F485286
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 904 | 567 | 722 | 230 |
Family's Representative Sequence
| Representative Sequence | 3300039453|Ga0436362_1173705|Ga0436362_1173705_865_1716 |
| Length | 283 |
| Sequence | MRTPIMIAGEAFRSGALAPVLKRGNYAISDGSRSCQDDRVKTHFPELAMAEPLQIGLLIFPKVTQLDFTGPLQVFSSLPAHLAKVHLVWKRIEPVASDGPLVLTPTATFADCPQLDVICVPGGIGTDDLVNDEEVLDFIRAQAERAQYVTSVCTGSLVLGAAGLLKGYRAATHWSAMDHLVPFGAIPTKTRVCVDRNRITGGGVTAGIDFALTLVSMLVDRTIAEAVQLRLEYNPAPPFQSGSPDSAPPEVLALIESRMAPFRQRRAEAVVRAAARLNEPASG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 9 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 10 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 11 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 12 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 13 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 14 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 15 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 16 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 17 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 18 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 19 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 20 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 21 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 22 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 23 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 24 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 25 | 2791355199 | |||
| 26 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 27 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 28 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 29 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 30 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 31 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 32 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 33 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 34 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 35 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 36 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 37 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 38 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 39 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 40 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 41 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 42 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 43 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 44 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 45 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 46 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 47 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 48 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 49 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 50 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 51 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 52 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 53 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 54 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 55 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 56 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 57 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 58 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 59 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 60 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 61 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 62 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 63 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 64 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 65 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 66 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 67 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 68 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 69 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 70 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 71 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 72 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 73 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 74 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 75 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 76 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 77 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 78 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 79 | 2906610324 | |||
| 80 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 81 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 82 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 83 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 84 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 85 | 2922368715 | |||
| 86 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 87 | 2922425934 | |||
| 88 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 89 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 90 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 91 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 92 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 93 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 94 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 95 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 96 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 97 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 98 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 99 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 100 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 101 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 102 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 103 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 104 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 105 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 106 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 107 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 108 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 109 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 110 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 111 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 112 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 113 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 114 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 115 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 116 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 117 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 118 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 119 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 120 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 121 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 122 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 123 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 124 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 125 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 126 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 127 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 128 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 129 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 130 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 131 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 132 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 133 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 134 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 135 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 136 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 137 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 138 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 139 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 140 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 141 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 142 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 143 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 144 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 145 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 146 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 147 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 148 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 149 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 150 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 151 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 152 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 153 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 154 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 155 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 156 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 157 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 158 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 159 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 160 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 162 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 163 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 164 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 165 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 170 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 171 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 172 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 173 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 174 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 177 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 179 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 180 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 181 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 182 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 184 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 185 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 186 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 187 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 188 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 189 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 190 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 192 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 193 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 194 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 195 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 196 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 197 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 198 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 199 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 200 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 201 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 202 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 204 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 205 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 206 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 207 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 208 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 209 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 210 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 211 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 212 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 213 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 214 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 215 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 216 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 218 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 219 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 220 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 221 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 222 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 223 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 224 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 225 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 226 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 227 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 228 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 229 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 230 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 231 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 232 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 233 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 234 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 235 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 236 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 237 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 238 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 239 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 240 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 241 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 242 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 243 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 244 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 245 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 246 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 247 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 248 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 249 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 250 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 251 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 252 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 253 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 254 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 255 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 256 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 257 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 258 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 299 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 300 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 301 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 302 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 304 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 307 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 308 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 309 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 310 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 311 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 312 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 313 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 314 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 315 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 316 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 317 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 318 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 319 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 320 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 321 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 322 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 323 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 324 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 325 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 326 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 327 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 328 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 329 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 330 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 331 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 332 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 333 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 334 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 335 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 336 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 337 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 338 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 339 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 340 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 341 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 342 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 343 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 344 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 345 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 346 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 347 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 348 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 349 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 350 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 351 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 352 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 353 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 354 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 355 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 356 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 357 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 358 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 359 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 431 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 432 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 433 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 434 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 435 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 436 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 437 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 438 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 439 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 440 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 441 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 442 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 443 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 444 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 445 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 446 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 447 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 448 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 449 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 450 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 451 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 452 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 453 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 454 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 455 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 456 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 457 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 461 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 463 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 464 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 466 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 467 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 469 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 470 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 471 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 472 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 473 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 474 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 475 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 476 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 477 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 478 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 479 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 480 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 481 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 482 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 483 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 484 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 485 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 486 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 487 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 488 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 489 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 490 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 491 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 492 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 493 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 494 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 495 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 499 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 500 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 501 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 502 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 503 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 504 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 505 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 506 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 507 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 508 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 509 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 510 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 511 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 512 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 513 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 514 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 515 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 516 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 517 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 518 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 519 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 520 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 521 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 522 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 523 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 524 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 525 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 526 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 527 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 528 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 529 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 530 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 531 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 532 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 533 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 534 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 535 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 536 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 537 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 538 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 539 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 540 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 541 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 542 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 543 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 544 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 545 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 546 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 547 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 548 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 549 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 550 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 551 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 552 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 553 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 554 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 555 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 556 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 557 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 558 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 559 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 560 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 561 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 562 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 563 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 564 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 565 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 566 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 567 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.22 |
| Metatranscriptomes | 0 |
| Isolates | 19.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.94 |
| Nodule | 16.37 |
| Rhizoplane | 4.31 |
| Rhizosphere | 55.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1002491 | 3300002705 | Bacteria | 6563 |
| 2 | JGI25154J39366_1000013 | 3300002738 | Bacteria | 268260 |
| 3 | JGI25157J39369_1002059 | 3300002741 | Bacteria | 5751 |
| 4 | JGI25406J46586_10038176 | 3300003203 | Bacteria | 1724 |
| 5 | JGI25153J46596_10001920 | 3300003215 | Bacteria | 12337 |
| 6 | JGI25153J46596_10002312 | 3300003215 | Bacteria | 11081 |
| 7 | JGI25153J46596_10017224 | 3300003215 | Bacteria | 2854 |
| 8 | JGI25160J50197_1000631 | 3300003354 | Bacteria | 19703 |
| 9 | JGI25160J50197_1011095 | 3300003354 | Bacteria | 3215 |
| 10 | JGI25404J52841_10004693 | 3300003659 | Bacteria | 2787 |
| 11 | JGI25404J52841_10005665 | 3300003659 | Bacteria | 2583 |
| 12 | JGI25404J52841_10006333 | 3300003659 | Bacteria | 2473 |
| 13 | JGI25404J52841_10009379 | 3300003659 | Bacteria | 2092 |
| 14 | Ga0055543_1001288 | 3300004625 | Bacteria | 10317 |
| 15 | Ga0065165_1000844 | 3300005262 | Bacteria | 40173 |
| 16 | Ga0065165_1002117 | 3300005262 | Bacteria | 18094 |
| 17 | Ga0065165_1034331 | 3300005262 | Bacteria | 1569 |
| 18 | Ga0070683_100126208 | 3300005329 | Bacteria | 2419 |
| 19 | Ga0070670_100857974 | 3300005331 | Bacteria | 822 |
| 20 | Ga0068869_100177424 | 3300005334 | Bacteria | 1668 |
| 21 | Ga0070680_100036288 | 3300005336 | Bacteria | 3982 |
| 22 | Ga0070680_100064055 | 3300005336 | Bacteria | 3012 |
| 23 | Ga0070680_100246414 | 3300005336 | Bacteria | 1511 |
| 24 | Ga0070682_100080180 | 3300005337 | Bacteria | 2110 |
| 25 | Ga0070682_100185509 | 3300005337 | Bacteria | 1457 |
| 26 | Ga0068868_100267074 | 3300005338 | Bacteria | 1445 |
| 27 | Ga0070668_100140649 | 3300005347 | Bacteria | 1945 |
| 28 | Ga0070668_100327741 | 3300005347 | Bacteria | 1291 |
| 29 | Ga0070671_100081966 | 3300005355 | Bacteria | 2697 |
| 30 | Ga0070671_100198395 | 3300005355 | Bacteria | 1701 |
| 31 | Ga0070674_100513901 | 3300005356 | Bacteria | 999 |
| 32 | Ga0070667_100328787 | 3300005367 | Bacteria | 1380 |
| 33 | Ga0070709_10000943 | 3300005434 | Bacteria | 16169 |
| 34 | Ga0070709_10025859 | 3300005434 | Bacteria | 3471 |
| 35 | Ga0070714_100030050 | 3300005435 | Bacteria | 4521 |
| 36 | Ga0070714_100351354 | 3300005435 | Bacteria | 1385 |
| 37 | Ga0070713_100040544 | 3300005436 | Bacteria | 3786 |
| 38 | Ga0070713_100113099 | 3300005436 | Bacteria | 2369 |
| 39 | Ga0070710_10009412 | 3300005437 | Bacteria | 4779 |
| 40 | Ga0070710_10040690 | 3300005437 | Bacteria | 2562 |
| 41 | Ga0070710_10113435 | 3300005437 | Bacteria | 1631 |
| 42 | Ga0070711_100023513 | 3300005439 | Bacteria | 4009 |
| 43 | Ga0070711_100059522 | 3300005439 | Bacteria | 2652 |
| 44 | Ga0070711_100131823 | 3300005439 | Bacteria | 1862 |
| 45 | Ga0070711_100145658 | 3300005439 | Bacteria | 1781 |
| 46 | Ga0070708_100262255 | 3300005445 | Bacteria | 1624 |
| 47 | Ga0070663_100004463 | 3300005455 | Bacteria | 8235 |
| 48 | Ga0070663_100012305 | 3300005455 | Bacteria | 5408 |
| 49 | Ga0070663_100029168 | 3300005455 | Bacteria | 3766 |
| 50 | Ga0070663_100057859 | 3300005455 | Bacteria | 2782 |
| 51 | Ga0070678_100043979 | 3300005456 | Bacteria | 3186 |
| 52 | Ga0070678_100304889 | 3300005456 | Bacteria | 1355 |
| 53 | Ga0070678_100377632 | 3300005456 | Bacteria | 1225 |
| 54 | Ga0070662_100493385 | 3300005457 | Bacteria | 1021 |
| 55 | Ga0070681_10063273 | 3300005458 | Bacteria | 3672 |
| 56 | Ga0070681_10069007 | 3300005458 | Bacteria | 3502 |
| 57 | Ga0070681_10076578 | 3300005458 | Bacteria | 3303 |
| 58 | Ga0070681_10099623 | 3300005458 | Bacteria | 2852 |
| 59 | Ga0070706_100028347 | 3300005467 | Bacteria | 5155 |
| 60 | Ga0070707_100160957 | 3300005468 | Bacteria | 2187 |
| 61 | Ga0070707_100200939 | 3300005468 | Bacteria | 1943 |
| 62 | Ga0070698_100159783 | 3300005471 | Bacteria | 2198 |
| 63 | Ga0070699_100121669 | 3300005518 | Bacteria | 2295 |
| 64 | Ga0070679_100025804 | 3300005530 | Bacteria | 5766 |
| 65 | Ga0070679_100259285 | 3300005530 | Bacteria | 1694 |
| 66 | Ga0070684_100015676 | 3300005535 | Bacteria | 6182 |
| 67 | Ga0070697_100039465 | 3300005536 | Unclassified | 3817 |
| 68 | Ga0068853_100093363 | 3300005539 | Bacteria | 2649 |
| 69 | Ga0068853_100175317 | 3300005539 | Bacteria | 1942 |
| 70 | Ga0068853_100450923 | 3300005539 | Bacteria | 1210 |
| 71 | Ga0068853_100625265 | 3300005539 | Bacteria | 1024 |
| 72 | Ga0068853_100882191 | 3300005539 | Bacteria | 859 |
| 73 | Ga0070686_100421597 | 3300005544 | Bacteria | 1020 |
| 74 | Ga0070665_100060084 | 3300005548 | Bacteria | 3811 |
| 75 | Ga0070665_100078115 | 3300005548 | Bacteria | 3316 |
| 76 | Ga0070665_100101926 | 3300005548 | Bacteria | 2874 |
| 77 | Ga0070665_100166997 | 3300005548 | Bacteria | 2203 |
| 78 | Ga0070665_100555181 | 3300005548 | Bacteria | 1161 |
| 79 | Ga0068855_100047191 | 3300005563 | Bacteria | 5089 |
| 80 | Ga0068855_100047627 | 3300005563 | Bacteria | 5064 |
| 81 | Ga0068855_100059338 | 3300005563 | Bacteria | 4477 |
| 82 | Ga0068855_100118158 | 3300005563 | Bacteria | 3037 |
| 83 | Ga0070664_100861488 | 3300005564 | Bacteria | 849 |
| 84 | Ga0068856_100133911 | 3300005614 | Bacteria | 2483 |
| 85 | Ga0068856_100182705 | 3300005614 | Bacteria | 2111 |
| 86 | Ga0068856_100543575 | 3300005614 | Bacteria | 1183 |
| 87 | Ga0068856_100724889 | 3300005614 | Bacteria | 1014 |
| 88 | Ga0068852_100198691 | 3300005616 | Bacteria | 1897 |
| 89 | Ga0068852_100260990 | 3300005616 | Bacteria | 1663 |
| 90 | Ga0068852_100379436 | 3300005616 | Bacteria | 1386 |
| 91 | Ga0068852_100943691 | 3300005616 | Bacteria | 881 |
| 92 | Ga0068859_100143562 | 3300005617 | Bacteria | 2461 |
| 93 | Ga0068859_100833652 | 3300005617 | Bacteria | 1009 |
| 94 | Ga0068870_10298658 | 3300005840 | Bacteria | 1016 |
| 95 | Ga0068858_100175128 | 3300005842 | Bacteria | 2024 |
| 96 | Ga0068858_100362299 | 3300005842 | Bacteria | 1390 |
| 97 | Ga0068860_100000589 | 3300005843 | Bacteria | 43469 |
| 98 | Ga0068860_100023488 | 3300005843 | Bacteria | 5958 |
| 99 | Ga0068860_100082950 | 3300005843 | Bacteria | 3048 |
| 100 | Ga0068860_100518562 | 3300005843 | Bacteria | 1192 |
| 101 | Ga0068862_100586181 | 3300005844 | Bacteria | 1069 |
| 102 | Ga0081455_10009042 | 3300005937 | Bacteria | 10284 |
| 103 | Ga0081455_10017212 | 3300005937 | Bacteria | 6939 |
| 104 | Ga0081455_10018811 | 3300005937 | Bacteria | 6553 |
| 105 | Ga0081455_10131983 | 3300005937 | Bacteria | 1952 |
| 106 | Ga0081538_10036981 | 3300005981 | Bacteria | 3176 |
| 107 | Ga0081540_1003394 | 3300005983 | Bacteria | 12630 |
| 108 | Ga0081540_1020867 | 3300005983 | Bacteria | 3924 |
| 109 | Ga0081540_1021640 | 3300005983 | Bacteria | 3820 |
| 110 | Ga0081540_1025247 | 3300005983 | Bacteria | 3425 |
| 111 | Ga0081540_1059621 | 3300005983 | Bacteria | 1831 |
| 112 | Ga0081539_10001398 | 3300005985 | Bacteria | 41551 |
| 113 | Ga0081539_10021340 | 3300005985 | Bacteria | 4333 |
| 114 | Ga0081539_10185926 | 3300005985 | Bacteria | 971 |
| 115 | Ga0070717_10001195 | 3300006028 | Bacteria | 17601 |
| 116 | Ga0075365_10055262 | 3300006038 | Bacteria | 2634 |
| 117 | Ga0075365_10059122 | 3300006038 | Bacteria | 2554 |
| 118 | Ga0075365_10094748 | 3300006038 | Bacteria | 2038 |
| 119 | Ga0075365_10179316 | 3300006038 | Bacteria | 1481 |
| 120 | Ga0075365_10524505 | 3300006038 | Bacteria | 837 |
| 121 | Ga0075368_10000684 | 3300006042 | Bacteria | 10294 |
| 122 | Ga0075368_10128489 | 3300006042 | Bacteria | 1052 |
| 123 | Ga0075363_100025917 | 3300006048 | Bacteria | 2995 |
| 124 | Ga0075363_100027730 | 3300006048 | Bacteria | 2906 |
| 125 | Ga0075363_100032563 | 3300006048 | Bacteria | 2709 |
| 126 | Ga0075363_100367304 | 3300006048 | Bacteria | 842 |
| 127 | Ga0075364_10028098 | 3300006051 | Bacteria | 3599 |
| 128 | Ga0070715_10078082 | 3300006163 | Bacteria | 1496 |
| 129 | Ga0070716_100027312 | 3300006173 | Bacteria | 3065 |
| 130 | Ga0070712_100090277 | 3300006175 | Bacteria | 2243 |
| 131 | Ga0070712_100251741 | 3300006175 | Bacteria | 1412 |
| 132 | Ga0075362_10100664 | 3300006177 | Bacteria | 1351 |
| 133 | Ga0075367_10005646 | 3300006178 | Bacteria | 6240 |
| 134 | Ga0075367_10022133 | 3300006178 | Bacteria | 3561 |
| 135 | Ga0075367_10032972 | 3300006178 | Bacteria | 2983 |
| 136 | Ga0075369_10013223 | 3300006186 | Bacteria | 3272 |
| 137 | Ga0075366_10006129 | 3300006195 | Bacteria | 6556 |
| 138 | Ga0075366_10056251 | 3300006195 | Bacteria | 2337 |
| 139 | Ga0075366_10230277 | 3300006195 | Bacteria | 1129 |
| 140 | Ga0075370_10013795 | 3300006353 | Bacteria | 4299 |
| 141 | Ga0075370_10035483 | 3300006353 | Bacteria | 2799 |
| 142 | Ga0075370_10052216 | 3300006353 | Bacteria | 2319 |
| 143 | Ga0075370_10058296 | 3300006353 | Bacteria | 2196 |
| 144 | Ga0075434_100141157 | 3300006871 | Bacteria | 2429 |
| 145 | Ga0097620_100143560 | 3300006931 | Bacteria | 2461 |
| 146 | Ga0097620_100833682 | 3300006931 | Bacteria | 1009 |
| 147 | Ga0099824_1006510 | 3300006942 | Bacteria | 15990 |
| 148 | Ga0099824_1012401 | 3300006942 | Bacteria | 9306 |
| 149 | Ga0099822_1003886 | 3300006943 | Bacteria | 19305 |
| 150 | Ga0105250_10070491 | 3300009092 | Bacteria | 1411 |
| 151 | Ga0105240_10047643 | 3300009093 | Bacteria | 5422 |
| 152 | Ga0105240_10183132 | 3300009093 | Bacteria | 2470 |
| 153 | Ga0105240_10227884 | 3300009093 | Bacteria | 2167 |
| 154 | Ga0105240_10305136 | 3300009093 | Bacteria | 1820 |
| 155 | Ga0105240_10314687 | 3300009093 | Bacteria | 1786 |
| 156 | Ga0105245_10933204 | 3300009098 | Bacteria | 910 |
| 157 | Ga0105247_10004329 | 3300009101 | Bacteria | 9071 |
| 158 | Ga0105243_10146926 | 3300009148 | Bacteria | 2018 |
| 159 | Ga0105241_10270136 | 3300009174 | Bacteria | 1448 |
| 160 | Ga0105248_10004990 | 3300009177 | Bacteria | 14670 |
| 161 | Ga0105248_10201894 | 3300009177 | Bacteria | 2240 |
| 162 | Ga0105237_10292492 | 3300009545 | Bacteria | 1632 |
| 163 | Ga0105237_10375557 | 3300009545 | Bacteria | 1426 |
| 164 | Ga0105237_10423898 | 3300009545 | Bacteria | 1336 |
| 165 | Ga0105238_10045226 | 3300009551 | Bacteria | 4448 |
| 166 | Ga0105238_10070803 | 3300009551 | Bacteria | 3486 |
| 167 | Ga0105238_10094882 | 3300009551 | Bacteria | 2971 |
| 168 | Ga0105239_10062789 | 3300010375 | Bacteria | 4077 |
| 169 | Ga0105239_10082423 | 3300010375 | Bacteria | 3542 |
| 170 | Ga0105239_10189322 | 3300010375 | Bacteria | 2303 |
| 171 | Ga0105239_10696974 | 3300010375 | Bacteria | 1161 |
| 172 | Ga0105239_10858460 | 3300010375 | Bacteria | 1041 |
| 173 | Ga0105246_10031542 | 3300011119 | Bacteria | 3508 |
| 174 | Ga0157371_10034937 | 3300013102 | Bacteria | 3604 |
| 175 | Ga0157370_10007389 | 3300013104 | Bacteria | 11970 |
| 176 | Ga0157369_10004890 | 3300013105 | Bacteria | 15715 |
| 177 | Ga0157369_10019548 | 3300013105 | Bacteria | 7579 |
| 178 | Ga0157369_10212434 | 3300013105 | Bacteria | 2027 |
| 179 | Ga0157374_10406121 | 3300013296 | Bacteria | 1359 |
| 180 | Ga0157378_10016616 | 3300013297 | Bacteria | 6447 |
| 181 | Ga0157378_10303285 | 3300013297 | Bacteria | 1546 |
| 182 | Ga0163162_10094634 | 3300013306 | Bacteria | 3074 |
| 183 | Ga0163162_10170328 | 3300013306 | Bacteria | 2302 |
| 184 | Ga0157372_10084277 | 3300013307 | Bacteria | 3602 |
| 185 | Ga0157375_10280668 | 3300013308 | Bacteria | 1829 |
| 186 | Ga0163163_10027245 | 3300014325 | Bacteria | 5473 |
| 187 | Ga0163163_10048691 | 3300014325 | Bacteria | 4168 |
| 188 | Ga0163163_10148889 | 3300014325 | Bacteria | 2385 |
| 189 | Ga0157380_10243877 | 3300014326 | Bacteria | 1622 |
| 190 | Ga0182006_1096908 | 3300015261 | Bacteria | 1052 |
| 191 | Ga0214542_1000001 | 3300021321 | Bacteria | 1018696 |
| 192 | Ga0214545_1000001 | 3300021324 | Bacteria | 1092817 |
| 193 | Ga0214543_1000001 | 3300021327 | Bacteria | 776921 |
| 194 | Ga0213876_10006878 | 3300021384 | Bacteria | 6200 |
| 195 | Ga0213876_10106677 | 3300021384 | Bacteria | 1486 |
| 196 | Ga0213875_10029210 | 3300021388 | Bacteria | 2615 |
| 197 | Ga0209435_100006 | 3300025206 | Bacteria | 542459 |
| 198 | Ga0209563_116775 | 3300025230 | Bacteria | 893 |
| 199 | Ga0209646_1000015 | 3300025246 | Bacteria | 542459 |
| 200 | Ga0209026_1000039 | 3300025250 | Bacteria | 280608 |
| 201 | Ga0209677_102871 | 3300025253 | Bacteria | 6058 |
| 202 | Ga0209759_1000005 | 3300025256 | Bacteria | 542459 |
| 203 | Ga0209759_1004195 | 3300025256 | Bacteria | 5468 |
| 204 | Ga0209233_1014518 | 3300025261 | Bacteria | 2216 |
| 205 | Ga0209673_1056165 | 3300025273 | Bacteria | 1009 |
| 206 | Ga0209564_1002211 | 3300025295 | Bacteria | 16219 |
| 207 | Ga0209758_1000021 | 3300025297 | Bacteria | 697691 |
| 208 | Ga0209758_1001025 | 3300025297 | Bacteria | 36697 |
| 209 | Ga0209758_1001133 | 3300025297 | Bacteria | 34266 |
| 210 | Ga0209758_1011526 | 3300025297 | Bacteria | 5104 |
| 211 | Ga0209758_1056350 | 3300025297 | Bacteria | 1328 |
| 212 | Ga0209758_1103550 | 3300025297 | Bacteria | 803 |
| 213 | Ga0209256_1007103 | 3300025299 | Bacteria | 5650 |
| 214 | Ga0209256_1053793 | 3300025299 | Bacteria | 962 |
| 215 | Ga0207426_1000479 | 3300025302 | Bacteria | 60939 |
| 216 | Ga0207426_1000599 | 3300025302 | Bacteria | 47456 |
| 217 | Ga0207426_1042331 | 3300025302 | Bacteria | 1406 |
| 218 | Ga0207697_10034517 | 3300025315 | Bacteria | 2071 |
| 219 | Ga0207692_10005535 | 3300025898 | Bacteria | 5068 |
| 220 | Ga0207692_10185844 | 3300025898 | Bacteria | 1213 |
| 221 | Ga0207710_10008563 | 3300025900 | Bacteria | 4312 |
| 222 | Ga0207710_10140396 | 3300025900 | Bacteria | 1166 |
| 223 | Ga0207688_10034076 | 3300025901 | Bacteria | 2818 |
| 224 | Ga0207680_10145430 | 3300025903 | Bacteria | 1575 |
| 225 | Ga0207680_10319547 | 3300025903 | Bacteria | 1085 |
| 226 | Ga0207647_10200842 | 3300025904 | Bacteria | 1153 |
| 227 | Ga0207685_10067238 | 3300025905 | Bacteria | 1440 |
| 228 | Ga0207685_10136231 | 3300025905 | Bacteria | 1096 |
| 229 | Ga0207699_10028127 | 3300025906 | Bacteria | 3121 |
| 230 | Ga0207699_10031894 | 3300025906 | Bacteria | 2963 |
| 231 | Ga0207707_10014703 | 3300025912 | Bacteria | 6821 |
| 232 | Ga0207707_10057211 | 3300025912 | Bacteria | 3394 |
| 233 | Ga0207707_10176666 | 3300025912 | Bacteria | 1865 |
| 234 | Ga0207707_10314629 | 3300025912 | Bacteria | 1352 |
| 235 | Ga0207695_10117455 | 3300025913 | Bacteria | 2632 |
| 236 | Ga0207695_10119717 | 3300025913 | Bacteria | 2602 |
| 237 | Ga0207695_10150334 | 3300025913 | Bacteria | 2268 |
| 238 | Ga0207695_10310635 | 3300025913 | Bacteria | 1467 |
| 239 | Ga0207671_10122976 | 3300025914 | Bacteria | 1985 |
| 240 | Ga0207671_10407342 | 3300025914 | Bacteria | 1082 |
| 241 | Ga0207671_10407514 | 3300025914 | Bacteria | 1081 |
| 242 | Ga0207671_10575123 | 3300025914 | Bacteria | 898 |
| 243 | Ga0207693_10083933 | 3300025915 | Bacteria | 2496 |
| 244 | Ga0207693_10116277 | 3300025915 | Bacteria | 2100 |
| 245 | Ga0207693_10159435 | 3300025915 | Bacteria | 1775 |
| 246 | Ga0207663_10046369 | 3300025916 | Bacteria | 2678 |
| 247 | Ga0207663_10383236 | 3300025916 | Bacteria | 1071 |
| 248 | Ga0207663_10437369 | 3300025916 | Bacteria | 1007 |
| 249 | Ga0207660_10008250 | 3300025917 | Bacteria | 6735 |
| 250 | Ga0207660_10060220 | 3300025917 | Bacteria | 2728 |
| 251 | Ga0207660_10174352 | 3300025917 | Bacteria | 1667 |
| 252 | Ga0207657_10081542 | 3300025919 | Bacteria | 2717 |
| 253 | Ga0207657_10148768 | 3300025919 | Bacteria | 1909 |
| 254 | Ga0207652_10457691 | 3300025921 | Bacteria | 1150 |
| 255 | Ga0207646_10332735 | 3300025922 | Bacteria | 1372 |
| 256 | Ga0207681_10524860 | 3300025923 | Bacteria | 972 |
| 257 | Ga0207694_10030817 | 3300025924 | Bacteria | 4094 |
| 258 | Ga0207694_10159698 | 3300025924 | Bacteria | 1820 |
| 259 | Ga0207694_10236215 | 3300025924 | Bacteria | 1493 |
| 260 | Ga0207650_10039723 | 3300025925 | Bacteria | 3439 |
| 261 | Ga0207650_10687629 | 3300025925 | Bacteria | 864 |
| 262 | Ga0207700_10022160 | 3300025928 | Bacteria | 4352 |
| 263 | Ga0207700_10052321 | 3300025928 | Bacteria | 3053 |
| 264 | Ga0207664_10052674 | 3300025929 | Bacteria | 3219 |
| 265 | Ga0207664_10134250 | 3300025929 | Bacteria | 2086 |
| 266 | Ga0207644_10275592 | 3300025931 | Bacteria | 1349 |
| 267 | Ga0207706_10331773 | 3300025933 | Bacteria | 1323 |
| 268 | Ga0207709_10248879 | 3300025935 | Bacteria | 1297 |
| 269 | Ga0207669_10284285 | 3300025937 | Bacteria | 1249 |
| 270 | Ga0207665_10001583 | 3300025939 | Bacteria | 15351 |
| 271 | Ga0207711_10150513 | 3300025941 | Bacteria | 2099 |
| 272 | Ga0207711_10608139 | 3300025941 | Bacteria | 1020 |
| 273 | Ga0207661_10391212 | 3300025944 | Bacteria | 1259 |
| 274 | Ga0207667_10265170 | 3300025949 | Bacteria | 1756 |
| 275 | Ga0207667_10335920 | 3300025949 | Bacteria | 1542 |
| 276 | Ga0207667_10336315 | 3300025949 | Bacteria | 1541 |
| 277 | Ga0207667_10533378 | 3300025949 | Bacteria | 1188 |
| 278 | Ga0207668_10329581 | 3300025972 | Bacteria | 1270 |
| 279 | Ga0207668_10705264 | 3300025972 | Bacteria | 887 |
| 280 | Ga0207640_10194183 | 3300025981 | Bacteria | 1532 |
| 281 | Ga0207658_10253221 | 3300025986 | Bacteria | 1497 |
| 282 | Ga0207677_10191226 | 3300026023 | Bacteria | 1619 |
| 283 | Ga0207639_10140392 | 3300026041 | Bacteria | 2012 |
| 284 | Ga0207639_10157319 | 3300026041 | Bacteria | 1911 |
| 285 | Ga0207639_10276002 | 3300026041 | Bacteria | 1476 |
| 286 | Ga0207639_10276975 | 3300026041 | Bacteria | 1474 |
| 287 | Ga0207639_10332409 | 3300026041 | Bacteria | 1352 |
| 288 | Ga0207678_10003569 | 3300026067 | Bacteria | 13988 |
| 289 | Ga0207678_10049928 | 3300026067 | Bacteria | 3615 |
| 290 | Ga0207678_10418767 | 3300026067 | Bacteria | 1161 |
| 291 | Ga0207678_10597085 | 3300026067 | Bacteria | 968 |
| 292 | Ga0207708_10197022 | 3300026075 | Bacteria | 1606 |
| 293 | Ga0207702_10031931 | 3300026078 | Bacteria | 4392 |
| 294 | Ga0207702_10267484 | 3300026078 | Bacteria | 1612 |
| 295 | Ga0207702_10431405 | 3300026078 | Bacteria | 1276 |
| 296 | Ga0207675_100161084 | 3300026118 | Bacteria | 2140 |
| 297 | Ga0207698_10292882 | 3300026142 | Bacteria | 1511 |
| 298 | Ga0207698_10554133 | 3300026142 | Bacteria | 1127 |
| 299 | Ga0207698_10907681 | 3300026142 | Bacteria | 888 |
| 300 | Ga0209389_1000121 | 3300027296 | Bacteria | 70490 |
| 301 | Ga0209589_1000003 | 3300027357 | Bacteria | 629130 |
| 302 | Ga0209589_1002338 | 3300027357 | Bacteria | 32739 |
| 303 | Ga0209489_100003 | 3300027361 | Bacteria | 663105 |
| 304 | Ga0209489_101475 | 3300027361 | Bacteria | 48380 |
| 305 | Ga0209700_100003 | 3300027363 | Bacteria | 663105 |
| 306 | Ga0209179_1000593 | 3300027512 | Bacteria | 3811 |
| 307 | Ga0209813_10036440 | 3300027866 | Bacteria | 1478 |
| 308 | Ga0209813_10085225 | 3300027866 | Bacteria | 1052 |
| 309 | Ga0268266_10001098 | 3300028379 | Bacteria | 33929 |
| 310 | Ga0268266_10017714 | 3300028379 | Bacteria | 6069 |
| 311 | Ga0268266_10143932 | 3300028379 | Bacteria | 2141 |
| 312 | Ga0268266_10150362 | 3300028379 | Bacteria | 2098 |
| 313 | Ga0268264_10000043 | 3300028381 | Bacteria | 371761 |
| 314 | Ga0268264_10524043 | 3300028381 | Bacteria | 1159 |
| 315 | Ga0265325_10027410 | 3300031241 | Bacteria | 3079 |
| 316 | Ga0265340_10036789 | 3300031247 | Bacteria | 2425 |
| 317 | Ga0265316_10357622 | 3300031344 | Bacteria | 1056 |
| 318 | Ga0307513_10164990 | 3300031456 | Bacteria | 2101 |
| 319 | Ga0307509_10060644 | 3300031507 | Bacteria | 3997 |
| 320 | Ga0307408_100036430 | 3300031548 | Bacteria | 3459 |
| 321 | Ga0307508_10000010 | 3300031616 | Bacteria | 255747 |
| 322 | Ga0265314_10285250 | 3300031711 | Bacteria | 932 |
| 323 | Ga0307516_10042681 | 3300031730 | Bacteria | 4497 |
| 324 | Ga0307413_10506479 | 3300031824 | Bacteria | 970 |
| 325 | Ga0307411_10333882 | 3300032005 | Bacteria | 1229 |
| 326 | Ga0307415_100118119 | 3300032126 | Bacteria | 1982 |
| 327 | Ga0307415_100351195 | 3300032126 | Bacteria | 1241 |
| 328 | Ga0307510_10004213 | 3300033180 | Bacteria | 16896 |
| 329 | Ga0307510_10006119 | 3300033180 | Bacteria | 14339 |
| 330 | Ga0307510_10392259 | 3300033180 | Bacteria | 832 |
| 331 | Ga0315911_1000001 | 3300033442 | Bacteria | 1088602 |
| 332 | Ga0373934_0085641 | 3300035086 | Bacteria | 1268 |
| 333 | Ga0373923_0045006 | 3300035111 | Bacteria | 1832 |
| 334 | Ga0373923_0049016 | 3300035111 | Bacteria | 1765 |
| 335 | Ga0373932_0077068 | 3300035112 | Bacteria | 1046 |
| 336 | Ga0373936_0005311 | 3300035113 | Bacteria | 4849 |
| 337 | Ga0373936_0145773 | 3300035113 | Bacteria | 1024 |
| 338 | Ga0373954_0008335 | 3300035118 | Bacteria | 4546 |
| 339 | Ga0373954_0024129 | 3300035118 | Bacteria | 2771 |
| 340 | Ga0373954_0067608 | 3300035118 | Bacteria | 1693 |
| 341 | Ga0373956_0141693 | 3300035119 | Bacteria | 1129 |
| 342 | Ga0373957_0013029 | 3300035120 | Bacteria | 2814 |
| 343 | Ga0373943_0004918 | 3300035170 | Bacteria | 6037 |
| 344 | Ga0373943_0227007 | 3300035170 | Bacteria | 1042 |
| 345 | Ga0373946_0029192 | 3300035171 | Bacteria | 2193 |
| 346 | Ga0373955_0039717 | 3300035172 | Bacteria | 2513 |
| 347 | Ga0373955_0090334 | 3300035172 | Bacteria | 1745 |
| 348 | Ga0373955_0316442 | 3300035172 | Bacteria | 942 |
| 349 | Ga0373924_0009245 | 3300035410 | Bacteria | 3609 |
| 350 | Ga0373924_0027064 | 3300035410 | Bacteria | 2279 |
| 351 | Ga0373931_0215128 | 3300035691 | Bacteria | 1155 |
| 352 | Ga0373931_0222551 | 3300035691 | Bacteria | 1137 |
| 353 | Ga0373935_0055144 | 3300035692 | Bacteria | 2532 |
| 354 | Ga0373927_0173928 | 3300035695 | Bacteria | 1412 |
| 355 | Ga0373927_0306964 | 3300035695 | Bacteria | 1044 |
| 356 | Ga0373927_0327863 | 3300035695 | Bacteria | 1008 |
| 357 | Ga0373927_0357239 | 3300035695 | Bacteria | 963 |
| 358 | Ga0373933_0001930 | 3300035724 | Bacteria | 11963 |
| 359 | Ga0373933_0017121 | 3300035724 | Bacteria | 4063 |
| 360 | Ga0373933_0054487 | 3300035724 | Bacteria | 2397 |
| 361 | Ga0373947_0033109 | 3300035725 | Bacteria | 3049 |
| 362 | Ga0373947_0082641 | 3300035725 | Bacteria | 1991 |
| 363 | Ga0373947_0209247 | 3300035725 | Bacteria | 1279 |
| 364 | Ga0373937_0127645 | 3300036401 | Bacteria | 2373 |
| 365 | Ga0373937_0157888 | 3300036401 | Bacteria | 2126 |
| 366 | Ga0373937_0711775 | 3300036401 | Bacteria | 951 |
| 367 | Ga0373925_0006009 | 3300037068 | Bacteria | 8990 |
| 368 | Ga0373925_0152585 | 3300037068 | Bacteria | 1815 |
| 369 | Ga0395899_0312624 | 3300037312 | Bacteria | 1060 |
| 370 | Ga0395900_0017864 | 3300037418 | Bacteria | 7240 |
| 371 | Ga0395900_0273815 | 3300037418 | Bacteria | 1682 |
| 372 | Ga0395898_0032284 | 3300037466 | Bacteria | 5226 |
| 373 | Ga0395898_0677965 | 3300037466 | Bacteria | 973 |
| 374 | Ga0395905_0007051 | 3300037471 | Bacteria | 11231 |
| 375 | Ga0395905_0250301 | 3300037471 | Bacteria | 1655 |
| 376 | Ga0436364_0991714 | 3300037853 | Bacteria | 3338 |
| 377 | Ga0395901_0129842 | 3300038443 | Bacteria | 2648 |
| 378 | Ga0395901_0377199 | 3300038443 | Bacteria | 1460 |
| 379 | Ga0436365_0866542 | 3300039437 | Bacteria | 750 |
| 380 | Ga0436365_1316672 | 3300039437 | Bacteria | 18310 |
| 381 | Ga0436365_1470075 | 3300039437 | Bacteria | 6471 |
| 382 | Ga0436365_1510814 | 3300039437 | Bacteria | 3411 |
| 383 | Ga0436360_0167622 | 3300039438 | Bacteria | 1607 |
| 384 | Ga0436363_1463179 | 3300039450 | Bacteria | 2610 |
| 385 | Ga0436362_1173705 | 3300039453 | Bacteria | 2758 |
| 386 | Ga0451802_0675589 | 3300041460 | Bacteria | 1221 |
| 387 | Ga0451806_367894 | 3300041462 | Bacteria | 3028 |
| 388 | Ga0451851_0219306 | 3300041507 | Bacteria | 1255 |
| 389 | Ga0451853_3503921 | 3300041512 | Bacteria | 1138 |
| 390 | Ga0451853_3945261 | 3300041512 | Bacteria | 1058 |
| 391 | Ga0466972_0054449 | 3300044658 | Bacteria | 1924 |
| 392 | Ga0466965_0009353 | 3300044683 | Bacteria | 4553 |
| 393 | Ga0466963_0243643 | 3300044694 | Bacteria | 1261 |
| 394 | Ga0466964_0054250 | 3300044706 | Bacteria | 1652 |
| 395 | Ga0466971_0043439 | 3300044719 | Bacteria | 2020 |
| 396 | Ga0466960_0095929 | 3300044901 | Bacteria | 1519 |
| 397 | Ga0466967_0029515 | 3300045976 | Bacteria | 4590 |
| 398 | Ga0466967_0129258 | 3300045976 | Bacteria | 2343 |
| 399 | Ga0495592_0073199 | 3300046454 | Bacteria | 2492 |
| 400 | Ga0495592_0095701 | 3300046454 | Bacteria | 2123 |
| 401 | Ga0495603_0000729 | 3300046455 | Bacteria | 18686 |
| 402 | Ga0495603_0028681 | 3300046455 | Bacteria | 3358 |
| 403 | Ga0495603_0032720 | 3300046455 | Bacteria | 3128 |
| 404 | Ga0495603_0064072 | 3300046455 | Bacteria | 2168 |
| 405 | Ga0495603_0197961 | 3300046455 | Bacteria | 1161 |
| 406 | Ga0495629_0001683 | 3300046459 | Bacteria | 17362 |
| 407 | Ga0495629_0003206 | 3300046459 | Bacteria | 12375 |
| 408 | Ga0495629_0435858 | 3300046459 | Bacteria | 888 |
| 409 | Ga0495638_0012724 | 3300046460 | Bacteria | 5754 |
| 410 | Ga0495638_0152144 | 3300046460 | Bacteria | 1341 |
| 411 | Ga0495641_0010184 | 3300046461 | Bacteria | 5486 |
| 412 | Ga0495651_0013636 | 3300046462 | Bacteria | 6281 |
| 413 | Ga0495653_0181243 | 3300046463 | Bacteria | 1445 |
| 414 | Ga0495653_0192112 | 3300046463 | Bacteria | 1392 |
| 415 | Ga0495580_0001179 | 3300046472 | Bacteria | 22977 |
| 416 | Ga0495580_0025532 | 3300046472 | Bacteria | 4318 |
| 417 | Ga0495580_0067039 | 3300046472 | Bacteria | 2512 |
| 418 | Ga0495582_0011077 | 3300046473 | Bacteria | 4965 |
| 419 | Ga0495639_0000381 | 3300046475 | Bacteria | 21245 |
| 420 | Ga0495639_0029667 | 3300046475 | Bacteria | 2428 |
| 421 | Ga0495639_0060299 | 3300046475 | Bacteria | 1738 |
| 422 | Ga0495662_0001877 | 3300046476 | Bacteria | 10527 |
| 423 | Ga0495662_0032221 | 3300046476 | Bacteria | 2532 |
| 424 | Ga0495664_0008790 | 3300046477 | Bacteria | 5642 |
| 425 | Ga0495664_0015631 | 3300046477 | Bacteria | 4316 |
| 426 | Ga0495664_0029939 | 3300046477 | Bacteria | 3186 |
| 427 | Ga0495584_0078243 | 3300046491 | Bacteria | 1664 |
| 428 | Ga0495584_0124241 | 3300046491 | Bacteria | 1307 |
| 429 | Ga0495584_0158115 | 3300046491 | Bacteria | 1152 |
| 430 | Ga0495585_0035910 | 3300046492 | Bacteria | 2798 |
| 431 | Ga0495594_0004862 | 3300046499 | Bacteria | 6916 |
| 432 | Ga0495583_0089310 | 3300046506 | Bacteria | 1329 |
| 433 | Ga0495606_0011059 | 3300046507 | Bacteria | 7403 |
| 434 | Ga0495610_0139898 | 3300046512 | Bacteria | 1043 |
| 435 | Ga0495616_0169145 | 3300046513 | Bacteria | 978 |
| 436 | Ga0495618_0031969 | 3300046514 | Bacteria | 3296 |
| 437 | Ga0495618_0059713 | 3300046514 | Bacteria | 2417 |
| 438 | Ga0495620_0139887 | 3300046515 | Bacteria | 947 |
| 439 | Ga0495628_0082675 | 3300046516 | Bacteria | 2494 |
| 440 | Ga0495630_0036156 | 3300046517 | Bacteria | 3692 |
| 441 | Ga0495630_0040192 | 3300046517 | Bacteria | 3495 |
| 442 | Ga0495632_0087111 | 3300046519 | Bacteria | 1485 |
| 443 | Ga0495637_0078692 | 3300046520 | Bacteria | 1318 |
| 444 | Ga0495643_0010985 | 3300046522 | Bacteria | 5540 |
| 445 | Ga0495643_0074345 | 3300046522 | Bacteria | 1780 |
| 446 | Ga0495648_0035952 | 3300046524 | Bacteria | 3204 |
| 447 | Ga0495642_0046160 | 3300046528 | Bacteria | 1782 |
| 448 | Ga0495652_0143134 | 3300046529 | Bacteria | 1878 |
| 449 | Ga0495652_0297688 | 3300046529 | Bacteria | 1174 |
| 450 | Ga0495665_0001300 | 3300046531 | Bacteria | 13310 |
| 451 | Ga0495665_0069349 | 3300046531 | Bacteria | 1858 |
| 452 | Ga0495640_0089610 | 3300046533 | Bacteria | 2031 |
| 453 | Ga0495586_0079732 | 3300046535 | Bacteria | 1798 |
| 454 | Ga0495586_0353052 | 3300046535 | Bacteria | 845 |
| 455 | Ga0495587_0003875 | 3300046536 | Bacteria | 9926 |
| 456 | Ga0495598_0095937 | 3300046537 | Bacteria | 974 |
| 457 | Ga0495645_0010706 | 3300046543 | Bacteria | 6440 |
| 458 | Ga0495645_0249765 | 3300046543 | Bacteria | 1179 |
| 459 | Ga0495622_0000825 | 3300046557 | Bacteria | 17144 |
| 460 | Ga0495633_0053666 | 3300046558 | Bacteria | 1897 |
| 461 | Ga0495633_0060589 | 3300046558 | Bacteria | 1773 |
| 462 | Ga0495667_0016472 | 3300046559 | Bacteria | 4994 |
| 463 | Ga0495667_0042567 | 3300046559 | Bacteria | 3012 |
| 464 | Ga0495667_0068796 | 3300046559 | Bacteria | 2311 |
| 465 | Ga0495656_0012999 | 3300046615 | Bacteria | 3086 |
| 466 | Ga0495656_0108522 | 3300046615 | Bacteria | 1294 |
| 467 | Ga0495668_0015342 | 3300046616 | Bacteria | 4477 |
| 468 | Ga0495668_0258780 | 3300046616 | Bacteria | 953 |
| 469 | Ga0495634_0000324 | 3300046642 | Bacteria | 46211 |
| 470 | Ga0495634_0067958 | 3300046642 | Bacteria | 2355 |
| 471 | Ga0495634_0234319 | 3300046642 | Bacteria | 1128 |
| 472 | Ga0495625_0101657 | 3300046660 | Bacteria | 1974 |
| 473 | Ga0495625_0165881 | 3300046660 | Bacteria | 1477 |
| 474 | Ga0495635_0005678 | 3300046663 | Bacteria | 8690 |
| 475 | Ga0495661_0173277 | 3300046665 | Bacteria | 1149 |
| 476 | Ga0495588_0002137 | 3300046674 | Bacteria | 8476 |
| 477 | Ga0495657_0081716 | 3300046675 | Bacteria | 2089 |
| 478 | Ga0495599_0167112 | 3300046678 | Bacteria | 1358 |
| 479 | Ga0495623_0078500 | 3300046679 | Bacteria | 2046 |
| 480 | Ga0495646_0056473 | 3300046680 | Bacteria | 2354 |
| 481 | Ga0495646_0124489 | 3300046680 | Bacteria | 1456 |
| 482 | Ga0495647_0001889 | 3300046681 | Bacteria | 6520 |
| 483 | Ga0495658_0001003 | 3300046683 | Bacteria | 14903 |
| 484 | Ga0495658_0042101 | 3300046683 | Bacteria | 2548 |
| 485 | Ga0495669_0005527 | 3300046684 | Bacteria | 5272 |
| 486 | Ga0495669_0195408 | 3300046684 | Bacteria | 966 |
| 487 | Ga0495613_0004628 | 3300046689 | Bacteria | 10328 |
| 488 | Ga0495613_0063204 | 3300046689 | Bacteria | 2709 |
| 489 | Ga0495613_0188790 | 3300046689 | Bacteria | 1457 |
| 490 | Ga0495613_0337798 | 3300046689 | Bacteria | 1037 |
| 491 | Ga0495624_0024440 | 3300046690 | Bacteria | 3975 |
| 492 | Ga0495624_0049143 | 3300046690 | Bacteria | 2675 |
| 493 | Ga0495649_0091495 | 3300046694 | Bacteria | 1621 |
| 494 | Ga0495600_0092491 | 3300046809 | Bacteria | 1972 |
| 495 | Ga0495600_0097504 | 3300046809 | Bacteria | 1916 |
| 496 | Ga0495581_0000160 | 3300047315 | Bacteria | 30015 |
| 497 | Ga0495581_0058149 | 3300047315 | Bacteria | 2232 |
| 498 | Ga0495581_0182858 | 3300047315 | Bacteria | 1226 |
| 499 | Ga0495604_0020017 | 3300047317 | Bacteria | 5348 |
| 500 | Ga0495604_0103334 | 3300047317 | Bacteria | 2090 |
| 501 | Ga0495636_0122912 | 3300047318 | Bacteria | 1149 |
| 502 | Ga0495674_0008261 | 3300047319 | Bacteria | 9932 |
| 503 | Ga0495674_0211502 | 3300047319 | Bacteria | 1606 |
| 504 | Ga0495674_0220141 | 3300047319 | Bacteria | 1569 |
| 505 | Ga0495672_0038451 | 3300047320 | Bacteria | 2919 |
| 506 | Ga0495676_0023467 | 3300047321 | Bacteria | 5356 |
| 507 | Ga0495676_0041304 | 3300047321 | Bacteria | 3798 |
| 508 | Ga0495676_0170119 | 3300047321 | Bacteria | 1534 |
| 509 | Ga0495676_0185606 | 3300047321 | Bacteria | 1454 |
| 510 | Ga0495676_0435507 | 3300047321 | Bacteria | 866 |
| 511 | Ga0495683_0050687 | 3300047323 | Bacteria | 2077 |
| 512 | Ga0495687_004391 | 3300047443 | Bacteria | 9565 |
| 513 | Ga0495675_0015095 | 3300047444 | Bacteria | 4884 |
| 514 | Ga0495673_0128670 | 3300047469 | Bacteria | 997 |
| 515 | Ga0495684_0044993 | 3300047471 | Bacteria | 3378 |
| 516 | Ga0495684_0054813 | 3300047471 | Bacteria | 3041 |
| 517 | Ga0495593_0000241 | 3300047673 | Bacteria | 29466 |
| 518 | Ga0495593_0027366 | 3300047673 | Bacteria | 3140 |
| 519 | Ga0495602_0044100 | 3300048088 | Bacteria | 4049 |
| 520 | Ga0495614_0072697 | 3300048089 | Bacteria | 1484 |
| 521 | Ga0495614_0184001 | 3300048089 | Bacteria | 941 |
| 522 | Ga0495615_0025646 | 3300048090 | Bacteria | 1370 |
| 523 | Ga0496100_0349753 | 3300048903 | Bacteria | 1116 |
| 524 | Ga0496101_0098205 | 3300048904 | Bacteria | 2188 |
| 525 | Ga0496101_0104458 | 3300048904 | Bacteria | 2125 |
| 526 | Ga0496101_0845653 | 3300048904 | Bacteria | 721 |
| 527 | Ga0496102_0008512 | 3300048905 | Bacteria | 8794 |
| 528 | Ga0496102_0249017 | 3300048905 | Bacteria | 1675 |
| 529 | Ga0496102_0315931 | 3300048905 | Bacteria | 1472 |
| 530 | Ga0496102_0545936 | 3300048905 | Bacteria | 1082 |
| 531 | Ga0496103_0194678 | 3300048906 | Bacteria | 1303 |
| 532 | Ga0496104_0071617 | 3300048907 | Bacteria | 3296 |
| 533 | Ga0496105_0003937 | 3300048908 | Bacteria | 11104 |
| 534 | Ga0496105_0270833 | 3300048908 | Bacteria | 1371 |
| 535 | Ga0496105_0537367 | 3300048908 | Bacteria | 914 |
| 536 | Ga0496106_0003031 | 3300048909 | Bacteria | 12509 |
| 537 | Ga0496107_0295252 | 3300048910 | Bacteria | 1206 |
| 538 | Ga0496107_0617756 | 3300048910 | Bacteria | 800 |
| 539 | Ga0496108_0034979 | 3300048911 | Bacteria | 4174 |
| 540 | Ga0496108_0701988 | 3300048911 | Bacteria | 877 |
| 541 | Ga0496109_0001522 | 3300048912 | Bacteria | 19299 |
| 542 | Ga0496109_0021025 | 3300048912 | Bacteria | 5770 |
| 543 | Ga0496109_0387729 | 3300048912 | Bacteria | 1320 |
| 544 | Ga0496109_0410729 | 3300048912 | Bacteria | 1279 |
| 545 | Ga0496110_0127744 | 3300048913 | Bacteria | 2294 |
| 546 | Ga0496110_0142177 | 3300048913 | Bacteria | 2169 |
| 547 | Ga0496110_0697802 | 3300048913 | Bacteria | 916 |
| 548 | Ga0496111_0307696 | 3300048914 | Bacteria | 1174 |
| 549 | Ga0496112_0000021 | 3300048915 | Bacteria | 156561 |
| 550 | Ga0496112_0020030 | 3300048915 | Bacteria | 6333 |
| 551 | Ga0496112_0122215 | 3300048915 | Bacteria | 2574 |
| 552 | Ga0496112_0175130 | 3300048915 | Bacteria | 2110 |
| 553 | Ga0496112_0659526 | 3300048915 | Bacteria | 976 |
| 554 | Ga0496113_0073481 | 3300048916 | Bacteria | 2605 |
| 555 | Ga0496114_0242587 | 3300048917 | Bacteria | 1585 |
| 556 | Ga0496114_0257887 | 3300048917 | Bacteria | 1535 |
| 557 | Ga0496115_0090778 | 3300048918 | Bacteria | 2496 |
| 558 | Ga0496115_0093708 | 3300048918 | Bacteria | 2456 |
| 559 | Ga0496115_0261510 | 3300048918 | Bacteria | 1423 |
| 560 | Ga0496116_0038168 | 3300048919 | Bacteria | 3339 |
| 561 | Ga0496117_0009110 | 3300048920 | Bacteria | 9325 |
| 562 | Ga0496117_0083106 | 3300048920 | Bacteria | 2095 |
| 563 | Ga0496118_0006337 | 3300048921 | Bacteria | 13064 |
| 564 | Ga0496118_0070194 | 3300048921 | Bacteria | 2531 |
| 565 | Ga0496119_0009371 | 3300048922 | Bacteria | 8418 |
| 566 | Ga0496120_0004023 | 3300048923 | Bacteria | 12746 |
| 567 | Ga0496121_0000183 | 3300048924 | Bacteria | 139168 |
| 568 | Ga0496121_0035667 | 3300048924 | Bacteria | 4451 |
| 569 | Ga0496121_0078095 | 3300048924 | Bacteria | 2633 |
| 570 | Ga0496121_0091317 | 3300048924 | Bacteria | 2378 |
| 571 | Ga0496121_0239551 | 3300048924 | Bacteria | 1265 |
| 572 | Ga0496122_0022521 | 3300048925 | Bacteria | 5596 |
| 573 | Ga0496123_0207705 | 3300048926 | Bacteria | 998 |
| 574 | Ga0496124_0002761 | 3300048927 | Bacteria | 22343 |
| 575 | Ga0496124_0129547 | 3300048927 | Bacteria | 2006 |
| 576 | Ga0496124_0229989 | 3300048927 | Bacteria | 1387 |
| 577 | Ga0496124_0246901 | 3300048927 | Bacteria | 1323 |
| 578 | Ga0496125_0000877 | 3300048928 | Bacteria | 47865 |
| 579 | Ga0496125_0042347 | 3300048928 | Bacteria | 3880 |
| 580 | Ga0496126_0026033 | 3300048929 | Bacteria | 5617 |
| 581 | Ga0496126_0034207 | 3300048929 | Bacteria | 4775 |
| 582 | Ga0496126_0045660 | 3300048929 | Bacteria | 4024 |
| 583 | Ga0496126_0062075 | 3300048929 | Bacteria | 3354 |
| 584 | Ga0496126_0071934 | 3300048929 | Bacteria | 3077 |
| 585 | Ga0496126_0073342 | 3300048929 | Bacteria | 3043 |
| 586 | Ga0496126_0073979 | 3300048929 | Bacteria | 3027 |
| 587 | Ga0496126_0217986 | 3300048929 | Bacteria | 1604 |
| 588 | Ga0496126_0349317 | 3300048929 | Bacteria | 1210 |
| 589 | Ga0495682_0110191 | 3300049460 | Bacteria | 986 |
| 590 | Ga0501031_0001053 | 3300049568 | Bacteria | 16721 |
| 591 | Ga0501032_0000668 | 3300049569 | Bacteria | 27884 |
| 592 | Ga0501032_0038828 | 3300049569 | Bacteria | 3240 |
| 593 | Ga0501033_0000619 | 3300049570 | Bacteria | 32912 |
| 594 | Ga0501033_0023712 | 3300049570 | Bacteria | 4627 |
| 595 | Ga0501033_0047661 | 3300049570 | Bacteria | 3185 |
| 596 | Ga0501033_0119351 | 3300049570 | Bacteria | 1915 |
| 597 | Ga0501033_0419811 | 3300049570 | Bacteria | 931 |
| 598 | Ga0501034_0000232 | 3300049571 | Bacteria | 103995 |
| 599 | Ga0501036_0000371 | 3300049572 | Bacteria | 31608 |
| 600 | Ga0501036_0172083 | 3300049572 | Bacteria | 1824 |
| 601 | Ga0501037_0000303 | 3300049573 | Bacteria | 41763 |
| 602 | Ga0501038_0000112 | 3300049574 | Bacteria | 68326 |
| 603 | Ga0501038_0119220 | 3300049574 | Bacteria | 2178 |
| 604 | Ga0501038_0429941 | 3300049574 | Bacteria | 1018 |
| 605 | Ga0501039_0000789 | 3300049575 | Bacteria | 22789 |
| 606 | Ga0501039_0134692 | 3300049575 | Bacteria | 1939 |
| 607 | Ga0501039_0143546 | 3300049575 | Bacteria | 1876 |
| 608 | Ga0501042_0021071 | 3300049578 | Bacteria | 4540 |
| 609 | Ga0501043_0000035 | 3300049579 | Bacteria | 133200 |
| 610 | Ga0501043_0096029 | 3300049579 | Bacteria | 2330 |
| 611 | Ga0501043_0317318 | 3300049579 | Bacteria | 1188 |
| 612 | Ga0501046_0022126 | 3300049580 | Bacteria | 5239 |
| 613 | Ga0501046_0049382 | 3300049580 | Bacteria | 3328 |
| 614 | Ga0501046_0055323 | 3300049580 | Bacteria | 3119 |
| 615 | Ga0501046_0193513 | 3300049580 | Bacteria | 1516 |
| 616 | Ga0501047_0000085 | 3300049581 | Bacteria | 118617 |
| 617 | Ga0501047_0031163 | 3300049581 | Bacteria | 5143 |
| 618 | Ga0501047_0045461 | 3300049581 | Bacteria | 4246 |
| 619 | Ga0501047_0601769 | 3300049581 | Bacteria | 921 |
| 620 | Ga0501048_0000061 | 3300049582 | Bacteria | 54555 |
| 621 | Ga0501048_0279425 | 3300049582 | Bacteria | 1187 |
| 622 | Ga0501067_0002211 | 3300049583 | Bacteria | 10755 |
| 623 | Ga0501067_0065732 | 3300049583 | Bacteria | 2008 |
| 624 | Ga0501067_0074997 | 3300049583 | Bacteria | 1874 |
| 625 | Ga0501068_0004923 | 3300049584 | Bacteria | 7276 |
| 626 | Ga0501069_0021376 | 3300049585 | Bacteria | 3510 |
| 627 | Ga0501070_0000272 | 3300049586 | Bacteria | 48952 |
| 628 | Ga0501070_0471742 | 3300049586 | Bacteria | 1010 |
| 629 | Ga0501071_0051827 | 3300049587 | Bacteria | 2958 |
| 630 | Ga0501071_0401422 | 3300049587 | Bacteria | 1047 |
| 631 | Ga0501072_0006309 | 3300049588 | Bacteria | 9028 |
| 632 | Ga0501073_0000026 | 3300049589 | Bacteria | 124358 |
| 633 | Ga0501073_0056283 | 3300049589 | Bacteria | 2751 |
| 634 | Ga0501074_0000017 | 3300049590 | Bacteria | 76626 |
| 635 | Ga0501074_0055970 | 3300049590 | Bacteria | 2842 |
| 636 | Ga0501079_0002647 | 3300049741 | Bacteria | 13021 |
| 637 | Ga0501080_0062421 | 3300049742 | Bacteria | 3468 |
| 638 | Ga0501083_0000638 | 3300049744 | Bacteria | 22694 |
| 639 | Ga0501035_0000548 | 3300049822 | Bacteria | 41814 |
| 640 | Ga0501035_0054958 | 3300049822 | Bacteria | 3555 |
| 641 | Ga0501035_0103647 | 3300049822 | Bacteria | 2495 |
| 642 | Ga0501035_0179739 | 3300049822 | Bacteria | 1823 |
| 643 | Ga0501044_0000051 | 3300049823 | Bacteria | 143658 |
| 644 | Ga0501044_0039498 | 3300049823 | Bacteria | 4923 |
| 645 | Ga0501044_0055169 | 3300049823 | Bacteria | 4082 |
| 646 | nmdc:mga03683_2975_c1 | 3300050489 | Bacteria | 5362 |
| 647 | nmdc:mga03n38_103522_c1 | 3300050490 | Bacteria | 1376 |
| 648 | nmdc:mga03n38_12912_c1 | 3300050490 | Bacteria | 3159 |
| 649 | nmdc:mga03n38_180288_c1 | 3300050490 | Bacteria | 1082 |
| 650 | nmdc:mga03n38_18704_c1 | 3300050490 | Bacteria | 2739 |
| 651 | nmdc:mga00v17_296813_c1 | 3300050491 | Bacteria | 1049 |
| 652 | nmdc:mga00v17_63272_c1 | 3300050491 | Bacteria | 2278 |
| 653 | nmdc:mga0yw44_398702_c1 | 3300050492 | Bacteria | 930 |
| 654 | nmdc:mga0yw44_48221_c1 | 3300050492 | Bacteria | 2568 |
| 655 | nmdc:mga0yw44_504413_c1 | 3300050492 | Bacteria | 821 |
| 656 | nmdc:mga0yw44_83360_c1 | 3300050492 | Bacteria | 2008 |
| 657 | nmdc:mga0k408_239432_c1 | 3300050493 | Bacteria | 1083 |
| 658 | nmdc:mga0k408_9279_c1 | 3300050493 | Bacteria | 5301 |
| 659 | nmdc:mga06z11_116980_c1 | 3300050494 | Bacteria | 1483 |
| 660 | nmdc:mga06z11_14996_c1 | 3300050494 | Bacteria | 3449 |
| 661 | nmdc:mga06z11_32574_c1 | 3300050494 | Bacteria | 2543 |
| 662 | nmdc:mga04h51_101074_c1 | 3300050495 | Bacteria | 1051 |
| 663 | nmdc:mga04h51_82482_c1 | 3300050495 | Bacteria | 1144 |
| 664 | nmdc:mga07m45_19502_c2 | 3300050496 | Bacteria | 2221 |
| 665 | nmdc:mga0n895_32103_c1 | 3300050512 | Bacteria | 5037 |
| 666 | nmdc:mga0n895_67036_c1 | 3300050512 | Bacteria | 3554 |
| 667 | nmdc:mga0rr50_433239_c1 | 3300050513 | Bacteria | 1113 |
| 668 | nmdc:mga0sz30_61424_c1 | 3300050516 | Bacteria | 1606 |
| 669 | Ga0495601_0035341 | 3300053077 | Bacteria | 3118 |
| 670 | Ga0495601_0078141 | 3300053077 | Bacteria | 2120 |
| 671 | Ga0495601_0095765 | 3300053077 | Bacteria | 1914 |
| 672 | Ga0495612_0021249 | 3300053078 | Bacteria | 2604 |
| 673 | Ga0495619_0188485 | 3300053085 | Bacteria | 1427 |
| 674 | Ga0495619_0551691 | 3300053085 | Bacteria | 790 |
| 675 | Ga0500578_0125302 | 3300053086 | Bacteria | 1613 |
| 676 | Ga0500578_0146850 | 3300053086 | Bacteria | 1471 |
| 677 | Ga0500643_000015 | 3300053087 | Bacteria | 310312 |
| 678 | Ga0500647_0089674 | 3300053091 | Bacteria | 1472 |
| 679 | Ga0500583_0054905 | 3300053092 | Bacteria | 1861 |
| 680 | Ga0500651_0078337 | 3300053093 | Bacteria | 2050 |
| 681 | Ga0500566_0000028 | 3300053094 | Bacteria | 75589 |
| 682 | Ga0500566_0000988 | 3300053094 | Bacteria | 16379 |
| 683 | Ga0500566_0005062 | 3300053094 | Bacteria | 7858 |
| 684 | Ga0500566_0157997 | 3300053094 | Bacteria | 1185 |
| 685 | Ga0500640_000581 | 3300053095 | Bacteria | 9411 |
| 686 | Ga0500650_0088991 | 3300053098 | Bacteria | 1445 |
| 687 | Ga0500555_000899 | 3300053103 | Bacteria | 10566 |
| 688 | Ga0500557_000022 | 3300053105 | Bacteria | 88506 |
| 689 | Ga0500562_028396 | 3300053108 | Bacteria | 1470 |
| 690 | Ga0500572_000269 | 3300053111 | Bacteria | 18807 |
| 691 | Ga0500591_013572 | 3300053115 | Bacteria | 3902 |
| 692 | Ga0500595_000652 | 3300053119 | Bacteria | 20859 |
| 693 | Ga0500595_004516 | 3300053119 | Bacteria | 6229 |
| 694 | Ga0500595_013151 | 3300053119 | Bacteria | 3175 |
| 695 | Ga0500614_000118 | 3300053123 | Bacteria | 18968 |
| 696 | Ga0500642_0000060 | 3300053130 | Bacteria | 64536 |
| 697 | Ga0500642_0130489 | 3300053130 | Bacteria | 1177 |
| 698 | Ga0500655_017516 | 3300053133 | Bacteria | 1326 |
| 699 | Ga0500559_0002964 | 3300053136 | Bacteria | 8527 |
| 700 | Ga0500559_0014416 | 3300053136 | Bacteria | 3340 |
| 701 | Ga0500559_0057837 | 3300053136 | Bacteria | 1723 |
| 702 | Ga0500568_0024464 | 3300053139 | Bacteria | 2557 |
| 703 | Ga0500573_0073398 | 3300053140 | Bacteria | 1949 |
| 704 | Ga0500577_0041110 | 3300053142 | Bacteria | 1685 |
| 705 | Ga0500589_176028 | 3300053147 | Bacteria | 845 |
| 706 | Ga0500603_000232 | 3300053150 | Bacteria | 14579 |
| 707 | Ga0500603_091129 | 3300053150 | Bacteria | 895 |
| 708 | Ga0500616_0024278 | 3300053153 | Bacteria | 3371 |
| 709 | Ga0500624_000625 | 3300053157 | Bacteria | 9453 |
| 710 | Ga0500634_0140001 | 3300053161 | Bacteria | 1147 |
| 711 | Ga0500639_000001 | 3300053163 | Bacteria | 244795 |
| 712 | Ga0500637_0000104 | 3300053178 | Bacteria | 30138 |
| 713 | Ga0500637_0152982 | 3300053178 | Bacteria | 1332 |
| 714 | Ga0500625_000333 | 3300053729 | Bacteria | 11823 |
| 715 | Ga0500645_008971 | 3300053730 | Bacteria | 3380 |
| 716 | Ga0500609_026835 | 3300053731 | Bacteria | 789 |
| 717 | Ga0500596_000195 | 3300053735 | Bacteria | 9974 |
| 718 | Ga0500599_016819 | 3300053736 | Bacteria | 1012 |
| 719 | Ga0500601_000662 | 3300053737 | Bacteria | 4722 |
| 720 | Ga0501084_0012583 | 3300054114 | Bacteria | 7011 |
| 721 | Ga0500661_000109 | 3300055283 | Bacteria | 13318 |
| 722 | Ga0501082_0003691 | 3300060353 | Bacteria | 13369 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047315 | Ga0495581_0058149 | Ga0495581_0058149_39_665 | 180 |
| 2 | iso_pu_bacteria | 2906643746 | 2906651675 | 206 |
| 3 | iso_pu_bacteria | 8019586578 | 8019590381 | 212 |
| 4 | 3300031548 | Ga0307408_100036430 | Ga0307408_1000364303 | 216 |
| 5 | 3300039437 | Ga0436365_0866542 | Ga0436365_0866542_13_666 | 216 |
| 6 | 3300035725 | Ga0373947_0209247 | Ga0373947_0209247_350_1090 | 221 |
| 7 | 3300046455 | Ga0495603_0028681 | Ga0495603_0028681_1577_2317 | 221 |
| 8 | 3300046475 | Ga0495639_0060299 | Ga0495639_0060299_452_1192 | 221 |
| 9 | 3300046537 | Ga0495598_0095937 | Ga0495598_0095937_50_790 | 221 |
| 10 | 3300047321 | Ga0495676_0185606 | Ga0495676_0185606_425_1165 | 221 |
| 11 | 3300005355 | Ga0070671_100198395 | Ga0070671_1001983952 | 222 |
| 12 | 3300005548 | Ga0070665_100060084 | Ga0070665_1000600843 | 222 |
| 13 | 3300006178 | Ga0075367_10022133 | Ga0075367_100221334 | 222 |
| 14 | 3300031824 | Ga0307413_10506479 | Ga0307413_105064791 | 222 |
| 15 | 3300032126 | Ga0307415_100118119 | Ga0307415_1001181192 | 222 |
| 16 | 3300032126 | Ga0307415_100351195 | Ga0307415_1003511951 | 222 |
| 17 | 3300046491 | Ga0495584_0078243 | Ga0495584_0078243_235_942 | 222 |
| 18 | 3300046491 | Ga0495584_0124241 | Ga0495584_0124241_185_889 | 222 |
| 19 | 3300046492 | Ga0495585_0035910 | Ga0495585_0035910_317_1021 | 222 |
| 20 | 3300046519 | Ga0495632_0087111 | Ga0495632_0087111_274_978 | 222 |
| 21 | 3300046520 | Ga0495637_0078692 | Ga0495637_0078692_564_1268 | 222 |
| 22 | 3300046522 | Ga0495643_0074345 | Ga0495643_0074345_501_1205 | 222 |
| 23 | 3300046558 | Ga0495633_0060589 | Ga0495633_0060589_255_959 | 222 |
| 24 | 3300046615 | Ga0495656_0108522 | Ga0495656_0108522_495_1199 | 222 |
| 25 | 3300046665 | Ga0495661_0173277 | Ga0495661_0173277_26_730 | 222 |
| 26 | 3300046674 | Ga0495588_0002137 | Ga0495588_0002137_7613_8317 | 222 |
| 27 | 3300046684 | Ga0495669_0005527 | Ga0495669_0005527_4342_5046 | 222 |
| 28 | 3300047317 | Ga0495604_0103334 | Ga0495604_0103334_682_1386 | 222 |
| 29 | 3300047318 | Ga0495636_0122912 | Ga0495636_0122912_318_1022 | 222 |
| 30 | 3300048090 | Ga0495615_0025646 | Ga0495615_0025646_570_1274 | 222 |
| 31 | 3300050494 | nmdc:mga06z11_116980_c1 | nmdc:mga06z11_116980_c1_726_1466 | 222 |
| 32 | 3300005455 | Ga0070663_100029168 | Ga0070663_1000291682 | 223 |
| 33 | 3300005455 | Ga0070663_100057859 | Ga0070663_1000578592 | 223 |
| 34 | 3300005539 | Ga0068853_100093363 | Ga0068853_1000933632 | 223 |
| 35 | 3300005616 | Ga0068852_100198691 | Ga0068852_1001986912 | 223 |
| 36 | 3300005842 | Ga0068858_100175128 | Ga0068858_1001751282 | 223 |
| 37 | 3300005843 | Ga0068860_100023488 | Ga0068860_1000234885 | 223 |
| 38 | 3300010375 | Ga0105239_10062789 | Ga0105239_100627893 | 223 |
| 39 | 3300025919 | Ga0207657_10148768 | Ga0207657_101487681 | 223 |
| 40 | 3300026142 | Ga0207698_10292882 | Ga0207698_102928822 | 223 |
| 41 | 3300048905 | Ga0496102_0315931 | Ga0496102_0315931_30_776 | 223 |
| 42 | 3300048929 | Ga0496126_0026033 | Ga0496126_0026033_656_1402 | 223 |
| 43 | 3300050490 | nmdc:mga03n38_12912_c1 | nmdc:mga03n38_12912_c1_1903_2649 | 223 |
| 44 | 3300050492 | nmdc:mga0yw44_504413_c1 | nmdc:mga0yw44_504413_c1_53_799 | 223 |
| 45 | 3300050494 | nmdc:mga06z11_14996_c1 | nmdc:mga06z11_14996_c1_687_1433 | 223 |
| 46 | 3300053086 | Ga0500578_0125302 | Ga0500578_0125302_83_763 | 223 |
| 47 | iso_pu_bacteria | 2824661429 | 2824671067 | 223 |
| 48 | iso_pu_bacteria | 2879099564 | 2879103300 | 223 |
| 49 | iso_pu_bacteria | 2922368715 | 2922374326 | 223 |
| 50 | iso_pu_bacteria | 2932809354 | 2932810630 | 223 |
| 51 | iso_pu_bacteria | 2932818245 | 2932821224 | 223 |
| 52 | iso_pu_bacteria | 2935675223 | 2935680483 | 223 |
| 53 | iso_pu_bacteria | 2935684952 | 2935692847 | 223 |
| 54 | iso_pu_bacteria | 2935713505 | 2935721428 | 223 |
| 55 | iso_pu_bacteria | 2935722832 | 2935730346 | 223 |
| 56 | iso_pu_bacteria | 2935732158 | 2935740359 | 223 |
| 57 | iso_pu_bacteria | 2935741537 | 2935749623 | 223 |
| 58 | iso_pu_bacteria | 2935750917 | 2935759064 | 223 |
| 59 | iso_pu_bacteria | 2935760218 | 2935762606 | 223 |
| 60 | iso_pu_bacteria | 2940556831 | 2940564931 | 223 |
| 61 | 3300005334 | Ga0068869_100177424 | Ga0068869_1001774242 | 224 |
| 62 | 3300005338 | Ga0068868_100267074 | Ga0068868_1002670742 | 224 |
| 63 | 3300005347 | Ga0070668_100140649 | Ga0070668_1001406492 | 224 |
| 64 | 3300005347 | Ga0070668_100327741 | Ga0070668_1003277412 | 224 |
| 65 | 3300005455 | Ga0070663_100004463 | Ga0070663_1000044632 | 224 |
| 66 | 3300005548 | Ga0070665_100101926 | Ga0070665_1001019263 | 224 |
| 67 | 3300005843 | Ga0068860_100082950 | Ga0068860_1000829503 | 224 |
| 68 | 3300006038 | Ga0075365_10055262 | Ga0075365_100552622 | 224 |
| 69 | 3300006048 | Ga0075363_100025917 | Ga0075363_1000259172 | 224 |
| 70 | 3300006178 | Ga0075367_10005646 | Ga0075367_100056462 | 224 |
| 71 | 3300006353 | Ga0075370_10035483 | Ga0075370_100354832 | 224 |
| 72 | 3300006353 | Ga0075370_10052216 | Ga0075370_100522162 | 224 |
| 73 | 3300006353 | Ga0075370_10058296 | Ga0075370_100582962 | 224 |
| 74 | 3300025972 | Ga0207668_10705264 | Ga0207668_107052641 | 224 |
| 75 | 3300026023 | Ga0207677_10191226 | Ga0207677_101912262 | 224 |
| 76 | 3300026067 | Ga0207678_10003569 | Ga0207678_100035698 | 224 |
| 77 | 3300028379 | Ga0268266_10017714 | Ga0268266_100177145 | 224 |
| 78 | 3300031456 | Ga0307513_10164990 | Ga0307513_101649903 | 224 |
| 79 | 3300031507 | Ga0307509_10060644 | Ga0307509_100606441 | 224 |
| 80 | 3300033180 | Ga0307510_10006119 | Ga0307510_1000611914 | 224 |
| 81 | 3300046460 | Ga0495638_0152144 | Ga0495638_0152144_31_741 | 224 |
| 82 | 3300046491 | Ga0495584_0158115 | Ga0495584_0158115_284_967 | 224 |
| 83 | 3300046615 | Ga0495656_0012999 | Ga0495656_0012999_227_1069 | 224 |
| 84 | 3300048904 | Ga0496101_0098205 | Ga0496101_0098205_326_1009 | 224 |
| 85 | 3300048908 | Ga0496105_0270833 | Ga0496105_0270833_346_1029 | 224 |
| 86 | 3300048908 | Ga0496105_0537367 | Ga0496105_0537367_206_889 | 224 |
| 87 | 3300048912 | Ga0496109_0001522 | Ga0496109_0001522_18013_18696 | 224 |
| 88 | 3300048917 | Ga0496114_0242587 | Ga0496114_0242587_275_958 | 224 |
| 89 | 3300048918 | Ga0496115_0090778 | Ga0496115_0090778_188_871 | 224 |
| 90 | 3300053094 | Ga0500566_0157997 | Ga0500566_0157997_187_897 | 224 |
| 91 | 3300053119 | Ga0500595_004516 | Ga0500595_004516_3581_4291 | 224 |
| 92 | 3300053133 | Ga0500655_017516 | Ga0500655_017516_195_905 | 224 |
| 93 | 3300053142 | Ga0500577_0041110 | Ga0500577_0041110_774_1484 | 224 |
| 94 | 3300053161 | Ga0500634_0140001 | Ga0500634_0140001_124_834 | 224 |
| 95 | 3300053178 | Ga0500637_0152982 | Ga0500637_0152982_55_765 | 224 |
| 96 | iso_pu_bacteria | 2507262055 | 2507508647 | 224 |
| 97 | iso_pu_bacteria | 2508501009 | 2508542742 | 224 |
| 98 | iso_pu_bacteria | 2508501042 | 2508691499 | 224 |
| 99 | iso_pu_bacteria | 2511231028 | 2511397779 | 224 |
| 100 | iso_pu_bacteria | 2513237092 | 2513623097 | 224 |
| 101 | iso_pu_bacteria | 2513237095 | 2513645902 | 224 |
| 102 | iso_pu_bacteria | 2513237096 | 2513654689 | 224 |
| 103 | iso_pu_bacteria | 2513237102 | 2513705210 | 224 |
| 104 | iso_pu_bacteria | 2513237104 | 2513719509 | 224 |
| 105 | iso_pu_bacteria | 2513237137 | 2513855900 | 224 |
| 106 | iso_pu_bacteria | 2513237139 | 2513872709 | 224 |
| 107 | iso_pu_bacteria | 2513237145 | 2513915131 | 224 |
| 108 | iso_pu_bacteria | 2513237161 | 2514011914 | 224 |
| 109 | iso_pu_bacteria | 2515154112 | 2515628301 | 224 |
| 110 | iso_pu_bacteria | 2517572143 | 2517892426 | 224 |
| 111 | iso_pu_bacteria | 2524023210 | 2524471038 | 224 |
| 112 | iso_pu_bacteria | 2528768022 | 2528851154 | 224 |
| 113 | iso_pu_bacteria | 2617270735 | 2617348954 | 224 |
| 114 | iso_pu_bacteria | 2617270741 | 2617375829 | 224 |
| 115 | iso_pu_bacteria | 2744054633 | 2745074955 | 224 |
| 116 | iso_pu_bacteria | 2791355196 | 2793062457 | 224 |
| 117 | iso_pu_bacteria | 2791355197 | 2793072093 | 224 |
| 118 | iso_pu_bacteria | 2802429603 | 2805915393 | 224 |
| 119 | iso_pu_bacteria | 2816332527 | 2818238970 | 224 |
| 120 | iso_pu_bacteria | 2824609381 | 2824617775 | 224 |
| 121 | iso_pu_bacteria | 2824617872 | 2824626207 | 224 |
| 122 | iso_pu_bacteria | 2824626560 | 2824634894 | 224 |
| 123 | iso_pu_bacteria | 2824635225 | 2824643179 | 224 |
| 124 | iso_pu_bacteria | 2824644064 | 2824651362 | 224 |
| 125 | iso_pu_bacteria | 2824671348 | 2824679407 | 224 |
| 126 | iso_pu_bacteria | 2824679649 | 2824687767 | 224 |
| 127 | iso_pu_bacteria | 2824687955 | 2824696055 | 224 |
| 128 | iso_pu_bacteria | 2824696289 | 2824701014 | 224 |
| 129 | iso_pu_bacteria | 2824714736 | 2824719511 | 224 |
| 130 | iso_pu_bacteria | 2824723954 | 2824729931 | 224 |
| 131 | iso_pu_bacteria | 2824732956 | 2824740730 | 224 |
| 132 | iso_pu_bacteria | 2824746037 | 2824753790 | 224 |
| 133 | iso_pu_bacteria | 2824773399 | 2824781345 | 224 |
| 134 | iso_pu_bacteria | 2828305725 | 2828309882 | 224 |
| 135 | iso_pu_bacteria | 2838122688 | 2838123814 | 224 |
| 136 | iso_pu_bacteria | 2841941048 | 2841944057 | 224 |
| 137 | iso_pu_bacteria | 2841949485 | 2841949914 | 224 |
| 138 | iso_pu_bacteria | 2841966195 | 2841966332 | 224 |
| 139 | iso_pu_bacteria | 2841974524 | 2841975066 | 224 |
| 140 | iso_pu_bacteria | 2841983080 | 2841983362 | 224 |
| 141 | iso_pu_bacteria | 2842038055 | 2842039125 | 224 |
| 142 | iso_pu_bacteria | 2842045827 | 2842047928 | 224 |
| 143 | iso_pu_bacteria | 2847939898 | 2847946505 | 224 |
| 144 | iso_pu_bacteria | 2849076700 | 2849079369 | 224 |
| 145 | iso_pu_bacteria | 2851182111 | 2851184694 | 224 |
| 146 | iso_pu_bacteria | 2852387548 | 2852394213 | 224 |
| 147 | iso_pu_bacteria | 2857509624 | 2857514372 | 224 |
| 148 | iso_pu_bacteria | 2874590934 | 2874591547 | 224 |
| 149 | iso_pu_bacteria | 2874604998 | 2874605145 | 224 |
| 150 | iso_pu_bacteria | 2874612657 | 2874619588 | 224 |
| 151 | iso_pu_bacteria | 2874620515 | 2874627158 | 224 |
| 152 | iso_pu_bacteria | 2874628541 | 2874631790 | 224 |
| 153 | iso_pu_bacteria | 2874645413 | 2874648935 | 224 |
| 154 | iso_pu_bacteria | 2876771140 | 2876771962 | 224 |
| 155 | iso_pu_bacteria | 2876818435 | 2876822093 | 224 |
| 156 | iso_pu_bacteria | 2879074833 | 2879075606 | 224 |
| 157 | iso_pu_bacteria | 2879127579 | 2879135486 | 224 |
| 158 | iso_pu_bacteria | 2879142872 | 2879143095 | 224 |
| 159 | iso_pu_bacteria | 2881364244 | 2881366994 | 224 |
| 160 | iso_pu_bacteria | 2881665667 | 2881671117 | 224 |
| 161 | iso_pu_bacteria | 2885366525 | 2885370528 | 224 |
| 162 | iso_pu_bacteria | 2885383462 | 2885390705 | 224 |
| 163 | iso_pu_bacteria | 2888378607 | 2888384003 | 224 |
| 164 | iso_pu_bacteria | 2888388044 | 2888393852 | 224 |
| 165 | iso_pu_bacteria | 2903748898 | 2903749462 | 224 |
| 166 | iso_pu_bacteria | 2903768456 | 2903777971 | 224 |
| 167 | iso_pu_bacteria | 2904666416 | 2904669859 | 224 |
| 168 | iso_pu_bacteria | 2906610324 | 2906618589 | 224 |
| 169 | iso_pu_bacteria | 2906626472 | 2906628612 | 224 |
| 170 | iso_pu_bacteria | 2906635258 | 2906638754 | 224 |
| 171 | iso_pu_bacteria | 2906660503 | 2906666411 | 224 |
| 172 | iso_pu_bacteria | 2908775508 | 2908780115 | 224 |
| 173 | iso_pu_bacteria | 2922393267 | 2922396368 | 224 |
| 174 | iso_pu_bacteria | 2922425934 | 2922430248 | 224 |
| 175 | iso_pu_bacteria | 2929615660 | 2929618000 | 224 |
| 176 | iso_pu_bacteria | 2929624759 | 2929627681 | 224 |
| 177 | iso_pu_bacteria | 2932784394 | 2932788220 | 224 |
| 178 | iso_pu_bacteria | 2932794094 | 2932797531 | 224 |
| 179 | iso_pu_bacteria | 2932801729 | 2932802846 | 224 |
| 180 | iso_pu_bacteria | 2932828146 | 2932831217 | 224 |
| 181 | iso_pu_bacteria | 2933577622 | 2933579928 | 224 |
| 182 | iso_pu_bacteria | 2935608549 | 2935608823 | 224 |
| 183 | iso_pu_bacteria | 2935616580 | 2935622987 | 224 |
| 184 | iso_pu_bacteria | 2935630451 | 2935631694 | 224 |
| 185 | iso_pu_bacteria | 2935694250 | 2935701016 | 224 |
| 186 | iso_pu_bacteria | 2935769743 | 2935773237 | 224 |
| 187 | iso_pu_bacteria | 2935777560 | 2935778483 | 224 |
| 188 | iso_pu_bacteria | 2935785616 | 2935790398 | 224 |
| 189 | iso_pu_bacteria | 2935793552 | 2935798127 | 224 |
| 190 | iso_pu_bacteria | 2935801545 | 2935803205 | 224 |
| 191 | iso_pu_bacteria | 2935819856 | 2935821983 | 224 |
| 192 | iso_pu_bacteria | 2935837841 | 2935838517 | 224 |
| 193 | iso_pu_bacteria | 2935847175 | 2935847565 | 224 |
| 194 | iso_pu_bacteria | 2935855204 | 2935861235 | 224 |
| 195 | iso_pu_bacteria | 2935864058 | 2935865773 | 224 |
| 196 | iso_pu_bacteria | 2935873716 | 2935878274 | 224 |
| 197 | iso_pu_bacteria | 2935883170 | 2935885188 | 224 |
| 198 | iso_pu_bacteria | 2935908558 | 2935909168 | 224 |
| 199 | iso_pu_bacteria | 2935916978 | 2935919889 | 224 |
| 200 | iso_pu_bacteria | 2935926038 | 2935926258 | 224 |
| 201 | iso_pu_bacteria | 2935934488 | 2935934708 | 224 |
| 202 | iso_pu_bacteria | 2935942939 | 2935943158 | 224 |
| 203 | iso_pu_bacteria | 2935951376 | 2935951596 | 224 |
| 204 | iso_pu_bacteria | 2935959822 | 2935966428 | 224 |
| 205 | iso_pu_bacteria | 2935967501 | 2935967721 | 224 |
| 206 | iso_pu_bacteria | 2935975950 | 2935977079 | 224 |
| 207 | iso_pu_bacteria | 2935984226 | 2935988233 | 224 |
| 208 | iso_pu_bacteria | 2935992306 | 2935994587 | 224 |
| 209 | iso_pu_bacteria | 2941507105 | 2941511488 | 224 |
| 210 | iso_pu_bacteria | 2941515067 | 2941519189 | 224 |
| 211 | iso_pu_bacteria | 2941523033 | 2941526231 | 224 |
| 212 | iso_pu_bacteria | 2941538514 | 2941538815 | 224 |
| 213 | iso_pu_bacteria | 3005483717 | 3005487283 | 224 |
| 214 | iso_pu_bacteria | 3005506211 | 3005510277 | 224 |
| 215 | iso_pu_bacteria | 3005587118 | 3005591071 | 224 |
| 216 | iso_pu_bacteria | 3005710791 | 3005714847 | 224 |
| 217 | iso_pu_bacteria | 3005718088 | 3005722275 | 224 |
| 218 | iso_pu_bacteria | 8006926726 | 8006929950 | 224 |
| 219 | iso_pu_bacteria | 8016511872 | 8016522404 | 224 |
| 220 | iso_pu_bacteria | 8016530956 | 8016534888 | 224 |
| 221 | iso_pu_bacteria | 8016539877 | 8016548099 | 224 |
| 222 | iso_pu_bacteria | 8016548790 | 8016554028 | 224 |
| 223 | iso_pu_bacteria | 8016557553 | 8016562402 | 224 |
| 224 | iso_pu_bacteria | 8016566248 | 8016573233 | 224 |
| 225 | iso_pu_bacteria | 8016575299 | 8016577377 | 224 |
| 226 | iso_pu_bacteria | 8016595262 | 8016600202 | 224 |
| 227 | iso_pu_bacteria | 8016603502 | 8016610550 | 224 |
| 228 | iso_pu_bacteria | 8016622563 | 8016626607 | 224 |
| 229 | iso_pu_bacteria | 8017057580 | 8017063156 | 224 |
| 230 | iso_pu_bacteria | 8019530166 | 8019534648 | 224 |
| 231 | iso_pu_bacteria | 8019538911 | 8019544823 | 224 |
| 232 | iso_pu_bacteria | 8019547302 | 8019553714 | 224 |
| 233 | iso_pu_bacteria | 8019555841 | 8019556789 | 224 |
| 234 | iso_pu_bacteria | 8019565922 | 8019568518 | 224 |
| 235 | iso_pu_bacteria | 8019576017 | 8019582590 | 224 |
| 236 | iso_pu_bacteria | 8019597564 | 8019600973 | 224 |
| 237 | iso_pu_bacteria | 8019608314 | 8019617580 | 224 |
| 238 | iso_pu_bacteria | 8019619141 | 8019628076 | 224 |
| 239 | iso_pu_bacteria | 8019638758 | 8019645196 | 224 |
| 240 | iso_pu_bacteria | 8019659431 | 8019662424 | 224 |
| 241 | iso_pu_bacteria | 8019668869 | 8019671922 | 224 |
| 242 | iso_pu_bacteria | 8019678201 | 8019684170 | 224 |
| 243 | iso_pu_bacteria | 8019687851 | 8019690010 | 224 |
| 244 | iso_pu_bacteria | 8054002106 | 8054007361 | 224 |
| 245 | iso_pu_bacteria | 8055742211 | 8055746411 | 224 |
| 246 | iso_pu_bacteria | 8056681323 | 8056686638 | 224 |
| 247 | iso_pu_bacteria | 8056689827 | 8056693570 | 224 |
| 248 | iso_pu_bacteria | 8057575449 | 8057579655 | 224 |
| 249 | 3300003215 | JGI25153J46596_10001920 | JGI25153J46596_100019208 | 225 |
| 250 | 3300003215 | JGI25153J46596_10002312 | JGI25153J46596_100023129 | 225 |
| 251 | 3300003215 | JGI25153J46596_10017224 | JGI25153J46596_100172243 | 225 |
| 252 | 3300003354 | JGI25160J50197_1000631 | JGI25160J50197_100063119 | 225 |
| 253 | 3300003354 | JGI25160J50197_1011095 | JGI25160J50197_10110954 | 225 |
| 254 | 3300004625 | Ga0055543_1001288 | Ga0055543_10012887 | 225 |
| 255 | 3300005262 | Ga0065165_1000844 | Ga0065165_100084411 | 225 |
| 256 | 3300005262 | Ga0065165_1002117 | Ga0065165_100211712 | 225 |
| 257 | 3300005262 | Ga0065165_1034331 | Ga0065165_10343311 | 225 |
| 258 | 3300005331 | Ga0070670_100857974 | Ga0070670_1008579741 | 225 |
| 259 | 3300005336 | Ga0070680_100246414 | Ga0070680_1002464141 | 225 |
| 260 | 3300005337 | Ga0070682_100080180 | Ga0070682_1000801802 | 225 |
| 261 | 3300005337 | Ga0070682_100185509 | Ga0070682_1001855092 | 225 |
| 262 | 3300005355 | Ga0070671_100081966 | Ga0070671_1000819662 | 225 |
| 263 | 3300005367 | Ga0070667_100328787 | Ga0070667_1003287871 | 225 |
| 264 | 3300005436 | Ga0070713_100040544 | Ga0070713_1000405443 | 225 |
| 265 | 3300005436 | Ga0070713_100113099 | Ga0070713_1001130992 | 225 |
| 266 | 3300005439 | Ga0070711_100145658 | Ga0070711_1001456583 | 225 |
| 267 | 3300005455 | Ga0070663_100012305 | Ga0070663_1000123052 | 225 |
| 268 | 3300005456 | Ga0070678_100304889 | Ga0070678_1003048891 | 225 |
| 269 | 3300005456 | Ga0070678_100377632 | Ga0070678_1003776322 | 225 |
| 270 | 3300005457 | Ga0070662_100493385 | Ga0070662_1004933852 | 225 |
| 271 | 3300005458 | Ga0070681_10099623 | Ga0070681_100996232 | 225 |
| 272 | 3300005530 | Ga0070679_100025804 | Ga0070679_1000258042 | 225 |
| 273 | 3300005539 | Ga0068853_100625265 | Ga0068853_1006252651 | 225 |
| 274 | 3300005539 | Ga0068853_100882191 | Ga0068853_1008821911 | 225 |
| 275 | 3300005544 | Ga0070686_100421597 | Ga0070686_1004215971 | 225 |
| 276 | 3300005548 | Ga0070665_100078115 | Ga0070665_1000781151 | 225 |
| 277 | 3300005548 | Ga0070665_100555181 | Ga0070665_1005551812 | 225 |
| 278 | 3300005563 | Ga0068855_100047191 | Ga0068855_1000471911 | 225 |
| 279 | 3300005563 | Ga0068855_100118158 | Ga0068855_1001181583 | 225 |
| 280 | 3300005564 | Ga0070664_100861488 | Ga0070664_1008614881 | 225 |
| 281 | 3300005614 | Ga0068856_100133911 | Ga0068856_1001339112 | 225 |
| 282 | 3300005614 | Ga0068856_100182705 | Ga0068856_1001827053 | 225 |
| 283 | 3300005614 | Ga0068856_100543575 | Ga0068856_1005435752 | 225 |
| 284 | 3300005614 | Ga0068856_100724889 | Ga0068856_1007248892 | 225 |
| 285 | 3300005616 | Ga0068852_100260990 | Ga0068852_1002609902 | 225 |
| 286 | 3300005616 | Ga0068852_100379436 | Ga0068852_1003794361 | 225 |
| 287 | 3300005616 | Ga0068852_100943691 | Ga0068852_1009436911 | 225 |
| 288 | 3300005617 | Ga0068859_100833652 | Ga0068859_1008336521 | 225 |
| 289 | 3300005840 | Ga0068870_10298658 | Ga0068870_102986581 | 225 |
| 290 | 3300005842 | Ga0068858_100362299 | Ga0068858_1003622991 | 225 |
| 291 | 3300005843 | Ga0068860_100518562 | Ga0068860_1005185621 | 225 |
| 292 | 3300005937 | Ga0081455_10017212 | Ga0081455_100172128 | 225 |
| 293 | 3300005983 | Ga0081540_1003394 | Ga0081540_10033946 | 225 |
| 294 | 3300005983 | Ga0081540_1021640 | Ga0081540_10216402 | 225 |
| 295 | 3300005983 | Ga0081540_1025247 | Ga0081540_10252473 | 225 |
| 296 | 3300005985 | Ga0081539_10021340 | Ga0081539_100213402 | 225 |
| 297 | 3300006028 | Ga0070717_10001195 | Ga0070717_1000119514 | 225 |
| 298 | 3300006038 | Ga0075365_10094748 | Ga0075365_100947482 | 225 |
| 299 | 3300006038 | Ga0075365_10179316 | Ga0075365_101793162 | 225 |
| 300 | 3300006038 | Ga0075365_10524505 | Ga0075365_105245051 | 225 |
| 301 | 3300006042 | Ga0075368_10000684 | Ga0075368_100006844 | 225 |
| 302 | 3300006048 | Ga0075363_100027730 | Ga0075363_1000277303 | 225 |
| 303 | 3300006048 | Ga0075363_100367304 | Ga0075363_1003673041 | 225 |
| 304 | 3300006051 | Ga0075364_10028098 | Ga0075364_100280984 | 225 |
| 305 | 3300006177 | Ga0075362_10100664 | Ga0075362_101006642 | 225 |
| 306 | 3300006186 | Ga0075369_10013223 | Ga0075369_100132233 | 225 |
| 307 | 3300006195 | Ga0075366_10006129 | Ga0075366_100061293 | 225 |
| 308 | 3300006195 | Ga0075366_10056251 | Ga0075366_100562513 | 225 |
| 309 | 3300006353 | Ga0075370_10013795 | Ga0075370_100137953 | 225 |
| 310 | 3300006931 | Ga0097620_100833682 | Ga0097620_1008336821 | 225 |
| 311 | 3300006942 | Ga0099824_1006510 | Ga0099824_10065108 | 225 |
| 312 | 3300009093 | Ga0105240_10305136 | Ga0105240_103051362 | 225 |
| 313 | 3300009093 | Ga0105240_10314687 | Ga0105240_103146872 | 225 |
| 314 | 3300009148 | Ga0105243_10146926 | Ga0105243_101469263 | 225 |
| 315 | 3300009174 | Ga0105241_10270136 | Ga0105241_102701362 | 225 |
| 316 | 3300009177 | Ga0105248_10004990 | Ga0105248_100049908 | 225 |
| 317 | 3300009177 | Ga0105248_10201894 | Ga0105248_102018943 | 225 |
| 318 | 3300009545 | Ga0105237_10375557 | Ga0105237_103755572 | 225 |
| 319 | 3300009551 | Ga0105238_10094882 | Ga0105238_100948822 | 225 |
| 320 | 3300010375 | Ga0105239_10189322 | Ga0105239_101893222 | 225 |
| 321 | 3300010375 | Ga0105239_10696974 | Ga0105239_106969742 | 225 |
| 322 | 3300010375 | Ga0105239_10858460 | Ga0105239_108584601 | 225 |
| 323 | 3300011119 | Ga0105246_10031542 | Ga0105246_100315421 | 225 |
| 324 | 3300013102 | Ga0157371_10034937 | Ga0157371_100349373 | 225 |
| 325 | 3300013104 | Ga0157370_10007389 | Ga0157370_100073892 | 225 |
| 326 | 3300013296 | Ga0157374_10406121 | Ga0157374_104061211 | 225 |
| 327 | 3300013297 | Ga0157378_10016616 | Ga0157378_100166164 | 225 |
| 328 | 3300013297 | Ga0157378_10303285 | Ga0157378_103032851 | 225 |
| 329 | 3300013306 | Ga0163162_10094634 | Ga0163162_100946343 | 225 |
| 330 | 3300013308 | Ga0157375_10280668 | Ga0157375_102806682 | 225 |
| 331 | 3300014325 | Ga0163163_10027245 | Ga0163163_100272452 | 225 |
| 332 | 3300014325 | Ga0163163_10048691 | Ga0163163_100486914 | 225 |
| 333 | 3300015261 | Ga0182006_1096908 | Ga0182006_10969081 | 225 |
| 334 | 3300021321 | Ga0214542_1000001 | Ga0214542_1000001841 | 225 |
| 335 | 3300021324 | Ga0214545_1000001 | Ga0214545_1000001907 | 225 |
| 336 | 3300021327 | Ga0214543_1000001 | Ga0214543_1000001287 | 225 |
| 337 | 3300025230 | Ga0209563_116775 | Ga0209563_1167752 | 225 |
| 338 | 3300025253 | Ga0209677_102871 | Ga0209677_1028712 | 225 |
| 339 | 3300025261 | Ga0209233_1014518 | Ga0209233_10145182 | 225 |
| 340 | 3300025273 | Ga0209673_1056165 | Ga0209673_10561651 | 225 |
| 341 | 3300025295 | Ga0209564_1002211 | Ga0209564_10022118 | 225 |
| 342 | 3300025297 | Ga0209758_1000021 | Ga0209758_1000021651 | 225 |
| 343 | 3300025297 | Ga0209758_1001025 | Ga0209758_10010257 | 225 |
| 344 | 3300025297 | Ga0209758_1001133 | Ga0209758_10011339 | 225 |
| 345 | 3300025297 | Ga0209758_1011526 | Ga0209758_10115264 | 225 |
| 346 | 3300025297 | Ga0209758_1056350 | Ga0209758_10563501 | 225 |
| 347 | 3300025297 | Ga0209758_1103550 | Ga0209758_11035501 | 225 |
| 348 | 3300025299 | Ga0209256_1007103 | Ga0209256_10071034 | 225 |
| 349 | 3300025299 | Ga0209256_1053793 | Ga0209256_10537931 | 225 |
| 350 | 3300025302 | Ga0207426_1000479 | Ga0207426_100047915 | 225 |
| 351 | 3300025302 | Ga0207426_1000599 | Ga0207426_100059930 | 225 |
| 352 | 3300025302 | Ga0207426_1042331 | Ga0207426_10423311 | 225 |
| 353 | 3300025315 | Ga0207697_10034517 | Ga0207697_100345173 | 225 |
| 354 | 3300025900 | Ga0207710_10140396 | Ga0207710_101403961 | 225 |
| 355 | 3300025901 | Ga0207688_10034076 | Ga0207688_100340761 | 225 |
| 356 | 3300025903 | Ga0207680_10145430 | Ga0207680_101454302 | 225 |
| 357 | 3300025903 | Ga0207680_10319547 | Ga0207680_103195471 | 225 |
| 358 | 3300025912 | Ga0207707_10314629 | Ga0207707_103146292 | 225 |
| 359 | 3300025913 | Ga0207695_10117455 | Ga0207695_101174551 | 225 |
| 360 | 3300025913 | Ga0207695_10150334 | Ga0207695_101503341 | 225 |
| 361 | 3300025914 | Ga0207671_10407514 | Ga0207671_104075142 | 225 |
| 362 | 3300025915 | Ga0207693_10159435 | Ga0207693_101594351 | 225 |
| 363 | 3300025916 | Ga0207663_10437369 | Ga0207663_104373691 | 225 |
| 364 | 3300025917 | Ga0207660_10174352 | Ga0207660_101743521 | 225 |
| 365 | 3300025919 | Ga0207657_10081542 | Ga0207657_100815422 | 225 |
| 366 | 3300025923 | Ga0207681_10524860 | Ga0207681_105248601 | 225 |
| 367 | 3300025924 | Ga0207694_10159698 | Ga0207694_101596982 | 225 |
| 368 | 3300025925 | Ga0207650_10039723 | Ga0207650_100397235 | 225 |
| 369 | 3300025925 | Ga0207650_10687629 | Ga0207650_106876291 | 225 |
| 370 | 3300025928 | Ga0207700_10022160 | Ga0207700_100221602 | 225 |
| 371 | 3300025928 | Ga0207700_10052321 | Ga0207700_100523212 | 225 |
| 372 | 3300025931 | Ga0207644_10275592 | Ga0207644_102755922 | 225 |
| 373 | 3300025933 | Ga0207706_10331773 | Ga0207706_103317732 | 225 |
| 374 | 3300025935 | Ga0207709_10248879 | Ga0207709_102488791 | 225 |
| 375 | 3300025941 | Ga0207711_10150513 | Ga0207711_101505132 | 225 |
| 376 | 3300025941 | Ga0207711_10608139 | Ga0207711_106081391 | 225 |
| 377 | 3300025949 | Ga0207667_10265170 | Ga0207667_102651701 | 225 |
| 378 | 3300025981 | Ga0207640_10194183 | Ga0207640_101941831 | 225 |
| 379 | 3300026041 | Ga0207639_10140392 | Ga0207639_101403922 | 225 |
| 380 | 3300026041 | Ga0207639_10276002 | Ga0207639_102760022 | 225 |
| 381 | 3300026075 | Ga0207708_10197022 | Ga0207708_101970221 | 225 |
| 382 | 3300026078 | Ga0207702_10031931 | Ga0207702_100319313 | 225 |
| 383 | 3300026078 | Ga0207702_10267484 | Ga0207702_102674842 | 225 |
| 384 | 3300026078 | Ga0207702_10431405 | Ga0207702_104314051 | 225 |
| 385 | 3300026118 | Ga0207675_100161084 | Ga0207675_1001610841 | 225 |
| 386 | 3300026142 | Ga0207698_10554133 | Ga0207698_105541331 | 225 |
| 387 | 3300027296 | Ga0209389_1000121 | Ga0209389_100012118 | 225 |
| 388 | 3300027357 | Ga0209589_1002338 | Ga0209589_10023389 | 225 |
| 389 | 3300027361 | Ga0209489_101475 | Ga0209489_10147533 | 225 |
| 390 | 3300027512 | Ga0209179_1000593 | Ga0209179_10005932 | 225 |
| 391 | 3300027866 | Ga0209813_10036440 | Ga0209813_100364402 | 225 |
| 392 | 3300028379 | Ga0268266_10001098 | Ga0268266_1000109824 | 225 |
| 393 | 3300028379 | Ga0268266_10143932 | Ga0268266_101439321 | 225 |
| 394 | 3300028381 | Ga0268264_10524043 | Ga0268264_105240431 | 225 |
| 395 | 3300031247 | Ga0265340_10036789 | Ga0265340_100367892 | 225 |
| 396 | 3300031616 | Ga0307508_10000010 | Ga0307508_1000001059 | 225 |
| 397 | 3300031730 | Ga0307516_10042681 | Ga0307516_100426814 | 225 |
| 398 | 3300032005 | Ga0307411_10333882 | Ga0307411_103338821 | 225 |
| 399 | 3300033180 | Ga0307510_10004213 | Ga0307510_100042139 | 225 |
| 400 | 3300033180 | Ga0307510_10392259 | Ga0307510_103922591 | 225 |
| 401 | 3300033442 | Ga0315911_1000001 | Ga0315911_1000001183 | 225 |
| 402 | 3300035086 | Ga0373934_0085641 | Ga0373934_0085641_290_976 | 225 |
| 403 | 3300035111 | Ga0373923_0045006 | Ga0373923_0045006_148_834 | 225 |
| 404 | 3300035112 | Ga0373932_0077068 | Ga0373932_0077068_343_1032 | 225 |
| 405 | 3300035113 | Ga0373936_0005311 | Ga0373936_0005311_2910_3596 | 225 |
| 406 | 3300035118 | Ga0373954_0008335 | Ga0373954_0008335_920_1606 | 225 |
| 407 | 3300035118 | Ga0373954_0067608 | Ga0373954_0067608_440_1126 | 225 |
| 408 | 3300035170 | Ga0373943_0004918 | Ga0373943_0004918_4670_5356 | 225 |
| 409 | 3300035172 | Ga0373955_0039717 | Ga0373955_0039717_741_1427 | 225 |
| 410 | 3300035172 | Ga0373955_0090334 | Ga0373955_0090334_766_1452 | 225 |
| 411 | 3300035410 | Ga0373924_0027064 | Ga0373924_0027064_300_986 | 225 |
| 412 | 3300035695 | Ga0373927_0306964 | Ga0373927_0306964_195_881 | 225 |
| 413 | 3300035695 | Ga0373927_0327863 | Ga0373927_0327863_22_708 | 225 |
| 414 | 3300035724 | Ga0373933_0001930 | Ga0373933_0001930_8707_9405 | 225 |
| 415 | 3300035724 | Ga0373933_0054487 | Ga0373933_0054487_1136_1822 | 225 |
| 416 | 3300036401 | Ga0373937_0127645 | Ga0373937_0127645_825_1511 | 225 |
| 417 | 3300037466 | Ga0395898_0677965 | Ga0395898_0677965_276_962 | 225 |
| 418 | 3300037471 | Ga0395905_0007051 | Ga0395905_0007051_6836_7522 | 225 |
| 419 | 3300037471 | Ga0395905_0250301 | Ga0395905_0250301_423_1109 | 225 |
| 420 | 3300038443 | Ga0395901_0129842 | Ga0395901_0129842_1511_2197 | 225 |
| 421 | 3300041460 | Ga0451802_0675589 | Ga0451802_0675589_384_1070 | 225 |
| 422 | 3300041512 | Ga0451853_3503921 | Ga0451853_3503921_338_1024 | 225 |
| 423 | 3300041512 | Ga0451853_3945261 | Ga0451853_3945261_104_790 | 225 |
| 424 | 3300044658 | Ga0466972_0054449 | Ga0466972_0054449_255_941 | 225 |
| 425 | 3300044683 | Ga0466965_0009353 | Ga0466965_0009353_1637_2323 | 225 |
| 426 | 3300044706 | Ga0466964_0054250 | Ga0466964_0054250_412_1113 | 225 |
| 427 | 3300044719 | Ga0466971_0043439 | Ga0466971_0043439_827_1513 | 225 |
| 428 | 3300044901 | Ga0466960_0095929 | Ga0466960_0095929_128_814 | 225 |
| 429 | 3300045976 | Ga0466967_0129258 | Ga0466967_0129258_1439_2125 | 225 |
| 430 | 3300046454 | Ga0495592_0073199 | Ga0495592_0073199_567_1253 | 225 |
| 431 | 3300046454 | Ga0495592_0095701 | Ga0495592_0095701_1245_1931 | 225 |
| 432 | 3300046455 | Ga0495603_0000729 | Ga0495603_0000729_11697_12383 | 225 |
| 433 | 3300046459 | Ga0495629_0001683 | Ga0495629_0001683_10374_11060 | 225 |
| 434 | 3300046459 | Ga0495629_0003206 | Ga0495629_0003206_2448_3134 | 225 |
| 435 | 3300046460 | Ga0495638_0012724 | Ga0495638_0012724_921_1622 | 225 |
| 436 | 3300046461 | Ga0495641_0010184 | Ga0495641_0010184_4653_5339 | 225 |
| 437 | 3300046462 | Ga0495651_0013636 | Ga0495651_0013636_2250_2936 | 225 |
| 438 | 3300046463 | Ga0495653_0181243 | Ga0495653_0181243_149_835 | 225 |
| 439 | 3300046463 | Ga0495653_0192112 | Ga0495653_0192112_152_838 | 225 |
| 440 | 3300046472 | Ga0495580_0001179 | Ga0495580_0001179_5907_6593 | 225 |
| 441 | 3300046475 | Ga0495639_0000381 | Ga0495639_0000381_14341_15027 | 225 |
| 442 | 3300046476 | Ga0495662_0001877 | Ga0495662_0001877_9258_9944 | 225 |
| 443 | 3300046477 | Ga0495664_0008790 | Ga0495664_0008790_3752_4438 | 225 |
| 444 | 3300046499 | Ga0495594_0004862 | Ga0495594_0004862_5848_6534 | 225 |
| 445 | 3300046506 | Ga0495583_0089310 | Ga0495583_0089310_140_826 | 225 |
| 446 | 3300046507 | Ga0495606_0011059 | Ga0495606_0011059_5348_6034 | 225 |
| 447 | 3300046512 | Ga0495610_0139898 | Ga0495610_0139898_301_1002 | 225 |
| 448 | 3300046513 | Ga0495616_0169145 | Ga0495616_0169145_200_886 | 225 |
| 449 | 3300046514 | Ga0495618_0059713 | Ga0495618_0059713_388_1074 | 225 |
| 450 | 3300046515 | Ga0495620_0139887 | Ga0495620_0139887_127_813 | 225 |
| 451 | 3300046516 | Ga0495628_0082675 | Ga0495628_0082675_400_1086 | 225 |
| 452 | 3300046517 | Ga0495630_0040192 | Ga0495630_0040192_194_880 | 225 |
| 453 | 3300046522 | Ga0495643_0010985 | Ga0495643_0010985_1133_1819 | 225 |
| 454 | 3300046528 | Ga0495642_0046160 | Ga0495642_0046160_282_986 | 225 |
| 455 | 3300046529 | Ga0495652_0143134 | Ga0495652_0143134_806_1492 | 225 |
| 456 | 3300046529 | Ga0495652_0297688 | Ga0495652_0297688_117_803 | 225 |
| 457 | 3300046531 | Ga0495665_0001300 | Ga0495665_0001300_7672_8358 | 225 |
| 458 | 3300046535 | Ga0495586_0353052 | Ga0495586_0353052_38_724 | 225 |
| 459 | 3300046536 | Ga0495587_0003875 | Ga0495587_0003875_1679_2365 | 225 |
| 460 | 3300046543 | Ga0495645_0249765 | Ga0495645_0249765_157_843 | 225 |
| 461 | 3300046557 | Ga0495622_0000825 | Ga0495622_0000825_2134_2820 | 225 |
| 462 | 3300046558 | Ga0495633_0053666 | Ga0495633_0053666_425_1111 | 225 |
| 463 | 3300046559 | Ga0495667_0016472 | Ga0495667_0016472_1367_2053 | 225 |
| 464 | 3300046559 | Ga0495667_0068796 | Ga0495667_0068796_162_848 | 225 |
| 465 | 3300046616 | Ga0495668_0015342 | Ga0495668_0015342_963_1649 | 225 |
| 466 | 3300046616 | Ga0495668_0258780 | Ga0495668_0258780_215_916 | 225 |
| 467 | 3300046642 | Ga0495634_0000324 | Ga0495634_0000324_32362_33048 | 225 |
| 468 | 3300046642 | Ga0495634_0234319 | Ga0495634_0234319_432_1118 | 225 |
| 469 | 3300046660 | Ga0495625_0101657 | Ga0495625_0101657_27_713 | 225 |
| 470 | 3300046663 | Ga0495635_0005678 | Ga0495635_0005678_7006_7692 | 225 |
| 471 | 3300046675 | Ga0495657_0081716 | Ga0495657_0081716_998_1684 | 225 |
| 472 | 3300046678 | Ga0495599_0167112 | Ga0495599_0167112_647_1333 | 225 |
| 473 | 3300046679 | Ga0495623_0078500 | Ga0495623_0078500_778_1464 | 225 |
| 474 | 3300046680 | Ga0495646_0056473 | Ga0495646_0056473_1646_2332 | 225 |
| 475 | 3300046680 | Ga0495646_0124489 | Ga0495646_0124489_725_1411 | 225 |
| 476 | 3300046681 | Ga0495647_0001889 | Ga0495647_0001889_5706_6392 | 225 |
| 477 | 3300046683 | Ga0495658_0001003 | Ga0495658_0001003_1223_1909 | 225 |
| 478 | 3300046689 | Ga0495613_0004628 | Ga0495613_0004628_132_818 | 225 |
| 479 | 3300046689 | Ga0495613_0063204 | Ga0495613_0063204_1468_2154 | 225 |
| 480 | 3300046689 | Ga0495613_0337798 | Ga0495613_0337798_29_715 | 225 |
| 481 | 3300046690 | Ga0495624_0049143 | Ga0495624_0049143_57_743 | 225 |
| 482 | 3300046694 | Ga0495649_0091495 | Ga0495649_0091495_559_1245 | 225 |
| 483 | 3300046809 | Ga0495600_0092491 | Ga0495600_0092491_558_1244 | 225 |
| 484 | 3300046809 | Ga0495600_0097504 | Ga0495600_0097504_510_1196 | 225 |
| 485 | 3300047315 | Ga0495581_0000160 | Ga0495581_0000160_14335_15021 | 225 |
| 486 | 3300047317 | Ga0495604_0020017 | Ga0495604_0020017_1006_1692 | 225 |
| 487 | 3300047319 | Ga0495674_0008261 | Ga0495674_0008261_6671_7357 | 225 |
| 488 | 3300047319 | Ga0495674_0220141 | Ga0495674_0220141_109_795 | 225 |
| 489 | 3300047321 | Ga0495676_0023467 | Ga0495676_0023467_4221_4907 | 225 |
| 490 | 3300047321 | Ga0495676_0041304 | Ga0495676_0041304_964_1650 | 225 |
| 491 | 3300047323 | Ga0495683_0050687 | Ga0495683_0050687_292_978 | 225 |
| 492 | 3300047443 | Ga0495687_004391 | Ga0495687_004391_8179_8865 | 225 |
| 493 | 3300047444 | Ga0495675_0015095 | Ga0495675_0015095_3178_3864 | 225 |
| 494 | 3300047469 | Ga0495673_0128670 | Ga0495673_0128670_202_888 | 225 |
| 495 | 3300047471 | Ga0495684_0054813 | Ga0495684_0054813_1246_1932 | 225 |
| 496 | 3300047673 | Ga0495593_0000241 | Ga0495593_0000241_13429_14115 | 225 |
| 497 | 3300048088 | Ga0495602_0044100 | Ga0495602_0044100_2931_3617 | 225 |
| 498 | 3300048905 | Ga0496102_0008512 | Ga0496102_0008512_7552_8238 | 225 |
| 499 | 3300048905 | Ga0496102_0545936 | Ga0496102_0545936_157_897 | 225 |
| 500 | 3300048906 | Ga0496103_0194678 | Ga0496103_0194678_293_979 | 225 |
| 501 | 3300048907 | Ga0496104_0071617 | Ga0496104_0071617_1109_1795 | 225 |
| 502 | 3300048908 | Ga0496105_0003937 | Ga0496105_0003937_4948_5634 | 225 |
| 503 | 3300048909 | Ga0496106_0003031 | Ga0496106_0003031_9608_10294 | 225 |
| 504 | 3300048910 | Ga0496107_0617756 | Ga0496107_0617756_71_757 | 225 |
| 505 | 3300048911 | Ga0496108_0034979 | Ga0496108_0034979_176_862 | 225 |
| 506 | 3300048911 | Ga0496108_0701988 | Ga0496108_0701988_71_757 | 225 |
| 507 | 3300048912 | Ga0496109_0021025 | Ga0496109_0021025_1813_2499 | 225 |
| 508 | 3300048912 | Ga0496109_0387729 | Ga0496109_0387729_200_880 | 225 |
| 509 | 3300048912 | Ga0496109_0410729 | Ga0496109_0410729_318_1004 | 225 |
| 510 | 3300048913 | Ga0496110_0127744 | Ga0496110_0127744_222_908 | 225 |
| 511 | 3300048913 | Ga0496110_0142177 | Ga0496110_0142177_886_1575 | 225 |
| 512 | 3300048913 | Ga0496110_0697802 | Ga0496110_0697802_33_719 | 225 |
| 513 | 3300048914 | Ga0496111_0307696 | Ga0496111_0307696_113_799 | 225 |
| 514 | 3300048915 | Ga0496112_0122215 | Ga0496112_0122215_881_1567 | 225 |
| 515 | 3300048915 | Ga0496112_0175130 | Ga0496112_0175130_688_1374 | 225 |
| 516 | 3300048915 | Ga0496112_0659526 | Ga0496112_0659526_69_755 | 225 |
| 517 | 3300048916 | Ga0496113_0073481 | Ga0496113_0073481_386_1072 | 225 |
| 518 | 3300048918 | Ga0496115_0261510 | Ga0496115_0261510_385_1071 | 225 |
| 519 | 3300048919 | Ga0496116_0038168 | Ga0496116_0038168_2170_2856 | 225 |
| 520 | 3300048920 | Ga0496117_0009110 | Ga0496117_0009110_3991_4677 | 225 |
| 521 | 3300048920 | Ga0496117_0083106 | Ga0496117_0083106_956_1642 | 225 |
| 522 | 3300048921 | Ga0496118_0006337 | Ga0496118_0006337_4442_5128 | 225 |
| 523 | 3300048921 | Ga0496118_0070194 | Ga0496118_0070194_1831_2517 | 225 |
| 524 | 3300048922 | Ga0496119_0009371 | Ga0496119_0009371_1267_1953 | 225 |
| 525 | 3300048923 | Ga0496120_0004023 | Ga0496120_0004023_2897_3583 | 225 |
| 526 | 3300048924 | Ga0496121_0000183 | Ga0496121_0000183_132513_133199 | 225 |
| 527 | 3300048924 | Ga0496121_0035667 | Ga0496121_0035667_557_1258 | 225 |
| 528 | 3300048924 | Ga0496121_0091317 | Ga0496121_0091317_1179_1865 | 225 |
| 529 | 3300048925 | Ga0496122_0022521 | Ga0496122_0022521_3206_3892 | 225 |
| 530 | 3300048926 | Ga0496123_0207705 | Ga0496123_0207705_64_750 | 225 |
| 531 | 3300048927 | Ga0496124_0002761 | Ga0496124_0002761_3863_4549 | 225 |
| 532 | 3300048927 | Ga0496124_0129547 | Ga0496124_0129547_1132_1818 | 225 |
| 533 | 3300048927 | Ga0496124_0229989 | Ga0496124_0229989_652_1338 | 225 |
| 534 | 3300048928 | Ga0496125_0042347 | Ga0496125_0042347_2807_3493 | 225 |
| 535 | 3300048929 | Ga0496126_0034207 | Ga0496126_0034207_2415_3101 | 225 |
| 536 | 3300048929 | Ga0496126_0045660 | Ga0496126_0045660_2277_2963 | 225 |
| 537 | 3300048929 | Ga0496126_0071934 | Ga0496126_0071934_1163_1849 | 225 |
| 538 | 3300048929 | Ga0496126_0073342 | Ga0496126_0073342_293_979 | 225 |
| 539 | 3300048929 | Ga0496126_0349317 | Ga0496126_0349317_41_727 | 225 |
| 540 | 3300049460 | Ga0495682_0110191 | Ga0495682_0110191_170_958 | 225 |
| 541 | 3300049568 | Ga0501031_0001053 | Ga0501031_0001053_1839_2525 | 225 |
| 542 | 3300049569 | Ga0501032_0000668 | Ga0501032_0000668_4406_5092 | 225 |
| 543 | 3300049570 | Ga0501033_0000619 | Ga0501033_0000619_12950_13636 | 225 |
| 544 | 3300049571 | Ga0501034_0000232 | Ga0501034_0000232_39833_40519 | 225 |
| 545 | 3300049572 | Ga0501036_0000371 | Ga0501036_0000371_13088_13774 | 225 |
| 546 | 3300049573 | Ga0501037_0000303 | Ga0501037_0000303_20758_21444 | 225 |
| 547 | 3300049574 | Ga0501038_0000112 | Ga0501038_0000112_49767_50453 | 225 |
| 548 | 3300049575 | Ga0501039_0000789 | Ga0501039_0000789_2592_3278 | 225 |
| 549 | 3300049578 | Ga0501042_0021071 | Ga0501042_0021071_2991_3677 | 225 |
| 550 | 3300049579 | Ga0501043_0000035 | Ga0501043_0000035_15637_16323 | 225 |
| 551 | 3300049580 | Ga0501046_0022126 | Ga0501046_0022126_4359_5045 | 225 |
| 552 | 3300049581 | Ga0501047_0000085 | Ga0501047_0000085_28062_28748 | 225 |
| 553 | 3300049581 | Ga0501047_0601769 | Ga0501047_0601769_131_823 | 225 |
| 554 | 3300049582 | Ga0501048_0000061 | Ga0501048_0000061_16628_17314 | 225 |
| 555 | 3300049583 | Ga0501067_0002211 | Ga0501067_0002211_1674_2360 | 225 |
| 556 | 3300049584 | Ga0501068_0004923 | Ga0501068_0004923_70_756 | 225 |
| 557 | 3300049585 | Ga0501069_0021376 | Ga0501069_0021376_2812_3498 | 225 |
| 558 | 3300049586 | Ga0501070_0000272 | Ga0501070_0000272_20205_20891 | 225 |
| 559 | 3300049587 | Ga0501071_0051827 | Ga0501071_0051827_121_807 | 225 |
| 560 | 3300049588 | Ga0501072_0006309 | Ga0501072_0006309_3951_4637 | 225 |
| 561 | 3300049589 | Ga0501073_0000026 | Ga0501073_0000026_31765_32451 | 225 |
| 562 | 3300049590 | Ga0501074_0000017 | Ga0501074_0000017_54420_55106 | 225 |
| 563 | 3300049741 | Ga0501079_0002647 | Ga0501079_0002647_4000_4686 | 225 |
| 564 | 3300049744 | Ga0501083_0000638 | Ga0501083_0000638_787_1473 | 225 |
| 565 | 3300049822 | Ga0501035_0000548 | Ga0501035_0000548_38619_39305 | 225 |
| 566 | 3300049823 | Ga0501044_0000051 | Ga0501044_0000051_9521_10207 | 225 |
| 567 | 3300050490 | nmdc:mga03n38_103522_c1 | nmdc:mga03n38_103522_c1_579_1265 | 225 |
| 568 | 3300050490 | nmdc:mga03n38_180288_c1 | nmdc:mga03n38_180288_c1_245_931 | 225 |
| 569 | 3300050491 | nmdc:mga00v17_296813_c1 | nmdc:mga00v17_296813_c1_64_750 | 225 |
| 570 | 3300050491 | nmdc:mga00v17_63272_c1 | nmdc:mga00v17_63272_c1_1016_1702 | 225 |
| 571 | 3300050492 | nmdc:mga0yw44_398702_c1 | nmdc:mga0yw44_398702_c1_185_886 | 225 |
| 572 | 3300050492 | nmdc:mga0yw44_83360_c1 | nmdc:mga0yw44_83360_c1_115_801 | 225 |
| 573 | 3300050493 | nmdc:mga0k408_239432_c1 | nmdc:mga0k408_239432_c1_275_961 | 225 |
| 574 | 3300050493 | nmdc:mga0k408_9279_c1 | nmdc:mga0k408_9279_c1_4155_4841 | 225 |
| 575 | 3300050495 | nmdc:mga04h51_82482_c1 | nmdc:mga04h51_82482_c1_146_832 | 225 |
| 576 | 3300050516 | nmdc:mga0sz30_61424_c1 | nmdc:mga0sz30_61424_c1_17_703 | 225 |
| 577 | 3300053077 | Ga0495601_0035341 | Ga0495601_0035341_882_1568 | 225 |
| 578 | 3300053085 | Ga0495619_0188485 | Ga0495619_0188485_593_1279 | 225 |
| 579 | 3300053085 | Ga0495619_0551691 | Ga0495619_0551691_76_762 | 225 |
| 580 | 3300053086 | Ga0500578_0146850 | Ga0500578_0146850_17_703 | 225 |
| 581 | 3300053087 | Ga0500643_000015 | Ga0500643_000015_80754_81455 | 225 |
| 582 | 3300053091 | Ga0500647_0089674 | Ga0500647_0089674_769_1455 | 225 |
| 583 | 3300053092 | Ga0500583_0054905 | Ga0500583_0054905_861_1562 | 225 |
| 584 | 3300053093 | Ga0500651_0078337 | Ga0500651_0078337_1173_1859 | 225 |
| 585 | 3300053094 | Ga0500566_0000988 | Ga0500566_0000988_13847_14548 | 225 |
| 586 | 3300053094 | Ga0500566_0005062 | Ga0500566_0005062_133_819 | 225 |
| 587 | 3300053098 | Ga0500650_0088991 | Ga0500650_0088991_595_1296 | 225 |
| 588 | 3300053103 | Ga0500555_000899 | Ga0500555_000899_9749_10450 | 225 |
| 589 | 3300053105 | Ga0500557_000022 | Ga0500557_000022_27083_27769 | 225 |
| 590 | 3300053108 | Ga0500562_028396 | Ga0500562_028396_442_1143 | 225 |
| 591 | 3300053119 | Ga0500595_000652 | Ga0500595_000652_6635_7321 | 225 |
| 592 | 3300053119 | Ga0500595_013151 | Ga0500595_013151_2112_2798 | 225 |
| 593 | 3300053130 | Ga0500642_0000060 | Ga0500642_0000060_46029_46715 | 225 |
| 594 | 3300053130 | Ga0500642_0130489 | Ga0500642_0130489_146_847 | 225 |
| 595 | 3300053136 | Ga0500559_0014416 | Ga0500559_0014416_1971_2657 | 225 |
| 596 | 3300053136 | Ga0500559_0057837 | Ga0500559_0057837_894_1580 | 225 |
| 597 | 3300053139 | Ga0500568_0024464 | Ga0500568_0024464_291_992 | 225 |
| 598 | 3300053140 | Ga0500573_0073398 | Ga0500573_0073398_547_1233 | 225 |
| 599 | 3300053147 | Ga0500589_176028 | Ga0500589_176028_85_786 | 225 |
| 600 | 3300053150 | Ga0500603_091129 | Ga0500603_091129_171_857 | 225 |
| 601 | 3300053153 | Ga0500616_0024278 | Ga0500616_0024278_2275_2976 | 225 |
| 602 | 3300053157 | Ga0500624_000625 | Ga0500624_000625_7671_8357 | 225 |
| 603 | 3300053178 | Ga0500637_0000104 | Ga0500637_0000104_12310_12996 | 225 |
| 604 | 3300053729 | Ga0500625_000333 | Ga0500625_000333_10853_11539 | 225 |
| 605 | 3300053730 | Ga0500645_008971 | Ga0500645_008971_801_1502 | 225 |
| 606 | 3300053731 | Ga0500609_026835 | Ga0500609_026835_44_730 | 225 |
| 607 | 3300053736 | Ga0500599_016819 | Ga0500599_016819_28_729 | 225 |
| 608 | 3300053737 | Ga0500601_000662 | Ga0500601_000662_117_803 | 225 |
| 609 | 3300054114 | Ga0501084_0012583 | Ga0501084_0012583_1001_1687 | 225 |
| 610 | 3300055283 | Ga0500661_000109 | Ga0500661_000109_908_1594 | 225 |
| 611 | 3300060353 | Ga0501082_0003691 | Ga0501082_0003691_8467_9153 | 225 |
| 612 | iso_pu_bacteria | 2513237101 | 2513692476 | 225 |
| 613 | iso_pu_bacteria | 2791355199 | 2793080936 | 225 |
| 614 | iso_pu_bacteria | 2889033259 | 2889039886 | 225 |
| 615 | iso_pu_bacteria | 8006994254 | 8006998779 | 225 |
| 616 | 3300005435 | Ga0070714_100030050 | Ga0070714_1000300506 | 226 |
| 617 | 3300005445 | Ga0070708_100262255 | Ga0070708_1002622552 | 226 |
| 618 | 3300005467 | Ga0070706_100028347 | Ga0070706_1000283472 | 226 |
| 619 | 3300005468 | Ga0070707_100160957 | Ga0070707_1001609572 | 226 |
| 620 | 3300005518 | Ga0070699_100121669 | Ga0070699_1001216693 | 226 |
| 621 | 3300005536 | Ga0070697_100039465 | Ga0070697_1000394651 | 226 |
| 622 | 3300025256 | Ga0209759_1004195 | Ga0209759_10041956 | 226 |
| 623 | 3300025914 | Ga0207671_10407342 | Ga0207671_104073422 | 226 |
| 624 | 3300025922 | Ga0207646_10332735 | Ga0207646_103327352 | 226 |
| 625 | 3300025924 | Ga0207694_10236215 | Ga0207694_102362152 | 226 |
| 626 | 3300025929 | Ga0207664_10052674 | Ga0207664_100526743 | 226 |
| 627 | 3300025986 | Ga0207658_10253221 | Ga0207658_102532212 | 226 |
| 628 | 3300037312 | Ga0395899_0312624 | Ga0395899_0312624_13_726 | 226 |
| 629 | 3300045976 | Ga0466967_0029515 | Ga0466967_0029515_1728_2417 | 226 |
| 630 | 3300048928 | Ga0496125_0000877 | Ga0496125_0000877_26111_26809 | 226 |
| 631 | iso_pu_bacteria | 2508501128 | 2509150834 | 226 |
| 632 | iso_pu_bacteria | 2935638405 | 2935642347 | 226 |
| 633 | iso_pu_bacteria | 2935665750 | 2935668350 | 226 |
| 634 | iso_pu_bacteria | 2935703347 | 2935706205 | 226 |
| 635 | iso_pu_bacteria | 2935810662 | 2935814525 | 226 |
| 636 | iso_pu_bacteria | 2935827899 | 2935831663 | 226 |
| 637 | iso_pu_bacteria | 2936002035 | 2936007613 | 226 |
| 638 | iso_pu_bacteria | 2936037263 | 2936040082 | 226 |
| 639 | iso_pu_bacteria | 3005474847 | 3005480178 | 226 |
| 640 | 3300003203 | JGI25406J46586_10038176 | JGI25406J46586_100381762 | 227 |
| 641 | 3300003659 | JGI25404J52841_10004693 | JGI25404J52841_100046932 | 227 |
| 642 | 3300003659 | JGI25404J52841_10005665 | JGI25404J52841_100056654 | 227 |
| 643 | 3300003659 | JGI25404J52841_10006333 | JGI25404J52841_100063331 | 227 |
| 644 | 3300003659 | JGI25404J52841_10009379 | JGI25404J52841_100093792 | 227 |
| 645 | 3300005329 | Ga0070683_100126208 | Ga0070683_1001262083 | 227 |
| 646 | 3300005336 | Ga0070680_100036288 | Ga0070680_1000362885 | 227 |
| 647 | 3300005336 | Ga0070680_100064055 | Ga0070680_1000640552 | 227 |
| 648 | 3300005356 | Ga0070674_100513901 | Ga0070674_1005139011 | 227 |
| 649 | 3300005434 | Ga0070709_10000943 | Ga0070709_1000094315 | 227 |
| 650 | 3300005434 | Ga0070709_10025859 | Ga0070709_100258592 | 227 |
| 651 | 3300005435 | Ga0070714_100351354 | Ga0070714_1003513542 | 227 |
| 652 | 3300005437 | Ga0070710_10009412 | Ga0070710_100094126 | 227 |
| 653 | 3300005437 | Ga0070710_10040690 | Ga0070710_100406902 | 227 |
| 654 | 3300005437 | Ga0070710_10113435 | Ga0070710_101134352 | 227 |
| 655 | 3300005439 | Ga0070711_100023513 | Ga0070711_1000235135 | 227 |
| 656 | 3300005439 | Ga0070711_100059522 | Ga0070711_1000595223 | 227 |
| 657 | 3300005439 | Ga0070711_100131823 | Ga0070711_1001318232 | 227 |
| 658 | 3300005456 | Ga0070678_100043979 | Ga0070678_1000439793 | 227 |
| 659 | 3300005458 | Ga0070681_10063273 | Ga0070681_100632733 | 227 |
| 660 | 3300005458 | Ga0070681_10069007 | Ga0070681_100690073 | 227 |
| 661 | 3300005458 | Ga0070681_10076578 | Ga0070681_100765783 | 227 |
| 662 | 3300005468 | Ga0070707_100200939 | Ga0070707_1002009394 | 227 |
| 663 | 3300005471 | Ga0070698_100159783 | Ga0070698_1001597832 | 227 |
| 664 | 3300005530 | Ga0070679_100259285 | Ga0070679_1002592852 | 227 |
| 665 | 3300005535 | Ga0070684_100015676 | Ga0070684_1000156765 | 227 |
| 666 | 3300005539 | Ga0068853_100175317 | Ga0068853_1001753171 | 227 |
| 667 | 3300005539 | Ga0068853_100450923 | Ga0068853_1004509232 | 227 |
| 668 | 3300005548 | Ga0070665_100166997 | Ga0070665_1001669972 | 227 |
| 669 | 3300005563 | Ga0068855_100047627 | Ga0068855_1000476276 | 227 |
| 670 | 3300005563 | Ga0068855_100059338 | Ga0068855_1000593382 | 227 |
| 671 | 3300005617 | Ga0068859_100143562 | Ga0068859_1001435622 | 227 |
| 672 | 3300005843 | Ga0068860_100000589 | Ga0068860_10000058917 | 227 |
| 673 | 3300005844 | Ga0068862_100586181 | Ga0068862_1005861811 | 227 |
| 674 | 3300005937 | Ga0081455_10009042 | Ga0081455_1000904213 | 227 |
| 675 | 3300005937 | Ga0081455_10018811 | Ga0081455_100188118 | 227 |
| 676 | 3300005937 | Ga0081455_10131983 | Ga0081455_101319832 | 227 |
| 677 | 3300005981 | Ga0081538_10036981 | Ga0081538_100369813 | 227 |
| 678 | 3300005983 | Ga0081540_1020867 | Ga0081540_10208673 | 227 |
| 679 | 3300005983 | Ga0081540_1059621 | Ga0081540_10596212 | 227 |
| 680 | 3300005985 | Ga0081539_10001398 | Ga0081539_1000139840 | 227 |
| 681 | 3300005985 | Ga0081539_10185926 | Ga0081539_101859261 | 227 |
| 682 | 3300006038 | Ga0075365_10059122 | Ga0075365_100591223 | 227 |
| 683 | 3300006042 | Ga0075368_10128489 | Ga0075368_101284892 | 227 |
| 684 | 3300006048 | Ga0075363_100032563 | Ga0075363_1000325632 | 227 |
| 685 | 3300006163 | Ga0070715_10078082 | Ga0070715_100780822 | 227 |
| 686 | 3300006173 | Ga0070716_100027312 | Ga0070716_1000273121 | 227 |
| 687 | 3300006175 | Ga0070712_100090277 | Ga0070712_1000902773 | 227 |
| 688 | 3300006175 | Ga0070712_100251741 | Ga0070712_1002517412 | 227 |
| 689 | 3300006178 | Ga0075367_10032972 | Ga0075367_100329722 | 227 |
| 690 | 3300006195 | Ga0075366_10230277 | Ga0075366_102302771 | 227 |
| 691 | 3300006871 | Ga0075434_100141157 | Ga0075434_1001411571 | 227 |
| 692 | 3300006931 | Ga0097620_100143560 | Ga0097620_1001435603 | 227 |
| 693 | 3300006942 | Ga0099824_1012401 | Ga0099824_10124018 | 227 |
| 694 | 3300006943 | Ga0099822_1003886 | Ga0099822_100388611 | 227 |
| 695 | 3300009092 | Ga0105250_10070491 | Ga0105250_100704912 | 227 |
| 696 | 3300009093 | Ga0105240_10047643 | Ga0105240_100476436 | 227 |
| 697 | 3300009093 | Ga0105240_10183132 | Ga0105240_101831323 | 227 |
| 698 | 3300009093 | Ga0105240_10227884 | Ga0105240_102278843 | 227 |
| 699 | 3300009098 | Ga0105245_10933204 | Ga0105245_109332041 | 227 |
| 700 | 3300009101 | Ga0105247_10004329 | Ga0105247_100043294 | 227 |
| 701 | 3300009545 | Ga0105237_10292492 | Ga0105237_102924923 | 227 |
| 702 | 3300009545 | Ga0105237_10423898 | Ga0105237_104238982 | 227 |
| 703 | 3300009551 | Ga0105238_10045226 | Ga0105238_100452262 | 227 |
| 704 | 3300009551 | Ga0105238_10070803 | Ga0105238_100708032 | 227 |
| 705 | 3300010375 | Ga0105239_10082423 | Ga0105239_100824233 | 227 |
| 706 | 3300013105 | Ga0157369_10004890 | Ga0157369_1000489015 | 227 |
| 707 | 3300013105 | Ga0157369_10019548 | Ga0157369_100195483 | 227 |
| 708 | 3300013105 | Ga0157369_10212434 | Ga0157369_102124342 | 227 |
| 709 | 3300013306 | Ga0163162_10170328 | Ga0163162_101703282 | 227 |
| 710 | 3300013307 | Ga0157372_10084277 | Ga0157372_100842773 | 227 |
| 711 | 3300014325 | Ga0163163_10148889 | Ga0163163_101488892 | 227 |
| 712 | 3300014326 | Ga0157380_10243877 | Ga0157380_102438772 | 227 |
| 713 | 3300021384 | Ga0213876_10006878 | Ga0213876_100068781 | 227 |
| 714 | 3300021384 | Ga0213876_10106677 | Ga0213876_101066771 | 227 |
| 715 | 3300021388 | Ga0213875_10029210 | Ga0213875_100292103 | 227 |
| 716 | 3300025898 | Ga0207692_10005535 | Ga0207692_100055352 | 227 |
| 717 | 3300025898 | Ga0207692_10185844 | Ga0207692_101858441 | 227 |
| 718 | 3300025900 | Ga0207710_10008563 | Ga0207710_100085634 | 227 |
| 719 | 3300025904 | Ga0207647_10200842 | Ga0207647_102008421 | 227 |
| 720 | 3300025905 | Ga0207685_10067238 | Ga0207685_100672381 | 227 |
| 721 | 3300025905 | Ga0207685_10136231 | Ga0207685_101362311 | 227 |
| 722 | 3300025906 | Ga0207699_10028127 | Ga0207699_100281272 | 227 |
| 723 | 3300025906 | Ga0207699_10031894 | Ga0207699_100318942 | 227 |
| 724 | 3300025912 | Ga0207707_10014703 | Ga0207707_100147037 | 227 |
| 725 | 3300025912 | Ga0207707_10057211 | Ga0207707_100572112 | 227 |
| 726 | 3300025912 | Ga0207707_10176666 | Ga0207707_101766662 | 227 |
| 727 | 3300025913 | Ga0207695_10119717 | Ga0207695_101197172 | 227 |
| 728 | 3300025913 | Ga0207695_10310635 | Ga0207695_103106352 | 227 |
| 729 | 3300025914 | Ga0207671_10122976 | Ga0207671_101229762 | 227 |
| 730 | 3300025914 | Ga0207671_10575123 | Ga0207671_105751231 | 227 |
| 731 | 3300025915 | Ga0207693_10083933 | Ga0207693_100839332 | 227 |
| 732 | 3300025915 | Ga0207693_10116277 | Ga0207693_101162772 | 227 |
| 733 | 3300025916 | Ga0207663_10046369 | Ga0207663_100463691 | 227 |
| 734 | 3300025916 | Ga0207663_10383236 | Ga0207663_103832361 | 227 |
| 735 | 3300025917 | Ga0207660_10008250 | Ga0207660_100082507 | 227 |
| 736 | 3300025917 | Ga0207660_10060220 | Ga0207660_100602202 | 227 |
| 737 | 3300025921 | Ga0207652_10457691 | Ga0207652_104576911 | 227 |
| 738 | 3300025924 | Ga0207694_10030817 | Ga0207694_100308174 | 227 |
| 739 | 3300025929 | Ga0207664_10134250 | Ga0207664_101342502 | 227 |
| 740 | 3300025937 | Ga0207669_10284285 | Ga0207669_102842852 | 227 |
| 741 | 3300025939 | Ga0207665_10001583 | Ga0207665_100015836 | 227 |
| 742 | 3300025944 | Ga0207661_10391212 | Ga0207661_103912121 | 227 |
| 743 | 3300025949 | Ga0207667_10335920 | Ga0207667_103359202 | 227 |
| 744 | 3300025949 | Ga0207667_10336315 | Ga0207667_103363153 | 227 |
| 745 | 3300025949 | Ga0207667_10533378 | Ga0207667_105333781 | 227 |
| 746 | 3300025972 | Ga0207668_10329581 | Ga0207668_103295812 | 227 |
| 747 | 3300026041 | Ga0207639_10157319 | Ga0207639_101573192 | 227 |
| 748 | 3300026041 | Ga0207639_10276975 | Ga0207639_102769752 | 227 |
| 749 | 3300026041 | Ga0207639_10332409 | Ga0207639_103324092 | 227 |
| 750 | 3300026067 | Ga0207678_10049928 | Ga0207678_100499282 | 227 |
| 751 | 3300026067 | Ga0207678_10418767 | Ga0207678_104187673 | 227 |
| 752 | 3300026067 | Ga0207678_10597085 | Ga0207678_105970852 | 227 |
| 753 | 3300026142 | Ga0207698_10907681 | Ga0207698_109076811 | 227 |
| 754 | 3300027357 | Ga0209589_1000003 | Ga0209589_1000003529 | 227 |
| 755 | 3300027361 | Ga0209489_100003 | Ga0209489_100003580 | 227 |
| 756 | 3300027363 | Ga0209700_100003 | Ga0209700_100003580 | 227 |
| 757 | 3300027866 | Ga0209813_10085225 | Ga0209813_100852251 | 227 |
| 758 | 3300028379 | Ga0268266_10150362 | Ga0268266_101503622 | 227 |
| 759 | 3300028381 | Ga0268264_10000043 | Ga0268264_1000004337 | 227 |
| 760 | 3300031241 | Ga0265325_10027410 | Ga0265325_100274101 | 227 |
| 761 | 3300031344 | Ga0265316_10357622 | Ga0265316_103576221 | 227 |
| 762 | 3300031711 | Ga0265314_10285250 | Ga0265314_102852501 | 227 |
| 763 | 3300035111 | Ga0373923_0049016 | Ga0373923_0049016_340_1038 | 227 |
| 764 | 3300035113 | Ga0373936_0145773 | Ga0373936_0145773_55_753 | 227 |
| 765 | 3300035118 | Ga0373954_0024129 | Ga0373954_0024129_1553_2251 | 227 |
| 766 | 3300035119 | Ga0373956_0141693 | Ga0373956_0141693_342_1040 | 227 |
| 767 | 3300035120 | Ga0373957_0013029 | Ga0373957_0013029_1269_1967 | 227 |
| 768 | 3300035170 | Ga0373943_0227007 | Ga0373943_0227007_269_967 | 227 |
| 769 | 3300035171 | Ga0373946_0029192 | Ga0373946_0029192_400_1098 | 227 |
| 770 | 3300035172 | Ga0373955_0316442 | Ga0373955_0316442_197_895 | 227 |
| 771 | 3300035410 | Ga0373924_0009245 | Ga0373924_0009245_940_1638 | 227 |
| 772 | 3300035691 | Ga0373931_0215128 | Ga0373931_0215128_98_829 | 227 |
| 773 | 3300035691 | Ga0373931_0222551 | Ga0373931_0222551_291_986 | 227 |
| 774 | 3300035692 | Ga0373935_0055144 | Ga0373935_0055144_1412_2110 | 227 |
| 775 | 3300035695 | Ga0373927_0173928 | Ga0373927_0173928_486_1289 | 227 |
| 776 | 3300035695 | Ga0373927_0357239 | Ga0373927_0357239_184_894 | 227 |
| 777 | 3300035724 | Ga0373933_0017121 | Ga0373933_0017121_1841_2539 | 227 |
| 778 | 3300035725 | Ga0373947_0033109 | Ga0373947_0033109_2240_2947 | 227 |
| 779 | 3300035725 | Ga0373947_0082641 | Ga0373947_0082641_80_775 | 227 |
| 780 | 3300036401 | Ga0373937_0157888 | Ga0373937_0157888_1157_1855 | 227 |
| 781 | 3300036401 | Ga0373937_0711775 | Ga0373937_0711775_100_807 | 227 |
| 782 | 3300037068 | Ga0373925_0006009 | Ga0373925_0006009_3376_4074 | 227 |
| 783 | 3300037068 | Ga0373925_0152585 | Ga0373925_0152585_1048_1743 | 227 |
| 784 | 3300037418 | Ga0395900_0017864 | Ga0395900_0017864_4635_5330 | 227 |
| 785 | 3300037418 | Ga0395900_0273815 | Ga0395900_0273815_427_1116 | 227 |
| 786 | 3300037466 | Ga0395898_0032284 | Ga0395898_0032284_283_978 | 227 |
| 787 | 3300037853 | Ga0436364_0991714 | Ga0436364_0991714_1663_2418 | 227 |
| 788 | 3300038443 | Ga0395901_0377199 | Ga0395901_0377199_203_892 | 227 |
| 789 | 3300039437 | Ga0436365_1316672 | Ga0436365_1316672_8988_9839 | 227 |
| 790 | 3300039437 | Ga0436365_1470075 | Ga0436365_1470075_1594_2289 | 227 |
| 791 | 3300039437 | Ga0436365_1510814 | Ga0436365_1510814_2204_2899 | 227 |
| 792 | 3300039438 | Ga0436360_0167622 | Ga0436360_0167622_12_719 | 227 |
| 793 | 3300039450 | Ga0436363_1463179 | Ga0436363_1463179_344_1039 | 227 |
| 794 | 3300039453 | Ga0436362_1173705 | Ga0436362_1173705_865_1716 | 227 |
| 795 | 3300041462 | Ga0451806_367894 | Ga0451806_367894_1411_2121 | 227 |
| 796 | 3300041507 | Ga0451851_0219306 | Ga0451851_0219306_311_1006 | 227 |
| 797 | 3300044694 | Ga0466963_0243643 | Ga0466963_0243643_261_956 | 227 |
| 798 | 3300046455 | Ga0495603_0032720 | Ga0495603_0032720_814_1521 | 227 |
| 799 | 3300046455 | Ga0495603_0064072 | Ga0495603_0064072_1093_1869 | 227 |
| 800 | 3300046455 | Ga0495603_0197961 | Ga0495603_0197961_199_894 | 227 |
| 801 | 3300046459 | Ga0495629_0435858 | Ga0495629_0435858_96_794 | 227 |
| 802 | 3300046472 | Ga0495580_0025532 | Ga0495580_0025532_1171_1869 | 227 |
| 803 | 3300046472 | Ga0495580_0067039 | Ga0495580_0067039_79_786 | 227 |
| 804 | 3300046473 | Ga0495582_0011077 | Ga0495582_0011077_1799_2497 | 227 |
| 805 | 3300046475 | Ga0495639_0029667 | Ga0495639_0029667_612_1310 | 227 |
| 806 | 3300046476 | Ga0495662_0032221 | Ga0495662_0032221_728_1426 | 227 |
| 807 | 3300046477 | Ga0495664_0015631 | Ga0495664_0015631_30_734 | 227 |
| 808 | 3300046477 | Ga0495664_0029939 | Ga0495664_0029939_2349_3047 | 227 |
| 809 | 3300046514 | Ga0495618_0031969 | Ga0495618_0031969_41_739 | 227 |
| 810 | 3300046517 | Ga0495630_0036156 | Ga0495630_0036156_164_862 | 227 |
| 811 | 3300046524 | Ga0495648_0035952 | Ga0495648_0035952_1265_1963 | 227 |
| 812 | 3300046531 | Ga0495665_0069349 | Ga0495665_0069349_197_895 | 227 |
| 813 | 3300046533 | Ga0495640_0089610 | Ga0495640_0089610_11_709 | 227 |
| 814 | 3300046535 | Ga0495586_0079732 | Ga0495586_0079732_1003_1701 | 227 |
| 815 | 3300046543 | Ga0495645_0010706 | Ga0495645_0010706_1435_2139 | 227 |
| 816 | 3300046559 | Ga0495667_0042567 | Ga0495667_0042567_29_727 | 227 |
| 817 | 3300046642 | Ga0495634_0067958 | Ga0495634_0067958_1455_2231 | 227 |
| 818 | 3300046660 | Ga0495625_0165881 | Ga0495625_0165881_313_1011 | 227 |
| 819 | 3300046683 | Ga0495658_0042101 | Ga0495658_0042101_635_1333 | 227 |
| 820 | 3300046684 | Ga0495669_0195408 | Ga0495669_0195408_15_725 | 227 |
| 821 | 3300046689 | Ga0495613_0188790 | Ga0495613_0188790_69_845 | 227 |
| 822 | 3300046690 | Ga0495624_0024440 | Ga0495624_0024440_23_721 | 227 |
| 823 | 3300047315 | Ga0495581_0182858 | Ga0495581_0182858_242_937 | 227 |
| 824 | 3300047319 | Ga0495674_0211502 | Ga0495674_0211502_114_818 | 227 |
| 825 | 3300047320 | Ga0495672_0038451 | Ga0495672_0038451_645_1412 | 227 |
| 826 | 3300047321 | Ga0495676_0170119 | Ga0495676_0170119_187_894 | 227 |
| 827 | 3300047321 | Ga0495676_0435507 | Ga0495676_0435507_34_810 | 227 |
| 828 | 3300047471 | Ga0495684_0044993 | Ga0495684_0044993_378_1076 | 227 |
| 829 | 3300047673 | Ga0495593_0027366 | Ga0495593_0027366_2312_3010 | 227 |
| 830 | 3300048089 | Ga0495614_0072697 | Ga0495614_0072697_18_716 | 227 |
| 831 | 3300048089 | Ga0495614_0184001 | Ga0495614_0184001_200_895 | 227 |
| 832 | 3300048903 | Ga0496100_0349753 | Ga0496100_0349753_45_746 | 227 |
| 833 | 3300048904 | Ga0496101_0104458 | Ga0496101_0104458_799_1500 | 227 |
| 834 | 3300048904 | Ga0496101_0845653 | Ga0496101_0845653_12_707 | 227 |
| 835 | 3300048905 | Ga0496102_0249017 | Ga0496102_0249017_653_1354 | 227 |
| 836 | 3300048910 | Ga0496107_0295252 | Ga0496107_0295252_386_1087 | 227 |
| 837 | 3300048915 | Ga0496112_0000021 | Ga0496112_0000021_150189_150884 | 227 |
| 838 | 3300048915 | Ga0496112_0020030 | Ga0496112_0020030_3355_4056 | 227 |
| 839 | 3300048917 | Ga0496114_0257887 | Ga0496114_0257887_42_743 | 227 |
| 840 | 3300048918 | Ga0496115_0093708 | Ga0496115_0093708_780_1481 | 227 |
| 841 | 3300048924 | Ga0496121_0078095 | Ga0496121_0078095_457_1152 | 227 |
| 842 | 3300048924 | Ga0496121_0239551 | Ga0496121_0239551_387_1160 | 227 |
| 843 | 3300048927 | Ga0496124_0246901 | Ga0496124_0246901_144_842 | 227 |
| 844 | 3300048929 | Ga0496126_0062075 | Ga0496126_0062075_1829_2524 | 227 |
| 845 | 3300048929 | Ga0496126_0073979 | Ga0496126_0073979_2021_2722 | 227 |
| 846 | 3300048929 | Ga0496126_0217986 | Ga0496126_0217986_844_1539 | 227 |
| 847 | 3300049569 | Ga0501032_0038828 | Ga0501032_0038828_512_1225 | 227 |
| 848 | 3300049570 | Ga0501033_0023712 | Ga0501033_0023712_1186_1899 | 227 |
| 849 | 3300049570 | Ga0501033_0047661 | Ga0501033_0047661_587_1300 | 227 |
| 850 | 3300049570 | Ga0501033_0119351 | Ga0501033_0119351_816_1532 | 227 |
| 851 | 3300049570 | Ga0501033_0419811 | Ga0501033_0419811_63_776 | 227 |
| 852 | 3300049572 | Ga0501036_0172083 | Ga0501036_0172083_311_1024 | 227 |
| 853 | 3300049574 | Ga0501038_0119220 | Ga0501038_0119220_753_1466 | 227 |
| 854 | 3300049574 | Ga0501038_0429941 | Ga0501038_0429941_193_906 | 227 |
| 855 | 3300049575 | Ga0501039_0134692 | Ga0501039_0134692_33_746 | 227 |
| 856 | 3300049575 | Ga0501039_0143546 | Ga0501039_0143546_305_1072 | 227 |
| 857 | 3300049579 | Ga0501043_0096029 | Ga0501043_0096029_536_1375 | 227 |
| 858 | 3300049579 | Ga0501043_0317318 | Ga0501043_0317318_82_795 | 227 |
| 859 | 3300049580 | Ga0501046_0049382 | Ga0501046_0049382_1486_2325 | 227 |
| 860 | 3300049580 | Ga0501046_0055323 | Ga0501046_0055323_404_1117 | 227 |
| 861 | 3300049580 | Ga0501046_0193513 | Ga0501046_0193513_515_1282 | 227 |
| 862 | 3300049581 | Ga0501047_0031163 | Ga0501047_0031163_817_1656 | 227 |
| 863 | 3300049581 | Ga0501047_0045461 | Ga0501047_0045461_2273_2986 | 227 |
| 864 | 3300049582 | Ga0501048_0279425 | Ga0501048_0279425_282_995 | 227 |
| 865 | 3300049583 | Ga0501067_0065732 | Ga0501067_0065732_1051_1746 | 227 |
| 866 | 3300049583 | Ga0501067_0074997 | Ga0501067_0074997_701_1414 | 227 |
| 867 | 3300049586 | Ga0501070_0471742 | Ga0501070_0471742_73_786 | 227 |
| 868 | 3300049587 | Ga0501071_0401422 | Ga0501071_0401422_183_896 | 227 |
| 869 | 3300049589 | Ga0501073_0056283 | Ga0501073_0056283_2014_2727 | 227 |
| 870 | 3300049590 | Ga0501074_0055970 | Ga0501074_0055970_1364_2203 | 227 |
| 871 | 3300049742 | Ga0501080_0062421 | Ga0501080_0062421_2029_2868 | 227 |
| 872 | 3300049822 | Ga0501035_0054958 | Ga0501035_0054958_1373_2086 | 227 |
| 873 | 3300049822 | Ga0501035_0103647 | Ga0501035_0103647_513_1226 | 227 |
| 874 | 3300049822 | Ga0501035_0179739 | Ga0501035_0179739_145_912 | 227 |
| 875 | 3300049823 | Ga0501044_0039498 | Ga0501044_0039498_1719_2432 | 227 |
| 876 | 3300049823 | Ga0501044_0055169 | Ga0501044_0055169_985_1824 | 227 |
| 877 | 3300050489 | nmdc:mga03683_2975_c1 | nmdc:mga03683_2975_c1_4107_4811 | 227 |
| 878 | 3300050490 | nmdc:mga03n38_18704_c1 | nmdc:mga03n38_18704_c1_524_1228 | 227 |
| 879 | 3300050492 | nmdc:mga0yw44_48221_c1 | nmdc:mga0yw44_48221_c1_1719_2423 | 227 |
| 880 | 3300050494 | nmdc:mga06z11_32574_c1 | nmdc:mga06z11_32574_c1_1018_1722 | 227 |
| 881 | 3300050495 | nmdc:mga04h51_101074_c1 | nmdc:mga04h51_101074_c1_36_740 | 227 |
| 882 | 3300050496 | nmdc:mga07m45_19502_c2 | nmdc:mga07m45_19502_c2_199_903 | 227 |
| 883 | 3300050512 | nmdc:mga0n895_32103_c1 | nmdc:mga0n895_32103_c1_4168_4863 | 227 |
| 884 | 3300050512 | nmdc:mga0n895_67036_c1 | nmdc:mga0n895_67036_c1_1447_2142 | 227 |
| 885 | 3300050513 | nmdc:mga0rr50_433239_c1 | nmdc:mga0rr50_433239_c1_160_855 | 227 |
| 886 | 3300053077 | Ga0495601_0078141 | Ga0495601_0078141_77_781 | 227 |
| 887 | 3300053077 | Ga0495601_0095765 | Ga0495601_0095765_214_990 | 227 |
| 888 | 3300053078 | Ga0495612_0021249 | Ga0495612_0021249_1235_1939 | 227 |
| 889 | 3300053094 | Ga0500566_0000028 | Ga0500566_0000028_11762_12469 | 227 |
| 890 | 3300053095 | Ga0500640_000581 | Ga0500640_000581_6809_7516 | 227 |
| 891 | 3300053111 | Ga0500572_000269 | Ga0500572_000269_6156_6863 | 227 |
| 892 | 3300053115 | Ga0500591_013572 | Ga0500591_013572_1055_1762 | 227 |
| 893 | 3300053123 | Ga0500614_000118 | Ga0500614_000118_15354_16061 | 227 |
| 894 | 3300053136 | Ga0500559_0002964 | Ga0500559_0002964_181_888 | 227 |
| 895 | 3300053150 | Ga0500603_000232 | Ga0500603_000232_12024_12731 | 227 |
| 896 | 3300053163 | Ga0500639_000001 | Ga0500639_000001_96141_96848 | 227 |
| 897 | 3300053735 | Ga0500596_000195 | Ga0500596_000195_4249_4956 | 227 |
| 898 | 3300002705 | JGI25156J39149_1002491 | JGI25156J39149_10024914 | 229 |
| 899 | 3300002738 | JGI25154J39366_1000013 | JGI25154J39366_100001381 | 229 |
| 900 | 3300002741 | JGI25157J39369_1002059 | JGI25157J39369_10020593 | 229 |
| 901 | 3300025206 | Ga0209435_100006 | Ga0209435_100006275 | 229 |
| 902 | 3300025246 | Ga0209646_1000015 | Ga0209646_1000015260 | 229 |
| 903 | 3300025250 | Ga0209026_1000039 | Ga0209026_1000039275 | 229 |
| 904 | 3300025256 | Ga0209759_1000005 | Ga0209759_1000005275 | 229 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3noq-assembly1.cif.gz_A | crystal structure of c101s isocyanide hydratase from pseudomonas fluorescens | 0.9908 | 1 | 221 |
| 7la0-assembly1.cif.gz_B | pseudomonas fluorescens g150a isocyanide hydratase (g150a-2) at 274k, refmac5-refined | 0.9875 | 1 | 221 |
| 7l9q-assembly1.cif.gz_B | wild-type pseudomonas fluorescens isocyanide hydratase (wt-1) at 274k, refmac5-refined | 0.9874 | 1 | 221 |
| 3noo-assembly1.cif.gz_B | crystal structure of c101a isocyanide hydratase from pseudomonas fluorescens | 0.9807 | 2 | 221 |
| 3nor-assembly1.cif.gz_A-2 | crystal structure of t102s isocyanide hydratase from pseudomonas fluorescens | 0.979 | 1 | 221 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3norA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.979 | 1 | 221 | 3.40.50.880 |
| 3ewnA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9443 | 5 | 218 | 3.40.50.880 |
| 3norA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9413 | 1 | 221 | 3.40.50.880 |
| af_I6Y6S3_1_186_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9401 | 28 | 209 | 3.40.50.880 |
| af_O16228_2_184_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9284 | 1 | 179 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A530GRT2-F1-model_v4 | DJ-1/PfpI family protein | 0.9985 | 1 | 124 |
GO:0006355
|
| AF-A0A1Z4N4H9-F1-model_v4 | ThiJ/PfpI domain-containing protein | 0.9908 | 2 | 221 |
GO:0006355
|
| AF-A0A530GRT2-F1-model_v4 | DJ-1/PfpI family protein | 0.9905 | 1 | 124 |
GO:0006355
|
| AF-A0A6I5P035-F1-model_v4 | DJ-1/PfpI family protein | 0.9886 | 1 | 219 |
GO:0006355
|
| AF-Q3JJZ1-F1-model_v4 | DJ-1/PfpI family protein (EC 4.2.1.103) | 0.9879 | 1 | 221 |
GO:0006355
GO:0050549 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar