 1577 | Ga0495634_0304457 | |||
| 1578 | Ga0495635_0054288 | |||
| 1579 | Ga0495635_0105560 | |||
| 1580 | Ga0495635_0145839 | |||
| 1581 | Ga0495635_0199213 | |||
| 1582 | Ga0495635_0533008 | |||
| 1583 | Ga0495635_0902373 | |||
| 1584 | Ga0495659_0159427 | |||
| 1585 | Ga0495659_0296734 | |||
| 1586 | Ga0495661_0184971 | |||
| 1587 | Ga0495657_0021956 | |||
| 1588 | Ga0495657_0029234 | |||
| 1589 | Ga0495657_0047144 | |||
| 1590 | Ga0495657_0430490 | |||
| 1591 | Ga0495657_0586943 | |||
| 1592 | Ga0495599_0003010 | |||
| 1593 | Ga0495599_0042100 | |||
| 1594 | Ga0495599_0089955 | |||
| 1595 | Ga0495599_0202184 | |||
| 1596 | Ga0495599_0409659 | |||
| 1597 | Ga0495623_0003795 | |||
| 1598 | Ga0495623_0055744 | |||
| 1599 | Ga0495623_0150041 | |||
| 1600 | Ga0495623_0697149 | |||
| 1601 | Ga0495646_0016747 | |||
| 1602 | Ga0495646_0027797 | |||
| 1603 | Ga0495646_0156942 | |||
| 1604 | Ga0495646_0226276 | |||
| 1605 | Ga0495646_0627982 | |||
| 1606 | Ga0495647_0004236 | |||
| 1607 | Ga0495647_0005065 | |||
| 1608 | Ga0495647_0099172 | |||
| 1609 | Ga0495647_0232320 | |||
| 1610 | Ga0495647_0264356 | |||
| 1611 | Ga0495658_0000498 | |||
| 1612 | Ga0495658_0000984 | |||
| 1613 | Ga0495658_0047423 | |||
| 1614 | Ga0495658_0332836 | |||
| 1615 | Ga0495669_0408158 | |||
| 1616 | Ga0495613_0001744 | |||
| 1617 | Ga0495613_0128745 | |||
| 1618 | Ga0495613_0213996 | |||
| 1619 | Ga0495613_0455603 | |||
| 1620 | Ga0495613_1017999 | |||
| 1621 | Ga0495624_0009825 | |||
| 1622 | Ga0495624_0049047 | |||
| 1623 | Ga0495624_0283882 | |||
| 1624 | Ga0495670_0514210 | |||
| 1625 | Ga0495671_0107132 | |||
| 1626 | Ga0495589_0041461 | |||
| 1627 | Ga0495600_0078080 | |||
| 1628 | Ga0495600_0153794 | |||
| 1629 | Ga0495600_0221860 | |||
| 1630 | Ga0495600_0333773 | |||
| 1631 | Ga0495600_0361027 | |||
| 1632 | Ga0495600_0663369 | |||
| 1633 | Ga0495581_0017975 | |||
| 1634 | Ga0495581_0165899 | |||
| 1635 | Ga0495581_0577898 | |||
| 1636 | Ga0495604_0000043 | |||
| 1637 | Ga0495604_0197841 | |||
| 1638 | Ga0495604_0796393 | |||
| 1639 | Ga0495636_0239882 | |||
| 1640 | Ga0495674_0007325 | |||
| 1641 | Ga0495674_0140659 | |||
| 1642 | Ga0495674_0257624 | |||
| 1643 | Ga0495674_0275889 | |||
| 1644 | Ga0495674_1018773 | |||
| 1645 | Ga0495676_0036425 | |||
| 1646 | Ga0495676_0055381 | |||
| 1647 | Ga0495676_0127381 | |||
| 1648 | Ga0495676_0216718 | |||
| 1649 | Ga0495676_0258931 | |||
| 1650 | Ga0495680_0005229 | |||
| 1651 | Ga0495680_0009827 | |||
| 1652 | Ga0495680_0010993 | |||
| 1653 | Ga0495680_0063962 | |||
| 1654 | Ga0495680_0077267 | |||
| 1655 | Ga0495680_0530118 | |||
| 1656 | Ga0495680_0549402 | |||
| 1657 | Ga0495675_0000413 | |||
| 1658 | Ga0495675_0382911 | |||
| 1659 | Ga0495677_0030197 | |||
| 1660 | Ga0495679_106867 | |||
| 1661 | Ga0495684_0001111 | |||
| 1662 | Ga0495684_0099178 | |||
| 1663 | Ga0495684_0108121 | |||
| 1664 | Ga0495684_0206246 | |||
| 1665 | Ga0495593_0001256 | |||
| 1666 | Ga0495593_0286655 | |||
| 1667 | Ga0495602_0022762 | |||
| 1668 | Ga0495602_0105660 | |||
| 1669 | Ga0495602_0239673 | |||
| 1670 | Ga0495602_0268964 | |||
| 1671 | Ga0495602_0295947 | |||
| 1672 | Ga0495602_0463206 | |||
| 1673 | Ga0495602_0598781 | |||
| 1674 | Ga0495614_0011701 | |||
| 1675 | Ga0495614_0015057 | |||
| 1676 | Ga0495614_0026807 | |||
| 1677 | Ga0495614_0389455 | |||
| 1678 | Ga0496100_0281157 | |||
| 1679 | Ga0496100_1050046 | |||
| 1680 | Ga0496101_0006702 | |||
| 1681 | Ga0496101_0120860 | |||
| 1682 | Ga0496101_0181290 | |||
| 1683 | Ga0496101_0224207 | |||
| 1684 | Ga0496102_0008253 | |||
| 1685 | Ga0496102_0033886 | |||
| 1686 | Ga0496102_0235144 | |||
| 1687 | Ga0496102_0344860 | |||
| 1688 | Ga0496102_1327456 | |||
| 1689 | Ga0496103_0014004 | |||
| 1690 | Ga0496103_0014605 | |||
| 1691 | Ga0496103_0023874 | |||
| 1692 | Ga0496104_0016980 | |||
| 1693 | Ga0496104_0051298 | |||
| 1694 | Ga0496104_0199048 | |||
| 1695 | Ga0496104_0563054 | |||
| 1696 | Ga0496105_0001128 | |||
| 1697 | Ga0496105_0019672 | |||
| 1698 | Ga0496105_0023605 | |||
| 1699 | Ga0496105_0029069 | |||
| 1700 | Ga0496105_0078938 | |||
| 1701 | Ga0496105_0431356 | |||
| 1702 | Ga0496105_1284798 | |||
| 1703 | Ga0496106_0144554 | |||
| 1704 | Ga0496106_1012200 | |||
| 1705 | Ga0496107_0017701 | |||
| 1706 | Ga0496107_0083102 | |||
| 1707 | Ga0496107_0957903 | |||
| 1708 | Ga0496107_1164253 | |||
| 1709 | Ga0496107_1274392 | |||
| 1710 | Ga0496108_0024612 | |||
| 1711 | Ga0496108_0050354 | |||
| 1712 | Ga0496108_0058486 | |||
| 1713 | Ga0496108_0408082 | |||
| 1714 | Ga0496109_0040631 | |||
| 1715 | Ga0496109_0113923 | |||
| 1716 | Ga0496109_0210733 | |||
| 1717 | Ga0496109_1160561 | |||
| 1718 | Ga0496109_1242564 | |||
| 1719 | Ga0496109_1298571 | |||
| 1720 | Ga0496109_1450675 | |||
| 1721 | Ga0496109_1635336 | |||
| 1722 | Ga0496110_0006968 | |||
| 1723 | Ga0496110_0197095 | |||
| 1724 | Ga0496110_0374762 | |||
| 1725 | Ga0496110_0625153 | |||
| 1726 | Ga0496110_1018689 | |||
| 1727 | Ga0496110_1076392 | |||
| 1728 | Ga0496111_0003910 | |||
| 1729 | Ga0496111_0011827 | |||
| 1730 | Ga0496111_0084083 | |||
| 1731 | Ga0496111_0194566 | |||
| 1732 | Ga0496112_0000784 | |||
| 1733 | Ga0496112_0064736 | |||
| 1734 | Ga0496112_0224801 | |||
| 1735 | Ga0496112_0380191 | |||
| 1736 | Ga0496112_0457725 | |||
| 1737 | Ga0496112_0694869 | |||
| 1738 | Ga0496112_0804901 | |||
| 1739 | Ga0496113_0005436 | |||
| 1740 | Ga0496113_0131938 | |||
| 1741 | Ga0496113_0211096 | |||
| 1742 | Ga0496113_0959715 | |||
| 1743 | Ga0496114_0006185 | |||
| 1744 | Ga0496114_0103270 | |||
| 1745 | Ga0496114_0283771 | |||
| 1746 | Ga0496114_0287895 | |||
| 1747 | Ga0496114_0566131 | |||
| 1748 | Ga0496115_0025749 | |||
| 1749 | Ga0496115_0074971 | |||
| 1750 | Ga0496115_0090233 | |||
| 1751 | Ga0496115_0101048 | |||
| 1752 | Ga0496115_0120815 | |||
| 1753 | Ga0496115_0172141 | |||
| 1754 | Ga0496115_0376840 | |||
| 1755 | Ga0496115_0404621 | |||
| 1756 | Ga0496115_0990093 | |||
| 1757 | Ga0501067_0026731 | |||
| 1758 | Ga0501067_0097285 | |||
| 1759 | nmdc:mga08y16_293463_c1 | |||
| 1760 | nmdc:mga0n895_106199_c1 | |||
| 1761 | nmdc:mga0n895_361774_c1 | |||
| 1762 | nmdc:mga0rr50_87290_c1 | |||
| 1763 | nmdc:mga08x19_284968_c1 | |||
| 1764 | nmdc:mga08x19_488519_c1 | |||
| 1765 | nmdc:mga08x19_96779_c1 | |||
| 1766 | nmdc:mga0a205_301697_c1 | |||
| 1767 | Ga0495601_0012252 | |||
| 1768 | Ga0495601_0089871 | |||
| 1769 | Ga0495601_0095008 | |||
| 1770 | Ga0495601_0193415 | |||
| 1771 | Ga0495601_0552820 | |||
| 1772 | Ga0495601_0735573 | |||
| 1773 | Ga0495601_0792089 | |||
| 1774 | Ga0495612_0039191 | |||
| 1775 | Ga0495612_0120054 | |||
| 1776 | Ga0495612_0120460 | |||
| 1777 | Ga0495612_0247953 | |||
| 1778 | Ga0495612_0250014 | |||
| 1779 | Ga0495595_0008486 | |||
| 1780 | Ga0495595_0015490 | |||
| 1781 | Ga0495595_0045351 | |||
| 1782 | Ga0495595_0046722 | |||
| 1783 | Ga0495595_0137177 | |||
| 1784 | Ga0495595_0255532 | |||
| 1785 | Ga0495595_0533035 | |||
| 1786 | Ga0495619_0015579 | |||
| 1787 | Ga0495619_0036099 | |||
| 1788 | Ga0495619_0160969 | |||
| 1789 | Ga0495619_0198067 | |||
| 1790 | Ga0495619_0291703 | |||
| 1791 | Ga0495619_0861149 | |||
| 1792 | Ga0495619_0875750 | |||
| 1793 | Ga0587084_083549 | |||
| 1794 | Ga0587093_004598 | |||
| 1795 | Ga0587066_003399 | |||
| 1796 | Ga0587070_036098 | |||
| 1797 | Ga0587070_116130 | |||
| 1798 | Ga0587073_0045665 | |||
| 1799 | Ga0587073_0253379 | |||
| 1800 | Ga0587077_013617 | |||
| 1801 | Ga0587080_016333 | |||
| 1802 | Ga0587082_040804 | |||
| 1803 | Ga0587083_0017472 | |||
| 1804 | Ga0587091_017544 | |||
| 1805 | Ga0587091_227942 | |||
| 1806 | Ga0587092_141637 | |||
| 1807 | Ga0587094_100316 | |||
| 1808 | Ga0587095_034152 | |||
| 1809 | Ga0587098_050366 | |||
| 1810 | Ga0587106_143625 | |||
| 1811 | Ga0587101_019781 | |||
| 1812 | Ga0587113_007713 | |||
| 1813 | Ga0587128_025778 | |||
| 1814 | Ga0587128_034818 | |||
| 1815 | Ga0587069_099660 | |||
| 1816 | Ga0587072_092623 | |||
| 1817 | Ga0587075_015933 | |||
| 1818 | Ga0587076_016640 | |||
| 1819 | Ga0587076_180546 | |||
| 1820 | Ga0587079_085088 | |||
| 1821 | Ga0587114_035975 | |||
| 1822 | Ga0587071_124155 | |||
| 1823 | Ga0587111_0168740 | |||
| 1824 | Ga0466962_0016173 | |||
| 1825 | Ga0466962_0024543 | |||
| 1826 | Ga0466962_0040609 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6wru-assembly1.cif.gz_G | structure of the 50s subunit of the ribosome from methicillin resistant staphylococcus aureus in complex with an isomer of the tedizolid | 0.9491 | 7 | 105 |
| 6gsk-assembly2.cif.gz_C5 | structure of t. thermophilus 70s ribosome complex with mrna, trnafmet and near-cognate trnathr in the a-site | 0.9331 | 3 | 76 |
| 6wru-assembly1.cif.gz_G | structure of the 50s subunit of the ribosome from methicillin resistant staphylococcus aureus in complex with an isomer of the tedizolid | 0.9287 | 7 | 105 |
| 8cgd-assembly1.cif.gz_t | clindamycin bound to the 50s subunit | 0.9248 | 4 | 105 |
| 8cam-assembly1.cif.gz_t | evernimicin bound to the 50s subunit | 0.9228 | 4 | 105 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHB7_1_104_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9302 | 5 | 103 | 2.30.30.30 |
| af_Q2FW17_1_100_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9252 | 5 | 103 | 2.30.30.30 |
| af_C6KSP8_36_136_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9202 | 3 | 103 | 2.30.30.30 |
| af_Q2FW17_1_100_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9076 | 5 | 103 | 2.30.30.30 |
| af_Q55DJ4_14_116_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8856 | 3 | 103 | 2.30.30.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F2T4U7-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9587 | 5 | 107 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A321L701-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9556 | 1 | 107 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A5VLJ4-F1-model_v4 | Large ribosomal subunit protein uL24 (50S ribosomal protein L24) | 0.95 | 5 | 106 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A0C1RHD6-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9495 | 5 | 106 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2V8ZTI9-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9488 | 5 | 107 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |