F485286

General Info

Members Datasets Scaffolds Average Seq Length
904 567 722 230

Family's Representative Sequence

Representative Sequence 3300039453|Ga0436362_1173705|Ga0436362_1173705_865_1716
Length 283
Sequence MRTPIMIAGEAFRSGALAPVLKRGNYAISDGSRSCQDDRVKTHFPELAMAEPLQIGLLIFPKVTQLDFTGPLQVFSSLPAHLAKVHLVWKRIEPVASDGPLVLTPTATFADCPQLDVICVPGGIGTDDLVNDEEVLDFIRAQAERAQYVTSVCTGSLVLGAAGLLKGYRAATHWSAMDHLVPFGAIPTKTRVCVDRNRITGGGVTAGIDFALTLVSMLVDRTIAEAVQLRLEYNPAPPFQSGSPDSAPPEVLALIESRMAPFRQRRAEAVVRAAARLNEPASG

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
9 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
10 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
11 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
12 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
13 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
14 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
15 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
16 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
17 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
18 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
19 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
20 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
21 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
22 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
23 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
24 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
25 2791355199
26 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
27 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
28 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
29 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
30 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
31 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
32 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
33 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
34 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
35 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
36 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
37 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
38 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
39 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
40 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
41 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
42 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
43 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
44 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
45 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
46 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
47 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
48 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
49 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
50 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
51 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
52 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
53 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
54 2851182111 Bosea sp. Tri-44 Isolate Nodule
55 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
56 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
57 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
58 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
59 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
60 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
61 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
62 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
63 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
64 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
65 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
66 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
67 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
68 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
69 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
70 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
71 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
72 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
73 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
74 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
75 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
76 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
77 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
78 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
79 2906610324
80 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
81 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
82 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
83 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
84 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
85 2922368715
86 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
87 2922425934
88 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
89 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
90 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
91 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
92 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
93 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
94 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
95 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
96 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
97 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
98 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
99 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
100 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
101 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
102 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
103 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
104 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
105 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
106 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
107 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
108 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
109 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
110 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
111 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
112 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
113 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
114 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
115 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
116 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
117 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
118 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
119 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
120 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
121 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
122 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
123 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
124 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
125 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
126 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
127 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
128 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
129 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
130 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
131 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
132 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
133 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
134 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
135 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
136 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
137 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
138 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
139 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
140 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
141 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
142 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
143 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
144 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
145 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
146 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
147 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
148 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
149 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
150 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
151 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
152 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
153 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
154 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
155 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
156 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
157 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
158 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
159 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
160 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
161 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
162 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
163 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
164 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
165 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
166 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
167 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
168 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
169 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
170 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
171 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
172 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
173 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
174 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
175 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
176 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
177 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
178 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
179 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
180 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
181 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
182 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
183 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
184 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
185 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
186 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
187 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
188 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
189 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
190 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
191 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
192 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
193 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
194 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
195 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
196 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
197 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
198 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
199 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
200 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
201 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
202 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
203 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
204 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
205 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
206 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
207 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
208 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
209 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
210 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
211 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
212 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
213 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
214 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
215 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
216 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
217 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
218 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
219 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
220 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
221 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
222 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
223 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
224 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
225 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
226 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
227 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
228 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
229 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
230 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
231 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
232 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
233 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
234 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
235 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
236 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
237 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
238 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
239 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
240 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
241 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
242 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
243 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
244 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
245 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
246 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
247 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
249 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
250 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
251 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
252 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
253 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
254 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
255 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
256 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
257 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
258 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
299 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
300 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
301 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
302 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
304 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
307 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
308 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
309 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
310 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
311 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
312 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
313 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
314 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
315 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
316 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
317 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
318 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
319 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
320 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
321 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
322 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
323 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
324 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
325 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
326 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
327 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
328 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
329 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
330 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
331 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
332 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
333 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
334 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
335 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
336 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
337 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
338 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
339 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
340 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
341 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
342 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
343 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
344 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
345 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
346 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
347 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
348 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
349 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
350 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
351 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
352 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
353 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
354 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
355 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
356 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
357 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
358 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
359 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
360 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
361 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
362 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
363 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
364 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
365 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
366 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
367 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
368 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
369 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
370 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
371 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
372 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
373 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
374 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
375 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
376 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
377 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
378 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
379 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
380 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
381 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
382 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
383 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
384 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
385 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
386 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
387 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
388 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
389 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
390 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
391 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
392 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
393 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
394 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
395 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
396 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
397 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
398 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
399 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
400 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
401 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
402 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
403 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
404 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
405 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
406 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
407 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
408 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
409 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
410 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
411 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
412 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
413 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
414 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
415 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
416 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
417 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
418 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
419 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
420 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
421 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
422 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
423 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
424 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
425 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
426 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
427 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
428 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
429 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
430 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
431 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
432 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
433 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
434 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
435 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
436 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
437 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
438 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
439 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
440 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
441 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
442 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
443 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
444 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
445 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
446 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
447 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
448 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
449 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
450 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
451 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
452 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
453 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
454 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
455 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
456 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
457 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
458 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
459 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
460 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
461 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
462 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
463 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
464 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
465 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
466 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
467 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
469 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
470 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
471 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
472 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
473 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
474 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
475 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
476 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
477 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
478 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
479 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
480 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
481 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
482 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
483 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
484 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
485 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
486 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
487 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
488 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
489 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
490 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
491 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
492 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
493 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
494 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
495 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
496 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
497 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
498 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
499 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
500 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
501 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
502 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
503 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
504 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
505 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
506 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
507 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
508 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
509 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
510 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
511 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
512 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
513 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
514 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
515 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
516 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
517 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
518 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
519 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
520 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
521 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
522 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
523 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
524 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
525 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
526 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
527 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
528 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
529 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
530 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
531 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
532 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
533 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
534 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
535 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
536 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
537 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
538 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
539 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
540 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
541 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
542 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
543 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
544 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
545 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
546 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
547 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
548 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
549 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
550 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
551 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
552 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
553 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
554 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
555 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
556 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
557 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
558 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
559 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
560 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
561 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
562 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
563 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
564 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
565 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
566 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
567 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.22
Metatranscriptomes 0
Isolates 19.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.94
Nodule 16.37
Rhizoplane 4.31
Rhizosphere 55.09
Stem 0
Stem Tuber 0
Unclassified 11.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1002491 3300002705 Bacteria 6563
2 JGI25154J39366_1000013 3300002738 Bacteria 268260
3 JGI25157J39369_1002059 3300002741 Bacteria 5751
4 JGI25406J46586_10038176 3300003203 Bacteria 1724
5 JGI25153J46596_10001920 3300003215 Bacteria 12337
6 JGI25153J46596_10002312 3300003215 Bacteria 11081
7 JGI25153J46596_10017224 3300003215 Bacteria 2854
8 JGI25160J50197_1000631 3300003354 Bacteria 19703
9 JGI25160J50197_1011095 3300003354 Bacteria 3215
10 JGI25404J52841_10004693 3300003659 Bacteria 2787
11 JGI25404J52841_10005665 3300003659 Bacteria 2583
12 JGI25404J52841_10006333 3300003659 Bacteria 2473
13 JGI25404J52841_10009379 3300003659 Bacteria 2092
14 Ga0055543_1001288 3300004625 Bacteria 10317
15 Ga0065165_1000844 3300005262 Bacteria 40173
16 Ga0065165_1002117 3300005262 Bacteria 18094
17 Ga0065165_1034331 3300005262 Bacteria 1569
18 Ga0070683_100126208 3300005329 Bacteria 2419
19 Ga0070670_100857974 3300005331 Bacteria 822
20 Ga0068869_100177424 3300005334 Bacteria 1668
21 Ga0070680_100036288 3300005336 Bacteria 3982
22 Ga0070680_100064055 3300005336 Bacteria 3012
23 Ga0070680_100246414 3300005336 Bacteria 1511
24 Ga0070682_100080180 3300005337 Bacteria 2110
25 Ga0070682_100185509 3300005337 Bacteria 1457
26 Ga0068868_100267074 3300005338 Bacteria 1445
27 Ga0070668_100140649 3300005347 Bacteria 1945
28 Ga0070668_100327741 3300005347 Bacteria 1291
29 Ga0070671_100081966 3300005355 Bacteria 2697
30 Ga0070671_100198395 3300005355 Bacteria 1701
31 Ga0070674_100513901 3300005356 Bacteria 999
32 Ga0070667_100328787 3300005367 Bacteria 1380
33 Ga0070709_10000943 3300005434 Bacteria 16169
34 Ga0070709_10025859 3300005434 Bacteria 3471
35 Ga0070714_100030050 3300005435 Bacteria 4521
36 Ga0070714_100351354 3300005435 Bacteria 1385
37 Ga0070713_100040544 3300005436 Bacteria 3786
38 Ga0070713_100113099 3300005436 Bacteria 2369
39 Ga0070710_10009412 3300005437 Bacteria 4779
40 Ga0070710_10040690 3300005437 Bacteria 2562
41 Ga0070710_10113435 3300005437 Bacteria 1631
42 Ga0070711_100023513 3300005439 Bacteria 4009
43 Ga0070711_100059522 3300005439 Bacteria 2652
44 Ga0070711_100131823 3300005439 Bacteria 1862
45 Ga0070711_100145658 3300005439 Bacteria 1781
46 Ga0070708_100262255 3300005445 Bacteria 1624
47 Ga0070663_100004463 3300005455 Bacteria 8235
48 Ga0070663_100012305 3300005455 Bacteria 5408
49 Ga0070663_100029168 3300005455 Bacteria 3766
50 Ga0070663_100057859 3300005455 Bacteria 2782
51 Ga0070678_100043979 3300005456 Bacteria 3186
52 Ga0070678_100304889 3300005456 Bacteria 1355
53 Ga0070678_100377632 3300005456 Bacteria 1225
54 Ga0070662_100493385 3300005457 Bacteria 1021
55 Ga0070681_10063273 3300005458 Bacteria 3672
56 Ga0070681_10069007 3300005458 Bacteria 3502
57 Ga0070681_10076578 3300005458 Bacteria 3303
58 Ga0070681_10099623 3300005458 Bacteria 2852
59 Ga0070706_100028347 3300005467 Bacteria 5155
60 Ga0070707_100160957 3300005468 Bacteria 2187
61 Ga0070707_100200939 3300005468 Bacteria 1943
62 Ga0070698_100159783 3300005471 Bacteria 2198
63 Ga0070699_100121669 3300005518 Bacteria 2295
64 Ga0070679_100025804 3300005530 Bacteria 5766
65 Ga0070679_100259285 3300005530 Bacteria 1694
66 Ga0070684_100015676 3300005535 Bacteria 6182
67 Ga0070697_100039465 3300005536 Unclassified 3817
68 Ga0068853_100093363 3300005539 Bacteria 2649
69 Ga0068853_100175317 3300005539 Bacteria 1942
70 Ga0068853_100450923 3300005539 Bacteria 1210
71 Ga0068853_100625265 3300005539 Bacteria 1024
72 Ga0068853_100882191 3300005539 Bacteria 859
73 Ga0070686_100421597 3300005544 Bacteria 1020
74 Ga0070665_100060084 3300005548 Bacteria 3811
75 Ga0070665_100078115 3300005548 Bacteria 3316
76 Ga0070665_100101926 3300005548 Bacteria 2874
77 Ga0070665_100166997 3300005548 Bacteria 2203
78 Ga0070665_100555181 3300005548 Bacteria 1161
79 Ga0068855_100047191 3300005563 Bacteria 5089
80 Ga0068855_100047627 3300005563 Bacteria 5064
81 Ga0068855_100059338 3300005563 Bacteria 4477
82 Ga0068855_100118158 3300005563 Bacteria 3037
83 Ga0070664_100861488 3300005564 Bacteria 849
84 Ga0068856_100133911 3300005614 Bacteria 2483
85 Ga0068856_100182705 3300005614 Bacteria 2111
86 Ga0068856_100543575 3300005614 Bacteria 1183
87 Ga0068856_100724889 3300005614 Bacteria 1014
88 Ga0068852_100198691 3300005616 Bacteria 1897
89 Ga0068852_100260990 3300005616 Bacteria 1663
90 Ga0068852_100379436 3300005616 Bacteria 1386
91 Ga0068852_100943691 3300005616 Bacteria 881
92 Ga0068859_100143562 3300005617 Bacteria 2461
93 Ga0068859_100833652 3300005617 Bacteria 1009
94 Ga0068870_10298658 3300005840 Bacteria 1016
95 Ga0068858_100175128 3300005842 Bacteria 2024
96 Ga0068858_100362299 3300005842 Bacteria 1390
97 Ga0068860_100000589 3300005843 Bacteria 43469
98 Ga0068860_100023488 3300005843 Bacteria 5958
99 Ga0068860_100082950 3300005843 Bacteria 3048
100 Ga0068860_100518562 3300005843 Bacteria 1192
101 Ga0068862_100586181 3300005844 Bacteria 1069
102 Ga0081455_10009042 3300005937 Bacteria 10284
103 Ga0081455_10017212 3300005937 Bacteria 6939
104 Ga0081455_10018811 3300005937 Bacteria 6553
105 Ga0081455_10131983 3300005937 Bacteria 1952
106 Ga0081538_10036981 3300005981 Bacteria 3176
107 Ga0081540_1003394 3300005983 Bacteria 12630
108 Ga0081540_1020867 3300005983 Bacteria 3924
109 Ga0081540_1021640 3300005983 Bacteria 3820
110 Ga0081540_1025247 3300005983 Bacteria 3425
111 Ga0081540_1059621 3300005983 Bacteria 1831
112 Ga0081539_10001398 3300005985 Bacteria 41551
113 Ga0081539_10021340 3300005985 Bacteria 4333
114 Ga0081539_10185926 3300005985 Bacteria 971
115 Ga0070717_10001195 3300006028 Bacteria 17601
116 Ga0075365_10055262 3300006038 Bacteria 2634
117 Ga0075365_10059122 3300006038 Bacteria 2554
118 Ga0075365_10094748 3300006038 Bacteria 2038
119 Ga0075365_10179316 3300006038 Bacteria 1481
120 Ga0075365_10524505 3300006038 Bacteria 837
121 Ga0075368_10000684 3300006042 Bacteria 10294
122 Ga0075368_10128489 3300006042 Bacteria 1052
123 Ga0075363_100025917 3300006048 Bacteria 2995
124 Ga0075363_100027730 3300006048 Bacteria 2906
125 Ga0075363_100032563 3300006048 Bacteria 2709
126 Ga0075363_100367304 3300006048 Bacteria 842
127 Ga0075364_10028098 3300006051 Bacteria 3599
128 Ga0070715_10078082 3300006163 Bacteria 1496
129 Ga0070716_100027312 3300006173 Bacteria 3065
130 Ga0070712_100090277 3300006175 Bacteria 2243
131 Ga0070712_100251741 3300006175 Bacteria 1412
132 Ga0075362_10100664 3300006177 Bacteria 1351
133 Ga0075367_10005646 3300006178 Bacteria 6240
134 Ga0075367_10022133 3300006178 Bacteria 3561
135 Ga0075367_10032972 3300006178 Bacteria 2983
136 Ga0075369_10013223 3300006186 Bacteria 3272
137 Ga0075366_10006129 3300006195 Bacteria 6556
138 Ga0075366_10056251 3300006195 Bacteria 2337
139 Ga0075366_10230277 3300006195 Bacteria 1129
140 Ga0075370_10013795 3300006353 Bacteria 4299
141 Ga0075370_10035483 3300006353 Bacteria 2799
142 Ga0075370_10052216 3300006353 Bacteria 2319
143 Ga0075370_10058296 3300006353 Bacteria 2196
144 Ga0075434_100141157 3300006871 Bacteria 2429
145 Ga0097620_100143560 3300006931 Bacteria 2461
146 Ga0097620_100833682 3300006931 Bacteria 1009
147 Ga0099824_1006510 3300006942 Bacteria 15990
148 Ga0099824_1012401 3300006942 Bacteria 9306
149 Ga0099822_1003886 3300006943 Bacteria 19305
150 Ga0105250_10070491 3300009092 Bacteria 1411
151 Ga0105240_10047643 3300009093 Bacteria 5422
152 Ga0105240_10183132 3300009093 Bacteria 2470
153 Ga0105240_10227884 3300009093 Bacteria 2167
154 Ga0105240_10305136 3300009093 Bacteria 1820
155 Ga0105240_10314687 3300009093 Bacteria 1786
156 Ga0105245_10933204 3300009098 Bacteria 910
157 Ga0105247_10004329 3300009101 Bacteria 9071
158 Ga0105243_10146926 3300009148 Bacteria 2018
159 Ga0105241_10270136 3300009174 Bacteria 1448
160 Ga0105248_10004990 3300009177 Bacteria 14670
161 Ga0105248_10201894 3300009177 Bacteria 2240
162 Ga0105237_10292492 3300009545 Bacteria 1632
163 Ga0105237_10375557 3300009545 Bacteria 1426
164 Ga0105237_10423898 3300009545 Bacteria 1336
165 Ga0105238_10045226 3300009551 Bacteria 4448
166 Ga0105238_10070803 3300009551 Bacteria 3486
167 Ga0105238_10094882 3300009551 Bacteria 2971
168 Ga0105239_10062789 3300010375 Bacteria 4077
169 Ga0105239_10082423 3300010375 Bacteria 3542
170 Ga0105239_10189322 3300010375 Bacteria 2303
171 Ga0105239_10696974 3300010375 Bacteria 1161
172 Ga0105239_10858460 3300010375 Bacteria 1041
173 Ga0105246_10031542 3300011119 Bacteria 3508
174 Ga0157371_10034937 3300013102 Bacteria 3604
175 Ga0157370_10007389 3300013104 Bacteria 11970
176 Ga0157369_10004890 3300013105 Bacteria 15715
177 Ga0157369_10019548 3300013105 Bacteria 7579
178 Ga0157369_10212434 3300013105 Bacteria 2027
179 Ga0157374_10406121 3300013296 Bacteria 1359
180 Ga0157378_10016616 3300013297 Bacteria 6447
181 Ga0157378_10303285 3300013297 Bacteria 1546
182 Ga0163162_10094634 3300013306 Bacteria 3074
183 Ga0163162_10170328 3300013306 Bacteria 2302
184 Ga0157372_10084277 3300013307 Bacteria 3602
185 Ga0157375_10280668 3300013308 Bacteria 1829
186 Ga0163163_10027245 3300014325 Bacteria 5473
187 Ga0163163_10048691 3300014325 Bacteria 4168
188 Ga0163163_10148889 3300014325 Bacteria 2385
189 Ga0157380_10243877 3300014326 Bacteria 1622
190 Ga0182006_1096908 3300015261 Bacteria 1052
191 Ga0214542_1000001 3300021321 Bacteria 1018696
192 Ga0214545_1000001 3300021324 Bacteria 1092817
193 Ga0214543_1000001 3300021327 Bacteria 776921
194 Ga0213876_10006878 3300021384 Bacteria 6200
195 Ga0213876_10106677 3300021384 Bacteria 1486
196 Ga0213875_10029210 3300021388 Bacteria 2615
197 Ga0209435_100006 3300025206 Bacteria 542459
198 Ga0209563_116775 3300025230 Bacteria 893
199 Ga0209646_1000015 3300025246 Bacteria 542459
200 Ga0209026_1000039 3300025250 Bacteria 280608
201 Ga0209677_102871 3300025253 Bacteria 6058
202 Ga0209759_1000005 3300025256 Bacteria 542459
203 Ga0209759_1004195 3300025256 Bacteria 5468
204 Ga0209233_1014518 3300025261 Bacteria 2216
205 Ga0209673_1056165 3300025273 Bacteria 1009
206 Ga0209564_1002211 3300025295 Bacteria 16219
207 Ga0209758_1000021 3300025297 Bacteria 697691
208 Ga0209758_1001025 3300025297 Bacteria 36697
209 Ga0209758_1001133 3300025297 Bacteria 34266
210 Ga0209758_1011526 3300025297 Bacteria 5104
211 Ga0209758_1056350 3300025297 Bacteria 1328
212 Ga0209758_1103550 3300025297 Bacteria 803
213 Ga0209256_1007103 3300025299 Bacteria 5650
214 Ga0209256_1053793 3300025299 Bacteria 962
215 Ga0207426_1000479 3300025302 Bacteria 60939
216 Ga0207426_1000599 3300025302 Bacteria 47456
217 Ga0207426_1042331 3300025302 Bacteria 1406
218 Ga0207697_10034517 3300025315 Bacteria 2071
219 Ga0207692_10005535 3300025898 Bacteria 5068
220 Ga0207692_10185844 3300025898 Bacteria 1213
221 Ga0207710_10008563 3300025900 Bacteria 4312
222 Ga0207710_10140396 3300025900 Bacteria 1166
223 Ga0207688_10034076 3300025901 Bacteria 2818
224 Ga0207680_10145430 3300025903 Bacteria 1575
225 Ga0207680_10319547 3300025903 Bacteria 1085
226 Ga0207647_10200842 3300025904 Bacteria 1153
227 Ga0207685_10067238 3300025905 Bacteria 1440
228 Ga0207685_10136231 3300025905 Bacteria 1096
229 Ga0207699_10028127 3300025906 Bacteria 3121
230 Ga0207699_10031894 3300025906 Bacteria 2963
231 Ga0207707_10014703 3300025912 Bacteria 6821
232 Ga0207707_10057211 3300025912 Bacteria 3394
233 Ga0207707_10176666 3300025912 Bacteria 1865
234 Ga0207707_10314629 3300025912 Bacteria 1352
235 Ga0207695_10117455 3300025913 Bacteria 2632
236 Ga0207695_10119717 3300025913 Bacteria 2602
237 Ga0207695_10150334 3300025913 Bacteria 2268
238 Ga0207695_10310635 3300025913 Bacteria 1467
239 Ga0207671_10122976 3300025914 Bacteria 1985
240 Ga0207671_10407342 3300025914 Bacteria 1082
241 Ga0207671_10407514 3300025914 Bacteria 1081
242 Ga0207671_10575123 3300025914 Bacteria 898
243 Ga0207693_10083933 3300025915 Bacteria 2496
244 Ga0207693_10116277 3300025915 Bacteria 2100
245 Ga0207693_10159435 3300025915 Bacteria 1775
246 Ga0207663_10046369 3300025916 Bacteria 2678
247 Ga0207663_10383236 3300025916 Bacteria 1071
248 Ga0207663_10437369 3300025916 Bacteria 1007
249 Ga0207660_10008250 3300025917 Bacteria 6735
250 Ga0207660_10060220 3300025917 Bacteria 2728
251 Ga0207660_10174352 3300025917 Bacteria 1667
252 Ga0207657_10081542 3300025919 Bacteria 2717
253 Ga0207657_10148768 3300025919 Bacteria 1909
254 Ga0207652_10457691 3300025921 Bacteria 1150
255 Ga0207646_10332735 3300025922 Bacteria 1372
256 Ga0207681_10524860 3300025923 Bacteria 972
257 Ga0207694_10030817 3300025924 Bacteria 4094
258 Ga0207694_10159698 3300025924 Bacteria 1820
259 Ga0207694_10236215 3300025924 Bacteria 1493
260 Ga0207650_10039723 3300025925 Bacteria 3439
261 Ga0207650_10687629 3300025925 Bacteria 864
262 Ga0207700_10022160 3300025928 Bacteria 4352
263 Ga0207700_10052321 3300025928 Bacteria 3053
264 Ga0207664_10052674 3300025929 Bacteria 3219
265 Ga0207664_10134250 3300025929 Bacteria 2086
266 Ga0207644_10275592 3300025931 Bacteria 1349
267 Ga0207706_10331773 3300025933 Bacteria 1323
268 Ga0207709_10248879 3300025935 Bacteria 1297
269 Ga0207669_10284285 3300025937 Bacteria 1249
270 Ga0207665_10001583 3300025939 Bacteria 15351
271 Ga0207711_10150513 3300025941 Bacteria 2099
272 Ga0207711_10608139 3300025941 Bacteria 1020
273 Ga0207661_10391212 3300025944 Bacteria 1259
274 Ga0207667_10265170 3300025949 Bacteria 1756
275 Ga0207667_10335920 3300025949 Bacteria 1542
276 Ga0207667_10336315 3300025949 Bacteria 1541
277 Ga0207667_10533378 3300025949 Bacteria 1188
278 Ga0207668_10329581 3300025972 Bacteria 1270
279 Ga0207668_10705264 3300025972 Bacteria 887
280 Ga0207640_10194183 3300025981 Bacteria 1532
281 Ga0207658_10253221 3300025986 Bacteria 1497
282 Ga0207677_10191226 3300026023 Bacteria 1619
283 Ga0207639_10140392 3300026041 Bacteria 2012
284 Ga0207639_10157319 3300026041 Bacteria 1911
285 Ga0207639_10276002 3300026041 Bacteria 1476
286 Ga0207639_10276975 3300026041 Bacteria 1474
287 Ga0207639_10332409 3300026041 Bacteria 1352
288 Ga0207678_10003569 3300026067 Bacteria 13988
289 Ga0207678_10049928 3300026067 Bacteria 3615
290 Ga0207678_10418767 3300026067 Bacteria 1161
291 Ga0207678_10597085 3300026067 Bacteria 968
292 Ga0207708_10197022 3300026075 Bacteria 1606
293 Ga0207702_10031931 3300026078 Bacteria 4392
294 Ga0207702_10267484 3300026078 Bacteria 1612
295 Ga0207702_10431405 3300026078 Bacteria 1276
296 Ga0207675_100161084 3300026118 Bacteria 2140
297 Ga0207698_10292882 3300026142 Bacteria 1511
298 Ga0207698_10554133 3300026142 Bacteria 1127
299 Ga0207698_10907681 3300026142 Bacteria 888
300 Ga0209389_1000121 3300027296 Bacteria 70490
301 Ga0209589_1000003 3300027357 Bacteria 629130
302 Ga0209589_1002338 3300027357 Bacteria 32739
303 Ga0209489_100003 3300027361 Bacteria 663105
304 Ga0209489_101475 3300027361 Bacteria 48380
305 Ga0209700_100003 3300027363 Bacteria 663105
306 Ga0209179_1000593 3300027512 Bacteria 3811
307 Ga0209813_10036440 3300027866 Bacteria 1478
308 Ga0209813_10085225 3300027866 Bacteria 1052
309 Ga0268266_10001098 3300028379 Bacteria 33929
310 Ga0268266_10017714 3300028379 Bacteria 6069
311 Ga0268266_10143932 3300028379 Bacteria 2141
312 Ga0268266_10150362 3300028379 Bacteria 2098
313 Ga0268264_10000043 3300028381 Bacteria 371761
314 Ga0268264_10524043 3300028381 Bacteria 1159
315 Ga0265325_10027410 3300031241 Bacteria 3079
316 Ga0265340_10036789 3300031247 Bacteria 2425
317 Ga0265316_10357622 3300031344 Bacteria 1056
318 Ga0307513_10164990 3300031456 Bacteria 2101
319 Ga0307509_10060644 3300031507 Bacteria 3997
320 Ga0307408_100036430 3300031548 Bacteria 3459
321 Ga0307508_10000010 3300031616 Bacteria 255747
322 Ga0265314_10285250 3300031711 Bacteria 932
323 Ga0307516_10042681 3300031730 Bacteria 4497
324 Ga0307413_10506479 3300031824 Bacteria 970
325 Ga0307411_10333882 3300032005 Bacteria 1229
326 Ga0307415_100118119 3300032126 Bacteria 1982
327 Ga0307415_100351195 3300032126 Bacteria 1241
328 Ga0307510_10004213 3300033180 Bacteria 16896
329 Ga0307510_10006119 3300033180 Bacteria 14339
330 Ga0307510_10392259 3300033180 Bacteria 832
331 Ga0315911_1000001 3300033442 Bacteria 1088602
332 Ga0373934_0085641 3300035086 Bacteria 1268
333 Ga0373923_0045006 3300035111 Bacteria 1832
334 Ga0373923_0049016 3300035111 Bacteria 1765
335 Ga0373932_0077068 3300035112 Bacteria 1046
336 Ga0373936_0005311 3300035113 Bacteria 4849
337 Ga0373936_0145773 3300035113 Bacteria 1024
338 Ga0373954_0008335 3300035118 Bacteria 4546
339 Ga0373954_0024129 3300035118 Bacteria 2771
340 Ga0373954_0067608 3300035118 Bacteria 1693
341 Ga0373956_0141693 3300035119 Bacteria 1129
342 Ga0373957_0013029 3300035120 Bacteria 2814
343 Ga0373943_0004918 3300035170 Bacteria 6037
344 Ga0373943_0227007 3300035170 Bacteria 1042
345 Ga0373946_0029192 3300035171 Bacteria 2193
346 Ga0373955_0039717 3300035172 Bacteria 2513
347 Ga0373955_0090334 3300035172 Bacteria 1745
348 Ga0373955_0316442 3300035172 Bacteria 942
349 Ga0373924_0009245 3300035410 Bacteria 3609
350 Ga0373924_0027064 3300035410 Bacteria 2279
351 Ga0373931_0215128 3300035691 Bacteria 1155
352 Ga0373931_0222551 3300035691 Bacteria 1137
353 Ga0373935_0055144 3300035692 Bacteria 2532
354 Ga0373927_0173928 3300035695 Bacteria 1412
355 Ga0373927_0306964 3300035695 Bacteria 1044
356 Ga0373927_0327863 3300035695 Bacteria 1008
357 Ga0373927_0357239 3300035695 Bacteria 963
358 Ga0373933_0001930 3300035724 Bacteria 11963
359 Ga0373933_0017121 3300035724 Bacteria 4063
360 Ga0373933_0054487 3300035724 Bacteria 2397
361 Ga0373947_0033109 3300035725 Bacteria 3049
362 Ga0373947_0082641 3300035725 Bacteria 1991
363 Ga0373947_0209247 3300035725 Bacteria 1279
364 Ga0373937_0127645 3300036401 Bacteria 2373
365 Ga0373937_0157888 3300036401 Bacteria 2126
366 Ga0373937_0711775 3300036401 Bacteria 951
367 Ga0373925_0006009 3300037068 Bacteria 8990
368 Ga0373925_0152585 3300037068 Bacteria 1815
369 Ga0395899_0312624 3300037312 Bacteria 1060
370 Ga0395900_0017864 3300037418 Bacteria 7240
371 Ga0395900_0273815 3300037418 Bacteria 1682
372 Ga0395898_0032284 3300037466 Bacteria 5226
373 Ga0395898_0677965 3300037466 Bacteria 973
374 Ga0395905_0007051 3300037471 Bacteria 11231
375 Ga0395905_0250301 3300037471 Bacteria 1655
376 Ga0436364_0991714 3300037853 Bacteria 3338
377 Ga0395901_0129842 3300038443 Bacteria 2648
378 Ga0395901_0377199 3300038443 Bacteria 1460
379 Ga0436365_0866542 3300039437 Bacteria 750
380 Ga0436365_1316672 3300039437 Bacteria 18310
381 Ga0436365_1470075 3300039437 Bacteria 6471
382 Ga0436365_1510814 3300039437 Bacteria 3411
383 Ga0436360_0167622 3300039438 Bacteria 1607
384 Ga0436363_1463179 3300039450 Bacteria 2610
385 Ga0436362_1173705 3300039453 Bacteria 2758
386 Ga0451802_0675589 3300041460 Bacteria 1221
387 Ga0451806_367894 3300041462 Bacteria 3028
388 Ga0451851_0219306 3300041507 Bacteria 1255
389 Ga0451853_3503921 3300041512 Bacteria 1138
390 Ga0451853_3945261 3300041512 Bacteria 1058
391 Ga0466972_0054449 3300044658 Bacteria 1924
392 Ga0466965_0009353 3300044683 Bacteria 4553
393 Ga0466963_0243643 3300044694 Bacteria 1261
394 Ga0466964_0054250 3300044706 Bacteria 1652
395 Ga0466971_0043439 3300044719 Bacteria 2020
396 Ga0466960_0095929 3300044901 Bacteria 1519
397 Ga0466967_0029515 3300045976 Bacteria 4590
398 Ga0466967_0129258 3300045976 Bacteria 2343
399 Ga0495592_0073199 3300046454 Bacteria 2492
400 Ga0495592_0095701 3300046454 Bacteria 2123
401 Ga0495603_0000729 3300046455 Bacteria 18686
402 Ga0495603_0028681 3300046455 Bacteria 3358
403 Ga0495603_0032720 3300046455 Bacteria 3128
404 Ga0495603_0064072 3300046455 Bacteria 2168
405 Ga0495603_0197961 3300046455 Bacteria 1161
406 Ga0495629_0001683 3300046459 Bacteria 17362
407 Ga0495629_0003206 3300046459 Bacteria 12375
408 Ga0495629_0435858 3300046459 Bacteria 888
409 Ga0495638_0012724 3300046460 Bacteria 5754
410 Ga0495638_0152144 3300046460 Bacteria 1341
411 Ga0495641_0010184 3300046461 Bacteria 5486
412 Ga0495651_0013636 3300046462 Bacteria 6281
413 Ga0495653_0181243 3300046463 Bacteria 1445
414 Ga0495653_0192112 3300046463 Bacteria 1392
415 Ga0495580_0001179 3300046472 Bacteria 22977
416 Ga0495580_0025532 3300046472 Bacteria 4318
417 Ga0495580_0067039 3300046472 Bacteria 2512
418 Ga0495582_0011077 3300046473 Bacteria 4965
419 Ga0495639_0000381 3300046475 Bacteria 21245
420 Ga0495639_0029667 3300046475 Bacteria 2428
421 Ga0495639_0060299 3300046475 Bacteria 1738
422 Ga0495662_0001877 3300046476 Bacteria 10527
423 Ga0495662_0032221 3300046476 Bacteria 2532
424 Ga0495664_0008790 3300046477 Bacteria 5642
425 Ga0495664_0015631 3300046477 Bacteria 4316
426 Ga0495664_0029939 3300046477 Bacteria 3186
427 Ga0495584_0078243 3300046491 Bacteria 1664
428 Ga0495584_0124241 3300046491 Bacteria 1307
429 Ga0495584_0158115 3300046491 Bacteria 1152
430 Ga0495585_0035910 3300046492 Bacteria 2798
431 Ga0495594_0004862 3300046499 Bacteria 6916
432 Ga0495583_0089310 3300046506 Bacteria 1329
433 Ga0495606_0011059 3300046507 Bacteria 7403
434 Ga0495610_0139898 3300046512 Bacteria 1043
435 Ga0495616_0169145 3300046513 Bacteria 978
436 Ga0495618_0031969 3300046514 Bacteria 3296
437 Ga0495618_0059713 3300046514 Bacteria 2417
438 Ga0495620_0139887 3300046515 Bacteria 947
439 Ga0495628_0082675 3300046516 Bacteria 2494
440 Ga0495630_0036156 3300046517 Bacteria 3692
441 Ga0495630_0040192 3300046517 Bacteria 3495
442 Ga0495632_0087111 3300046519 Bacteria 1485
443 Ga0495637_0078692 3300046520 Bacteria 1318
444 Ga0495643_0010985 3300046522 Bacteria 5540
445 Ga0495643_0074345 3300046522 Bacteria 1780
446 Ga0495648_0035952 3300046524 Bacteria 3204
447 Ga0495642_0046160 3300046528 Bacteria 1782
448 Ga0495652_0143134 3300046529 Bacteria 1878
449 Ga0495652_0297688 3300046529 Bacteria 1174
450 Ga0495665_0001300 3300046531 Bacteria 13310
451 Ga0495665_0069349 3300046531 Bacteria 1858
452 Ga0495640_0089610 3300046533 Bacteria 2031
453 Ga0495586_0079732 3300046535 Bacteria 1798
454 Ga0495586_0353052 3300046535 Bacteria 845
455 Ga0495587_0003875 3300046536 Bacteria 9926
456 Ga0495598_0095937 3300046537 Bacteria 974
457 Ga0495645_0010706 3300046543 Bacteria 6440
458 Ga0495645_0249765 3300046543 Bacteria 1179
459 Ga0495622_0000825 3300046557 Bacteria 17144
460 Ga0495633_0053666 3300046558 Bacteria 1897
461 Ga0495633_0060589 3300046558 Bacteria 1773
462 Ga0495667_0016472 3300046559 Bacteria 4994
463 Ga0495667_0042567 3300046559 Bacteria 3012
464 Ga0495667_0068796 3300046559 Bacteria 2311
465 Ga0495656_0012999 3300046615 Bacteria 3086
466 Ga0495656_0108522 3300046615 Bacteria 1294
467 Ga0495668_0015342 3300046616 Bacteria 4477
468 Ga0495668_0258780 3300046616 Bacteria 953
469 Ga0495634_0000324 3300046642 Bacteria 46211
470 Ga0495634_0067958 3300046642 Bacteria 2355
471 Ga0495634_0234319 3300046642 Bacteria 1128
472 Ga0495625_0101657 3300046660 Bacteria 1974
473 Ga0495625_0165881 3300046660 Bacteria 1477
474 Ga0495635_0005678 3300046663 Bacteria 8690
475 Ga0495661_0173277 3300046665 Bacteria 1149
476 Ga0495588_0002137 3300046674 Bacteria 8476
477 Ga0495657_0081716 3300046675 Bacteria 2089
478 Ga0495599_0167112 3300046678 Bacteria 1358
479 Ga0495623_0078500 3300046679 Bacteria 2046
480 Ga0495646_0056473 3300046680 Bacteria 2354
481 Ga0495646_0124489 3300046680 Bacteria 1456
482 Ga0495647_0001889 3300046681 Bacteria 6520
483 Ga0495658_0001003 3300046683 Bacteria 14903
484 Ga0495658_0042101 3300046683 Bacteria 2548
485 Ga0495669_0005527 3300046684 Bacteria 5272
486 Ga0495669_0195408 3300046684 Bacteria 966
487 Ga0495613_0004628 3300046689 Bacteria 10328
488 Ga0495613_0063204 3300046689 Bacteria 2709
489 Ga0495613_0188790 3300046689 Bacteria 1457
490 Ga0495613_0337798 3300046689 Bacteria 1037
491 Ga0495624_0024440 3300046690 Bacteria 3975
492 Ga0495624_0049143 3300046690 Bacteria 2675
493 Ga0495649_0091495 3300046694 Bacteria 1621
494 Ga0495600_0092491 3300046809 Bacteria 1972
495 Ga0495600_0097504 3300046809 Bacteria 1916
496 Ga0495581_0000160 3300047315 Bacteria 30015
497 Ga0495581_0058149 3300047315 Bacteria 2232
498 Ga0495581_0182858 3300047315 Bacteria 1226
499 Ga0495604_0020017 3300047317 Bacteria 5348
500 Ga0495604_0103334 3300047317 Bacteria 2090
501 Ga0495636_0122912 3300047318 Bacteria 1149
502 Ga0495674_0008261 3300047319 Bacteria 9932
503 Ga0495674_0211502 3300047319 Bacteria 1606
504 Ga0495674_0220141 3300047319 Bacteria 1569
505 Ga0495672_0038451 3300047320 Bacteria 2919
506 Ga0495676_0023467 3300047321 Bacteria 5356
507 Ga0495676_0041304 3300047321 Bacteria 3798
508 Ga0495676_0170119 3300047321 Bacteria 1534
509 Ga0495676_0185606 3300047321 Bacteria 1454
510 Ga0495676_0435507 3300047321 Bacteria 866
511 Ga0495683_0050687 3300047323 Bacteria 2077
512 Ga0495687_004391 3300047443 Bacteria 9565
513 Ga0495675_0015095 3300047444 Bacteria 4884
514 Ga0495673_0128670 3300047469 Bacteria 997
515 Ga0495684_0044993 3300047471 Bacteria 3378
516 Ga0495684_0054813 3300047471 Bacteria 3041
517 Ga0495593_0000241 3300047673 Bacteria 29466
518 Ga0495593_0027366 3300047673 Bacteria 3140
519 Ga0495602_0044100 3300048088 Bacteria 4049
520 Ga0495614_0072697 3300048089 Bacteria 1484
521 Ga0495614_0184001 3300048089 Bacteria 941
522 Ga0495615_0025646 3300048090 Bacteria 1370
523 Ga0496100_0349753 3300048903 Bacteria 1116
524 Ga0496101_0098205 3300048904 Bacteria 2188
525 Ga0496101_0104458 3300048904 Bacteria 2125
526 Ga0496101_0845653 3300048904 Bacteria 721
527 Ga0496102_0008512 3300048905 Bacteria 8794
528 Ga0496102_0249017 3300048905 Bacteria 1675
529 Ga0496102_0315931 3300048905 Bacteria 1472
530 Ga0496102_0545936 3300048905 Bacteria 1082
531 Ga0496103_0194678 3300048906 Bacteria 1303
532 Ga0496104_0071617 3300048907 Bacteria 3296
533 Ga0496105_0003937 3300048908 Bacteria 11104
534 Ga0496105_0270833 3300048908 Bacteria 1371
535 Ga0496105_0537367 3300048908 Bacteria 914
536 Ga0496106_0003031 3300048909 Bacteria 12509
537 Ga0496107_0295252 3300048910 Bacteria 1206
538 Ga0496107_0617756 3300048910 Bacteria 800
539 Ga0496108_0034979 3300048911 Bacteria 4174
540 Ga0496108_0701988 3300048911 Bacteria 877
541 Ga0496109_0001522 3300048912 Bacteria 19299
542 Ga0496109_0021025 3300048912 Bacteria 5770
543 Ga0496109_0387729 3300048912 Bacteria 1320
544 Ga0496109_0410729 3300048912 Bacteria 1279
545 Ga0496110_0127744 3300048913 Bacteria 2294
546 Ga0496110_0142177 3300048913 Bacteria 2169
547 Ga0496110_0697802 3300048913 Bacteria 916
548 Ga0496111_0307696 3300048914 Bacteria 1174
549 Ga0496112_0000021 3300048915 Bacteria 156561
550 Ga0496112_0020030 3300048915 Bacteria 6333
551 Ga0496112_0122215 3300048915 Bacteria 2574
552 Ga0496112_0175130 3300048915 Bacteria 2110
553 Ga0496112_0659526 3300048915 Bacteria 976
554 Ga0496113_0073481 3300048916 Bacteria 2605
555 Ga0496114_0242587 3300048917 Bacteria 1585
556 Ga0496114_0257887 3300048917 Bacteria 1535
557 Ga0496115_0090778 3300048918 Bacteria 2496
558 Ga0496115_0093708 3300048918 Bacteria 2456
559 Ga0496115_0261510 3300048918 Bacteria 1423
560 Ga0496116_0038168 3300048919 Bacteria 3339
561 Ga0496117_0009110 3300048920 Bacteria 9325
562 Ga0496117_0083106 3300048920 Bacteria 2095
563 Ga0496118_0006337 3300048921 Bacteria 13064
564 Ga0496118_0070194 3300048921 Bacteria 2531
565 Ga0496119_0009371 3300048922 Bacteria 8418
566 Ga0496120_0004023 3300048923 Bacteria 12746
567 Ga0496121_0000183 3300048924 Bacteria 139168
568 Ga0496121_0035667 3300048924 Bacteria 4451
569 Ga0496121_0078095 3300048924 Bacteria 2633
570 Ga0496121_0091317 3300048924 Bacteria 2378
571 Ga0496121_0239551 3300048924 Bacteria 1265
572 Ga0496122_0022521 3300048925 Bacteria 5596
573 Ga0496123_0207705 3300048926 Bacteria 998
574 Ga0496124_0002761 3300048927 Bacteria 22343
575 Ga0496124_0129547 3300048927 Bacteria 2006
576 Ga0496124_0229989 3300048927 Bacteria 1387
577 Ga0496124_0246901 3300048927 Bacteria 1323
578 Ga0496125_0000877 3300048928 Bacteria 47865
579 Ga0496125_0042347 3300048928 Bacteria 3880
580 Ga0496126_0026033 3300048929 Bacteria 5617
581 Ga0496126_0034207 3300048929 Bacteria 4775
582 Ga0496126_0045660 3300048929 Bacteria 4024
583 Ga0496126_0062075 3300048929 Bacteria 3354
584 Ga0496126_0071934 3300048929 Bacteria 3077
585 Ga0496126_0073342 3300048929 Bacteria 3043
586 Ga0496126_0073979 3300048929 Bacteria 3027
587 Ga0496126_0217986 3300048929 Bacteria 1604
588 Ga0496126_0349317 3300048929 Bacteria 1210
589 Ga0495682_0110191 3300049460 Bacteria 986
590 Ga0501031_0001053 3300049568 Bacteria 16721
591 Ga0501032_0000668 3300049569 Bacteria 27884
592 Ga0501032_0038828 3300049569 Bacteria 3240
593 Ga0501033_0000619 3300049570 Bacteria 32912
594 Ga0501033_0023712 3300049570 Bacteria 4627
595 Ga0501033_0047661 3300049570 Bacteria 3185
596 Ga0501033_0119351 3300049570 Bacteria 1915
597 Ga0501033_0419811 3300049570 Bacteria 931
598 Ga0501034_0000232 3300049571 Bacteria 103995
599 Ga0501036_0000371 3300049572 Bacteria 31608
600 Ga0501036_0172083 3300049572 Bacteria 1824
601 Ga0501037_0000303 3300049573 Bacteria 41763
602 Ga0501038_0000112 3300049574 Bacteria 68326
603 Ga0501038_0119220 3300049574 Bacteria 2178
604 Ga0501038_0429941 3300049574 Bacteria 1018
605 Ga0501039_0000789 3300049575 Bacteria 22789
606 Ga0501039_0134692 3300049575 Bacteria 1939
607 Ga0501039_0143546 3300049575 Bacteria 1876
608 Ga0501042_0021071 3300049578 Bacteria 4540
609 Ga0501043_0000035 3300049579 Bacteria 133200
610 Ga0501043_0096029 3300049579 Bacteria 2330
611 Ga0501043_0317318 3300049579 Bacteria 1188
612 Ga0501046_0022126 3300049580 Bacteria 5239
613 Ga0501046_0049382 3300049580 Bacteria 3328
614 Ga0501046_0055323 3300049580 Bacteria 3119
615 Ga0501046_0193513 3300049580 Bacteria 1516
616 Ga0501047_0000085 3300049581 Bacteria 118617
617 Ga0501047_0031163 3300049581 Bacteria 5143
618 Ga0501047_0045461 3300049581 Bacteria 4246
619 Ga0501047_0601769 3300049581 Bacteria 921
620 Ga0501048_0000061 3300049582 Bacteria 54555
621 Ga0501048_0279425 3300049582 Bacteria 1187
622 Ga0501067_0002211 3300049583 Bacteria 10755
623 Ga0501067_0065732 3300049583 Bacteria 2008
624 Ga0501067_0074997 3300049583 Bacteria 1874
625 Ga0501068_0004923 3300049584 Bacteria 7276
626 Ga0501069_0021376 3300049585 Bacteria 3510
627 Ga0501070_0000272 3300049586 Bacteria 48952
628 Ga0501070_0471742 3300049586 Bacteria 1010
629 Ga0501071_0051827 3300049587 Bacteria 2958
630 Ga0501071_0401422 3300049587 Bacteria 1047
631 Ga0501072_0006309 3300049588 Bacteria 9028
632 Ga0501073_0000026 3300049589 Bacteria 124358
633 Ga0501073_0056283 3300049589 Bacteria 2751
634 Ga0501074_0000017 3300049590 Bacteria 76626
635 Ga0501074_0055970 3300049590 Bacteria 2842
636 Ga0501079_0002647 3300049741 Bacteria 13021
637 Ga0501080_0062421 3300049742 Bacteria 3468
638 Ga0501083_0000638 3300049744 Bacteria 22694
639 Ga0501035_0000548 3300049822 Bacteria 41814
640 Ga0501035_0054958 3300049822 Bacteria 3555
641 Ga0501035_0103647 3300049822 Bacteria 2495
642 Ga0501035_0179739 3300049822 Bacteria 1823
643 Ga0501044_0000051 3300049823 Bacteria 143658
644 Ga0501044_0039498 3300049823 Bacteria 4923
645 Ga0501044_0055169 3300049823 Bacteria 4082
646 nmdc:mga03683_2975_c1 3300050489 Bacteria 5362
647 nmdc:mga03n38_103522_c1 3300050490 Bacteria 1376
648 nmdc:mga03n38_12912_c1 3300050490 Bacteria 3159
649 nmdc:mga03n38_180288_c1 3300050490 Bacteria 1082
650 nmdc:mga03n38_18704_c1 3300050490 Bacteria 2739
651 nmdc:mga00v17_296813_c1 3300050491 Bacteria 1049
652 nmdc:mga00v17_63272_c1 3300050491 Bacteria 2278
653 nmdc:mga0yw44_398702_c1 3300050492 Bacteria 930
654 nmdc:mga0yw44_48221_c1 3300050492 Bacteria 2568
655 nmdc:mga0yw44_504413_c1 3300050492 Bacteria 821
656 nmdc:mga0yw44_83360_c1 3300050492 Bacteria 2008
657 nmdc:mga0k408_239432_c1 3300050493 Bacteria 1083
658 nmdc:mga0k408_9279_c1 3300050493 Bacteria 5301
659 nmdc:mga06z11_116980_c1 3300050494 Bacteria 1483
660 nmdc:mga06z11_14996_c1 3300050494 Bacteria 3449
661 nmdc:mga06z11_32574_c1 3300050494 Bacteria 2543
662 nmdc:mga04h51_101074_c1 3300050495 Bacteria 1051
663 nmdc:mga04h51_82482_c1 3300050495 Bacteria 1144
664 nmdc:mga07m45_19502_c2 3300050496 Bacteria 2221
665 nmdc:mga0n895_32103_c1 3300050512 Bacteria 5037
666 nmdc:mga0n895_67036_c1 3300050512 Bacteria 3554
667 nmdc:mga0rr50_433239_c1 3300050513 Bacteria 1113
668 nmdc:mga0sz30_61424_c1 3300050516 Bacteria 1606
669 Ga0495601_0035341 3300053077 Bacteria 3118
670 Ga0495601_0078141 3300053077 Bacteria 2120
671 Ga0495601_0095765 3300053077 Bacteria 1914
672 Ga0495612_0021249 3300053078 Bacteria 2604
673 Ga0495619_0188485 3300053085 Bacteria 1427
674 Ga0495619_0551691 3300053085 Bacteria 790
675 Ga0500578_0125302 3300053086 Bacteria 1613
676 Ga0500578_0146850 3300053086 Bacteria 1471
677 Ga0500643_000015 3300053087 Bacteria 310312
678 Ga0500647_0089674 3300053091 Bacteria 1472
679 Ga0500583_0054905 3300053092 Bacteria 1861
680 Ga0500651_0078337 3300053093 Bacteria 2050
681 Ga0500566_0000028 3300053094 Bacteria 75589
682 Ga0500566_0000988 3300053094 Bacteria 16379
683 Ga0500566_0005062 3300053094 Bacteria 7858
684 Ga0500566_0157997 3300053094 Bacteria 1185
685 Ga0500640_000581 3300053095 Bacteria 9411
686 Ga0500650_0088991 3300053098 Bacteria 1445
687 Ga0500555_000899 3300053103 Bacteria 10566
688 Ga0500557_000022 3300053105 Bacteria 88506
689 Ga0500562_028396 3300053108 Bacteria 1470
690 Ga0500572_000269 3300053111 Bacteria 18807
691 Ga0500591_013572 3300053115 Bacteria 3902
692 Ga0500595_000652 3300053119 Bacteria 20859
693 Ga0500595_004516 3300053119 Bacteria 6229
694 Ga0500595_013151 3300053119 Bacteria 3175
695 Ga0500614_000118 3300053123 Bacteria 18968
696 Ga0500642_0000060 3300053130 Bacteria 64536
697 Ga0500642_0130489 3300053130 Bacteria 1177
698 Ga0500655_017516 3300053133 Bacteria 1326
699 Ga0500559_0002964 3300053136 Bacteria 8527
700 Ga0500559_0014416 3300053136 Bacteria 3340
701 Ga0500559_0057837 3300053136 Bacteria 1723
702 Ga0500568_0024464 3300053139 Bacteria 2557
703 Ga0500573_0073398 3300053140 Bacteria 1949
704 Ga0500577_0041110 3300053142 Bacteria 1685
705 Ga0500589_176028 3300053147 Bacteria 845
706 Ga0500603_000232 3300053150 Bacteria 14579
707 Ga0500603_091129 3300053150 Bacteria 895
708 Ga0500616_0024278 3300053153 Bacteria 3371
709 Ga0500624_000625 3300053157 Bacteria 9453
710 Ga0500634_0140001 3300053161 Bacteria 1147
711 Ga0500639_000001 3300053163 Bacteria 244795
712 Ga0500637_0000104 3300053178 Bacteria 30138
713 Ga0500637_0152982 3300053178 Bacteria 1332
714 Ga0500625_000333 3300053729 Bacteria 11823
715 Ga0500645_008971 3300053730 Bacteria 3380
716 Ga0500609_026835 3300053731 Bacteria 789
717 Ga0500596_000195 3300053735 Bacteria 9974
718 Ga0500599_016819 3300053736 Bacteria 1012
719 Ga0500601_000662 3300053737 Bacteria 4722
720 Ga0501084_0012583 3300054114 Bacteria 7011
721 Ga0500661_000109 3300055283 Bacteria 13318
722 Ga0501082_0003691 3300060353 Bacteria 13369

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047315 Ga0495581_0058149 Ga0495581_0058149_39_665 180
2 iso_pu_bacteria 2906643746 2906651675 206
3 iso_pu_bacteria 8019586578 8019590381 212
4 3300031548 Ga0307408_100036430 Ga0307408_1000364303 216
5 3300039437 Ga0436365_0866542 Ga0436365_0866542_13_666 216
6 3300035725 Ga0373947_0209247 Ga0373947_0209247_350_1090 221
7 3300046455 Ga0495603_0028681 Ga0495603_0028681_1577_2317 221
8 3300046475 Ga0495639_0060299 Ga0495639_0060299_452_1192 221
9 3300046537 Ga0495598_0095937 Ga0495598_0095937_50_790 221
10 3300047321 Ga0495676_0185606 Ga0495676_0185606_425_1165 221
11 3300005355 Ga0070671_100198395 Ga0070671_1001983952 222
12 3300005548 Ga0070665_100060084 Ga0070665_1000600843 222
13 3300006178 Ga0075367_10022133 Ga0075367_100221334 222
14 3300031824 Ga0307413_10506479 Ga0307413_105064791 222
15 3300032126 Ga0307415_100118119 Ga0307415_1001181192 222
16 3300032126 Ga0307415_100351195 Ga0307415_1003511951 222
17 3300046491 Ga0495584_0078243 Ga0495584_0078243_235_942 222
18 3300046491 Ga0495584_0124241 Ga0495584_0124241_185_889 222
19 3300046492 Ga0495585_0035910 Ga0495585_0035910_317_1021 222
20 3300046519 Ga0495632_0087111 Ga0495632_0087111_274_978 222
21 3300046520 Ga0495637_0078692 Ga0495637_0078692_564_1268 222
22 3300046522 Ga0495643_0074345 Ga0495643_0074345_501_1205 222
23 3300046558 Ga0495633_0060589 Ga0495633_0060589_255_959 222
24 3300046615 Ga0495656_0108522 Ga0495656_0108522_495_1199 222
25 3300046665 Ga0495661_0173277 Ga0495661_0173277_26_730 222
26 3300046674 Ga0495588_0002137 Ga0495588_0002137_7613_8317 222
27 3300046684 Ga0495669_0005527 Ga0495669_0005527_4342_5046 222
28 3300047317 Ga0495604_0103334 Ga0495604_0103334_682_1386 222
29 3300047318 Ga0495636_0122912 Ga0495636_0122912_318_1022 222
30 3300048090 Ga0495615_0025646 Ga0495615_0025646_570_1274 222
31 3300050494 nmdc:mga06z11_116980_c1 nmdc:mga06z11_116980_c1_726_1466 222
32 3300005455 Ga0070663_100029168 Ga0070663_1000291682 223
33 3300005455 Ga0070663_100057859 Ga0070663_1000578592 223
34 3300005539 Ga0068853_100093363 Ga0068853_1000933632 223
35 3300005616 Ga0068852_100198691 Ga0068852_1001986912 223
36 3300005842 Ga0068858_100175128 Ga0068858_1001751282 223
37 3300005843 Ga0068860_100023488 Ga0068860_1000234885 223
38 3300010375 Ga0105239_10062789 Ga0105239_100627893 223
39 3300025919 Ga0207657_10148768 Ga0207657_101487681 223
40 3300026142 Ga0207698_10292882 Ga0207698_102928822 223
41 3300048905 Ga0496102_0315931 Ga0496102_0315931_30_776 223
42 3300048929 Ga0496126_0026033 Ga0496126_0026033_656_1402 223
43 3300050490 nmdc:mga03n38_12912_c1 nmdc:mga03n38_12912_c1_1903_2649 223
44 3300050492 nmdc:mga0yw44_504413_c1 nmdc:mga0yw44_504413_c1_53_799 223
45 3300050494 nmdc:mga06z11_14996_c1 nmdc:mga06z11_14996_c1_687_1433 223
46 3300053086 Ga0500578_0125302 Ga0500578_0125302_83_763 223
47 iso_pu_bacteria 2824661429 2824671067 223
48 iso_pu_bacteria 2879099564 2879103300 223
49 iso_pu_bacteria 2922368715 2922374326 223
50 iso_pu_bacteria 2932809354 2932810630 223
51 iso_pu_bacteria 2932818245 2932821224 223
52 iso_pu_bacteria 2935675223 2935680483 223
53 iso_pu_bacteria 2935684952 2935692847 223
54 iso_pu_bacteria 2935713505 2935721428 223
55 iso_pu_bacteria 2935722832 2935730346 223
56 iso_pu_bacteria 2935732158 2935740359 223
57 iso_pu_bacteria 2935741537 2935749623 223
58 iso_pu_bacteria 2935750917 2935759064 223
59 iso_pu_bacteria 2935760218 2935762606 223
60 iso_pu_bacteria 2940556831 2940564931 223
61 3300005334 Ga0068869_100177424 Ga0068869_1001774242 224
62 3300005338 Ga0068868_100267074 Ga0068868_1002670742 224
63 3300005347 Ga0070668_100140649 Ga0070668_1001406492 224
64 3300005347 Ga0070668_100327741 Ga0070668_1003277412 224
65 3300005455 Ga0070663_100004463 Ga0070663_1000044632 224
66 3300005548 Ga0070665_100101926 Ga0070665_1001019263 224
67 3300005843 Ga0068860_100082950 Ga0068860_1000829503 224
68 3300006038 Ga0075365_10055262 Ga0075365_100552622 224
69 3300006048 Ga0075363_100025917 Ga0075363_1000259172 224
70 3300006178 Ga0075367_10005646 Ga0075367_100056462 224
71 3300006353 Ga0075370_10035483 Ga0075370_100354832 224
72 3300006353 Ga0075370_10052216 Ga0075370_100522162 224
73 3300006353 Ga0075370_10058296 Ga0075370_100582962 224
74 3300025972 Ga0207668_10705264 Ga0207668_107052641 224
75 3300026023 Ga0207677_10191226 Ga0207677_101912262 224
76 3300026067 Ga0207678_10003569 Ga0207678_100035698 224
77 3300028379 Ga0268266_10017714 Ga0268266_100177145 224
78 3300031456 Ga0307513_10164990 Ga0307513_101649903 224
79 3300031507 Ga0307509_10060644 Ga0307509_100606441 224
80 3300033180 Ga0307510_10006119 Ga0307510_1000611914 224
81 3300046460 Ga0495638_0152144 Ga0495638_0152144_31_741 224
82 3300046491 Ga0495584_0158115 Ga0495584_0158115_284_967 224
83 3300046615 Ga0495656_0012999 Ga0495656_0012999_227_1069 224
84 3300048904 Ga0496101_0098205 Ga0496101_0098205_326_1009 224
85 3300048908 Ga0496105_0270833 Ga0496105_0270833_346_1029 224
86 3300048908 Ga0496105_0537367 Ga0496105_0537367_206_889 224
87 3300048912 Ga0496109_0001522 Ga0496109_0001522_18013_18696 224
88 3300048917 Ga0496114_0242587 Ga0496114_0242587_275_958 224
89 3300048918 Ga0496115_0090778 Ga0496115_0090778_188_871 224
90 3300053094 Ga0500566_0157997 Ga0500566_0157997_187_897 224
91 3300053119 Ga0500595_004516 Ga0500595_004516_3581_4291 224
92 3300053133 Ga0500655_017516 Ga0500655_017516_195_905 224
93 3300053142 Ga0500577_0041110 Ga0500577_0041110_774_1484 224
94 3300053161 Ga0500634_0140001 Ga0500634_0140001_124_834 224
95 3300053178 Ga0500637_0152982 Ga0500637_0152982_55_765 224
96 iso_pu_bacteria 2507262055 2507508647 224
97 iso_pu_bacteria 2508501009 2508542742 224
98 iso_pu_bacteria 2508501042 2508691499 224
99 iso_pu_bacteria 2511231028 2511397779 224
100 iso_pu_bacteria 2513237092 2513623097 224
101 iso_pu_bacteria 2513237095 2513645902 224
102 iso_pu_bacteria 2513237096 2513654689 224
103 iso_pu_bacteria 2513237102 2513705210 224
104 iso_pu_bacteria 2513237104 2513719509 224
105 iso_pu_bacteria 2513237137 2513855900 224
106 iso_pu_bacteria 2513237139 2513872709 224
107 iso_pu_bacteria 2513237145 2513915131 224
108 iso_pu_bacteria 2513237161 2514011914 224
109 iso_pu_bacteria 2515154112 2515628301 224
110 iso_pu_bacteria 2517572143 2517892426 224
111 iso_pu_bacteria 2524023210 2524471038 224
112 iso_pu_bacteria 2528768022 2528851154 224
113 iso_pu_bacteria 2617270735 2617348954 224
114 iso_pu_bacteria 2617270741 2617375829 224
115 iso_pu_bacteria 2744054633 2745074955 224
116 iso_pu_bacteria 2791355196 2793062457 224
117 iso_pu_bacteria 2791355197 2793072093 224
118 iso_pu_bacteria 2802429603 2805915393 224
119 iso_pu_bacteria 2816332527 2818238970 224
120 iso_pu_bacteria 2824609381 2824617775 224
121 iso_pu_bacteria 2824617872 2824626207 224
122 iso_pu_bacteria 2824626560 2824634894 224
123 iso_pu_bacteria 2824635225 2824643179 224
124 iso_pu_bacteria 2824644064 2824651362 224
125 iso_pu_bacteria 2824671348 2824679407 224
126 iso_pu_bacteria 2824679649 2824687767 224
127 iso_pu_bacteria 2824687955 2824696055 224
128 iso_pu_bacteria 2824696289 2824701014 224
129 iso_pu_bacteria 2824714736 2824719511 224
130 iso_pu_bacteria 2824723954 2824729931 224
131 iso_pu_bacteria 2824732956 2824740730 224
132 iso_pu_bacteria 2824746037 2824753790 224
133 iso_pu_bacteria 2824773399 2824781345 224
134 iso_pu_bacteria 2828305725 2828309882 224
135 iso_pu_bacteria 2838122688 2838123814 224
136 iso_pu_bacteria 2841941048 2841944057 224
137 iso_pu_bacteria 2841949485 2841949914 224
138 iso_pu_bacteria 2841966195 2841966332 224
139 iso_pu_bacteria 2841974524 2841975066 224
140 iso_pu_bacteria 2841983080 2841983362 224
141 iso_pu_bacteria 2842038055 2842039125 224
142 iso_pu_bacteria 2842045827 2842047928 224
143 iso_pu_bacteria 2847939898 2847946505 224
144 iso_pu_bacteria 2849076700 2849079369 224
145 iso_pu_bacteria 2851182111 2851184694 224
146 iso_pu_bacteria 2852387548 2852394213 224
147 iso_pu_bacteria 2857509624 2857514372 224
148 iso_pu_bacteria 2874590934 2874591547 224
149 iso_pu_bacteria 2874604998 2874605145 224
150 iso_pu_bacteria 2874612657 2874619588 224
151 iso_pu_bacteria 2874620515 2874627158 224
152 iso_pu_bacteria 2874628541 2874631790 224
153 iso_pu_bacteria 2874645413 2874648935 224
154 iso_pu_bacteria 2876771140 2876771962 224
155 iso_pu_bacteria 2876818435 2876822093 224
156 iso_pu_bacteria 2879074833 2879075606 224
157 iso_pu_bacteria 2879127579 2879135486 224
158 iso_pu_bacteria 2879142872 2879143095 224
159 iso_pu_bacteria 2881364244 2881366994 224
160 iso_pu_bacteria 2881665667 2881671117 224
161 iso_pu_bacteria 2885366525 2885370528 224
162 iso_pu_bacteria 2885383462 2885390705 224
163 iso_pu_bacteria 2888378607 2888384003 224
164 iso_pu_bacteria 2888388044 2888393852 224
165 iso_pu_bacteria 2903748898 2903749462 224
166 iso_pu_bacteria 2903768456 2903777971 224
167 iso_pu_bacteria 2904666416 2904669859 224
168 iso_pu_bacteria 2906610324 2906618589 224
169 iso_pu_bacteria 2906626472 2906628612 224
170 iso_pu_bacteria 2906635258 2906638754 224
171 iso_pu_bacteria 2906660503 2906666411 224
172 iso_pu_bacteria 2908775508 2908780115 224
173 iso_pu_bacteria 2922393267 2922396368 224
174 iso_pu_bacteria 2922425934 2922430248 224
175 iso_pu_bacteria 2929615660 2929618000 224
176 iso_pu_bacteria 2929624759 2929627681 224
177 iso_pu_bacteria 2932784394 2932788220 224
178 iso_pu_bacteria 2932794094 2932797531 224
179 iso_pu_bacteria 2932801729 2932802846 224
180 iso_pu_bacteria 2932828146 2932831217 224
181 iso_pu_bacteria 2933577622 2933579928 224
182 iso_pu_bacteria 2935608549 2935608823 224
183 iso_pu_bacteria 2935616580 2935622987 224
184 iso_pu_bacteria 2935630451 2935631694 224
185 iso_pu_bacteria 2935694250 2935701016 224
186 iso_pu_bacteria 2935769743 2935773237 224
187 iso_pu_bacteria 2935777560 2935778483 224
188 iso_pu_bacteria 2935785616 2935790398 224
189 iso_pu_bacteria 2935793552 2935798127 224
190 iso_pu_bacteria 2935801545 2935803205 224
191 iso_pu_bacteria 2935819856 2935821983 224
192 iso_pu_bacteria 2935837841 2935838517 224
193 iso_pu_bacteria 2935847175 2935847565 224
194 iso_pu_bacteria 2935855204 2935861235 224
195 iso_pu_bacteria 2935864058 2935865773 224
196 iso_pu_bacteria 2935873716 2935878274 224
197 iso_pu_bacteria 2935883170 2935885188 224
198 iso_pu_bacteria 2935908558 2935909168 224
199 iso_pu_bacteria 2935916978 2935919889 224
200 iso_pu_bacteria 2935926038 2935926258 224
201 iso_pu_bacteria 2935934488 2935934708 224
202 iso_pu_bacteria 2935942939 2935943158 224
203 iso_pu_bacteria 2935951376 2935951596 224
204 iso_pu_bacteria 2935959822 2935966428 224
205 iso_pu_bacteria 2935967501 2935967721 224
206 iso_pu_bacteria 2935975950 2935977079 224
207 iso_pu_bacteria 2935984226 2935988233 224
208 iso_pu_bacteria 2935992306 2935994587 224
209 iso_pu_bacteria 2941507105 2941511488 224
210 iso_pu_bacteria 2941515067 2941519189 224
211 iso_pu_bacteria 2941523033 2941526231 224
212 iso_pu_bacteria 2941538514 2941538815 224
213 iso_pu_bacteria 3005483717 3005487283 224
214 iso_pu_bacteria 3005506211 3005510277 224
215 iso_pu_bacteria 3005587118 3005591071 224
216 iso_pu_bacteria 3005710791 3005714847 224
217 iso_pu_bacteria 3005718088 3005722275 224
218 iso_pu_bacteria 8006926726 8006929950 224
219 iso_pu_bacteria 8016511872 8016522404 224
220 iso_pu_bacteria 8016530956 8016534888 224
221 iso_pu_bacteria 8016539877 8016548099 224
222 iso_pu_bacteria 8016548790 8016554028 224
223 iso_pu_bacteria 8016557553 8016562402 224
224 iso_pu_bacteria 8016566248 8016573233 224
225 iso_pu_bacteria 8016575299 8016577377 224
226 iso_pu_bacteria 8016595262 8016600202 224
227 iso_pu_bacteria 8016603502 8016610550 224
228 iso_pu_bacteria 8016622563 8016626607 224
229 iso_pu_bacteria 8017057580 8017063156 224
230 iso_pu_bacteria 8019530166 8019534648 224
231 iso_pu_bacteria 8019538911 8019544823 224
232 iso_pu_bacteria 8019547302 8019553714 224
233 iso_pu_bacteria 8019555841 8019556789 224
234 iso_pu_bacteria 8019565922 8019568518 224
235 iso_pu_bacteria 8019576017 8019582590 224
236 iso_pu_bacteria 8019597564 8019600973 224
237 iso_pu_bacteria 8019608314 8019617580 224
238 iso_pu_bacteria 8019619141 8019628076 224
239 iso_pu_bacteria 8019638758 8019645196 224
240 iso_pu_bacteria 8019659431 8019662424 224
241 iso_pu_bacteria 8019668869 8019671922 224
242 iso_pu_bacteria 8019678201 8019684170 224
243 iso_pu_bacteria 8019687851 8019690010 224
244 iso_pu_bacteria 8054002106 8054007361 224
245 iso_pu_bacteria 8055742211 8055746411 224
246 iso_pu_bacteria 8056681323 8056686638 224
247 iso_pu_bacteria 8056689827 8056693570 224
248 iso_pu_bacteria 8057575449 8057579655 224
249 3300003215 JGI25153J46596_10001920 JGI25153J46596_100019208 225
250 3300003215 JGI25153J46596_10002312 JGI25153J46596_100023129 225
251 3300003215 JGI25153J46596_10017224 JGI25153J46596_100172243 225
252 3300003354 JGI25160J50197_1000631 JGI25160J50197_100063119 225
253 3300003354 JGI25160J50197_1011095 JGI25160J50197_10110954 225
254 3300004625 Ga0055543_1001288 Ga0055543_10012887 225
255 3300005262 Ga0065165_1000844 Ga0065165_100084411 225
256 3300005262 Ga0065165_1002117 Ga0065165_100211712 225
257 3300005262 Ga0065165_1034331 Ga0065165_10343311 225
258 3300005331 Ga0070670_100857974 Ga0070670_1008579741 225
259 3300005336 Ga0070680_100246414 Ga0070680_1002464141 225
260 3300005337 Ga0070682_100080180 Ga0070682_1000801802 225
261 3300005337 Ga0070682_100185509 Ga0070682_1001855092 225
262 3300005355 Ga0070671_100081966 Ga0070671_1000819662 225
263 3300005367 Ga0070667_100328787 Ga0070667_1003287871 225
264 3300005436 Ga0070713_100040544 Ga0070713_1000405443 225
265 3300005436 Ga0070713_100113099 Ga0070713_1001130992 225
266 3300005439 Ga0070711_100145658 Ga0070711_1001456583 225
267 3300005455 Ga0070663_100012305 Ga0070663_1000123052 225
268 3300005456 Ga0070678_100304889 Ga0070678_1003048891 225
269 3300005456 Ga0070678_100377632 Ga0070678_1003776322 225
270 3300005457 Ga0070662_100493385 Ga0070662_1004933852 225
271 3300005458 Ga0070681_10099623 Ga0070681_100996232 225
272 3300005530 Ga0070679_100025804 Ga0070679_1000258042 225
273 3300005539 Ga0068853_100625265 Ga0068853_1006252651 225
274 3300005539 Ga0068853_100882191 Ga0068853_1008821911 225
275 3300005544 Ga0070686_100421597 Ga0070686_1004215971 225
276 3300005548 Ga0070665_100078115 Ga0070665_1000781151 225
277 3300005548 Ga0070665_100555181 Ga0070665_1005551812 225
278 3300005563 Ga0068855_100047191 Ga0068855_1000471911 225
279 3300005563 Ga0068855_100118158 Ga0068855_1001181583 225
280 3300005564 Ga0070664_100861488 Ga0070664_1008614881 225
281 3300005614 Ga0068856_100133911 Ga0068856_1001339112 225
282 3300005614 Ga0068856_100182705 Ga0068856_1001827053 225
283 3300005614 Ga0068856_100543575 Ga0068856_1005435752 225
284 3300005614 Ga0068856_100724889 Ga0068856_1007248892 225
285 3300005616 Ga0068852_100260990 Ga0068852_1002609902 225
286 3300005616 Ga0068852_100379436 Ga0068852_1003794361 225
287 3300005616 Ga0068852_100943691 Ga0068852_1009436911 225
288 3300005617 Ga0068859_100833652 Ga0068859_1008336521 225
289 3300005840 Ga0068870_10298658 Ga0068870_102986581 225
290 3300005842 Ga0068858_100362299 Ga0068858_1003622991 225
291 3300005843 Ga0068860_100518562 Ga0068860_1005185621 225
292 3300005937 Ga0081455_10017212 Ga0081455_100172128 225
293 3300005983 Ga0081540_1003394 Ga0081540_10033946 225
294 3300005983 Ga0081540_1021640 Ga0081540_10216402 225
295 3300005983 Ga0081540_1025247 Ga0081540_10252473 225
296 3300005985 Ga0081539_10021340 Ga0081539_100213402 225
297 3300006028 Ga0070717_10001195 Ga0070717_1000119514 225
298 3300006038 Ga0075365_10094748 Ga0075365_100947482 225
299 3300006038 Ga0075365_10179316 Ga0075365_101793162 225
300 3300006038 Ga0075365_10524505 Ga0075365_105245051 225
301 3300006042 Ga0075368_10000684 Ga0075368_100006844 225
302 3300006048 Ga0075363_100027730 Ga0075363_1000277303 225
303 3300006048 Ga0075363_100367304 Ga0075363_1003673041 225
304 3300006051 Ga0075364_10028098 Ga0075364_100280984 225
305 3300006177 Ga0075362_10100664 Ga0075362_101006642 225
306 3300006186 Ga0075369_10013223 Ga0075369_100132233 225
307 3300006195 Ga0075366_10006129 Ga0075366_100061293 225
308 3300006195 Ga0075366_10056251 Ga0075366_100562513 225
309 3300006353 Ga0075370_10013795 Ga0075370_100137953 225
310 3300006931 Ga0097620_100833682 Ga0097620_1008336821 225
311 3300006942 Ga0099824_1006510 Ga0099824_10065108 225
312 3300009093 Ga0105240_10305136 Ga0105240_103051362 225
313 3300009093 Ga0105240_10314687 Ga0105240_103146872 225
314 3300009148 Ga0105243_10146926 Ga0105243_101469263 225
315 3300009174 Ga0105241_10270136 Ga0105241_102701362 225
316 3300009177 Ga0105248_10004990 Ga0105248_100049908 225
317 3300009177 Ga0105248_10201894 Ga0105248_102018943 225
318 3300009545 Ga0105237_10375557 Ga0105237_103755572 225
319 3300009551 Ga0105238_10094882 Ga0105238_100948822 225
320 3300010375 Ga0105239_10189322 Ga0105239_101893222 225
321 3300010375 Ga0105239_10696974 Ga0105239_106969742 225
322 3300010375 Ga0105239_10858460 Ga0105239_108584601 225
323 3300011119 Ga0105246_10031542 Ga0105246_100315421 225
324 3300013102 Ga0157371_10034937 Ga0157371_100349373 225
325 3300013104 Ga0157370_10007389 Ga0157370_100073892 225
326 3300013296 Ga0157374_10406121 Ga0157374_104061211 225
327 3300013297 Ga0157378_10016616 Ga0157378_100166164 225
328 3300013297 Ga0157378_10303285 Ga0157378_103032851 225
329 3300013306 Ga0163162_10094634 Ga0163162_100946343 225
330 3300013308 Ga0157375_10280668 Ga0157375_102806682 225
331 3300014325 Ga0163163_10027245 Ga0163163_100272452 225
332 3300014325 Ga0163163_10048691 Ga0163163_100486914 225
333 3300015261 Ga0182006_1096908 Ga0182006_10969081 225
334 3300021321 Ga0214542_1000001 Ga0214542_1000001841 225
335 3300021324 Ga0214545_1000001 Ga0214545_1000001907 225
336 3300021327 Ga0214543_1000001 Ga0214543_1000001287 225
337 3300025230 Ga0209563_116775 Ga0209563_1167752 225
338 3300025253 Ga0209677_102871 Ga0209677_1028712 225
339 3300025261 Ga0209233_1014518 Ga0209233_10145182 225
340 3300025273 Ga0209673_1056165 Ga0209673_10561651 225
341 3300025295 Ga0209564_1002211 Ga0209564_10022118 225
342 3300025297 Ga0209758_1000021 Ga0209758_1000021651 225
343 3300025297 Ga0209758_1001025 Ga0209758_10010257 225
344 3300025297 Ga0209758_1001133 Ga0209758_10011339 225
345 3300025297 Ga0209758_1011526 Ga0209758_10115264 225
346 3300025297 Ga0209758_1056350 Ga0209758_10563501 225
347 3300025297 Ga0209758_1103550 Ga0209758_11035501 225
348 3300025299 Ga0209256_1007103 Ga0209256_10071034 225
349 3300025299 Ga0209256_1053793 Ga0209256_10537931 225
350 3300025302 Ga0207426_1000479 Ga0207426_100047915 225
351 3300025302 Ga0207426_1000599 Ga0207426_100059930 225
352 3300025302 Ga0207426_1042331 Ga0207426_10423311 225
353 3300025315 Ga0207697_10034517 Ga0207697_100345173 225
354 3300025900 Ga0207710_10140396 Ga0207710_101403961 225
355 3300025901 Ga0207688_10034076 Ga0207688_100340761 225
356 3300025903 Ga0207680_10145430 Ga0207680_101454302 225
357 3300025903 Ga0207680_10319547 Ga0207680_103195471 225
358 3300025912 Ga0207707_10314629 Ga0207707_103146292 225
359 3300025913 Ga0207695_10117455 Ga0207695_101174551 225
360 3300025913 Ga0207695_10150334 Ga0207695_101503341 225
361 3300025914 Ga0207671_10407514 Ga0207671_104075142 225
362 3300025915 Ga0207693_10159435 Ga0207693_101594351 225
363 3300025916 Ga0207663_10437369 Ga0207663_104373691 225
364 3300025917 Ga0207660_10174352 Ga0207660_101743521 225
365 3300025919 Ga0207657_10081542 Ga0207657_100815422 225
366 3300025923 Ga0207681_10524860 Ga0207681_105248601 225
367 3300025924 Ga0207694_10159698 Ga0207694_101596982 225
368 3300025925 Ga0207650_10039723 Ga0207650_100397235 225
369 3300025925 Ga0207650_10687629 Ga0207650_106876291 225
370 3300025928 Ga0207700_10022160 Ga0207700_100221602 225
371 3300025928 Ga0207700_10052321 Ga0207700_100523212 225
372 3300025931 Ga0207644_10275592 Ga0207644_102755922 225
373 3300025933 Ga0207706_10331773 Ga0207706_103317732 225
374 3300025935 Ga0207709_10248879 Ga0207709_102488791 225
375 3300025941 Ga0207711_10150513 Ga0207711_101505132 225
376 3300025941 Ga0207711_10608139 Ga0207711_106081391 225
377 3300025949 Ga0207667_10265170 Ga0207667_102651701 225
378 3300025981 Ga0207640_10194183 Ga0207640_101941831 225
379 3300026041 Ga0207639_10140392 Ga0207639_101403922 225
380 3300026041 Ga0207639_10276002 Ga0207639_102760022 225
381 3300026075 Ga0207708_10197022 Ga0207708_101970221 225
382 3300026078 Ga0207702_10031931 Ga0207702_100319313 225
383 3300026078 Ga0207702_10267484 Ga0207702_102674842 225
384 3300026078 Ga0207702_10431405 Ga0207702_104314051 225
385 3300026118 Ga0207675_100161084 Ga0207675_1001610841 225
386 3300026142 Ga0207698_10554133 Ga0207698_105541331 225
387 3300027296 Ga0209389_1000121 Ga0209389_100012118 225
388 3300027357 Ga0209589_1002338 Ga0209589_10023389 225
389 3300027361 Ga0209489_101475 Ga0209489_10147533 225
390 3300027512 Ga0209179_1000593 Ga0209179_10005932 225
391 3300027866 Ga0209813_10036440 Ga0209813_100364402 225
392 3300028379 Ga0268266_10001098 Ga0268266_1000109824 225
393 3300028379 Ga0268266_10143932 Ga0268266_101439321 225
394 3300028381 Ga0268264_10524043 Ga0268264_105240431 225
395 3300031247 Ga0265340_10036789 Ga0265340_100367892 225
396 3300031616 Ga0307508_10000010 Ga0307508_1000001059 225
397 3300031730 Ga0307516_10042681 Ga0307516_100426814 225
398 3300032005 Ga0307411_10333882 Ga0307411_103338821 225
399 3300033180 Ga0307510_10004213 Ga0307510_100042139 225
400 3300033180 Ga0307510_10392259 Ga0307510_103922591 225
401 3300033442 Ga0315911_1000001 Ga0315911_1000001183 225
402 3300035086 Ga0373934_0085641 Ga0373934_0085641_290_976 225
403 3300035111 Ga0373923_0045006 Ga0373923_0045006_148_834 225
404 3300035112 Ga0373932_0077068 Ga0373932_0077068_343_1032 225
405 3300035113 Ga0373936_0005311 Ga0373936_0005311_2910_3596 225
406 3300035118 Ga0373954_0008335 Ga0373954_0008335_920_1606 225
407 3300035118 Ga0373954_0067608 Ga0373954_0067608_440_1126 225
408 3300035170 Ga0373943_0004918 Ga0373943_0004918_4670_5356 225
409 3300035172 Ga0373955_0039717 Ga0373955_0039717_741_1427 225
410 3300035172 Ga0373955_0090334 Ga0373955_0090334_766_1452 225
411 3300035410 Ga0373924_0027064 Ga0373924_0027064_300_986 225
412 3300035695 Ga0373927_0306964 Ga0373927_0306964_195_881 225
413 3300035695 Ga0373927_0327863 Ga0373927_0327863_22_708 225
414 3300035724 Ga0373933_0001930 Ga0373933_0001930_8707_9405 225
415 3300035724 Ga0373933_0054487 Ga0373933_0054487_1136_1822 225
416 3300036401 Ga0373937_0127645 Ga0373937_0127645_825_1511 225
417 3300037466 Ga0395898_0677965 Ga0395898_0677965_276_962 225
418 3300037471 Ga0395905_0007051 Ga0395905_0007051_6836_7522 225
419 3300037471 Ga0395905_0250301 Ga0395905_0250301_423_1109 225
420 3300038443 Ga0395901_0129842 Ga0395901_0129842_1511_2197 225
421 3300041460 Ga0451802_0675589 Ga0451802_0675589_384_1070 225
422 3300041512 Ga0451853_3503921 Ga0451853_3503921_338_1024 225
423 3300041512 Ga0451853_3945261 Ga0451853_3945261_104_790 225
424 3300044658 Ga0466972_0054449 Ga0466972_0054449_255_941 225
425 3300044683 Ga0466965_0009353 Ga0466965_0009353_1637_2323 225
426 3300044706 Ga0466964_0054250 Ga0466964_0054250_412_1113 225
427 3300044719 Ga0466971_0043439 Ga0466971_0043439_827_1513 225
428 3300044901 Ga0466960_0095929 Ga0466960_0095929_128_814 225
429 3300045976 Ga0466967_0129258 Ga0466967_0129258_1439_2125 225
430 3300046454 Ga0495592_0073199 Ga0495592_0073199_567_1253 225
431 3300046454 Ga0495592_0095701 Ga0495592_0095701_1245_1931 225
432 3300046455 Ga0495603_0000729 Ga0495603_0000729_11697_12383 225
433 3300046459 Ga0495629_0001683 Ga0495629_0001683_10374_11060 225
434 3300046459 Ga0495629_0003206 Ga0495629_0003206_2448_3134 225
435 3300046460 Ga0495638_0012724 Ga0495638_0012724_921_1622 225
436 3300046461 Ga0495641_0010184 Ga0495641_0010184_4653_5339 225
437 3300046462 Ga0495651_0013636 Ga0495651_0013636_2250_2936 225
438 3300046463 Ga0495653_0181243 Ga0495653_0181243_149_835 225
439 3300046463 Ga0495653_0192112 Ga0495653_0192112_152_838 225
440 3300046472 Ga0495580_0001179 Ga0495580_0001179_5907_6593 225
441 3300046475 Ga0495639_0000381 Ga0495639_0000381_14341_15027 225
442 3300046476 Ga0495662_0001877 Ga0495662_0001877_9258_9944 225
443 3300046477 Ga0495664_0008790 Ga0495664_0008790_3752_4438 225
444 3300046499 Ga0495594_0004862 Ga0495594_0004862_5848_6534 225
445 3300046506 Ga0495583_0089310 Ga0495583_0089310_140_826 225
446 3300046507 Ga0495606_0011059 Ga0495606_0011059_5348_6034 225
447 3300046512 Ga0495610_0139898 Ga0495610_0139898_301_1002 225
448 3300046513 Ga0495616_0169145 Ga0495616_0169145_200_886 225
449 3300046514 Ga0495618_0059713 Ga0495618_0059713_388_1074 225
450 3300046515 Ga0495620_0139887 Ga0495620_0139887_127_813 225
451 3300046516 Ga0495628_0082675 Ga0495628_0082675_400_1086 225
452 3300046517 Ga0495630_0040192 Ga0495630_0040192_194_880 225
453 3300046522 Ga0495643_0010985 Ga0495643_0010985_1133_1819 225
454 3300046528 Ga0495642_0046160 Ga0495642_0046160_282_986 225
455 3300046529 Ga0495652_0143134 Ga0495652_0143134_806_1492 225
456 3300046529 Ga0495652_0297688 Ga0495652_0297688_117_803 225
457 3300046531 Ga0495665_0001300 Ga0495665_0001300_7672_8358 225
458 3300046535 Ga0495586_0353052 Ga0495586_0353052_38_724 225
459 3300046536 Ga0495587_0003875 Ga0495587_0003875_1679_2365 225
460 3300046543 Ga0495645_0249765 Ga0495645_0249765_157_843 225
461 3300046557 Ga0495622_0000825 Ga0495622_0000825_2134_2820 225
462 3300046558 Ga0495633_0053666 Ga0495633_0053666_425_1111 225
463 3300046559 Ga0495667_0016472 Ga0495667_0016472_1367_2053 225
464 3300046559 Ga0495667_0068796 Ga0495667_0068796_162_848 225
465 3300046616 Ga0495668_0015342 Ga0495668_0015342_963_1649 225
466 3300046616 Ga0495668_0258780 Ga0495668_0258780_215_916 225
467 3300046642 Ga0495634_0000324 Ga0495634_0000324_32362_33048 225
468 3300046642 Ga0495634_0234319 Ga0495634_0234319_432_1118 225
469 3300046660 Ga0495625_0101657 Ga0495625_0101657_27_713 225
470 3300046663 Ga0495635_0005678 Ga0495635_0005678_7006_7692 225
471 3300046675 Ga0495657_0081716 Ga0495657_0081716_998_1684 225
472 3300046678 Ga0495599_0167112 Ga0495599_0167112_647_1333 225
473 3300046679 Ga0495623_0078500 Ga0495623_0078500_778_1464 225
474 3300046680 Ga0495646_0056473 Ga0495646_0056473_1646_2332 225
475 3300046680 Ga0495646_0124489 Ga0495646_0124489_725_1411 225
476 3300046681 Ga0495647_0001889 Ga0495647_0001889_5706_6392 225
477 3300046683 Ga0495658_0001003 Ga0495658_0001003_1223_1909 225
478 3300046689 Ga0495613_0004628 Ga0495613_0004628_132_818 225
479 3300046689 Ga0495613_0063204 Ga0495613_0063204_1468_2154 225
480 3300046689 Ga0495613_0337798 Ga0495613_0337798_29_715 225
481 3300046690 Ga0495624_0049143 Ga0495624_0049143_57_743 225
482 3300046694 Ga0495649_0091495 Ga0495649_0091495_559_1245 225
483 3300046809 Ga0495600_0092491 Ga0495600_0092491_558_1244 225
484 3300046809 Ga0495600_0097504 Ga0495600_0097504_510_1196 225
485 3300047315 Ga0495581_0000160 Ga0495581_0000160_14335_15021 225
486 3300047317 Ga0495604_0020017 Ga0495604_0020017_1006_1692 225
487 3300047319 Ga0495674_0008261 Ga0495674_0008261_6671_7357 225
488 3300047319 Ga0495674_0220141 Ga0495674_0220141_109_795 225
489 3300047321 Ga0495676_0023467 Ga0495676_0023467_4221_4907 225
490 3300047321 Ga0495676_0041304 Ga0495676_0041304_964_1650 225
491 3300047323 Ga0495683_0050687 Ga0495683_0050687_292_978 225
492 3300047443 Ga0495687_004391 Ga0495687_004391_8179_8865 225
493 3300047444 Ga0495675_0015095 Ga0495675_0015095_3178_3864 225
494 3300047469 Ga0495673_0128670 Ga0495673_0128670_202_888 225
495 3300047471 Ga0495684_0054813 Ga0495684_0054813_1246_1932 225
496 3300047673 Ga0495593_0000241 Ga0495593_0000241_13429_14115 225
497 3300048088 Ga0495602_0044100 Ga0495602_0044100_2931_3617 225
498 3300048905 Ga0496102_0008512 Ga0496102_0008512_7552_8238 225
499 3300048905 Ga0496102_0545936 Ga0496102_0545936_157_897 225
500 3300048906 Ga0496103_0194678 Ga0496103_0194678_293_979 225
501 3300048907 Ga0496104_0071617 Ga0496104_0071617_1109_1795 225
502 3300048908 Ga0496105_0003937 Ga0496105_0003937_4948_5634 225
503 3300048909 Ga0496106_0003031 Ga0496106_0003031_9608_10294 225
504 3300048910 Ga0496107_0617756 Ga0496107_0617756_71_757 225
505 3300048911 Ga0496108_0034979 Ga0496108_0034979_176_862 225
506 3300048911 Ga0496108_0701988 Ga0496108_0701988_71_757 225
507 3300048912 Ga0496109_0021025 Ga0496109_0021025_1813_2499 225
508 3300048912 Ga0496109_0387729 Ga0496109_0387729_200_880 225
509 3300048912 Ga0496109_0410729 Ga0496109_0410729_318_1004 225
510 3300048913 Ga0496110_0127744 Ga0496110_0127744_222_908 225
511 3300048913 Ga0496110_0142177 Ga0496110_0142177_886_1575 225
512 3300048913 Ga0496110_0697802 Ga0496110_0697802_33_719 225
513 3300048914 Ga0496111_0307696 Ga0496111_0307696_113_799 225
514 3300048915 Ga0496112_0122215 Ga0496112_0122215_881_1567 225
515 3300048915 Ga0496112_0175130 Ga0496112_0175130_688_1374 225
516 3300048915 Ga0496112_0659526 Ga0496112_0659526_69_755 225
517 3300048916 Ga0496113_0073481 Ga0496113_0073481_386_1072 225
518 3300048918 Ga0496115_0261510 Ga0496115_0261510_385_1071 225
519 3300048919 Ga0496116_0038168 Ga0496116_0038168_2170_2856 225
520 3300048920 Ga0496117_0009110 Ga0496117_0009110_3991_4677 225
521 3300048920 Ga0496117_0083106 Ga0496117_0083106_956_1642 225
522 3300048921 Ga0496118_0006337 Ga0496118_0006337_4442_5128 225
523 3300048921 Ga0496118_0070194 Ga0496118_0070194_1831_2517 225
524 3300048922 Ga0496119_0009371 Ga0496119_0009371_1267_1953 225
525 3300048923 Ga0496120_0004023 Ga0496120_0004023_2897_3583 225
526 3300048924 Ga0496121_0000183 Ga0496121_0000183_132513_133199 225
527 3300048924 Ga0496121_0035667 Ga0496121_0035667_557_1258 225
528 3300048924 Ga0496121_0091317 Ga0496121_0091317_1179_1865 225
529 3300048925 Ga0496122_0022521 Ga0496122_0022521_3206_3892 225
530 3300048926 Ga0496123_0207705 Ga0496123_0207705_64_750 225
531 3300048927 Ga0496124_0002761 Ga0496124_0002761_3863_4549 225
532 3300048927 Ga0496124_0129547 Ga0496124_0129547_1132_1818 225
533 3300048927 Ga0496124_0229989 Ga0496124_0229989_652_1338 225
534 3300048928 Ga0496125_0042347 Ga0496125_0042347_2807_3493 225
535 3300048929 Ga0496126_0034207 Ga0496126_0034207_2415_3101 225
536 3300048929 Ga0496126_0045660 Ga0496126_0045660_2277_2963 225
537 3300048929 Ga0496126_0071934 Ga0496126_0071934_1163_1849 225
538 3300048929 Ga0496126_0073342 Ga0496126_0073342_293_979 225
539 3300048929 Ga0496126_0349317 Ga0496126_0349317_41_727 225
540 3300049460 Ga0495682_0110191 Ga0495682_0110191_170_958 225
541 3300049568 Ga0501031_0001053 Ga0501031_0001053_1839_2525 225
542 3300049569 Ga0501032_0000668 Ga0501032_0000668_4406_5092 225
543 3300049570 Ga0501033_0000619 Ga0501033_0000619_12950_13636 225
544 3300049571 Ga0501034_0000232 Ga0501034_0000232_39833_40519 225
545 3300049572 Ga0501036_0000371 Ga0501036_0000371_13088_13774 225
546 3300049573 Ga0501037_0000303 Ga0501037_0000303_20758_21444 225
547 3300049574 Ga0501038_0000112 Ga0501038_0000112_49767_50453 225
548 3300049575 Ga0501039_0000789 Ga0501039_0000789_2592_3278 225
549 3300049578 Ga0501042_0021071 Ga0501042_0021071_2991_3677 225
550 3300049579 Ga0501043_0000035 Ga0501043_0000035_15637_16323 225
551 3300049580 Ga0501046_0022126 Ga0501046_0022126_4359_5045 225
552 3300049581 Ga0501047_0000085 Ga0501047_0000085_28062_28748 225
553 3300049581 Ga0501047_0601769 Ga0501047_0601769_131_823 225
554 3300049582 Ga0501048_0000061 Ga0501048_0000061_16628_17314 225
555 3300049583 Ga0501067_0002211 Ga0501067_0002211_1674_2360 225
556 3300049584 Ga0501068_0004923 Ga0501068_0004923_70_756 225
557 3300049585 Ga0501069_0021376 Ga0501069_0021376_2812_3498 225
558 3300049586 Ga0501070_0000272 Ga0501070_0000272_20205_20891 225
559 3300049587 Ga0501071_0051827 Ga0501071_0051827_121_807 225
560 3300049588 Ga0501072_0006309 Ga0501072_0006309_3951_4637 225
561 3300049589 Ga0501073_0000026 Ga0501073_0000026_31765_32451 225
562 3300049590 Ga0501074_0000017 Ga0501074_0000017_54420_55106 225
563 3300049741 Ga0501079_0002647 Ga0501079_0002647_4000_4686 225
564 3300049744 Ga0501083_0000638 Ga0501083_0000638_787_1473 225
565 3300049822 Ga0501035_0000548 Ga0501035_0000548_38619_39305 225
566 3300049823 Ga0501044_0000051 Ga0501044_0000051_9521_10207 225
567 3300050490 nmdc:mga03n38_103522_c1 nmdc:mga03n38_103522_c1_579_1265 225
568 3300050490 nmdc:mga03n38_180288_c1 nmdc:mga03n38_180288_c1_245_931 225
569 3300050491 nmdc:mga00v17_296813_c1 nmdc:mga00v17_296813_c1_64_750 225
570 3300050491 nmdc:mga00v17_63272_c1 nmdc:mga00v17_63272_c1_1016_1702 225
571 3300050492 nmdc:mga0yw44_398702_c1 nmdc:mga0yw44_398702_c1_185_886 225
572 3300050492 nmdc:mga0yw44_83360_c1 nmdc:mga0yw44_83360_c1_115_801 225
573 3300050493 nmdc:mga0k408_239432_c1 nmdc:mga0k408_239432_c1_275_961 225
574 3300050493 nmdc:mga0k408_9279_c1 nmdc:mga0k408_9279_c1_4155_4841 225
575 3300050495 nmdc:mga04h51_82482_c1 nmdc:mga04h51_82482_c1_146_832 225
576 3300050516 nmdc:mga0sz30_61424_c1 nmdc:mga0sz30_61424_c1_17_703 225
577 3300053077 Ga0495601_0035341 Ga0495601_0035341_882_1568 225
578 3300053085 Ga0495619_0188485 Ga0495619_0188485_593_1279 225
579 3300053085 Ga0495619_0551691 Ga0495619_0551691_76_762 225
580 3300053086 Ga0500578_0146850 Ga0500578_0146850_17_703 225
581 3300053087 Ga0500643_000015 Ga0500643_000015_80754_81455 225
582 3300053091 Ga0500647_0089674 Ga0500647_0089674_769_1455 225
583 3300053092 Ga0500583_0054905 Ga0500583_0054905_861_1562 225
584 3300053093 Ga0500651_0078337 Ga0500651_0078337_1173_1859 225
585 3300053094 Ga0500566_0000988 Ga0500566_0000988_13847_14548 225
586 3300053094 Ga0500566_0005062 Ga0500566_0005062_133_819 225
587 3300053098 Ga0500650_0088991 Ga0500650_0088991_595_1296 225
588 3300053103 Ga0500555_000899 Ga0500555_000899_9749_10450 225
589 3300053105 Ga0500557_000022 Ga0500557_000022_27083_27769 225
590 3300053108 Ga0500562_028396 Ga0500562_028396_442_1143 225
591 3300053119 Ga0500595_000652 Ga0500595_000652_6635_7321 225
592 3300053119 Ga0500595_013151 Ga0500595_013151_2112_2798 225
593 3300053130 Ga0500642_0000060 Ga0500642_0000060_46029_46715 225
594 3300053130 Ga0500642_0130489 Ga0500642_0130489_146_847 225
595 3300053136 Ga0500559_0014416 Ga0500559_0014416_1971_2657 225
596 3300053136 Ga0500559_0057837 Ga0500559_0057837_894_1580 225
597 3300053139 Ga0500568_0024464 Ga0500568_0024464_291_992 225
598 3300053140 Ga0500573_0073398 Ga0500573_0073398_547_1233 225
599 3300053147 Ga0500589_176028 Ga0500589_176028_85_786 225
600 3300053150 Ga0500603_091129 Ga0500603_091129_171_857 225
601 3300053153 Ga0500616_0024278 Ga0500616_0024278_2275_2976 225
602 3300053157 Ga0500624_000625 Ga0500624_000625_7671_8357 225
603 3300053178 Ga0500637_0000104 Ga0500637_0000104_12310_12996 225
604 3300053729 Ga0500625_000333 Ga0500625_000333_10853_11539 225
605 3300053730 Ga0500645_008971 Ga0500645_008971_801_1502 225
606 3300053731 Ga0500609_026835 Ga0500609_026835_44_730 225
607 3300053736 Ga0500599_016819 Ga0500599_016819_28_729 225
608 3300053737 Ga0500601_000662 Ga0500601_000662_117_803 225
609 3300054114 Ga0501084_0012583 Ga0501084_0012583_1001_1687 225
610 3300055283 Ga0500661_000109 Ga0500661_000109_908_1594 225
611 3300060353 Ga0501082_0003691 Ga0501082_0003691_8467_9153 225
612 iso_pu_bacteria 2513237101 2513692476 225
613 iso_pu_bacteria 2791355199 2793080936 225
614 iso_pu_bacteria 2889033259 2889039886 225
615 iso_pu_bacteria 8006994254 8006998779 225
616 3300005435 Ga0070714_100030050 Ga0070714_1000300506 226
617 3300005445 Ga0070708_100262255 Ga0070708_1002622552 226
618 3300005467 Ga0070706_100028347 Ga0070706_1000283472 226
619 3300005468 Ga0070707_100160957 Ga0070707_1001609572 226
620 3300005518 Ga0070699_100121669 Ga0070699_1001216693 226
621 3300005536 Ga0070697_100039465 Ga0070697_1000394651 226
622 3300025256 Ga0209759_1004195 Ga0209759_10041956 226
623 3300025914 Ga0207671_10407342 Ga0207671_104073422 226
624 3300025922 Ga0207646_10332735 Ga0207646_103327352 226
625 3300025924 Ga0207694_10236215 Ga0207694_102362152 226
626 3300025929 Ga0207664_10052674 Ga0207664_100526743 226
627 3300025986 Ga0207658_10253221 Ga0207658_102532212 226
628 3300037312 Ga0395899_0312624 Ga0395899_0312624_13_726 226
629 3300045976 Ga0466967_0029515 Ga0466967_0029515_1728_2417 226
630 3300048928 Ga0496125_0000877 Ga0496125_0000877_26111_26809 226
631 iso_pu_bacteria 2508501128 2509150834 226
632 iso_pu_bacteria 2935638405 2935642347 226
633 iso_pu_bacteria 2935665750 2935668350 226
634 iso_pu_bacteria 2935703347 2935706205 226
635 iso_pu_bacteria 2935810662 2935814525 226
636 iso_pu_bacteria 2935827899 2935831663 226
637 iso_pu_bacteria 2936002035 2936007613 226
638 iso_pu_bacteria 2936037263 2936040082 226
639 iso_pu_bacteria 3005474847 3005480178 226
640 3300003203 JGI25406J46586_10038176 JGI25406J46586_100381762 227
641 3300003659 JGI25404J52841_10004693 JGI25404J52841_100046932 227
642 3300003659 JGI25404J52841_10005665 JGI25404J52841_100056654 227
643 3300003659 JGI25404J52841_10006333 JGI25404J52841_100063331 227
644 3300003659 JGI25404J52841_10009379 JGI25404J52841_100093792 227
645 3300005329 Ga0070683_100126208 Ga0070683_1001262083 227
646 3300005336 Ga0070680_100036288 Ga0070680_1000362885 227
647 3300005336 Ga0070680_100064055 Ga0070680_1000640552 227
648 3300005356 Ga0070674_100513901 Ga0070674_1005139011 227
649 3300005434 Ga0070709_10000943 Ga0070709_1000094315 227
650 3300005434 Ga0070709_10025859 Ga0070709_100258592 227
651 3300005435 Ga0070714_100351354 Ga0070714_1003513542 227
652 3300005437 Ga0070710_10009412 Ga0070710_100094126 227
653 3300005437 Ga0070710_10040690 Ga0070710_100406902 227
654 3300005437 Ga0070710_10113435 Ga0070710_101134352 227
655 3300005439 Ga0070711_100023513 Ga0070711_1000235135 227
656 3300005439 Ga0070711_100059522 Ga0070711_1000595223 227
657 3300005439 Ga0070711_100131823 Ga0070711_1001318232 227
658 3300005456 Ga0070678_100043979 Ga0070678_1000439793 227
659 3300005458 Ga0070681_10063273 Ga0070681_100632733 227
660 3300005458 Ga0070681_10069007 Ga0070681_100690073 227
661 3300005458 Ga0070681_10076578 Ga0070681_100765783 227
662 3300005468 Ga0070707_100200939 Ga0070707_1002009394 227
663 3300005471 Ga0070698_100159783 Ga0070698_1001597832 227
664 3300005530 Ga0070679_100259285 Ga0070679_1002592852 227
665 3300005535 Ga0070684_100015676 Ga0070684_1000156765 227
666 3300005539 Ga0068853_100175317 Ga0068853_1001753171 227
667 3300005539 Ga0068853_100450923 Ga0068853_1004509232 227
668 3300005548 Ga0070665_100166997 Ga0070665_1001669972 227
669 3300005563 Ga0068855_100047627 Ga0068855_1000476276 227
670 3300005563 Ga0068855_100059338 Ga0068855_1000593382 227
671 3300005617 Ga0068859_100143562 Ga0068859_1001435622 227
672 3300005843 Ga0068860_100000589 Ga0068860_10000058917 227
673 3300005844 Ga0068862_100586181 Ga0068862_1005861811 227
674 3300005937 Ga0081455_10009042 Ga0081455_1000904213 227
675 3300005937 Ga0081455_10018811 Ga0081455_100188118 227
676 3300005937 Ga0081455_10131983 Ga0081455_101319832 227
677 3300005981 Ga0081538_10036981 Ga0081538_100369813 227
678 3300005983 Ga0081540_1020867 Ga0081540_10208673 227
679 3300005983 Ga0081540_1059621 Ga0081540_10596212 227
680 3300005985 Ga0081539_10001398 Ga0081539_1000139840 227
681 3300005985 Ga0081539_10185926 Ga0081539_101859261 227
682 3300006038 Ga0075365_10059122 Ga0075365_100591223 227
683 3300006042 Ga0075368_10128489 Ga0075368_101284892 227
684 3300006048 Ga0075363_100032563 Ga0075363_1000325632 227
685 3300006163 Ga0070715_10078082 Ga0070715_100780822 227
686 3300006173 Ga0070716_100027312 Ga0070716_1000273121 227
687 3300006175 Ga0070712_100090277 Ga0070712_1000902773 227
688 3300006175 Ga0070712_100251741 Ga0070712_1002517412 227
689 3300006178 Ga0075367_10032972 Ga0075367_100329722 227
690 3300006195 Ga0075366_10230277 Ga0075366_102302771 227
691 3300006871 Ga0075434_100141157 Ga0075434_1001411571 227
692 3300006931 Ga0097620_100143560 Ga0097620_1001435603 227
693 3300006942 Ga0099824_1012401 Ga0099824_10124018 227
694 3300006943 Ga0099822_1003886 Ga0099822_100388611 227
695 3300009092 Ga0105250_10070491 Ga0105250_100704912 227
696 3300009093 Ga0105240_10047643 Ga0105240_100476436 227
697 3300009093 Ga0105240_10183132 Ga0105240_101831323 227
698 3300009093 Ga0105240_10227884 Ga0105240_102278843 227
699 3300009098 Ga0105245_10933204 Ga0105245_109332041 227
700 3300009101 Ga0105247_10004329 Ga0105247_100043294 227
701 3300009545 Ga0105237_10292492 Ga0105237_102924923 227
702 3300009545 Ga0105237_10423898 Ga0105237_104238982 227
703 3300009551 Ga0105238_10045226 Ga0105238_100452262 227
704 3300009551 Ga0105238_10070803 Ga0105238_100708032 227
705 3300010375 Ga0105239_10082423 Ga0105239_100824233 227
706 3300013105 Ga0157369_10004890 Ga0157369_1000489015 227
707 3300013105 Ga0157369_10019548 Ga0157369_100195483 227
708 3300013105 Ga0157369_10212434 Ga0157369_102124342 227
709 3300013306 Ga0163162_10170328 Ga0163162_101703282 227
710 3300013307 Ga0157372_10084277 Ga0157372_100842773 227
711 3300014325 Ga0163163_10148889 Ga0163163_101488892 227
712 3300014326 Ga0157380_10243877 Ga0157380_102438772 227
713 3300021384 Ga0213876_10006878 Ga0213876_100068781 227
714 3300021384 Ga0213876_10106677 Ga0213876_101066771 227
715 3300021388 Ga0213875_10029210 Ga0213875_100292103 227
716 3300025898 Ga0207692_10005535 Ga0207692_100055352 227
717 3300025898 Ga0207692_10185844 Ga0207692_101858441 227
718 3300025900 Ga0207710_10008563 Ga0207710_100085634 227
719 3300025904 Ga0207647_10200842 Ga0207647_102008421 227
720 3300025905 Ga0207685_10067238 Ga0207685_100672381 227
721 3300025905 Ga0207685_10136231 Ga0207685_101362311 227
722 3300025906 Ga0207699_10028127 Ga0207699_100281272 227
723 3300025906 Ga0207699_10031894 Ga0207699_100318942 227
724 3300025912 Ga0207707_10014703 Ga0207707_100147037 227
725 3300025912 Ga0207707_10057211 Ga0207707_100572112 227
726 3300025912 Ga0207707_10176666 Ga0207707_101766662 227
727 3300025913 Ga0207695_10119717 Ga0207695_101197172 227
728 3300025913 Ga0207695_10310635 Ga0207695_103106352 227
729 3300025914 Ga0207671_10122976 Ga0207671_101229762 227
730 3300025914 Ga0207671_10575123 Ga0207671_105751231 227
731 3300025915 Ga0207693_10083933 Ga0207693_100839332 227
732 3300025915 Ga0207693_10116277 Ga0207693_101162772 227
733 3300025916 Ga0207663_10046369 Ga0207663_100463691 227
734 3300025916 Ga0207663_10383236 Ga0207663_103832361 227
735 3300025917 Ga0207660_10008250 Ga0207660_100082507 227
736 3300025917 Ga0207660_10060220 Ga0207660_100602202 227
737 3300025921 Ga0207652_10457691 Ga0207652_104576911 227
738 3300025924 Ga0207694_10030817 Ga0207694_100308174 227
739 3300025929 Ga0207664_10134250 Ga0207664_101342502 227
740 3300025937 Ga0207669_10284285 Ga0207669_102842852 227
741 3300025939 Ga0207665_10001583 Ga0207665_100015836 227
742 3300025944 Ga0207661_10391212 Ga0207661_103912121 227
743 3300025949 Ga0207667_10335920 Ga0207667_103359202 227
744 3300025949 Ga0207667_10336315 Ga0207667_103363153 227
745 3300025949 Ga0207667_10533378 Ga0207667_105333781 227
746 3300025972 Ga0207668_10329581 Ga0207668_103295812 227
747 3300026041 Ga0207639_10157319 Ga0207639_101573192 227
748 3300026041 Ga0207639_10276975 Ga0207639_102769752 227
749 3300026041 Ga0207639_10332409 Ga0207639_103324092 227
750 3300026067 Ga0207678_10049928 Ga0207678_100499282 227
751 3300026067 Ga0207678_10418767 Ga0207678_104187673 227
752 3300026067 Ga0207678_10597085 Ga0207678_105970852 227
753 3300026142 Ga0207698_10907681 Ga0207698_109076811 227
754 3300027357 Ga0209589_1000003 Ga0209589_1000003529 227
755 3300027361 Ga0209489_100003 Ga0209489_100003580 227
756 3300027363 Ga0209700_100003 Ga0209700_100003580 227
757 3300027866 Ga0209813_10085225 Ga0209813_100852251 227
758 3300028379 Ga0268266_10150362 Ga0268266_101503622 227
759 3300028381 Ga0268264_10000043 Ga0268264_1000004337 227
760 3300031241 Ga0265325_10027410 Ga0265325_100274101 227
761 3300031344 Ga0265316_10357622 Ga0265316_103576221 227
762 3300031711 Ga0265314_10285250 Ga0265314_102852501 227
763 3300035111 Ga0373923_0049016 Ga0373923_0049016_340_1038 227
764 3300035113 Ga0373936_0145773 Ga0373936_0145773_55_753 227
765 3300035118 Ga0373954_0024129 Ga0373954_0024129_1553_2251 227
766 3300035119 Ga0373956_0141693 Ga0373956_0141693_342_1040 227
767 3300035120 Ga0373957_0013029 Ga0373957_0013029_1269_1967 227
768 3300035170 Ga0373943_0227007 Ga0373943_0227007_269_967 227
769 3300035171 Ga0373946_0029192 Ga0373946_0029192_400_1098 227
770 3300035172 Ga0373955_0316442 Ga0373955_0316442_197_895 227
771 3300035410 Ga0373924_0009245 Ga0373924_0009245_940_1638 227
772 3300035691 Ga0373931_0215128 Ga0373931_0215128_98_829 227
773 3300035691 Ga0373931_0222551 Ga0373931_0222551_291_986 227
774 3300035692 Ga0373935_0055144 Ga0373935_0055144_1412_2110 227
775 3300035695 Ga0373927_0173928 Ga0373927_0173928_486_1289 227
776 3300035695 Ga0373927_0357239 Ga0373927_0357239_184_894 227
777 3300035724 Ga0373933_0017121 Ga0373933_0017121_1841_2539 227
778 3300035725 Ga0373947_0033109 Ga0373947_0033109_2240_2947 227
779 3300035725 Ga0373947_0082641 Ga0373947_0082641_80_775 227
780 3300036401 Ga0373937_0157888 Ga0373937_0157888_1157_1855 227
781 3300036401 Ga0373937_0711775 Ga0373937_0711775_100_807 227
782 3300037068 Ga0373925_0006009 Ga0373925_0006009_3376_4074 227
783 3300037068 Ga0373925_0152585 Ga0373925_0152585_1048_1743 227
784 3300037418 Ga0395900_0017864 Ga0395900_0017864_4635_5330 227
785 3300037418 Ga0395900_0273815 Ga0395900_0273815_427_1116 227
786 3300037466 Ga0395898_0032284 Ga0395898_0032284_283_978 227
787 3300037853 Ga0436364_0991714 Ga0436364_0991714_1663_2418 227
788 3300038443 Ga0395901_0377199 Ga0395901_0377199_203_892 227
789 3300039437 Ga0436365_1316672 Ga0436365_1316672_8988_9839 227
790 3300039437 Ga0436365_1470075 Ga0436365_1470075_1594_2289 227
791 3300039437 Ga0436365_1510814 Ga0436365_1510814_2204_2899 227
792 3300039438 Ga0436360_0167622 Ga0436360_0167622_12_719 227
793 3300039450 Ga0436363_1463179 Ga0436363_1463179_344_1039 227
794 3300039453 Ga0436362_1173705 Ga0436362_1173705_865_1716 227
795 3300041462 Ga0451806_367894 Ga0451806_367894_1411_2121 227
796 3300041507 Ga0451851_0219306 Ga0451851_0219306_311_1006 227
797 3300044694 Ga0466963_0243643 Ga0466963_0243643_261_956 227
798 3300046455 Ga0495603_0032720 Ga0495603_0032720_814_1521 227
799 3300046455 Ga0495603_0064072 Ga0495603_0064072_1093_1869 227
800 3300046455 Ga0495603_0197961 Ga0495603_0197961_199_894 227
801 3300046459 Ga0495629_0435858 Ga0495629_0435858_96_794 227
802 3300046472 Ga0495580_0025532 Ga0495580_0025532_1171_1869 227
803 3300046472 Ga0495580_0067039 Ga0495580_0067039_79_786 227
804 3300046473 Ga0495582_0011077 Ga0495582_0011077_1799_2497 227
805 3300046475 Ga0495639_0029667 Ga0495639_0029667_612_1310 227
806 3300046476 Ga0495662_0032221 Ga0495662_0032221_728_1426 227
807 3300046477 Ga0495664_0015631 Ga0495664_0015631_30_734 227
808 3300046477 Ga0495664_0029939 Ga0495664_0029939_2349_3047 227
809 3300046514 Ga0495618_0031969 Ga0495618_0031969_41_739 227
810 3300046517 Ga0495630_0036156 Ga0495630_0036156_164_862 227
811 3300046524 Ga0495648_0035952 Ga0495648_0035952_1265_1963 227
812 3300046531 Ga0495665_0069349 Ga0495665_0069349_197_895 227
813 3300046533 Ga0495640_0089610 Ga0495640_0089610_11_709 227
814 3300046535 Ga0495586_0079732 Ga0495586_0079732_1003_1701 227
815 3300046543 Ga0495645_0010706 Ga0495645_0010706_1435_2139 227
816 3300046559 Ga0495667_0042567 Ga0495667_0042567_29_727 227
817 3300046642 Ga0495634_0067958 Ga0495634_0067958_1455_2231 227
818 3300046660 Ga0495625_0165881 Ga0495625_0165881_313_1011 227
819 3300046683 Ga0495658_0042101 Ga0495658_0042101_635_1333 227
820 3300046684 Ga0495669_0195408 Ga0495669_0195408_15_725 227
821 3300046689 Ga0495613_0188790 Ga0495613_0188790_69_845 227
822 3300046690 Ga0495624_0024440 Ga0495624_0024440_23_721 227
823 3300047315 Ga0495581_0182858 Ga0495581_0182858_242_937 227
824 3300047319 Ga0495674_0211502 Ga0495674_0211502_114_818 227
825 3300047320 Ga0495672_0038451 Ga0495672_0038451_645_1412 227
826 3300047321 Ga0495676_0170119 Ga0495676_0170119_187_894 227
827 3300047321 Ga0495676_0435507 Ga0495676_0435507_34_810 227
828 3300047471 Ga0495684_0044993 Ga0495684_0044993_378_1076 227
829 3300047673 Ga0495593_0027366 Ga0495593_0027366_2312_3010 227
830 3300048089 Ga0495614_0072697 Ga0495614_0072697_18_716 227
831 3300048089 Ga0495614_0184001 Ga0495614_0184001_200_895 227
832 3300048903 Ga0496100_0349753 Ga0496100_0349753_45_746 227
833 3300048904 Ga0496101_0104458 Ga0496101_0104458_799_1500 227
834 3300048904 Ga0496101_0845653 Ga0496101_0845653_12_707 227
835 3300048905 Ga0496102_0249017 Ga0496102_0249017_653_1354 227
836 3300048910 Ga0496107_0295252 Ga0496107_0295252_386_1087 227
837 3300048915 Ga0496112_0000021 Ga0496112_0000021_150189_150884 227
838 3300048915 Ga0496112_0020030 Ga0496112_0020030_3355_4056 227
839 3300048917 Ga0496114_0257887 Ga0496114_0257887_42_743 227
840 3300048918 Ga0496115_0093708 Ga0496115_0093708_780_1481 227
841 3300048924 Ga0496121_0078095 Ga0496121_0078095_457_1152 227
842 3300048924 Ga0496121_0239551 Ga0496121_0239551_387_1160 227
843 3300048927 Ga0496124_0246901 Ga0496124_0246901_144_842 227
844 3300048929 Ga0496126_0062075 Ga0496126_0062075_1829_2524 227
845 3300048929 Ga0496126_0073979 Ga0496126_0073979_2021_2722 227
846 3300048929 Ga0496126_0217986 Ga0496126_0217986_844_1539 227
847 3300049569 Ga0501032_0038828 Ga0501032_0038828_512_1225 227
848 3300049570 Ga0501033_0023712 Ga0501033_0023712_1186_1899 227
849 3300049570 Ga0501033_0047661 Ga0501033_0047661_587_1300 227
850 3300049570 Ga0501033_0119351 Ga0501033_0119351_816_1532 227
851 3300049570 Ga0501033_0419811 Ga0501033_0419811_63_776 227
852 3300049572 Ga0501036_0172083 Ga0501036_0172083_311_1024 227
853 3300049574 Ga0501038_0119220 Ga0501038_0119220_753_1466 227
854 3300049574 Ga0501038_0429941 Ga0501038_0429941_193_906 227
855 3300049575 Ga0501039_0134692 Ga0501039_0134692_33_746 227
856 3300049575 Ga0501039_0143546 Ga0501039_0143546_305_1072 227
857 3300049579 Ga0501043_0096029 Ga0501043_0096029_536_1375 227
858 3300049579 Ga0501043_0317318 Ga0501043_0317318_82_795 227
859 3300049580 Ga0501046_0049382 Ga0501046_0049382_1486_2325 227
860 3300049580 Ga0501046_0055323 Ga0501046_0055323_404_1117 227
861 3300049580 Ga0501046_0193513 Ga0501046_0193513_515_1282 227
862 3300049581 Ga0501047_0031163 Ga0501047_0031163_817_1656 227
863 3300049581 Ga0501047_0045461 Ga0501047_0045461_2273_2986 227
864 3300049582 Ga0501048_0279425 Ga0501048_0279425_282_995 227
865 3300049583 Ga0501067_0065732 Ga0501067_0065732_1051_1746 227
866 3300049583 Ga0501067_0074997 Ga0501067_0074997_701_1414 227
867 3300049586 Ga0501070_0471742 Ga0501070_0471742_73_786 227
868 3300049587 Ga0501071_0401422 Ga0501071_0401422_183_896 227
869 3300049589 Ga0501073_0056283 Ga0501073_0056283_2014_2727 227
870 3300049590 Ga0501074_0055970 Ga0501074_0055970_1364_2203 227
871 3300049742 Ga0501080_0062421 Ga0501080_0062421_2029_2868 227
872 3300049822 Ga0501035_0054958 Ga0501035_0054958_1373_2086 227
873 3300049822 Ga0501035_0103647 Ga0501035_0103647_513_1226 227
874 3300049822 Ga0501035_0179739 Ga0501035_0179739_145_912 227
875 3300049823 Ga0501044_0039498 Ga0501044_0039498_1719_2432 227
876 3300049823 Ga0501044_0055169 Ga0501044_0055169_985_1824 227
877 3300050489 nmdc:mga03683_2975_c1 nmdc:mga03683_2975_c1_4107_4811 227
878 3300050490 nmdc:mga03n38_18704_c1 nmdc:mga03n38_18704_c1_524_1228 227
879 3300050492 nmdc:mga0yw44_48221_c1 nmdc:mga0yw44_48221_c1_1719_2423 227
880 3300050494 nmdc:mga06z11_32574_c1 nmdc:mga06z11_32574_c1_1018_1722 227
881 3300050495 nmdc:mga04h51_101074_c1 nmdc:mga04h51_101074_c1_36_740 227
882 3300050496 nmdc:mga07m45_19502_c2 nmdc:mga07m45_19502_c2_199_903 227
883 3300050512 nmdc:mga0n895_32103_c1 nmdc:mga0n895_32103_c1_4168_4863 227
884 3300050512 nmdc:mga0n895_67036_c1 nmdc:mga0n895_67036_c1_1447_2142 227
885 3300050513 nmdc:mga0rr50_433239_c1 nmdc:mga0rr50_433239_c1_160_855 227
886 3300053077 Ga0495601_0078141 Ga0495601_0078141_77_781 227
887 3300053077 Ga0495601_0095765 Ga0495601_0095765_214_990 227
888 3300053078 Ga0495612_0021249 Ga0495612_0021249_1235_1939 227
889 3300053094 Ga0500566_0000028 Ga0500566_0000028_11762_12469 227
890 3300053095 Ga0500640_000581 Ga0500640_000581_6809_7516 227
891 3300053111 Ga0500572_000269 Ga0500572_000269_6156_6863 227
892 3300053115 Ga0500591_013572 Ga0500591_013572_1055_1762 227
893 3300053123 Ga0500614_000118 Ga0500614_000118_15354_16061 227
894 3300053136 Ga0500559_0002964 Ga0500559_0002964_181_888 227
895 3300053150 Ga0500603_000232 Ga0500603_000232_12024_12731 227
896 3300053163 Ga0500639_000001 Ga0500639_000001_96141_96848 227
897 3300053735 Ga0500596_000195 Ga0500596_000195_4249_4956 227
898 3300002705 JGI25156J39149_1002491 JGI25156J39149_10024914 229
899 3300002738 JGI25154J39366_1000013 JGI25154J39366_100001381 229
900 3300002741 JGI25157J39369_1002059 JGI25157J39369_10020593 229
901 3300025206 Ga0209435_100006 Ga0209435_100006275 229
902 3300025246 Ga0209646_1000015 Ga0209646_1000015260 229
903 3300025250 Ga0209026_1000039 Ga0209026_1000039275 229
904 3300025256 Ga0209759_1000005 Ga0209759_1000005275 229

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

54

217

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3noq-assembly1.cif.gz_A crystal structure of c101s isocyanide hydratase from pseudomonas fluorescens 0.9908 1 221
7la0-assembly1.cif.gz_B pseudomonas fluorescens g150a isocyanide hydratase (g150a-2) at 274k, refmac5-refined 0.9875 1 221
7l9q-assembly1.cif.gz_B wild-type pseudomonas fluorescens isocyanide hydratase (wt-1) at 274k, refmac5-refined 0.9874 1 221
3noo-assembly1.cif.gz_B crystal structure of c101a isocyanide hydratase from pseudomonas fluorescens 0.9807 2 221
3nor-assembly1.cif.gz_A-2 crystal structure of t102s isocyanide hydratase from pseudomonas fluorescens 0.979 1 221
ID Description Score Start End Superfamily
3norA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.979 1 221 3.40.50.880
3ewnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9443 5 218 3.40.50.880
3norA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9413 1 221 3.40.50.880
af_I6Y6S3_1_186_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9401 28 209 3.40.50.880
af_O16228_2_184_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9284 1 179 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A530GRT2-F1-model_v4 DJ-1/PfpI family protein 0.9985 1 124 GO:0006355
AF-A0A1Z4N4H9-F1-model_v4 ThiJ/PfpI domain-containing protein 0.9908 2 221 GO:0006355
AF-A0A530GRT2-F1-model_v4 DJ-1/PfpI family protein 0.9905 1 124 GO:0006355
AF-A0A6I5P035-F1-model_v4 DJ-1/PfpI family protein 0.9886 1 219 GO:0006355
AF-Q3JJZ1-F1-model_v4 DJ-1/PfpI family protein (EC 4.2.1.103) 0.9879 1 221 GO:0006355
GO:0050549

Feature Viewer

pLDDT pTM Quality
93.45 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map