F485275

General Info

Members Datasets Scaffolds Average Seq Length
904 284 904 242

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10034927|Ga0163162_100349274
Length 278
Sequence LWLADLPFCLTNQLQKQHSKNSEEQGDFVEPFMNNNNYDPTNNVSWQLGHRGRVAVFIDGNNLFHAARFHNIDIDYNKLLRVLLGDGRLLRAFFYTGVDVGAERQQGFLLWMRRNGFRVIQKELKTFYDGTRKANLDVEIAVDMLSLAGRYDTAVLVSGDEDFVYAVNAVAYKGCRVEIAGFRSNTAPKLIDVADYFIDLGEIADKVRKEMTHGGARYDERDLHDHLPHQYLQEPLHMQDAPPDAFQAAMRVVIEAEIEEDAAEFQASTEFIRVTDDH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
92 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
124 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
192 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
193 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
194 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
195 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
196 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
206 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
207 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
208 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
209 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
210 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
211 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
212 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
213 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
214 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
217 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
218 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
228 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
229 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
230 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
231 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
232 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
233 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
234 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
235 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
238 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
239 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
240 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
241 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
242 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
243 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
244 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
245 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
246 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
247 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
248 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
249 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
250 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
251 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
252 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
253 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
254 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
255 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
256 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
257 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
258 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
259 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
260 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
261 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
264 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
265 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
266 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
267 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
268 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
269 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
270 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
271 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
272 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
275 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
282 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
283 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
284 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0
Rhizoplane 1.66
Rhizosphere 97.12
Stem 0
Stem Tuber 0
Unclassified 1.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3011979 2162886007 Unclassified 1042
2 CNAas_1000478 3300000532 Bacteria 3901
3 JGI24748J21848_1000008 3300002074 Bacteria 191483
4 JGI24749J21850_1015254 3300002076 Bacteria 1078
5 JGI24034J26672_10000002 3300002239 Bacteria 925353
6 JGI24751J29686_10000099 3300002459 Bacteria 47837
7 JGI25406J46586_10002315 3300003203 Bacteria 8996
8 JGI25406J46586_10004596 3300003203 Bacteria 6424
9 rootL2_10068297 3300003322 Bacteria 1323
10 Ga0065714_10014729 3300005288 Bacteria 2110
11 Ga0065714_10064424 3300005288 Bacteria 236118
12 Ga0065704_10009481 3300005289 Bacteria 2134
13 Ga0065704_10077781 3300005289 Unclassified 4621
14 Ga0065704_10093396 3300005289 Bacteria 2595
15 Ga0065704_10154614 3300005289 Unclassified 1401
16 Ga0065712_10000117 3300005290 Bacteria 235194
17 Ga0065712_10008362 3300005290 Bacteria 3354
18 Ga0065712_10074270 3300005290 Bacteria 4108
19 Ga0065712_10085397 3300005290 Bacteria 2700
20 Ga0065712_10243771 3300005290 Unclassified 977
21 Ga0065715_10000523 3300005293 Bacteria 10848
22 Ga0065715_10019608 3300005293 Bacteria 2387
23 Ga0065715_10107615 3300005293 Bacteria 2762
24 Ga0065715_10109566 3300005293 Bacteria 2663
25 Ga0065715_10148450 3300005293 Bacteria 1759
26 Ga0065715_10161319 3300005293 Bacteria 1569
27 Ga0065715_10167384 3300005293 Bacteria 1575
28 Ga0065715_10197836 3300005293 Bacteria 1378
29 Ga0065715_10211093 3300005293 Bacteria 1309
30 Ga0065715_10233378 3300005293 Bacteria 1222
31 Ga0065707_10002026 3300005295 Bacteria 9025
32 Ga0065707_10126370 3300005295 Unclassified 2004
33 Ga0065707_10287383 3300005295 Bacteria 1033
34 Ga0065707_10336285 3300005295 Bacteria 941
35 Ga0070658_10191196 3300005327 Bacteria 1725
36 Ga0070683_100156087 3300005329 Bacteria 2164
37 Ga0070683_100471866 3300005329 Bacteria 1198
38 Ga0070690_100000586 3300005330 Bacteria 18332
39 Ga0070690_100001671 3300005330 Bacteria 11669
40 Ga0070690_100008805 3300005330 Bacteria 5829
41 Ga0070690_100156539 3300005330 Bacteria 1558
42 Ga0070670_100000297 3300005331 Bacteria 43678
43 Ga0070670_100002514 3300005331 Bacteria 15120
44 Ga0070670_100110509 3300005331 Bacteria 2368
45 Ga0070670_100136269 3300005331 Bacteria 2122
46 Ga0070677_10018755 3300005333 Bacteria 2496
47 Ga0068869_100003815 3300005334 Bacteria 9293
48 Ga0068869_100095699 3300005334 Bacteria 2241
49 Ga0068869_100145361 3300005334 Bacteria 1834
50 Ga0070666_10005057 3300005335 Bacteria 8067
51 Ga0070680_100003154 3300005336 Bacteria 12253
52 Ga0070680_100139028 3300005336 Viruses 2036
53 Ga0070680_100193837 3300005336 Unclassified 1713
54 Ga0070682_100032646 3300005337 Bacteria 3158
55 Ga0070682_100069047 3300005337 Bacteria 2256
56 Ga0068868_100044308 3300005338 Bacteria 3478
57 Ga0068868_100099889 3300005338 Bacteria 2348
58 Ga0068868_100399916 3300005338 Unclassified 1185
59 Ga0068868_100676395 3300005338 Unclassified 921
60 Ga0070689_100000425 3300005340 Bacteria 24906
61 Ga0070689_100005978 3300005340 Bacteria 8378
62 Ga0070689_100008912 3300005340 Bacteria 7095
63 Ga0070689_100021304 3300005340 Bacteria 4823
64 Ga0070689_100060971 3300005340 Bacteria 2933
65 Ga0070689_100063432 3300005340 Bacteria 2876
66 Ga0070689_100253736 3300005340 Unclassified 1452
67 Ga0070687_100005050 3300005343 Bacteria 5319
68 Ga0070687_100216181 3300005343 Unclassified 1171
69 Ga0070687_100248487 3300005343 Unclassified 1104
70 Ga0070687_100252496 3300005343 Bacteria 1096
71 Ga0070661_100076305 3300005344 Bacteria 2470
72 Ga0070661_100099213 3300005344 Bacteria 2164
73 Ga0070661_100138665 3300005344 Bacteria 1831
74 Ga0070692_10003268 3300005345 Bacteria 6537
75 Ga0070692_10021801 3300005345 Bacteria 3121
76 Ga0070692_10031990 3300005345 Unclassified 2642
77 Ga0070692_10157841 3300005345 Bacteria 1297
78 Ga0070668_100010711 3300005347 Bacteria 6818
79 Ga0070668_100246991 3300005347 Unclassified 1480
80 Ga0070669_100025762 3300005353 Bacteria 4225
81 Ga0070669_100049747 3300005353 Bacteria 3061
82 Ga0070669_100705031 3300005353 Unclassified 852
83 Ga0070671_100016473 3300005355 Bacteria 5975
84 Ga0070671_100069648 3300005355 Bacteria 2934
85 Ga0070671_100079341 3300005355 Bacteria 2744
86 Ga0070671_100123203 3300005355 Bacteria 2182
87 Ga0070673_100036706 3300005364 Bacteria 3728
88 Ga0070673_100038484 3300005364 Unclassified 3653
89 Ga0070673_100054380 3300005364 Bacteria 3149
90 Ga0070673_100064557 3300005364 Bacteria 2917
91 Ga0070673_100083506 3300005364 Bacteria 2595
92 Ga0070673_100086206 3300005364 Bacteria 2558
93 Ga0070673_100185583 3300005364 Bacteria 1783
94 Ga0070673_100542617 3300005364 Bacteria 1056
95 Ga0070688_100206569 3300005365 Bacteria 1377
96 Ga0070688_100316283 3300005365 Bacteria 1133
97 Ga0070659_100001747 3300005366 Bacteria 15600
98 Ga0070659_100317167 3300005366 Bacteria 1303
99 Ga0070667_100114751 3300005367 Bacteria 2339
100 Ga0070667_100519001 3300005367 Bacteria 1093
101 Ga0070703_10004244 3300005406 Bacteria 4034
102 Ga0070703_10206557 3300005406 Bacteria 774
103 Ga0070701_10154103 3300005438 Bacteria 1326
104 Ga0070701_10316323 3300005438 Bacteria 964
105 Ga0070705_100005473 3300005440 Bacteria 6190
106 Ga0070705_100056223 3300005440 Unclassified 2316
107 Ga0070705_100061510 3300005440 Bacteria 2232
108 Ga0070705_100181824 3300005440 Bacteria 1425
109 Ga0070700_100000087 3300005441 Bacteria 62003
110 Ga0070700_100021734 3300005441 Bacteria 3733
111 Ga0070700_100032947 3300005441 Bacteria 3119
112 Ga0070700_100049244 3300005441 Unclassified 2615
113 Ga0070700_100195633 3300005441 Bacteria 1417
114 Ga0070700_100202744 3300005441 Bacteria 1394
115 Ga0070694_100000781 3300005444 Bacteria 17791
116 Ga0070694_100028768 3300005444 Bacteria 3619
117 Ga0070694_100046232 3300005444 Bacteria 2921
118 Ga0070694_100066085 3300005444 Unclassified 2480
119 Ga0070694_100143014 3300005444 Bacteria 1739
120 Ga0070694_100199823 3300005444 Bacteria 1489
121 Ga0070694_100290935 3300005444 Bacteria 1248
122 Ga0070694_100351504 3300005444 Bacteria 1142
123 Ga0070694_100408277 3300005444 Bacteria 1065
124 Ga0070708_100000281 3300005445 Bacteria 38291
125 Ga0070708_100021762 3300005445 Bacteria 5429
126 Ga0070708_100437422 3300005445 Bacteria 1234
127 Ga0070708_100528633 3300005445 Unclassified 1113
128 Ga0070663_100458645 3300005455 Bacteria 1052
129 Ga0070662_100023433 3300005457 Unclassified 4240
130 Ga0070662_100032856 3300005457 Bacteria 3650
131 Ga0070662_100284294 3300005457 Bacteria 1339
132 Ga0070681_10001035 3300005458 Bacteria 23588
133 Ga0070681_10006412 3300005458 Bacteria 11446
134 Ga0068867_100010249 3300005459 Bacteria 6611
135 Ga0068867_100044438 3300005459 Bacteria 3255
136 Ga0068867_100144220 3300005459 Bacteria 1864
137 Ga0068867_100228819 3300005459 Bacteria 1502
138 Ga0068867_100270792 3300005459 Bacteria 1388
139 Ga0070685_10012338 3300005466 Bacteria 4489
140 Ga0070685_10104802 3300005466 Unclassified 1732
141 Ga0070706_100000146 3300005467 Bacteria 89818
142 Ga0070706_100001677 3300005467 Bacteria 23063
143 Ga0070706_100003498 3300005467 Bacteria 15433
144 Ga0070706_100011659 3300005467 Bacteria 8165
145 Ga0070706_100148069 3300005467 Unclassified 2192
146 Ga0070706_100184375 3300005467 Unclassified 1949
147 Ga0070706_100210199 3300005467 Bacteria 1817
148 Ga0070707_100002790 3300005468 Bacteria 16625
149 Ga0070707_100054355 3300005468 Unclassified 3838
150 Ga0070707_100112338 3300005468 Bacteria 2642
151 Ga0070698_100001335 3300005471 Bacteria 27442
152 Ga0070698_100007291 3300005471 Bacteria 11974
153 Ga0070698_100008222 3300005471 Bacteria 11286
154 Ga0070698_100009193 3300005471 Bacteria 10606
155 Ga0070698_100018185 3300005471 Bacteria 7400
156 Ga0070698_100026906 3300005471 Bacteria 5981
157 Ga0070698_100049187 3300005471 Bacteria 4305
158 Ga0070698_100055583 3300005471 Bacteria 4012
159 Ga0070699_100001043 3300005518 Bacteria 25801
160 Ga0070699_100009689 3300005518 Bacteria 8340
161 Ga0070699_100064874 3300005518 Bacteria 3168
162 Ga0070699_100342736 3300005518 Unclassified 1345
163 Ga0070679_100000253 3300005530 Bacteria 44883
164 Ga0070679_100016260 3300005530 Bacteria 7169
165 Ga0070679_100041381 3300005530 Unclassified 4586
166 Ga0070679_100184479 3300005530 Unclassified 2058
167 Ga0070684_100026876 3300005535 Bacteria 4852
168 Ga0070697_100000135 3300005536 Bacteria 59315
169 Ga0070697_100000976 3300005536 Bacteria 21590
170 Ga0070697_100022130 3300005536 Bacteria 5044
171 Ga0070697_100050242 3300005536 Bacteria 3385
172 Ga0070697_100053292 3300005536 Bacteria 3288
173 Ga0070697_100065615 3300005536 Unclassified 2967
174 Ga0070697_100114304 3300005536 Bacteria 2252
175 Ga0070697_100116781 3300005536 Bacteria 2229
176 Ga0070697_100215403 3300005536 Bacteria 1636
177 Ga0068853_100048451 3300005539 Bacteria 3649
178 Ga0068853_100048498 3300005539 Bacteria 3648
179 Ga0068853_100142995 3300005539 Bacteria 2148
180 Ga0068853_100250915 3300005539 Bacteria 1623
181 Ga0068853_100377510 3300005539 Unclassified 1323
182 Ga0070672_100003999 3300005543 Bacteria 9610
183 Ga0070672_100034146 3300005543 Bacteria 3859
184 Ga0070672_100442008 3300005543 Bacteria 1119
185 Ga0070686_100002097 3300005544 Bacteria 10998
186 Ga0070686_100022113 3300005544 Bacteria 3785
187 Ga0070686_100137052 3300005544 Bacteria 1699
188 Ga0070695_100012598 3300005545 Bacteria 5078
189 Ga0070695_100086747 3300005545 Bacteria 2081
190 Ga0070695_100091079 3300005545 Bacteria 2036
191 Ga0070695_100127482 3300005545 Bacteria 1750
192 Ga0070695_100185034 3300005545 Bacteria 1479
193 Ga0070695_100257988 3300005545 Unclassified 1272
194 Ga0070695_100312825 3300005545 Bacteria 1165
195 Ga0070695_100552136 3300005545 Unclassified 898
196 Ga0070696_100007058 3300005546 Bacteria 7500
197 Ga0070696_100013848 3300005546 Bacteria 5414
198 Ga0070696_100071749 3300005546 Bacteria 2437
199 Ga0070696_100125694 3300005546 Unclassified 1860
200 Ga0070696_100130947 3300005546 Unclassified 1825
201 Ga0070696_100145368 3300005546 Bacteria 1736
202 Ga0070696_100150820 3300005546 Unclassified 1706
203 Ga0070696_100359696 3300005546 Bacteria 1129
204 Ga0070693_100005553 3300005547 Bacteria 6067
205 Ga0070693_100006262 3300005547 Bacteria 5767
206 Ga0070693_100052201 3300005547 Bacteria 2343
207 Ga0070693_100179153 3300005547 Bacteria 1363
208 Ga0070693_100441813 3300005547 Unclassified 911
209 Ga0070665_100015048 3300005548 Bacteria 7766
210 Ga0070665_100424870 3300005548 Bacteria 1338
211 Ga0070704_100001584 3300005549 Bacteria 12287
212 Ga0070704_100017738 3300005549 Unclassified 4536
213 Ga0070704_100019042 3300005549 Unclassified 4403
214 Ga0070704_100039611 3300005549 Unclassified 3236
215 Ga0070704_100049855 3300005549 Bacteria 2939
216 Ga0070704_100137681 3300005549 Bacteria 1901
217 Ga0070704_100178618 3300005549 Unclassified 1696
218 Ga0070704_100185070 3300005549 Unclassified 1669
219 Ga0070704_100423242 3300005549 Bacteria 1141
220 Ga0068855_100159977 3300005563 Bacteria 2557
221 Ga0070664_100010132 3300005564 Bacteria 7642
222 Ga0070664_100052355 3300005564 Bacteria 3458
223 Ga0070664_100284655 3300005564 Bacteria 1491
224 Ga0068857_100001808 3300005577 Bacteria 17204
225 Ga0068857_100077435 3300005577 Unclassified 2967
226 Ga0068857_100145335 3300005577 Unclassified 2146
227 Ga0068857_100408414 3300005577 Bacteria 1264
228 Ga0068854_100053767 3300005578 Unclassified 2893
229 Ga0068854_100083876 3300005578 Bacteria 2357
230 Ga0068854_100088056 3300005578 Bacteria 2305
231 Ga0068854_100145429 3300005578 Bacteria 1823
232 Ga0068854_100199672 3300005578 Unclassified 1571
233 Ga0068854_100260121 3300005578 Unclassified 1389
234 Ga0068856_100026318 3300005614 Bacteria 5673
235 Ga0068856_100689821 3300005614 Unclassified 1042
236 Ga0070702_100007113 3300005615 Bacteria 5343
237 Ga0070702_100010986 3300005615 Unclassified 4488
238 Ga0070702_100026802 3300005615 Bacteria 3102
239 Ga0070702_100038735 3300005615 Bacteria 2656
240 Ga0070702_100041770 3300005615 Bacteria 2574
241 Ga0070702_100097811 3300005615 Unclassified 1794
242 Ga0068852_100037636 3300005616 Bacteria 4058
243 Ga0068852_100082560 3300005616 Bacteria 2856
244 Ga0068852_100292069 3300005616 Unclassified 1575
245 Ga0068852_100364776 3300005616 Unclassified 1414
246 Ga0068859_100007476 3300005617 Bacteria 11092
247 Ga0068859_100021332 3300005617 Archaea 6500
248 Ga0068859_100023588 3300005617 Bacteria 6175
249 Ga0068859_100087979 3300005617 Bacteria 3155
250 Ga0068859_100103724 3300005617 Bacteria 2902
251 Ga0068859_100129625 3300005617 Unclassified 2593
252 Ga0068859_100204665 3300005617 Bacteria 2059
253 Ga0068859_100246767 3300005617 Bacteria 1875
254 Ga0068864_100007609 3300005618 Bacteria 8920
255 Ga0068864_100046576 3300005618 Bacteria 3721
256 Ga0068864_100062858 3300005618 Bacteria 3217
257 Ga0068864_100109445 3300005618 Bacteria 2460
258 Ga0068864_100146065 3300005618 Bacteria 2138
259 Ga0068864_100193288 3300005618 Bacteria 1866
260 Ga0068864_100213827 3300005618 Bacteria 1776
261 Ga0068864_100316615 3300005618 Bacteria 1464
262 Ga0068864_100412452 3300005618 Bacteria 1285
263 Ga0068866_10007529 3300005718 Bacteria 4562
264 Ga0068861_100008148 3300005719 Bacteria 7208
265 Ga0068861_100051532 3300005719 Bacteria 3125
266 Ga0068861_100068272 3300005719 Bacteria 2747
267 Ga0068861_100079766 3300005719 Bacteria 2560
268 Ga0068851_10076656 3300005834 Bacteria 1739
269 Ga0068851_10216519 3300005834 Unclassified 1074
270 Ga0068870_10002880 3300005840 Bacteria 7243
271 Ga0068870_10031917 3300005840 Bacteria 2672
272 Ga0068870_10062967 3300005840 Unclassified 1999
273 Ga0068870_10153923 3300005840 Bacteria 1357
274 Ga0068863_100083374 3300005841 Bacteria 3029
275 Ga0068863_100137722 3300005841 Bacteria 2332
276 Ga0068863_100328218 3300005841 Unclassified 1487
277 Ga0068863_100473311 3300005841 Bacteria 1231
278 Ga0068858_100000300 3300005842 Bacteria 53038
279 Ga0068858_100028604 3300005842 Bacteria 5176
280 Ga0068858_100064512 3300005842 Bacteria 3390
281 Ga0068858_100108487 3300005842 Bacteria 2591
282 Ga0068858_100214827 3300005842 Unclassified 1820
283 Ga0068858_100243520 3300005842 Bacteria 1707
284 Ga0068858_100272913 3300005842 Bacteria 1609
285 Ga0068858_100411793 3300005842 Bacteria 1299
286 Ga0068860_100009809 3300005843 Bacteria 9505
287 Ga0068860_100017487 3300005843 Bacteria 6987
288 Ga0068860_100031178 3300005843 Bacteria 5126
289 Ga0068860_100032323 3300005843 Bacteria 5028
290 Ga0068860_100056848 3300005843 Bacteria 3718
291 Ga0068860_100098417 3300005843 Bacteria 2789
292 Ga0068860_100243806 3300005843 Bacteria 1748
293 Ga0068860_100320671 3300005843 Bacteria 1521
294 Ga0068860_100575065 3300005843 Unclassified 1130
295 Ga0068860_100987627 3300005843 Unclassified 859
296 Ga0068862_100047231 3300005844 Unclassified 3674
297 Ga0068862_100076747 3300005844 Bacteria 2892
298 Ga0068862_100086255 3300005844 Bacteria 2729
299 Ga0068862_100091340 3300005844 Bacteria 2652
300 Ga0068862_100125430 3300005844 Bacteria 2266
301 Ga0068862_100320809 3300005844 Bacteria 1430
302 Ga0068862_100342648 3300005844 Bacteria 1385
303 Ga0068862_100380669 3300005844 Bacteria 1316
304 Ga0068862_100566137 3300005844 Bacteria 1087
305 Ga0081539_10000073 3300005985 Bacteria 231470
306 Ga0081539_10000537 3300005985 Bacteria 78553
307 Ga0081539_10001715 3300005985 Bacteria 35136
308 Ga0081539_10005214 3300005985 Bacteria 13468
309 Ga0081539_10038097 3300005985 Bacteria 2853
310 Ga0070716_100007698 3300006173 Bacteria 5317
311 Ga0070716_100380921 3300006173 Unclassified 1008
312 Ga0097621_100004289 3300006237 Bacteria 9902
313 Ga0097621_100010498 3300006237 Bacteria 6781
314 Ga0097621_100014340 3300006237 Bacteria 5928
315 Ga0097621_100020722 3300006237 Bacteria 5071
316 Ga0097621_100102742 3300006237 Bacteria 2407
317 Ga0068871_100002162 3300006358 Bacteria 13342
318 Ga0068871_100006422 3300006358 Bacteria 8315
319 Ga0068871_100012458 3300006358 Bacteria 6271
320 Ga0068871_100152698 3300006358 Bacteria 1970
321 Ga0068871_100165898 3300006358 Bacteria 1891
322 Ga0068871_100466771 3300006358 Bacteria 1133
323 Ga0075428_100100612 3300006844 Unclassified 3152
324 Ga0075428_100118600 3300006844 Bacteria 2881
325 Ga0075428_100188055 3300006844 Bacteria 2234
326 Ga0075431_100064456 3300006847 Unclassified 3783
327 Ga0075431_100186618 3300006847 Unclassified 2126
328 Ga0075433_10013013 3300006852 Bacteria 6746
329 Ga0075433_10039767 3300006852 Unclassified 4068
330 Ga0075433_10068108 3300006852 Unclassified 3124
331 Ga0075433_10187089 3300006852 Unclassified 1842
332 Ga0075433_10410053 3300006852 Bacteria 1195
333 Ga0075434_100016372 3300006871 Bacteria 7126
334 Ga0075434_100053330 3300006871 Unclassified 4018
335 Ga0075434_100065989 3300006871 Bacteria 3605
336 Ga0075434_100155923 3300006871 Bacteria 2302
337 Ga0075434_100238946 3300006871 Bacteria 1837
338 Ga0075429_100040781 3300006880 Bacteria 4042
339 Ga0075429_100094296 3300006880 Unclassified 2610
340 Ga0068865_100021295 3300006881 Bacteria 4214
341 Ga0068865_100251450 3300006881 Bacteria 1395
342 Ga0068865_100353928 3300006881 Bacteria 1190
343 Ga0075436_100178566 3300006914 Unclassified 1500
344 Ga0097620_100007476 3300006931 Bacteria 11092
345 Ga0097620_100021332 3300006931 Archaea 6500
346 Ga0097620_100023588 3300006931 Bacteria 6175
347 Ga0097620_100087961 3300006931 Bacteria 3155
348 Ga0097620_100103723 3300006931 Bacteria 2902
349 Ga0097620_100129625 3300006931 Unclassified 2593
350 Ga0097620_100204658 3300006931 Bacteria 2059
351 Ga0097620_100246767 3300006931 Bacteria 1875
352 Ga0075435_100016854 3300007076 Bacteria 5516
353 Ga0105251_10083198 3300009011 Bacteria 1478
354 Ga0105251_10109763 3300009011 Viruses 1257
355 Ga0105250_10105234 3300009092 Unclassified 1153
356 Ga0105240_10033643 3300009093 Bacteria 6618
357 Ga0105240_10090698 3300009093 Bacteria 3735
358 Ga0105240_10321544 3300009093 Bacteria 1763
359 Ga0105240_10494646 3300009093 Bacteria 1361
360 Ga0105240_10524349 3300009093 Bacteria 1314
361 Ga0111539_10000228 3300009094 Bacteria 67465
362 Ga0105245_10580807 3300009098 Unclassified 1145
363 Ga0105247_10000001 3300009101 Bacteria 739726
364 Ga0105247_10000944 3300009101 Bacteria 21912
365 Ga0105247_10212765 3300009101 Bacteria 1305
366 Ga0105247_10402434 3300009101 Unclassified 976
367 Ga0114129_10009329 3300009147 Bacteria 13999
368 Ga0114129_10010021 3300009147 Bacteria 13509
369 Ga0114129_10036140 3300009147 Bacteria 6976
370 Ga0114129_10043736 3300009147 Bacteria 6301
371 Ga0114129_10070255 3300009147 Bacteria 4882
372 Ga0114129_10104964 3300009147 Bacteria 3905
373 Ga0114129_10222357 3300009147 Bacteria 2546
374 Ga0114129_10256404 3300009147 Bacteria 2346
375 Ga0114129_10284886 3300009147 Bacteria 2207
376 Ga0114129_10290623 3300009147 Bacteria 2181
377 Ga0114129_10299469 3300009147 Bacteria 2144
378 Ga0114129_10421697 3300009147 Bacteria 1755
379 Ga0114129_11039024 3300009147 Bacteria 1029
380 Ga0105243_10009655 3300009148 Bacteria 7345
381 Ga0105243_10015532 3300009148 Bacteria 5755
382 Ga0105243_10154001 3300009148 Bacteria 1975
383 Ga0105243_10242299 3300009148 Unclassified 1605
384 Ga0105243_10332241 3300009148 Bacteria 1389
385 Ga0105243_10484654 3300009148 Bacteria 1168
386 Ga0105243_10749931 3300009148 Bacteria 957
387 Ga0105241_10039156 3300009174 Unclassified 3575
388 Ga0105241_10042488 3300009174 Bacteria 3439
389 Ga0105241_10054835 3300009174 Bacteria 3052
390 Ga0105241_10097826 3300009174 Unclassified 2327
391 Ga0105241_10126473 3300009174 Bacteria 2064
392 Ga0105241_10213673 3300009174 Bacteria 1617
393 Ga0105241_10221769 3300009174 Unclassified 1590
394 Ga0105241_10238386 3300009174 Bacteria 1536
395 Ga0105241_10311307 3300009174 Bacteria 1355
396 Ga0105241_10362202 3300009174 Unclassified 1262
397 Ga0105241_10434586 3300009174 Bacteria 1158
398 Ga0105241_10539184 3300009174 Unclassified 1046
399 Ga0105242_10020124 3300009176 Bacteria 5230
400 Ga0105242_10119011 3300009176 Unclassified 2263
401 Ga0105242_10266237 3300009176 Bacteria 1550
402 Ga0105242_10367094 3300009176 Bacteria 1334
403 Ga0105242_10457641 3300009176 Bacteria 1204
404 Ga0105248_10007824 3300009177 Bacteria 11735
405 Ga0105248_10030836 3300009177 Bacteria 5990
406 Ga0105248_10084506 3300009177 Bacteria 3570
407 Ga0105248_10092032 3300009177 Bacteria 3415
408 Ga0105248_10107562 3300009177 Bacteria 3145
409 Ga0105248_10146472 3300009177 Bacteria 2665
410 Ga0105248_10282269 3300009177 Bacteria 1869
411 Ga0105248_10666141 3300009177 Bacteria 1174
412 Ga0105248_10695795 3300009177 Bacteria 1147
413 Ga0105237_10003830 3300009545 Bacteria 17683
414 Ga0105237_10064552 3300009545 Bacteria 3657
415 Ga0105237_10167781 3300009545 Unclassified 2195
416 Ga0105238_10023042 3300009551 Bacteria 6349
417 Ga0105238_10029980 3300009551 Bacteria 5537
418 Ga0105249_10000082 3300009553 Bacteria 137479
419 Ga0105249_10004186 3300009553 Bacteria 12459
420 Ga0105249_10041991 3300009553 Unclassified 4159
421 Ga0105249_10070421 3300009553 Bacteria 3228
422 Ga0105249_10082712 3300009553 Bacteria 2987
423 Ga0105249_10493700 3300009553 Bacteria 1268
424 Ga0105239_10025224 3300010375 Bacteria 6547
425 Ga0105239_10038591 3300010375 Bacteria 5235
426 Ga0105239_10243218 3300010375 Bacteria 2020
427 Ga0105239_10673004 3300010375 Unclassified 1183
428 Ga0105246_10061162 3300011119 Bacteria 2619
429 Ga0105246_10144930 3300011119 Bacteria 1791
430 Ga0105246_10168951 3300011119 Bacteria 1673
431 Ga0105246_10243114 3300011119 Bacteria 1424
432 Ga0105246_10292028 3300011119 Bacteria 1312
433 Ga0157373_10001858 3300013100 Bacteria 16027
434 Ga0157373_10034607 3300013100 Unclassified 3628
435 Ga0157373_10052993 3300013100 Bacteria 2885
436 Ga0157373_10073759 3300013100 Bacteria 2408
437 Ga0157373_10147792 3300013100 Bacteria 1653
438 Ga0157373_10156345 3300013100 Bacteria 1604
439 Ga0157371_10606367 3300013102 Unclassified 815
440 Ga0157370_10165512 3300013104 Unclassified 2056
441 Ga0157369_10063904 3300013105 Bacteria 3965
442 Ga0157374_10035586 3300013296 Bacteria 4556
443 Ga0157374_10175646 3300013296 Bacteria 2091
444 Ga0157378_10001322 3300013297 Bacteria 22280
445 Ga0157378_10032365 3300013297 Bacteria 4621
446 Ga0157378_10042818 3300013297 Unclassified 4019
447 Ga0157378_10046208 3300013297 Bacteria 3871
448 Ga0157378_10152807 3300013297 Unclassified 2152
449 Ga0157378_10211766 3300013297 Unclassified 1838
450 Ga0157378_10255179 3300013297 Bacteria 1680
451 Ga0157378_10405347 3300013297 Bacteria 1345
452 Ga0157378_10596690 3300013297 Bacteria 1115
453 Ga0163162_10000002 3300013306 Bacteria 717331
454 Ga0163162_10001013 3300013306 Bacteria 26117
455 Ga0163162_10018042 3300013306 Bacteria 6906
456 Ga0163162_10019028 3300013306 Bacteria 6734
457 Ga0163162_10034927 3300013306 Bacteria 5005
458 Ga0163162_10036450 3300013306 Bacteria 4903
459 Ga0163162_10064268 3300013306 Bacteria 3714
460 Ga0163162_10071625 3300013306 Unclassified 3520
461 Ga0163162_10167414 3300013306 Bacteria 2322
462 Ga0163162_10738049 3300013306 Bacteria 1105
463 Ga0157372_10016757 3300013307 Bacteria 7866
464 Ga0157372_10033719 3300013307 Bacteria 5626
465 Ga0157372_10081450 3300013307 Bacteria 3664
466 Ga0157372_10132186 3300013307 Bacteria 2872
467 Ga0157372_10522260 3300013307 Bacteria 1384
468 Ga0157372_11180763 3300013307 Unclassified 885
469 Ga0157375_10024922 3300013308 Bacteria 5546
470 Ga0157375_10060852 3300013308 Bacteria 3747
471 Ga0157375_10107277 3300013308 Viruses 2886
472 Ga0157375_10285441 3300013308 Unclassified 1814
473 Ga0157375_10345755 3300013308 Viruses 1653
474 Ga0163163_10000792 3300014325 Bacteria 26791
475 Ga0163163_10001129 3300014325 Bacteria 22678
476 Ga0163163_10002387 3300014325 Bacteria 15897
477 Ga0163163_10006454 3300014325 Bacteria 10257
478 Ga0163163_10052870 3300014325 Bacteria 4008
479 Ga0163163_10056305 3300014325 Bacteria 3886
480 Ga0163163_10105660 3300014325 Bacteria 2841
481 Ga0163163_10201794 3300014325 Bacteria 2037
482 Ga0163163_10274999 3300014325 Bacteria 1735
483 Ga0163163_10329416 3300014325 Unclassified 1581
484 Ga0163163_10513014 3300014325 Bacteria 1261
485 Ga0163163_10536805 3300014325 Bacteria 1232
486 Ga0163163_10766147 3300014325 Bacteria 1028
487 Ga0163163_10944930 3300014325 Unclassified 925
488 Ga0157380_10001721 3300014326 Bacteria 14423
489 Ga0157380_10003861 3300014326 Bacteria 10330
490 Ga0157380_10015660 3300014326 Bacteria 5574
491 Ga0182008_10094903 3300014497 Bacteria 1472
492 Ga0157377_10045491 3300014745 Unclassified 2452
493 Ga0157377_10270408 3300014745 Unclassified 1110
494 Ga0157379_10071775 3300014968 Bacteria 3097
495 Ga0157379_10099444 3300014968 Bacteria 2611
496 Ga0157379_10147467 3300014968 Bacteria 2122
497 Ga0157379_10428276 3300014968 Unclassified 1219
498 Ga0157376_10008850 3300014969 Bacteria 7283
499 Ga0163161_10004077 3300017792 Bacteria 10217
500 Ga0213876_10000456 3300021384 Bacteria 32826
501 Ga0213876_10001307 3300021384 Bacteria 15671
502 Ga0213876_10007222 3300021384 Bacteria 6057
503 Ga0207672_1000167 3300025223 Bacteria 9023
504 Ga0207697_10010841 3300025315 Bacteria 3877
505 Ga0207697_10117111 3300025315 Bacteria 1144
506 Ga0207653_10002903 3300025885 Bacteria 5445
507 Ga0207710_10000003 3300025900 Bacteria 1071597
508 Ga0207710_10002921 3300025900 Bacteria 7768
509 Ga0207688_10080761 3300025901 Bacteria 1856
510 Ga0207680_10101131 3300025903 Bacteria 1852
511 Ga0207680_10222257 3300025903 Bacteria 1295
512 Ga0207647_10002055 3300025904 Bacteria 15381
513 Ga0207647_10077733 3300025904 Unclassified 1994
514 Ga0207647_10182677 3300025904 Unclassified 1217
515 Ga0207647_10243138 3300025904 Unclassified 1033
516 Ga0207645_10088695 3300025907 Bacteria 1989
517 Ga0207643_10003641 3300025908 Bacteria 8303
518 Ga0207643_10012630 3300025908 Unclassified 4561
519 Ga0207643_10042201 3300025908 Bacteria 2571
520 Ga0207643_10166848 3300025908 Bacteria 1327
521 Ga0207643_10170511 3300025908 Unclassified 1313
522 Ga0207684_10000327 3300025910 Bacteria 67005
523 Ga0207684_10006374 3300025910 Bacteria 10757
524 Ga0207684_10011158 3300025910 Bacteria 7867
525 Ga0207684_10019280 3300025910 Bacteria 5836
526 Ga0207684_10075799 3300025910 Unclassified 2859
527 Ga0207654_10061504 3300025911 Unclassified 2197
528 Ga0207654_10081638 3300025911 Unclassified 1947
529 Ga0207654_10137003 3300025911 Bacteria 1556
530 Ga0207654_10231527 3300025911 Bacteria 1231
531 Ga0207654_10363727 3300025911 Unclassified 999
532 Ga0207654_10624022 3300025911 Bacteria 770
533 Ga0207707_10000142 3300025912 Bacteria 74613
534 Ga0207707_10008860 3300025912 Bacteria 8737
535 Ga0207707_10013516 3300025912 Bacteria 7115
536 Ga0207707_10134238 3300025912 Bacteria 2164
537 Ga0207707_10247811 3300025912 Bacteria 1548
538 Ga0207695_10145025 3300025913 Bacteria 2319
539 Ga0207671_10008571 3300025914 Bacteria 8650
540 Ga0207671_10021278 3300025914 Bacteria 4922
541 Ga0207671_10027714 3300025914 Unclassified 4235
542 Ga0207671_10058927 3300025914 Bacteria 2847
543 Ga0207671_10234845 3300025914 Bacteria 1439
544 Ga0207660_10002786 3300025917 Bacteria 11453
545 Ga0207660_10052273 3300025917 Bacteria 2908
546 Ga0207660_10094914 3300025917 Viruses 2218
547 Ga0207662_10010043 3300025918 Bacteria 5220
548 Ga0207662_10015191 3300025918 Bacteria 4329
549 Ga0207662_10086136 3300025918 Bacteria 1925
550 Ga0207662_10088016 3300025918 Unclassified 1906
551 Ga0207662_10146703 3300025918 Bacteria 1498
552 Ga0207662_10211930 3300025918 Bacteria 1258
553 Ga0207649_10053965 3300025920 Bacteria 2500
554 Ga0207649_10083594 3300025920 Bacteria 2073
555 Ga0207652_10000361 3300025921 Bacteria 47204
556 Ga0207652_10045654 3300025921 Bacteria 3735
557 Ga0207652_10069092 3300025921 Bacteria 3066
558 Ga0207652_10263533 3300025921 Unclassified 1555
559 Ga0207646_10003588 3300025922 Bacteria 17390
560 Ga0207646_10194872 3300025922 Bacteria 1830
561 Ga0207646_10284974 3300025922 Unclassified 1493
562 Ga0207681_10041364 3300025923 Bacteria 3072
563 Ga0207681_10113607 3300025923 Bacteria 1974
564 Ga0207694_10058438 3300025924 Bacteria 2999
565 Ga0207694_10071133 3300025924 Bacteria 2718
566 Ga0207650_10000313 3300025925 Bacteria 47889
567 Ga0207650_10088474 3300025925 Unclassified 2362
568 Ga0207650_10127877 3300025925 Bacteria 1985
569 Ga0207659_10670811 3300025926 Unclassified 887
570 Ga0207644_10006242 3300025931 Bacteria 7768
571 Ga0207644_10039335 3300025931 Bacteria 3338
572 Ga0207644_10073028 3300025931 Bacteria 2514
573 Ga0207644_10351120 3300025931 Bacteria 1198
574 Ga0207690_10002898 3300025932 Bacteria 10336
575 Ga0207690_10386069 3300025932 Unclassified 1114
576 Ga0207706_10034806 3300025933 Bacteria 4481
577 Ga0207706_10179685 3300025933 Unclassified 1858
578 Ga0207686_10066718 3300025934 Bacteria 2299
579 Ga0207686_10422081 3300025934 Bacteria 1020
580 Ga0207709_10009750 3300025935 Bacteria 5292
581 Ga0207709_10011773 3300025935 Bacteria 4822
582 Ga0207709_10211531 3300025935 Bacteria 1392
583 Ga0207670_10002988 3300025936 Bacteria 8925
584 Ga0207670_10005837 3300025936 Bacteria 6796
585 Ga0207670_10095794 3300025936 Bacteria 2109
586 Ga0207670_10160762 3300025936 Bacteria 1676
587 Ga0207670_10239436 3300025936 Unclassified 1397
588 Ga0207704_10046734 3300025938 Bacteria 2582
589 Ga0207665_10053071 3300025939 Unclassified 2732
590 Ga0207665_10132920 3300025939 Unclassified 1768
591 Ga0207665_10198050 3300025939 Bacteria 1462
592 Ga0207665_10472188 3300025939 Unclassified 965
593 Ga0207691_10000900 3300025940 Bacteria 29470
594 Ga0207691_10001099 3300025940 Bacteria 26879
595 Ga0207691_10101924 3300025940 Unclassified 2561
596 Ga0207691_10147009 3300025940 Bacteria 2074
597 Ga0207691_10348630 3300025940 Bacteria 1267
598 Ga0207711_10009470 3300025941 Bacteria 8127
599 Ga0207711_10060499 3300025941 Bacteria 3264
600 Ga0207711_10104861 3300025941 Bacteria 2506
601 Ga0207711_10255243 3300025941 Bacteria 1611
602 Ga0207711_10312417 3300025941 Bacteria 1451
603 Ga0207711_10598697 3300025941 Bacteria 1028
604 Ga0207689_10005258 3300025942 Bacteria 11605
605 Ga0207689_10007541 3300025942 Bacteria 9541
606 Ga0207689_10035808 3300025942 Bacteria 4121
607 Ga0207689_10077303 3300025942 Bacteria 2736
608 Ga0207689_10122646 3300025942 Bacteria 2137
609 Ga0207689_10122918 3300025942 Bacteria 2135
610 Ga0207689_10191300 3300025942 Unclassified 1688
611 Ga0207689_10561898 3300025942 Unclassified 959
612 Ga0207661_10351934 3300025944 Bacteria 1329
613 Ga0207679_10011061 3300025945 Bacteria 5828
614 Ga0207679_10140743 3300025945 Bacteria 1950
615 Ga0207667_10201046 3300025949 Bacteria 2044
616 Ga0207651_10003013 3300025960 Bacteria 8160
617 Ga0207651_10004834 3300025960 Bacteria 6860
618 Ga0207651_10041794 3300025960 Bacteria 3046
619 Ga0207651_10075570 3300025960 Bacteria 2405
620 Ga0207651_10179882 3300025960 Bacteria 1677
621 Ga0207651_10188311 3300025960 Bacteria 1644
622 Ga0207651_10243078 3300025960 Bacteria 1468
623 Ga0207651_10285664 3300025960 Unclassified 1366
624 Ga0207651_10288624 3300025960 Bacteria 1359
625 Ga0207712_10000075 3300025961 Bacteria 120693
626 Ga0207712_10005296 3300025961 Bacteria 8148
627 Ga0207712_10033030 3300025961 Bacteria 3496
628 Ga0207712_10070098 3300025961 Bacteria 2517
629 Ga0207712_10164949 3300025961 Bacteria 1726
630 Ga0207712_10463546 3300025961 Bacteria 1077
631 Ga0207668_10094155 3300025972 Bacteria 2208
632 Ga0207640_10052429 3300025981 Bacteria 2657
633 Ga0207640_10238404 3300025981 Unclassified 1404
634 Ga0207658_10136522 3300025986 Bacteria 1979
635 Ga0207658_10724769 3300025986 Unclassified 900
636 Ga0207703_10000118 3300026035 Bacteria 95317
637 Ga0207703_10048587 3300026035 Bacteria 3426
638 Ga0207703_10075988 3300026035 Bacteria 2785
639 Ga0207703_10181224 3300026035 Unclassified 1859
640 Ga0207703_10433600 3300026035 Bacteria 1225
641 Ga0207703_10498915 3300026035 Bacteria 1142
642 Ga0207639_10012957 3300026041 Bacteria 5818
643 Ga0207639_10013199 3300026041 Bacteria 5776
644 Ga0207639_10167671 3300026041 Bacteria 1857
645 Ga0207639_10273744 3300026041 Unclassified 1482
646 Ga0207639_10319434 3300026041 Bacteria 1378
647 Ga0207639_10417970 3300026041 Bacteria 1212
648 Ga0207678_10611512 3300026067 Unclassified 956
649 Ga0207708_10000149 3300026075 Bacteria 56107
650 Ga0207708_10032572 3300026075 Bacteria 3958
651 Ga0207708_10035028 3300026075 Bacteria 3820
652 Ga0207708_10095463 3300026075 Bacteria 2297
653 Ga0207702_10411385 3300026078 Bacteria 1306
654 Ga0207702_10506417 3300026078 Unclassified 1177
655 Ga0207641_10065626 3300026088 Bacteria 3105
656 Ga0207641_10069708 3300026088 Bacteria 3020
657 Ga0207641_10092706 3300026088 Bacteria 2646
658 Ga0207641_10303643 3300026088 Bacteria 1508
659 Ga0207641_10440741 3300026088 Unclassified 1257
660 Ga0207641_11163525 3300026088 Bacteria 771
661 Ga0207648_10010767 3300026089 Bacteria 8641
662 Ga0207648_10099781 3300026089 Bacteria 2543
663 Ga0207648_10236459 3300026089 Bacteria 1626
664 Ga0207648_10329851 3300026089 Unclassified 1372
665 Ga0207648_10339380 3300026089 Bacteria 1353
666 Ga0207676_10030219 3300026095 Bacteria 4064
667 Ga0207676_10055713 3300026095 Bacteria 3105
668 Ga0207676_10071960 3300026095 Bacteria 2777
669 Ga0207676_10094810 3300026095 Bacteria 2460
670 Ga0207676_10136198 3300026095 Bacteria 2095
671 Ga0207676_10280528 3300026095 Bacteria 1512
672 Ga0207676_10902141 3300026095 Unclassified 867
673 Ga0207674_10000115 3300026116 Bacteria 93114
674 Ga0207674_10052508 3300026116 Unclassified 4157
675 Ga0207674_10081385 3300026116 Bacteria 3241
676 Ga0207674_10081537 3300026116 Bacteria 3237
677 Ga0207674_10183079 3300026116 Bacteria 2046
678 Ga0207674_10309286 3300026116 Unclassified 1529
679 Ga0207674_10403195 3300026116 Unclassified 1321
680 Ga0207674_10451493 3300026116 Unclassified 1242
681 Ga0207674_10467076 3300026116 Bacteria 1220
682 Ga0207674_10475087 3300026116 Bacteria 1208
683 Ga0207674_10529639 3300026116 Bacteria 1138
684 Ga0207675_100004070 3300026118 Bacteria 14154
685 Ga0207675_100054853 3300026118 Unclassified 3718
686 Ga0207675_100067857 3300026118 Bacteria 3334
687 Ga0207675_100085625 3300026118 Bacteria 2958
688 Ga0207675_100087553 3300026118 Bacteria 2925
689 Ga0207675_100097610 3300026118 Bacteria 2767
690 Ga0207675_100110978 3300026118 Unclassified 2588
691 Ga0207675_100385111 3300026118 Bacteria 1379
692 Ga0207675_100568033 3300026118 Unclassified 1135
693 Ga0207698_10151975 3300026142 Bacteria 2011
694 Ga0207698_10165393 3300026142 Bacteria 1941
695 Ga0207428_10009062 3300027907 Bacteria 8949
696 Ga0268265_10085360 3300028380 Bacteria 2505
697 Ga0268265_10144162 3300028380 Viruses 1998
698 Ga0268265_10368297 3300028380 Bacteria 1318
699 Ga0268265_10389014 3300028380 Bacteria 1285
700 Ga0268264_10009332 3300028381 Bacteria 8123
701 Ga0268264_10014553 3300028381 Bacteria 6462
702 Ga0268264_10117979 3300028381 Bacteria 2335
703 Ga0268264_10212015 3300028381 Bacteria 1778
704 Ga0268264_10362442 3300028381 Unclassified 1383
705 Ga0268264_10679371 3300028381 Bacteria 1021
706 Ga0268264_11217815 3300028381 Unclassified 762
707 Ga0307408_100013368 3300031548 Bacteria 5446
708 Ga0307408_100051065 3300031548 Unclassified 2977
709 Ga0307408_100929913 3300031548 Bacteria 797
710 Ga0307405_10028822 3300031731 Bacteria 3238
711 Ga0307405_10662984 3300031731 Unclassified 859
712 Ga0307413_10016901 3300031824 Bacteria 3786
713 Ga0307413_10237889 3300031824 Bacteria 1342
714 Ga0307410_10012790 3300031852 Bacteria 4869
715 Ga0307410_10037850 3300031852 Bacteria 3155
716 Ga0307410_10057723 3300031852 Unclassified 2644
717 Ga0307410_10075240 3300031852 Unclassified 2354
718 Ga0307410_10508618 3300031852 Unclassified 992
719 Ga0307406_10010023 3300031901 Bacteria 5332
720 Ga0307406_10013760 3300031901 Unclassified 4641
721 Ga0307406_10068185 3300031901 Unclassified 2322
722 Ga0307406_10294236 3300031901 Bacteria 1244
723 Ga0307406_10349934 3300031901 Unclassified 1154
724 Ga0307407_10016091 3300031903 Bacteria 3715
725 Ga0307407_10070884 3300031903 Unclassified 2073
726 Ga0307412_10045781 3300031911 Unclassified 2862
727 Ga0307412_10065581 3300031911 Bacteria 2458
728 Ga0307412_10087522 3300031911 Bacteria 2170
729 Ga0307409_100000663 3300031995 Bacteria 15255
730 Ga0307409_100138670 3300031995 Bacteria 2092
731 Ga0307409_100298806 3300031995 Bacteria 1497
732 Ga0307416_100071864 3300032002 Bacteria 2877
733 Ga0307416_100503468 3300032002 Bacteria 1276
734 Ga0307416_100906647 3300032002 Bacteria 982
735 Ga0307416_101036095 3300032002 Unclassified 924
736 Ga0307414_10006298 3300032004 Bacteria 6603
737 Ga0307414_10039321 3300032004 Bacteria 3185
738 Ga0307411_10013130 3300032005 Bacteria 4555
739 Ga0307411_10019309 3300032005 Bacteria 3935
740 Ga0307411_10053741 3300032005 Bacteria 2641
741 Ga0307411_10071903 3300032005 Bacteria 2347
742 Ga0307411_10158877 3300032005 Bacteria 1690
743 Ga0307411_10177398 3300032005 Unclassified 1613
744 Ga0307415_100005152 3300032126 Bacteria 6896
745 Ga0307415_100026563 3300032126 Unclassified 3654
746 Ga0307415_100048519 3300032126 Bacteria 2866
747 Ga0307415_100145386 3300032126 Unclassified 1817
748 Ga0373949_0015015 3300035090 Bacteria 1727
749 Ga0373951_0002234 3300035091 Bacteria 4921
750 Ga0373942_0056745 3300035207 Unclassified 1112
751 Ga0373961_0081109 3300035241 Bacteria 1021
752 Ga0373962_0013515 3300035242 Bacteria 2070
753 Ga0373931_0065689 3300035691 Unclassified 1967
754 Ga0395900_0128868 3300037418 Bacteria 2594
755 Ga0395900_0292844 3300037418 Bacteria 1616
756 Ga0395898_0072037 3300037466 Bacteria 3339
757 Ga0395898_0541380 3300037466 Bacteria 1106
758 Ga0395905_0015010 3300037471 Bacteria 7383
759 Ga0395905_0480250 3300037471 Bacteria 1142
760 Ga0436364_1261410 3300037853 Bacteria 2421
761 Ga0395901_0907650 3300038443 Bacteria 862
762 Ga0242422_00406 3300038699 Bacteria 2692
763 Ga0436365_0475046 3300039437 Unclassified 1634
764 Ga0436365_1035707 3300039437 Bacteria 53176
765 Ga0436365_1254673 3300039437 Bacteria 6056
766 Ga0436365_1522569 3300039437 Bacteria 30271
767 Ga0436365_1814617 3300039437 Bacteria 1893
768 Ga0439439_0060500 3300041406 Unclassified 1005
769 Ga0439455_0018825 3300042012 Bacteria 1623
770 Ga0439446_0058904 3300042156 Bacteria 1159
771 Ga0439458_0011023 3300042157 Bacteria 2018
772 Ga0439434_0053027 3300042435 Bacteria 1259
773 Ga0439460_0016911 3300042461 Unclassified 1948
774 Ga0495582_0253697 3300046473 Bacteria 1009
775 Ga0495663_0000250 3300046525 Bacteria 20919
776 Ga0495598_0000324 3300046537 Bacteria 8561
777 Ga0495621_0000620 3300046539 Bacteria 8926
778 Ga0495645_0084295 3300046543 Bacteria 2276
779 Ga0495656_0246557 3300046615 Bacteria 901
780 Ga0495668_0092278 3300046616 Bacteria 1659
781 Ga0495669_0152306 3300046684 Bacteria 1095
782 Ga0496104_0196700 3300048907 Bacteria 1928
783 Ga0496104_0241948 3300048907 Unclassified 1717
784 Ga0496106_0110556 3300048909 Bacteria 2139
785 Ga0496107_0605884 3300048910 Unclassified 809
786 Ga0496108_0696700 3300048911 Bacteria 881
787 Ga0496109_0386309 3300048912 Bacteria 1323
788 Ga0496110_0540762 3300048913 Unclassified 1059
789 Ga0496110_0552282 3300048913 Bacteria 1047
790 Ga0496112_0220922 3300048915 Unclassified 1851
791 Ga0496112_0228025 3300048915 Bacteria 1818
792 Ga0496112_0363818 3300048915 Bacteria 1388
793 Ga0496112_0653568 3300048915 Bacteria 981
794 Ga0496113_0018347 3300048916 Bacteria 4871
795 Ga0496113_0237208 3300048916 Bacteria 1455
796 Ga0496113_0282661 3300048916 Bacteria 1327
797 Ga0501291_002148 3300049514 Unclassified 2338
798 Ga0501291_024371 3300049514 Bacteria 983
799 Ga0501292_005738 3300049515 Unclassified 1741
800 Ga0501292_011067 3300049515 Bacteria 1360
801 Ga0501292_052455 3300049515 Unclassified 725
802 Ga0501295_033862 3300049518 Unclassified 1024
803 Ga0501296_000385 3300049519 Unclassified 4432
804 Ga0501296_003153 3300049519 Unclassified 1752
805 Ga0501297_010357 3300049520 Unclassified 1054
806 Ga0501298_002662 3300049521 Unclassified 2719
807 Ga0501298_006179 3300049521 Unclassified 1950
808 Ga0501298_050066 3300049521 Unclassified 865
809 Ga0501299_009132 3300049522 Unclassified 1628
810 Ga0501299_030963 3300049522 Bacteria 1032
811 Ga0501302_001276 3300049525 Unclassified 1377
812 Ga0501303_006396 3300049526 Unclassified 1027
813 Ga0501038_0002990 3300049574 Bacteria 15762
814 Ga0501198_004236 3300049649 Bacteria 1986
815 Ga0501202_045306 3300049652 Unclassified 961
816 Ga0501206_009230 3300049653 Unclassified 1310
817 Ga0501207_007861 3300049654 Unclassified 1530
818 Ga0501207_025630 3300049654 Unclassified 968
819 Ga0501208_016359 3300049655 Bacteria 1153
820 Ga0501216_001287 3300049660 Bacteria 3359
821 Ga0501216_003973 3300049660 Unclassified 2178
822 Ga0501216_005192 3300049660 Unclassified 1953
823 Ga0501217_000999 3300049661 Bacteria 5114
824 Ga0501217_003179 3300049661 Bacteria 3295
825 Ga0501217_007155 3300049661 Unclassified 2387
826 Ga0501217_011956 3300049661 Bacteria 1927
827 Ga0501223_011764 3300049663 Unclassified 1756
828 Ga0501224_001194 3300049664 Bacteria 3408
829 Ga0501224_006398 3300049664 Bacteria 1707
830 Ga0501227_001750 3300049665 Bacteria 4819
831 Ga0501227_005350 3300049665 Bacteria 2747
832 Ga0501228_007948 3300049666 Unclassified 1004
833 Ga0501233_002330 3300049668 Bacteria 3343
834 Ga0501233_002767 3300049668 Bacteria 3112
835 Ga0501233_050116 3300049668 Bacteria 1009
836 Ga0501233_058559 3300049668 Bacteria 951
837 Ga0501235_009168 3300049669 Bacteria 2162
838 Ga0501235_010494 3300049669 Unclassified 2024
839 Ga0501236_018163 3300049670 Bacteria 1012
840 Ga0501242_014433 3300049674 Unclassified 978
841 Ga0501243_018322 3300049675 Bacteria 1140
842 Ga0501249_011636 3300049679 Unclassified 1850
843 Ga0501253_023569 3300049683 Unclassified 1108
844 Ga0501257_011757 3300049686 Bacteria 2000
845 Ga0501257_013698 3300049686 Bacteria 1860
846 Ga0501257_030136 3300049686 Bacteria 1305
847 Ga0501259_000994 3300049688 Unclassified 4712
848 Ga0501261_004238 3300049690 Unclassified 1767
849 Ga0501225_0003206 3300049705 Unclassified 4998
850 Ga0501225_0005408 3300049705 Bacteria 3752
851 Ga0501225_0005503 3300049705 Bacteria 3715
852 Ga0501225_0049288 3300049705 Unclassified 1171
853 Ga0501225_0081332 3300049705 Bacteria 930
854 Ga0501229_017520 3300049706 Unclassified 935
855 Ga0501234_004139 3300049707 Unclassified 2277
856 Ga0501234_007201 3300049707 Unclassified 1742
857 Ga0501234_020238 3300049707 Bacteria 1058
858 Ga0501245_010136 3300049708 Unclassified 1359
859 Ga0501245_037458 3300049708 Unclassified 823
860 Ga0501080_0409654 3300049742 Bacteria 1219
861 Ga0501232_003194 3300049757 Bacteria 1480
862 Ga0501241_021038 3300049758 Bacteria 1202
863 Ga0501268_011948 3300049765 Unclassified 1381
864 Ga0501270_016125 3300049767 Unclassified 1076
865 Ga0501272_000969 3300049769 Unclassified 2629
866 Ga0501273_019455 3300049770 Bacteria 910
867 Ga0501274_010100 3300049771 Unclassified 866
868 Ga0501283_000500 3300049779 Bacteria 5167
869 Ga0501283_006315 3300049779 Bacteria 1657
870 Ga0501212_000526 3300049851 Bacteria 3771
871 Ga0501212_005485 3300049851 Bacteria 1676
872 Ga0501226_001467 3300049853 Bacteria 3013
873 nmdc:mga05p37_102787_c1 3300050507 Bacteria 3518
874 nmdc:mga05p37_106883_c1 3300050507 Bacteria 3443
875 nmdc:mga05p37_229121_c1 3300050507 Bacteria 2239
876 nmdc:mga05p37_233694_c1 3300050507 Bacteria 2214
877 nmdc:mga05p37_358293_c1 3300050507 Bacteria 1715
878 nmdc:mga05p37_396484_c1 3300050507 Bacteria 1612
879 nmdc:mga05p37_458242_c1 3300050507 Bacteria 1474
880 nmdc:mga05p37_491371_c1 3300050507 Bacteria 1411
881 nmdc:mga05p37_63333_c1 3300050507 Bacteria 4550
882 nmdc:mga09592_123925_c1 3300050508 Bacteria 2221
883 nmdc:mga0qj67_203653_c1 3300050509 Bacteria 1608
884 nmdc:mga06r32_209432_c1 3300050510 Bacteria 1937
885 nmdc:mga06r32_605969_c1 3300050510 Bacteria 1066
886 nmdc:mga06r32_76972_c1 3300050510 Unclassified 3240
887 nmdc:mga08y16_15514_c1 3300050511 Bacteria 8011
888 nmdc:mga0n895_217147_c1 3300050512 Bacteria 1942
889 nmdc:mga0n895_33535_c1 3300050512 Bacteria 4936
890 nmdc:mga0rr50_364557_c1 3300050513 Bacteria 1217
891 nmdc:mga0rr50_439611_c1 3300050513 Unclassified 1105
892 nmdc:mga08x19_166377_c1 3300050514 Unclassified 1500
893 nmdc:mga0a205_13389_c1 3300050515 Bacteria 7636
894 nmdc:mga0a205_24407_c1 3300050515 Bacteria 5749
895 nmdc:mga0a205_267608_c1 3300050515 Unclassified 1586
896 nmdc:mga0a205_31937_c1 3300050515 Bacteria 5047
897 nmdc:mga0a205_48678_c1 3300050515 Unclassified 4092
898 nmdc:mga0a205_489906_c1 3300050515 Bacteria 1087
899 nmdc:mga0a205_538296_c1 3300050515 Unclassified 1023
900 nmdc:mga0a205_727360_c1 3300050515 Bacteria 842
901 nmdc:mga0a205_72874_c1 3300050515 Bacteria 3318
902 Ga0495601_0039808 3300053077 Unclassified 2944
903 Ga0500616_0002784 3300053153 Bacteria 14088
904 Ga0530510_0139104 3300061734 Bacteria 1788

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049683 Ga0501253_023569 Ga0501253_023569_497_1087 194
2 3300009147 Ga0114129_10009329 Ga0114129_1000932912 208
3 3300050507 nmdc:mga05p37_106883_c1 nmdc:mga05p37_106883_c1_1122_1907 208
4 3300031901 Ga0307406_10013760 Ga0307406_100137605 212
5 3300039437 Ga0436365_1522569 Ga0436365_1522569_10266_11009 212
6 3300006852 Ga0075433_10068108 Ga0075433_100681082 216
7 3300006871 Ga0075434_100053330 Ga0075434_1000533304 216
8 3300025911 Ga0207654_10363727 Ga0207654_103637272 216
9 3300039437 Ga0436365_1035707 Ga0436365_1035707_39528_40271 216
10 3300009093 Ga0105240_10524349 Ga0105240_105243492 217
11 3300009174 Ga0105241_10213673 Ga0105241_102136732 217
12 3300013307 Ga0157372_10132186 Ga0157372_101321862 217
13 3300049515 Ga0501292_011067 Ga0501292_011067_326_1000 217
14 3300050512 nmdc:mga0n895_33535_c1 nmdc:mga0n895_33535_c1_277_1023 217
15 3300031824 Ga0307413_10016901 Ga0307413_100169014 218
16 3300031852 Ga0307410_10012790 Ga0307410_100127904 218
17 3300031903 Ga0307407_10016091 Ga0307407_100160913 218
18 3300031911 Ga0307412_10065581 Ga0307412_100655813 218
19 3300031995 Ga0307409_100000663 Ga0307409_1000006634 218
20 3300032004 Ga0307414_10039321 Ga0307414_100393213 218
21 3300032005 Ga0307411_10013130 Ga0307411_100131302 218
22 3300042156 Ga0439446_0058904 Ga0439446_0058904_389_1147 218
23 3300031548 Ga0307408_100051065 Ga0307408_1000510653 219
24 3300031901 Ga0307406_10294236 Ga0307406_102942361 219
25 3300025936 Ga0207670_10005837 Ga0207670_100058375 220
26 3300049514 Ga0501291_002148 Ga0501291_002148_1635_2303 220
27 3300049515 Ga0501292_052455 Ga0501292_052455_44_712 220
28 3300049518 Ga0501295_033862 Ga0501295_033862_334_1002 220
29 3300049521 Ga0501298_006179 Ga0501298_006179_37_705 220
30 3300049522 Ga0501299_009132 Ga0501299_009132_17_685 220
31 3300049525 Ga0501302_001276 Ga0501302_001276_696_1364 220
32 3300049526 Ga0501303_006396 Ga0501303_006396_324_992 220
33 3300049674 Ga0501242_014433 Ga0501242_014433_254_922 220
34 3300049771 Ga0501274_010100 Ga0501274_010100_68_736 220
35 3300005293 Ga0065715_10109566 Ga0065715_101095662 221
36 3300005327 Ga0070658_10191196 Ga0070658_101911963 221
37 3300005329 Ga0070683_100156087 Ga0070683_1001560872 221
38 3300005344 Ga0070661_100138665 Ga0070661_1001386652 221
39 3300005355 Ga0070671_100123203 Ga0070671_1001232032 221
40 3300005455 Ga0070663_100458645 Ga0070663_1004586452 221
41 3300005535 Ga0070684_100026876 Ga0070684_1000268764 221
42 3300005564 Ga0070664_100052355 Ga0070664_1000523553 221
43 3300005578 Ga0068854_100083876 Ga0068854_1000838762 221
44 3300005616 Ga0068852_100037636 Ga0068852_1000376363 221
45 3300005834 Ga0068851_10076656 Ga0068851_100766561 221
46 3300009147 Ga0114129_10036140 Ga0114129_100361406 221
47 3300009177 Ga0105248_10695795 Ga0105248_106957952 221
48 3300013297 Ga0157378_10255179 Ga0157378_102551792 221
49 3300013306 Ga0163162_10036450 Ga0163162_100364501 221
50 3300013308 Ga0157375_10060852 Ga0157375_100608526 221
51 3300013308 Ga0157375_10345755 Ga0157375_103457554 221
52 3300025920 Ga0207649_10083594 Ga0207649_100835943 221
53 3300025940 Ga0207691_10001099 Ga0207691_1000109910 221
54 3300025941 Ga0207711_10598697 Ga0207711_105986972 221
55 3300025960 Ga0207651_10041794 Ga0207651_100417943 221
56 3300026067 Ga0207678_10611512 Ga0207678_106115122 221
57 3300031731 Ga0307405_10662984 Ga0307405_106629841 221
58 3300031852 Ga0307410_10508618 Ga0307410_105086182 221
59 3300031995 Ga0307409_100138670 Ga0307409_1001386702 221
60 3300031995 Ga0307409_100298806 Ga0307409_1002988062 221
61 3300032002 Ga0307416_101036095 Ga0307416_1010360952 221
62 3300032005 Ga0307411_10158877 Ga0307411_101588772 221
63 3300032126 Ga0307415_100048519 Ga0307415_1000485193 221
64 3300049521 Ga0501298_050066 Ga0501298_050066_45_755 221
65 3300050507 nmdc:mga05p37_229121_c1 nmdc:mga05p37_229121_c1_1125_1874 221
66 3300005330 Ga0070690_100156539 Ga0070690_1001565392 222
67 3300005530 Ga0070679_100041381 Ga0070679_1000413812 222
68 3300005539 Ga0068853_100377510 Ga0068853_1003775102 222
69 3300005564 Ga0070664_100284655 Ga0070664_1002846552 222
70 3300005577 Ga0068857_100145335 Ga0068857_1001453352 222
71 3300005578 Ga0068854_100199672 Ga0068854_1001996722 222
72 3300005614 Ga0068856_100689821 Ga0068856_1006898211 222
73 3300005616 Ga0068852_100082560 Ga0068852_1000825603 222
74 3300005834 Ga0068851_10216519 Ga0068851_102165192 222
75 3300005842 Ga0068858_100411793 Ga0068858_1004117931 222
76 3300005843 Ga0068860_100320671 Ga0068860_1003206712 222
77 3300005844 Ga0068862_100566137 Ga0068862_1005661372 222
78 3300006173 Ga0070716_100380921 Ga0070716_1003809212 222
79 3300006358 Ga0068871_100152698 Ga0068871_1001526982 222
80 3300009093 Ga0105240_10090698 Ga0105240_100906982 222
81 3300009174 Ga0105241_10042488 Ga0105241_100424883 222
82 3300009545 Ga0105237_10064552 Ga0105237_100645524 222
83 3300010375 Ga0105239_10025224 Ga0105239_100252243 222
84 3300013100 Ga0157373_10073759 Ga0157373_100737593 222
85 3300013104 Ga0157370_10165512 Ga0157370_101655122 222
86 3300013105 Ga0157369_10063904 Ga0157369_100639042 222
87 3300013307 Ga0157372_10033719 Ga0157372_100337192 222
88 3300013307 Ga0157372_10081450 Ga0157372_100814504 222
89 3300025911 Ga0207654_10061504 Ga0207654_100615042 222
90 3300025912 Ga0207707_10008860 Ga0207707_100088602 222
91 3300025913 Ga0207695_10145025 Ga0207695_101450253 222
92 3300025914 Ga0207671_10021278 Ga0207671_100212784 222
93 3300025921 Ga0207652_10069092 Ga0207652_100690921 222
94 3300025940 Ga0207691_10348630 Ga0207691_103486302 222
95 3300025981 Ga0207640_10238404 Ga0207640_102384042 222
96 3300026078 Ga0207702_10506417 Ga0207702_105064171 222
97 3300026116 Ga0207674_10081385 Ga0207674_100813852 222
98 3300026116 Ga0207674_10309286 Ga0207674_103092862 222
99 3300031852 Ga0307410_10057723 Ga0307410_100577233 222
100 3300031903 Ga0307407_10070884 Ga0307407_100708842 222
101 3300046473 Ga0495582_0253697 Ga0495582_0253697_236_949 222
102 3300046543 Ga0495645_0084295 Ga0495645_0084295_1489_2202 222
103 3300048913 Ga0496110_0540762 Ga0496110_0540762_300_974 222
104 3300053077 Ga0495601_0039808 Ga0495601_0039808_944_1657 222
105 3300003203 JGI25406J46586_10002315 JGI25406J46586_100023156 223
106 3300005985 Ga0081539_10000073 Ga0081539_10000073135 223
107 3300037471 Ga0395905_0015010 Ga0395905_0015010_3074_3868 223
108 3300005340 Ga0070689_100005978 Ga0070689_1000059783 224
109 3300005618 Ga0068864_100193288 Ga0068864_1001932882 224
110 3300005843 Ga0068860_100056848 Ga0068860_1000568482 224
111 3300005844 Ga0068862_100047231 Ga0068862_1000472313 224
112 3300006237 Ga0097621_100102742 Ga0097621_1001027422 224
113 3300009553 Ga0105249_10041991 Ga0105249_100419912 224
114 3300013306 Ga0163162_10071625 Ga0163162_100716252 224
115 3300025942 Ga0207689_10035808 Ga0207689_100358084 224
116 3300026088 Ga0207641_10303643 Ga0207641_103036432 224
117 3300026095 Ga0207676_10071960 Ga0207676_100719602 224
118 3300005467 Ga0070706_100003498 Ga0070706_1000034982 225
119 3300006914 Ga0075436_100178566 Ga0075436_1001785662 225
120 3300025910 Ga0207684_10006374 Ga0207684_100063744 225
121 3300050514 nmdc:mga08x19_166377_c1 nmdc:mga08x19_166377_c1_615_1343 225
122 3300050515 nmdc:mga0a205_538296_c1 nmdc:mga0a205_538296_c1_201_950 226
123 3300005545 Ga0070695_100127482 Ga0070695_1001274822 227
124 3300005445 Ga0070708_100021762 Ga0070708_1000217623 229
125 3300005471 Ga0070698_100008222 Ga0070698_1000082226 229
126 3300049514 Ga0501291_024371 Ga0501291_024371_34_729 229
127 3300002459 JGI24751J29686_10000099 JGI24751J29686_1000009933 230
128 3300005331 Ga0070670_100000297 Ga0070670_10000029715 230
129 3300005355 Ga0070671_100016473 Ga0070671_1000164734 230
130 3300014325 Ga0163163_10000792 Ga0163163_1000079215 230
131 3300021384 Ga0213876_10000456 Ga0213876_1000045613 230
132 3300025925 Ga0207650_10000313 Ga0207650_1000031333 230
133 3300025931 Ga0207644_10006242 Ga0207644_100062427 230
134 3300037471 Ga0395905_0480250 Ga0395905_0480250_177_1004 230
135 3300053153 Ga0500616_0002784 Ga0500616_0002784_8278_9006 231
136 3300009093 Ga0105240_10494646 Ga0105240_104946462 232
137 3300005985 Ga0081539_10001715 Ga0081539_100017157 233
138 3300025925 Ga0207650_10088474 Ga0207650_100884742 233
139 3300009147 Ga0114129_10284886 Ga0114129_102848862 234
140 3300021384 Ga0213876_10001307 Ga0213876_100013073 234
141 3300005347 Ga0070668_100010711 Ga0070668_1000107112 235
142 3300005547 Ga0070693_100441813 Ga0070693_1004418131 235
143 3300005617 Ga0068859_100007476 Ga0068859_1000074767 235
144 3300006931 Ga0097620_100007476 Ga0097620_1000074767 235
145 3300009098 Ga0105245_10580807 Ga0105245_105808071 235
146 3300009148 Ga0105243_10242299 Ga0105243_102422991 235
147 3300009553 Ga0105249_10000082 Ga0105249_1000008229 235
148 3300013306 Ga0163162_10000002 Ga0163162_10000002514 235
149 3300025935 Ga0207709_10211531 Ga0207709_102115312 235
150 3300025941 Ga0207711_10255243 Ga0207711_102552432 235
151 3300025960 Ga0207651_10179882 Ga0207651_101798823 235
152 3300025961 Ga0207712_10000075 Ga0207712_1000007563 235
153 3300025972 Ga0207668_10094155 Ga0207668_100941552 235
154 3300026075 Ga0207708_10000149 Ga0207708_1000014930 235
155 3300026088 Ga0207641_10440741 Ga0207641_104407413 235
156 3300031548 Ga0307408_100013368 Ga0307408_1000133684 235
157 3300031731 Ga0307405_10028822 Ga0307405_100288222 235
158 3300031824 Ga0307413_10237889 Ga0307413_102378892 235
159 3300031852 Ga0307410_10037850 Ga0307410_100378503 235
160 3300031901 Ga0307406_10010023 Ga0307406_100100234 235
161 3300031911 Ga0307412_10087522 Ga0307412_100875222 235
162 3300032004 Ga0307414_10006298 Ga0307414_100062982 235
163 3300032005 Ga0307411_10053741 Ga0307411_100537413 235
164 3300032126 Ga0307415_100005152 Ga0307415_1000051526 235
165 3300005293 Ga0065715_10161319 Ga0065715_101613192 236
166 3300005406 Ga0070703_10206557 Ga0070703_102065571 236
167 3300005441 Ga0070700_100000087 Ga0070700_10000008738 236
168 3300005518 Ga0070699_100001043 Ga0070699_10000104310 236
169 3300005536 Ga0070697_100022130 Ga0070697_1000221304 236
170 3300005545 Ga0070695_100012598 Ga0070695_1000125984 236
171 3300005549 Ga0070704_100019042 Ga0070704_1000190422 236
172 3300005617 Ga0068859_100246767 Ga0068859_1002467672 236
173 3300006931 Ga0097620_100246767 Ga0097620_1002467673 236
174 3300009545 Ga0105237_10167781 Ga0105237_101677812 236
175 3300013100 Ga0157373_10156345 Ga0157373_101563452 236
176 3300014325 Ga0163163_10766147 Ga0163163_107661472 236
177 3300014497 Ga0182008_10094903 Ga0182008_100949032 236
178 3300021384 Ga0213876_10007222 Ga0213876_100072222 236
179 3300025912 Ga0207707_10247811 Ga0207707_102478112 236
180 3300025914 Ga0207671_10027714 Ga0207671_100277144 236
181 3300026035 Ga0207703_10433600 Ga0207703_104336002 236
182 3300026088 Ga0207641_11163525 Ga0207641_111635251 236
183 3300026116 Ga0207674_10529639 Ga0207674_105296392 236
184 3300037418 Ga0395900_0292844 Ga0395900_0292844_347_1063 236
185 3300037466 Ga0395898_0541380 Ga0395898_0541380_289_1005 236
186 3300038443 Ga0395901_0907650 Ga0395901_0907650_71_787 236
187 3300039437 Ga0436365_1254673 Ga0436365_1254673_4924_5664 236
188 3300042435 Ga0439434_0053027 Ga0439434_0053027_520_1239 236
189 3300048915 Ga0496112_0363818 Ga0496112_0363818_76_792 236
190 3300049649 Ga0501198_004236 Ga0501198_004236_1048_1779 236
191 3300049660 Ga0501216_001287 Ga0501216_001287_2071_2802 236
192 3300049661 Ga0501217_003179 Ga0501217_003179_2011_2742 236
193 3300049664 Ga0501224_001194 Ga0501224_001194_2069_2800 236
194 3300049665 Ga0501227_001750 Ga0501227_001750_2037_2768 236
195 3300049668 Ga0501233_002767 Ga0501233_002767_355_1086 236
196 3300049670 Ga0501236_018163 Ga0501236_018163_204_935 236
197 3300049686 Ga0501257_013698 Ga0501257_013698_986_1717 236
198 3300049688 Ga0501259_000994 Ga0501259_000994_1340_2071 236
199 3300049705 Ga0501225_0003206 Ga0501225_0003206_1852_2583 236
200 3300049758 Ga0501241_021038 Ga0501241_021038_418_1149 236
201 3300049851 Ga0501212_000526 Ga0501212_000526_1025_1756 236
202 3300049853 Ga0501226_001467 Ga0501226_001467_2052_2783 236
203 3300050510 nmdc:mga06r32_209432_c1 nmdc:mga06r32_209432_c1_249_980 236
204 3300005295 Ga0065707_10287383 Ga0065707_102873832 237
205 3300005549 Ga0070704_100049855 Ga0070704_1000498552 237
206 3300009174 Ga0105241_10434586 Ga0105241_104345862 237
207 3300025911 Ga0207654_10624022 Ga0207654_106240221 237
208 3300037853 Ga0436364_1261410 Ga0436364_1261410_826_1560 237
209 3300039437 Ga0436365_1814617 Ga0436365_1814617_1021_1755 237
210 3300005364 Ga0070673_100036706 Ga0070673_1000367062 238
211 3300005468 Ga0070707_100002790 Ga0070707_10000279015 238
212 3300005549 Ga0070704_100001584 Ga0070704_1000015849 238
213 3300025922 Ga0207646_10003588 Ga0207646_100035888 238
214 3300025960 Ga0207651_10004834 Ga0207651_100048344 238
215 3300037418 Ga0395900_0128868 Ga0395900_0128868_824_1564 238
216 3300002074 JGI24748J21848_1000008 JGI24748J21848_1000008134 239
217 3300002076 JGI24749J21850_1015254 JGI24749J21850_10152542 239
218 3300002239 JGI24034J26672_10000002 JGI24034J26672_10000002343 239
219 3300005293 Ga0065715_10233378 Ga0065715_102333782 239
220 3300005353 Ga0070669_100049747 Ga0070669_1000497472 239
221 3300005438 Ga0070701_10316323 Ga0070701_103163231 239
222 3300005441 Ga0070700_100202744 Ga0070700_1002027442 239
223 3300005444 Ga0070694_100290935 Ga0070694_1002909352 239
224 3300005459 Ga0068867_100270792 Ga0068867_1002707922 239
225 3300005536 Ga0070697_100116781 Ga0070697_1001167813 239
226 3300005544 Ga0070686_100137052 Ga0070686_1001370522 239
227 3300005842 Ga0068858_100000300 Ga0068858_1000003002 239
228 3300005843 Ga0068860_100243806 Ga0068860_1002438061 239
229 3300005985 Ga0081539_10038097 Ga0081539_100380973 239
230 3300006881 Ga0068865_100353928 Ga0068865_1003539281 239
231 3300009011 Ga0105251_10109763 Ga0105251_101097632 239
232 3300009092 Ga0105250_10105234 Ga0105250_101052342 239
233 3300009093 Ga0105240_10321544 Ga0105240_103215443 239
234 3300009101 Ga0105247_10000001 Ga0105247_10000001303 239
235 3300009174 Ga0105241_10097826 Ga0105241_100978262 239
236 3300009177 Ga0105248_10146472 Ga0105248_101464722 239
237 3300009551 Ga0105238_10023042 Ga0105238_100230427 239
238 3300009553 Ga0105249_10070421 Ga0105249_100704212 239
239 3300013102 Ga0157371_10606367 Ga0157371_106063671 239
240 3300013297 Ga0157378_10596690 Ga0157378_105966902 239
241 3300013306 Ga0163162_10019028 Ga0163162_100190286 239
242 3300014326 Ga0157380_10001721 Ga0157380_100017212 239
243 3300025223 Ga0207672_1000167 Ga0207672_10001673 239
244 3300025315 Ga0207697_10117111 Ga0207697_101171111 239
245 3300025900 Ga0207710_10000003 Ga0207710_10000003334 239
246 3300025901 Ga0207688_10080761 Ga0207688_100807612 239
247 3300025904 Ga0207647_10182677 Ga0207647_101826772 239
248 3300025910 Ga0207684_10011158 Ga0207684_100111588 239
249 3300025911 Ga0207654_10231527 Ga0207654_102315272 239
250 3300025914 Ga0207671_10234845 Ga0207671_102348452 239
251 3300025923 Ga0207681_10041364 Ga0207681_100413643 239
252 3300025924 Ga0207694_10071133 Ga0207694_100711334 239
253 3300025926 Ga0207659_10670811 Ga0207659_106708111 239
254 3300025934 Ga0207686_10422081 Ga0207686_104220812 239
255 3300025940 Ga0207691_10147009 Ga0207691_101470092 239
256 3300025941 Ga0207711_10060499 Ga0207711_100604994 239
257 3300025945 Ga0207679_10140743 Ga0207679_101407431 239
258 3300025961 Ga0207712_10005296 Ga0207712_100052961 239
259 3300026035 Ga0207703_10000118 Ga0207703_100001184 239
260 3300026041 Ga0207639_10319434 Ga0207639_103194341 239
261 3300026118 Ga0207675_100087553 Ga0207675_1000875532 239
262 3300028381 Ga0268264_11217815 Ga0268264_112178151 239
263 3300035241 Ga0373961_0081109 Ga0373961_0081109_32_757 239
264 3300035242 Ga0373962_0013515 Ga0373962_0013515_1133_1858 239
265 3300049742 Ga0501080_0409654 Ga0501080_0409654_299_1051 239
266 3300005293 Ga0065715_10197836 Ga0065715_101978362 240
267 3300005330 Ga0070690_100000586 Ga0070690_1000005868 240
268 3300005337 Ga0070682_100032646 Ga0070682_1000326464 240
269 3300005343 Ga0070687_100216181 Ga0070687_1002161811 240
270 3300005345 Ga0070692_10003268 Ga0070692_100032687 240
271 3300005406 Ga0070703_10004244 Ga0070703_100042443 240
272 3300005440 Ga0070705_100005473 Ga0070705_1000054736 240
273 3300005444 Ga0070694_100028768 Ga0070694_1000287683 240
274 3300005459 Ga0068867_100144220 Ga0068867_1001442201 240
275 3300005471 Ga0070698_100001335 Ga0070698_1000013355 240
276 3300005518 Ga0070699_100064874 Ga0070699_1000648743 240
277 3300005518 Ga0070699_100342736 Ga0070699_1003427362 240
278 3300005536 Ga0070697_100000135 Ga0070697_10000013520 240
279 3300005544 Ga0070686_100022113 Ga0070686_1000221132 240
280 3300005546 Ga0070696_100007058 Ga0070696_1000070584 240
281 3300005546 Ga0070696_100013848 Ga0070696_1000138486 240
282 3300005547 Ga0070693_100006262 Ga0070693_1000062624 240
283 3300005549 Ga0070704_100017738 Ga0070704_1000177384 240
284 3300005616 Ga0068852_100364776 Ga0068852_1003647762 240
285 3300005617 Ga0068859_100204665 Ga0068859_1002046652 240
286 3300005719 Ga0068861_100068272 Ga0068861_1000682722 240
287 3300005842 Ga0068858_100028604 Ga0068858_1000286045 240
288 3300005842 Ga0068858_100243520 Ga0068858_1002435202 240
289 3300006931 Ga0097620_100204658 Ga0097620_1002046582 240
290 3300009176 Ga0105242_10266237 Ga0105242_102662372 240
291 3300009545 Ga0105237_10003830 Ga0105237_1000383010 240
292 3300013297 Ga0157378_10046208 Ga0157378_100462084 240
293 3300013297 Ga0157378_10405347 Ga0157378_104053472 240
294 3300013306 Ga0163162_10167414 Ga0163162_101674142 240
295 3300014968 Ga0157379_10428276 Ga0157379_104282762 240
296 3300025885 Ga0207653_10002903 Ga0207653_100029031 240
297 3300025904 Ga0207647_10243138 Ga0207647_102431381 240
298 3300025914 Ga0207671_10008571 Ga0207671_100085716 240
299 3300025918 Ga0207662_10015191 Ga0207662_100151913 240
300 3300025918 Ga0207662_10088016 Ga0207662_100880163 240
301 3300025939 Ga0207665_10198050 Ga0207665_101980502 240
302 3300026075 Ga0207708_10032572 Ga0207708_100325722 240
303 3300026089 Ga0207648_10099781 Ga0207648_100997812 240
304 3300026118 Ga0207675_100097610 Ga0207675_1000976103 240
305 3300026142 Ga0207698_10165393 Ga0207698_101653933 240
306 3300048916 Ga0496113_0018347 Ga0496113_0018347_208_933 240
307 3300050515 nmdc:mga0a205_727360_c1 nmdc:mga0a205_727360_c1_23_748 240
308 3300005290 Ga0065712_10085397 Ga0065712_100853972 241
309 3300005290 Ga0065712_10243771 Ga0065712_102437711 241
310 3300005334 Ga0068869_100145361 Ga0068869_1001453612 241
311 3300005336 Ga0070680_100193837 Ga0070680_1001938372 241
312 3300005340 Ga0070689_100253736 Ga0070689_1002537362 241
313 3300005343 Ga0070687_100252496 Ga0070687_1002524962 241
314 3300005345 Ga0070692_10031990 Ga0070692_100319902 241
315 3300005355 Ga0070671_100079341 Ga0070671_1000793413 241
316 3300005364 Ga0070673_100038484 Ga0070673_1000384842 241
317 3300005364 Ga0070673_100083506 Ga0070673_1000835063 241
318 3300005364 Ga0070673_100542617 Ga0070673_1005426172 241
319 3300005365 Ga0070688_100206569 Ga0070688_1002065692 241
320 3300005441 Ga0070700_100021734 Ga0070700_1000217342 241
321 3300005441 Ga0070700_100195633 Ga0070700_1001956332 241
322 3300005444 Ga0070694_100000781 Ga0070694_1000007812 241
323 3300005444 Ga0070694_100066085 Ga0070694_1000660852 241
324 3300005444 Ga0070694_100199823 Ga0070694_1001998232 241
325 3300005457 Ga0070662_100032856 Ga0070662_1000328562 241
326 3300005459 Ga0068867_100228819 Ga0068867_1002288192 241
327 3300005471 Ga0070698_100049187 Ga0070698_1000491873 241
328 3300005536 Ga0070697_100050242 Ga0070697_1000502423 241
329 3300005546 Ga0070696_100150820 Ga0070696_1001508202 241
330 3300005548 Ga0070665_100015048 Ga0070665_1000150488 241
331 3300005548 Ga0070665_100424870 Ga0070665_1004248702 241
332 3300005549 Ga0070704_100039611 Ga0070704_1000396112 241
333 3300005549 Ga0070704_100178618 Ga0070704_1001786182 241
334 3300005563 Ga0068855_100159977 Ga0068855_1001599773 241
335 3300005578 Ga0068854_100053767 Ga0068854_1000537672 241
336 3300005615 Ga0070702_100026802 Ga0070702_1000268024 241
337 3300005615 Ga0070702_100097811 Ga0070702_1000978111 241
338 3300005617 Ga0068859_100087979 Ga0068859_1000879794 241
339 3300005618 Ga0068864_100146065 Ga0068864_1001460653 241
340 3300005840 Ga0068870_10153923 Ga0068870_101539232 241
341 3300005843 Ga0068860_100031178 Ga0068860_1000311786 241
342 3300005844 Ga0068862_100086255 Ga0068862_1000862553 241
343 3300005844 Ga0068862_100320809 Ga0068862_1003208092 241
344 3300005844 Ga0068862_100342648 Ga0068862_1003426482 241
345 3300006237 Ga0097621_100004289 Ga0097621_1000042894 241
346 3300006358 Ga0068871_100002162 Ga0068871_1000021626 241
347 3300006358 Ga0068871_100466771 Ga0068871_1004667711 241
348 3300006844 Ga0075428_100100612 Ga0075428_1001006123 241
349 3300006844 Ga0075428_100118600 Ga0075428_1001186003 241
350 3300006847 Ga0075431_100186618 Ga0075431_1001866182 241
351 3300006852 Ga0075433_10039767 Ga0075433_100397674 241
352 3300006871 Ga0075434_100065989 Ga0075434_1000659893 241
353 3300006880 Ga0075429_100094296 Ga0075429_1000942961 241
354 3300006931 Ga0097620_100087961 Ga0097620_1000879614 241
355 3300009093 Ga0105240_10033643 Ga0105240_100336437 241
356 3300009101 Ga0105247_10212765 Ga0105247_102127653 241
357 3300009147 Ga0114129_10043736 Ga0114129_100437365 241
358 3300009147 Ga0114129_10299469 Ga0114129_102994692 241
359 3300009177 Ga0105248_10030836 Ga0105248_100308365 241
360 3300009177 Ga0105248_10084506 Ga0105248_100845064 241
361 3300009177 Ga0105248_10666141 Ga0105248_106661412 241
362 3300010375 Ga0105239_10673004 Ga0105239_106730042 241
363 3300013296 Ga0157374_10035586 Ga0157374_100355863 241
364 3300013297 Ga0157378_10001322 Ga0157378_100013227 241
365 3300013297 Ga0157378_10211766 Ga0157378_102117661 241
366 3300013306 Ga0163162_10001013 Ga0163162_100010133 241
367 3300013306 Ga0163162_10738049 Ga0163162_107380492 241
368 3300013307 Ga0157372_10016757 Ga0157372_100167573 241
369 3300013308 Ga0157375_10024922 Ga0157375_100249222 241
370 3300013308 Ga0157375_10285441 Ga0157375_102854412 241
371 3300014325 Ga0163163_10001129 Ga0163163_1000112913 241
372 3300014745 Ga0157377_10045491 Ga0157377_100454912 241
373 3300014968 Ga0157379_10071775 Ga0157379_100717752 241
374 3300025903 Ga0207680_10222257 Ga0207680_102222571 241
375 3300025917 Ga0207660_10052273 Ga0207660_100522734 241
376 3300025918 Ga0207662_10086136 Ga0207662_100861363 241
377 3300025933 Ga0207706_10034806 Ga0207706_100348062 241
378 3300025939 Ga0207665_10053071 Ga0207665_100530713 241
379 3300025939 Ga0207665_10472188 Ga0207665_104721881 241
380 3300025941 Ga0207711_10312417 Ga0207711_103124171 241
381 3300025942 Ga0207689_10122646 Ga0207689_101226462 241
382 3300025949 Ga0207667_10201046 Ga0207667_102010462 241
383 3300025960 Ga0207651_10075570 Ga0207651_100755702 241
384 3300025960 Ga0207651_10288624 Ga0207651_102886242 241
385 3300025981 Ga0207640_10052429 Ga0207640_100524292 241
386 3300026035 Ga0207703_10498915 Ga0207703_104989152 241
387 3300026041 Ga0207639_10417970 Ga0207639_104179701 241
388 3300026075 Ga0207708_10095463 Ga0207708_100954632 241
389 3300026089 Ga0207648_10236459 Ga0207648_102364592 241
390 3300026089 Ga0207648_10329851 Ga0207648_103298511 241
391 3300026089 Ga0207648_10339380 Ga0207648_103393802 241
392 3300028380 Ga0268265_10085360 Ga0268265_100853602 241
393 3300028380 Ga0268265_10368297 Ga0268265_103682972 241
394 3300028381 Ga0268264_10362442 Ga0268264_103624421 241
395 3300032002 Ga0307416_100503468 Ga0307416_1005034682 241
396 3300035691 Ga0373931_0065689 Ga0373931_0065689_391_1119 241
397 3300039437 Ga0436365_0475046 Ga0436365_0475046_169_909 241
398 3300042012 Ga0439455_0018825 Ga0439455_0018825_160_906 241
399 3300042157 Ga0439458_0011023 Ga0439458_0011023_37_783 241
400 3300046525 Ga0495663_0000250 Ga0495663_0000250_9522_10250 241
401 3300046537 Ga0495598_0000324 Ga0495598_0000324_5327_6055 241
402 3300046539 Ga0495621_0000620 Ga0495621_0000620_619_1347 241
403 3300046616 Ga0495668_0092278 Ga0495668_0092278_345_1073 241
404 3300048907 Ga0496104_0196700 Ga0496104_0196700_824_1555 241
405 3300048912 Ga0496109_0386309 Ga0496109_0386309_175_903 241
406 3300048915 Ga0496112_0220922 Ga0496112_0220922_626_1357 241
407 3300049520 Ga0501297_010357 Ga0501297_010357_213_941 241
408 3300049654 Ga0501207_025630 Ga0501207_025630_163_891 241
409 3300049661 Ga0501217_007155 Ga0501217_007155_1375_2103 241
410 3300049665 Ga0501227_005350 Ga0501227_005350_219_947 241
411 3300049666 Ga0501228_007948 Ga0501228_007948_172_900 241
412 3300049668 Ga0501233_058559 Ga0501233_058559_192_920 241
413 3300049675 Ga0501243_018322 Ga0501243_018322_148_876 241
414 3300049686 Ga0501257_030136 Ga0501257_030136_25_753 241
415 3300049705 Ga0501225_0081332 Ga0501225_0081332_139_867 241
416 3300049706 Ga0501229_017520 Ga0501229_017520_94_822 241
417 3300049707 Ga0501234_020238 Ga0501234_020238_59_787 241
418 3300049708 Ga0501245_037458 Ga0501245_037458_78_806 241
419 3300049765 Ga0501268_011948 Ga0501268_011948_529_1257 241
420 3300050507 nmdc:mga05p37_63333_c1 nmdc:mga05p37_63333_c1_1735_2463 241
421 3300050510 nmdc:mga06r32_605969_c1 nmdc:mga06r32_605969_c1_29_754 241
422 3300050515 nmdc:mga0a205_72874_c1 nmdc:mga0a205_72874_c1_2136_2867 241
423 3300061734 Ga0530510_0139104 Ga0530510_0139104_286_1014 241
424 3300000532 CNAas_1000478 CNAas_10004783 242
425 3300003203 JGI25406J46586_10004596 JGI25406J46586_100045965 242
426 3300003322 rootL2_10068297 rootL2_100682972 242
427 3300005288 Ga0065714_10014729 Ga0065714_100147293 242
428 3300005288 Ga0065714_10064424 Ga0065714_10064424109 242
429 3300005289 Ga0065704_10009481 Ga0065704_100094812 242
430 3300005289 Ga0065704_10093396 Ga0065704_100933963 242
431 3300005290 Ga0065712_10000117 Ga0065712_10000117109 242
432 3300005290 Ga0065712_10074270 Ga0065712_100742704 242
433 3300005293 Ga0065715_10000523 Ga0065715_100005232 242
434 3300005293 Ga0065715_10019608 Ga0065715_100196082 242
435 3300005293 Ga0065715_10107615 Ga0065715_101076153 242
436 3300005293 Ga0065715_10148450 Ga0065715_101484502 242
437 3300005293 Ga0065715_10167384 Ga0065715_101673842 242
438 3300005293 Ga0065715_10211093 Ga0065715_102110932 242
439 3300005295 Ga0065707_10336285 Ga0065707_103362851 242
440 3300005329 Ga0070683_100471866 Ga0070683_1004718662 242
441 3300005330 Ga0070690_100001671 Ga0070690_1000016713 242
442 3300005331 Ga0070670_100002514 Ga0070670_1000025142 242
443 3300005331 Ga0070670_100110509 Ga0070670_1001105092 242
444 3300005334 Ga0068869_100003815 Ga0068869_1000038152 242
445 3300005334 Ga0068869_100095699 Ga0068869_1000956991 242
446 3300005336 Ga0070680_100139028 Ga0070680_1001390282 242
447 3300005337 Ga0070682_100069047 Ga0070682_1000690472 242
448 3300005338 Ga0068868_100099889 Ga0068868_1000998892 242
449 3300005338 Ga0068868_100676395 Ga0068868_1006763951 242
450 3300005340 Ga0070689_100000425 Ga0070689_10000042512 242
451 3300005340 Ga0070689_100008912 Ga0070689_1000089123 242
452 3300005340 Ga0070689_100060971 Ga0070689_1000609712 242
453 3300005340 Ga0070689_100063432 Ga0070689_1000634322 242
454 3300005343 Ga0070687_100248487 Ga0070687_1002484872 242
455 3300005344 Ga0070661_100076305 Ga0070661_1000763053 242
456 3300005344 Ga0070661_100099213 Ga0070661_1000992132 242
457 3300005345 Ga0070692_10021801 Ga0070692_100218014 242
458 3300005347 Ga0070668_100246991 Ga0070668_1002469912 242
459 3300005353 Ga0070669_100025762 Ga0070669_1000257622 242
460 3300005355 Ga0070671_100069648 Ga0070671_1000696482 242
461 3300005364 Ga0070673_100054380 Ga0070673_1000543804 242
462 3300005364 Ga0070673_100064557 Ga0070673_1000645574 242
463 3300005364 Ga0070673_100185583 Ga0070673_1001855831 242
464 3300005365 Ga0070688_100316283 Ga0070688_1003162832 242
465 3300005366 Ga0070659_100317167 Ga0070659_1003171672 242
466 3300005367 Ga0070667_100519001 Ga0070667_1005190011 242
467 3300005438 Ga0070701_10154103 Ga0070701_101541032 242
468 3300005440 Ga0070705_100056223 Ga0070705_1000562232 242
469 3300005440 Ga0070705_100181824 Ga0070705_1001818242 242
470 3300005441 Ga0070700_100032947 Ga0070700_1000329472 242
471 3300005441 Ga0070700_100049244 Ga0070700_1000492443 242
472 3300005444 Ga0070694_100143014 Ga0070694_1001430142 242
473 3300005444 Ga0070694_100351504 Ga0070694_1003515042 242
474 3300005444 Ga0070694_100408277 Ga0070694_1004082772 242
475 3300005445 Ga0070708_100000281 Ga0070708_10000028124 242
476 3300005445 Ga0070708_100437422 Ga0070708_1004374221 242
477 3300005445 Ga0070708_100528633 Ga0070708_1005286331 242
478 3300005457 Ga0070662_100023433 Ga0070662_1000234334 242
479 3300005458 Ga0070681_10006412 Ga0070681_100064127 242
480 3300005459 Ga0068867_100044438 Ga0068867_1000444382 242
481 3300005467 Ga0070706_100000146 Ga0070706_10000014662 242
482 3300005467 Ga0070706_100001677 Ga0070706_10000167725 242
483 3300005467 Ga0070706_100011659 Ga0070706_1000116598 242
484 3300005467 Ga0070706_100148069 Ga0070706_1001480692 242
485 3300005467 Ga0070706_100184375 Ga0070706_1001843751 242
486 3300005467 Ga0070706_100210199 Ga0070706_1002101992 242
487 3300005468 Ga0070707_100054355 Ga0070707_1000543555 242
488 3300005468 Ga0070707_100112338 Ga0070707_1001123382 242
489 3300005471 Ga0070698_100007291 Ga0070698_1000072916 242
490 3300005471 Ga0070698_100009193 Ga0070698_1000091933 242
491 3300005471 Ga0070698_100018185 Ga0070698_1000181856 242
492 3300005471 Ga0070698_100055583 Ga0070698_1000555832 242
493 3300005518 Ga0070699_100009689 Ga0070699_1000096894 242
494 3300005530 Ga0070679_100016260 Ga0070679_1000162606 242
495 3300005530 Ga0070679_100184479 Ga0070679_1001844792 242
496 3300005536 Ga0070697_100000976 Ga0070697_1000009766 242
497 3300005536 Ga0070697_100053292 Ga0070697_1000532922 242
498 3300005536 Ga0070697_100065615 Ga0070697_1000656152 242
499 3300005536 Ga0070697_100215403 Ga0070697_1002154032 242
500 3300005539 Ga0068853_100048451 Ga0068853_1000484513 242
501 3300005539 Ga0068853_100048498 Ga0068853_1000484983 242
502 3300005543 Ga0070672_100442008 Ga0070672_1004420082 242
503 3300005545 Ga0070695_100091079 Ga0070695_1000910791 242
504 3300005545 Ga0070695_100185034 Ga0070695_1001850342 242
505 3300005545 Ga0070695_100257988 Ga0070695_1002579882 242
506 3300005545 Ga0070695_100312825 Ga0070695_1003128251 242
507 3300005545 Ga0070695_100552136 Ga0070695_1005521361 242
508 3300005546 Ga0070696_100071749 Ga0070696_1000717493 242
509 3300005546 Ga0070696_100130947 Ga0070696_1001309472 242
510 3300005546 Ga0070696_100359696 Ga0070696_1003596961 242
511 3300005547 Ga0070693_100005553 Ga0070693_1000055536 242
512 3300005547 Ga0070693_100052201 Ga0070693_1000522013 242
513 3300005547 Ga0070693_100179153 Ga0070693_1001791532 242
514 3300005549 Ga0070704_100137681 Ga0070704_1001376813 242
515 3300005549 Ga0070704_100185070 Ga0070704_1001850702 242
516 3300005549 Ga0070704_100423242 Ga0070704_1004232422 242
517 3300005564 Ga0070664_100010132 Ga0070664_1000101326 242
518 3300005577 Ga0068857_100001808 Ga0068857_1000018088 242
519 3300005577 Ga0068857_100408414 Ga0068857_1004084142 242
520 3300005578 Ga0068854_100145429 Ga0068854_1001454292 242
521 3300005578 Ga0068854_100260121 Ga0068854_1002601211 242
522 3300005615 Ga0070702_100010986 Ga0070702_1000109864 242
523 3300005615 Ga0070702_100038735 Ga0070702_1000387352 242
524 3300005615 Ga0070702_100041770 Ga0070702_1000417703 242
525 3300005617 Ga0068859_100023588 Ga0068859_1000235886 242
526 3300005617 Ga0068859_100103724 Ga0068859_1001037242 242
527 3300005618 Ga0068864_100007609 Ga0068864_1000076097 242
528 3300005618 Ga0068864_100046576 Ga0068864_1000465764 242
529 3300005618 Ga0068864_100109445 Ga0068864_1001094453 242
530 3300005618 Ga0068864_100213827 Ga0068864_1002138272 242
531 3300005618 Ga0068864_100316615 Ga0068864_1003166152 242
532 3300005618 Ga0068864_100412452 Ga0068864_1004124521 242
533 3300005719 Ga0068861_100008148 Ga0068861_1000081483 242
534 3300005719 Ga0068861_100051532 Ga0068861_1000515324 242
535 3300005719 Ga0068861_100079766 Ga0068861_1000797662 242
536 3300005840 Ga0068870_10002880 Ga0068870_100028803 242
537 3300005840 Ga0068870_10062967 Ga0068870_100629672 242
538 3300005841 Ga0068863_100137722 Ga0068863_1001377222 242
539 3300005841 Ga0068863_100328218 Ga0068863_1003282182 242
540 3300005841 Ga0068863_100473311 Ga0068863_1004733112 242
541 3300005842 Ga0068858_100064512 Ga0068858_1000645122 242
542 3300005842 Ga0068858_100108487 Ga0068858_1001084873 242
543 3300005842 Ga0068858_100214827 Ga0068858_1002148272 242
544 3300005843 Ga0068860_100017487 Ga0068860_1000174873 242
545 3300005843 Ga0068860_100098417 Ga0068860_1000984173 242
546 3300005843 Ga0068860_100987627 Ga0068860_1009876271 242
547 3300005844 Ga0068862_100076747 Ga0068862_1000767472 242
548 3300005844 Ga0068862_100091340 Ga0068862_1000913402 242
549 3300005844 Ga0068862_100380669 Ga0068862_1003806692 242
550 3300005985 Ga0081539_10000537 Ga0081539_1000053733 242
551 3300005985 Ga0081539_10005214 Ga0081539_100052143 242
552 3300006173 Ga0070716_100007698 Ga0070716_1000076982 242
553 3300006237 Ga0097621_100014340 Ga0097621_1000143402 242
554 3300006237 Ga0097621_100020722 Ga0097621_1000207222 242
555 3300006358 Ga0068871_100012458 Ga0068871_1000124583 242
556 3300006358 Ga0068871_100165898 Ga0068871_1001658982 242
557 3300006847 Ga0075431_100064456 Ga0075431_1000644562 242
558 3300006852 Ga0075433_10013013 Ga0075433_100130134 242
559 3300006852 Ga0075433_10187089 Ga0075433_101870891 242
560 3300006852 Ga0075433_10410053 Ga0075433_104100532 242
561 3300006871 Ga0075434_100016372 Ga0075434_1000163726 242
562 3300006871 Ga0075434_100238946 Ga0075434_1002389462 242
563 3300006880 Ga0075429_100040781 Ga0075429_1000407812 242
564 3300006881 Ga0068865_100251450 Ga0068865_1002514502 242
565 3300006931 Ga0097620_100023588 Ga0097620_1000235882 242
566 3300006931 Ga0097620_100103723 Ga0097620_1001037233 242
567 3300007076 Ga0075435_100016854 Ga0075435_1000168542 242
568 3300009011 Ga0105251_10083198 Ga0105251_100831982 242
569 3300009094 Ga0111539_10000228 Ga0111539_1000022823 242
570 3300009101 Ga0105247_10000944 Ga0105247_100009445 242
571 3300009101 Ga0105247_10402434 Ga0105247_104024341 242
572 3300009147 Ga0114129_10010021 Ga0114129_1001002114 242
573 3300009147 Ga0114129_10070255 Ga0114129_100702553 242
574 3300009147 Ga0114129_10104964 Ga0114129_101049644 242
575 3300009147 Ga0114129_10222357 Ga0114129_102223573 242
576 3300009147 Ga0114129_10256404 Ga0114129_102564043 242
577 3300009147 Ga0114129_10290623 Ga0114129_102906233 242
578 3300009147 Ga0114129_10421697 Ga0114129_104216972 242
579 3300009147 Ga0114129_11039024 Ga0114129_110390242 242
580 3300009148 Ga0105243_10009655 Ga0105243_100096556 242
581 3300009148 Ga0105243_10154001 Ga0105243_101540013 242
582 3300009148 Ga0105243_10332241 Ga0105243_103322412 242
583 3300009148 Ga0105243_10484654 Ga0105243_104846542 242
584 3300009148 Ga0105243_10749931 Ga0105243_107499311 242
585 3300009174 Ga0105241_10039156 Ga0105241_100391562 242
586 3300009174 Ga0105241_10054835 Ga0105241_100548353 242
587 3300009174 Ga0105241_10126473 Ga0105241_101264731 242
588 3300009174 Ga0105241_10311307 Ga0105241_103113072 242
589 3300009174 Ga0105241_10362202 Ga0105241_103622022 242
590 3300009174 Ga0105241_10539184 Ga0105241_105391841 242
591 3300009176 Ga0105242_10119011 Ga0105242_101190112 242
592 3300009176 Ga0105242_10367094 Ga0105242_103670942 242
593 3300009176 Ga0105242_10457641 Ga0105242_104576411 242
594 3300009177 Ga0105248_10092032 Ga0105248_100920322 242
595 3300009177 Ga0105248_10282269 Ga0105248_102822692 242
596 3300009551 Ga0105238_10029980 Ga0105238_100299801 242
597 3300009553 Ga0105249_10082712 Ga0105249_100827123 242
598 3300011119 Ga0105246_10061162 Ga0105246_100611623 242
599 3300011119 Ga0105246_10144930 Ga0105246_101449301 242
600 3300011119 Ga0105246_10168951 Ga0105246_101689512 242
601 3300011119 Ga0105246_10243114 Ga0105246_102431141 242
602 3300013100 Ga0157373_10001858 Ga0157373_100018585 242
603 3300013100 Ga0157373_10034607 Ga0157373_100346073 242
604 3300013100 Ga0157373_10052993 Ga0157373_100529933 242
605 3300013100 Ga0157373_10147792 Ga0157373_101477922 242
606 3300013296 Ga0157374_10175646 Ga0157374_101756462 242
607 3300013297 Ga0157378_10042818 Ga0157378_100428183 242
608 3300013306 Ga0163162_10064268 Ga0163162_100642682 242
609 3300013307 Ga0157372_10522260 Ga0157372_105222602 242
610 3300013307 Ga0157372_11180763 Ga0157372_111807631 242
611 3300013308 Ga0157375_10107277 Ga0157375_101072772 242
612 3300014325 Ga0163163_10006454 Ga0163163_1000645410 242
613 3300014325 Ga0163163_10052870 Ga0163163_100528703 242
614 3300014325 Ga0163163_10056305 Ga0163163_100563053 242
615 3300014325 Ga0163163_10105660 Ga0163163_101056602 242
616 3300014325 Ga0163163_10201794 Ga0163163_102017941 242
617 3300014325 Ga0163163_10329416 Ga0163163_103294162 242
618 3300014325 Ga0163163_10513014 Ga0163163_105130141 242
619 3300014325 Ga0163163_10536805 Ga0163163_105368052 242
620 3300014325 Ga0163163_10944930 Ga0163163_109449302 242
621 3300014326 Ga0157380_10003861 Ga0157380_100038618 242
622 3300014745 Ga0157377_10270408 Ga0157377_102704082 242
623 3300014968 Ga0157379_10099444 Ga0157379_100994443 242
624 3300025900 Ga0207710_10002921 Ga0207710_100029214 242
625 3300025904 Ga0207647_10002055 Ga0207647_100020556 242
626 3300025904 Ga0207647_10077733 Ga0207647_100777332 242
627 3300025908 Ga0207643_10003641 Ga0207643_100036412 242
628 3300025908 Ga0207643_10012630 Ga0207643_100126304 242
629 3300025908 Ga0207643_10166848 Ga0207643_101668482 242
630 3300025908 Ga0207643_10170511 Ga0207643_101705112 242
631 3300025910 Ga0207684_10000327 Ga0207684_1000032744 242
632 3300025910 Ga0207684_10019280 Ga0207684_100192806 242
633 3300025910 Ga0207684_10075799 Ga0207684_100757993 242
634 3300025912 Ga0207707_10013516 Ga0207707_100135166 242
635 3300025912 Ga0207707_10134238 Ga0207707_101342383 242
636 3300025917 Ga0207660_10094914 Ga0207660_100949141 242
637 3300025918 Ga0207662_10146703 Ga0207662_101467032 242
638 3300025918 Ga0207662_10211930 Ga0207662_102119302 242
639 3300025920 Ga0207649_10053965 Ga0207649_100539651 242
640 3300025921 Ga0207652_10045654 Ga0207652_100456542 242
641 3300025921 Ga0207652_10263533 Ga0207652_102635332 242
642 3300025922 Ga0207646_10194872 Ga0207646_101948722 242
643 3300025924 Ga0207694_10058438 Ga0207694_100584384 242
644 3300025925 Ga0207650_10127877 Ga0207650_101278772 242
645 3300025931 Ga0207644_10039335 Ga0207644_100393353 242
646 3300025931 Ga0207644_10073028 Ga0207644_100730283 242
647 3300025931 Ga0207644_10351120 Ga0207644_103511202 242
648 3300025932 Ga0207690_10002898 Ga0207690_100028986 242
649 3300025932 Ga0207690_10386069 Ga0207690_103860692 242
650 3300025933 Ga0207706_10179685 Ga0207706_101796852 242
651 3300025935 Ga0207709_10009750 Ga0207709_100097504 242
652 3300025936 Ga0207670_10002988 Ga0207670_100029887 242
653 3300025936 Ga0207670_10095794 Ga0207670_100957942 242
654 3300025936 Ga0207670_10239436 Ga0207670_102394362 242
655 3300025939 Ga0207665_10132920 Ga0207665_101329203 242
656 3300025942 Ga0207689_10007541 Ga0207689_100075418 242
657 3300025942 Ga0207689_10077303 Ga0207689_100773032 242
658 3300025942 Ga0207689_10122918 Ga0207689_101229182 242
659 3300025942 Ga0207689_10191300 Ga0207689_101913001 242
660 3300025942 Ga0207689_10561898 Ga0207689_105618982 242
661 3300025944 Ga0207661_10351934 Ga0207661_103519342 242
662 3300025945 Ga0207679_10011061 Ga0207679_100110614 242
663 3300025960 Ga0207651_10188311 Ga0207651_101883111 242
664 3300025960 Ga0207651_10243078 Ga0207651_102430782 242
665 3300025960 Ga0207651_10285664 Ga0207651_102856642 242
666 3300025961 Ga0207712_10070098 Ga0207712_100700982 242
667 3300025961 Ga0207712_10463546 Ga0207712_104635462 242
668 3300025986 Ga0207658_10724769 Ga0207658_107247691 242
669 3300026035 Ga0207703_10048587 Ga0207703_100485874 242
670 3300026035 Ga0207703_10181224 Ga0207703_101812242 242
671 3300026041 Ga0207639_10012957 Ga0207639_100129573 242
672 3300026041 Ga0207639_10013199 Ga0207639_100131993 242
673 3300026041 Ga0207639_10273744 Ga0207639_102737442 242
674 3300026075 Ga0207708_10035028 Ga0207708_100350282 242
675 3300026088 Ga0207641_10069708 Ga0207641_100697083 242
676 3300026088 Ga0207641_10092706 Ga0207641_100927063 242
677 3300026095 Ga0207676_10030219 Ga0207676_100302193 242
678 3300026095 Ga0207676_10094810 Ga0207676_100948104 242
679 3300026095 Ga0207676_10136198 Ga0207676_101361982 242
680 3300026095 Ga0207676_10280528 Ga0207676_102805282 242
681 3300026095 Ga0207676_10902141 Ga0207676_109021411 242
682 3300026116 Ga0207674_10000115 Ga0207674_1000011543 242
683 3300026116 Ga0207674_10052508 Ga0207674_100525084 242
684 3300026116 Ga0207674_10081537 Ga0207674_100815374 242
685 3300026116 Ga0207674_10183079 Ga0207674_101830792 242
686 3300026116 Ga0207674_10403195 Ga0207674_104031952 242
687 3300026116 Ga0207674_10451493 Ga0207674_104514931 242
688 3300026116 Ga0207674_10467076 Ga0207674_104670762 242
689 3300026116 Ga0207674_10475087 Ga0207674_104750872 242
690 3300026118 Ga0207675_100004070 Ga0207675_10000407010 242
691 3300026118 Ga0207675_100054853 Ga0207675_1000548532 242
692 3300026118 Ga0207675_100067857 Ga0207675_1000678572 242
693 3300026118 Ga0207675_100110978 Ga0207675_1001109784 242
694 3300026118 Ga0207675_100385111 Ga0207675_1003851112 242
695 3300026142 Ga0207698_10151975 Ga0207698_101519752 242
696 3300028380 Ga0268265_10144162 Ga0268265_101441622 242
697 3300028380 Ga0268265_10389014 Ga0268265_103890142 242
698 3300028381 Ga0268264_10014553 Ga0268264_100145536 242
699 3300028381 Ga0268264_10117979 Ga0268264_101179792 242
700 3300028381 Ga0268264_10212015 Ga0268264_102120152 242
701 3300031548 Ga0307408_100929913 Ga0307408_1009299131 242
702 3300031901 Ga0307406_10349934 Ga0307406_103499342 242
703 3300032002 Ga0307416_100071864 Ga0307416_1000718643 242
704 3300032002 Ga0307416_100906647 Ga0307416_1009066471 242
705 3300032005 Ga0307411_10019309 Ga0307411_100193092 242
706 3300032005 Ga0307411_10071903 Ga0307411_100719033 242
707 3300032126 Ga0307415_100145386 Ga0307415_1001453862 242
708 3300035090 Ga0373949_0015015 Ga0373949_0015015_956_1690 242
709 3300035091 Ga0373951_0002234 Ga0373951_0002234_3744_4478 242
710 3300035207 Ga0373942_0056745 Ga0373942_0056745_126_860 242
711 3300037466 Ga0395898_0072037 Ga0395898_0072037_1984_2718 242
712 3300038699 Ga0242422_00406 Ga0242422_00406_55_789 242
713 3300041406 Ga0439439_0060500 Ga0439439_0060500_159_896 242
714 3300042461 Ga0439460_0016911 Ga0439460_0016911_865_1602 242
715 3300048907 Ga0496104_0241948 Ga0496104_0241948_543_1274 242
716 3300048909 Ga0496106_0110556 Ga0496106_0110556_525_1259 242
717 3300048910 Ga0496107_0605884 Ga0496107_0605884_52_783 242
718 3300048911 Ga0496108_0696700 Ga0496108_0696700_12_749 242
719 3300048913 Ga0496110_0552282 Ga0496110_0552282_298_1032 242
720 3300048915 Ga0496112_0228025 Ga0496112_0228025_941_1675 242
721 3300048915 Ga0496112_0653568 Ga0496112_0653568_96_827 242
722 3300048916 Ga0496113_0237208 Ga0496113_0237208_102_836 242
723 3300049519 Ga0501296_003153 Ga0501296_003153_654_1391 242
724 3300049652 Ga0501202_045306 Ga0501202_045306_136_873 242
725 3300049653 Ga0501206_009230 Ga0501206_009230_202_939 242
726 3300049654 Ga0501207_007861 Ga0501207_007861_596_1333 242
727 3300049660 Ga0501216_005192 Ga0501216_005192_224_961 242
728 3300049661 Ga0501217_011956 Ga0501217_011956_826_1557 242
729 3300049663 Ga0501223_011764 Ga0501223_011764_806_1543 242
730 3300049664 Ga0501224_006398 Ga0501224_006398_806_1537 242
731 3300049668 Ga0501233_002330 Ga0501233_002330_425_1156 242
732 3300049669 Ga0501235_009168 Ga0501235_009168_397_1128 242
733 3300049669 Ga0501235_010494 Ga0501235_010494_24_761 242
734 3300049679 Ga0501249_011636 Ga0501249_011636_34_771 242
735 3300049705 Ga0501225_0005503 Ga0501225_0005503_2105_2836 242
736 3300049705 Ga0501225_0049288 Ga0501225_0049288_181_918 242
737 3300049707 Ga0501234_004139 Ga0501234_004139_1302_2039 242
738 3300049708 Ga0501245_010136 Ga0501245_010136_156_893 242
739 3300049767 Ga0501270_016125 Ga0501270_016125_187_924 242
740 3300049770 Ga0501273_019455 Ga0501273_019455_22_753 242
741 3300049779 Ga0501283_000500 Ga0501283_000500_3205_3942 242
742 3300049779 Ga0501283_006315 Ga0501283_006315_469_1200 242
743 3300049851 Ga0501212_005485 Ga0501212_005485_924_1655 242
744 3300050507 nmdc:mga05p37_102787_c1 nmdc:mga05p37_102787_c1_1640_2371 242
745 3300050507 nmdc:mga05p37_233694_c1 nmdc:mga05p37_233694_c1_197_928 242
746 3300050507 nmdc:mga05p37_358293_c1 nmdc:mga05p37_358293_c1_948_1682 242
747 3300050507 nmdc:mga05p37_396484_c1 nmdc:mga05p37_396484_c1_429_1160 242
748 3300050507 nmdc:mga05p37_458242_c1 nmdc:mga05p37_458242_c1_706_1437 242
749 3300050507 nmdc:mga05p37_491371_c1 nmdc:mga05p37_491371_c1_603_1340 242
750 3300050508 nmdc:mga09592_123925_c1 nmdc:mga09592_123925_c1_718_1449 242
751 3300050509 nmdc:mga0qj67_203653_c1 nmdc:mga0qj67_203653_c1_555_1286 242
752 3300050510 nmdc:mga06r32_76972_c1 nmdc:mga06r32_76972_c1_305_1036 242
753 3300050511 nmdc:mga08y16_15514_c1 nmdc:mga08y16_15514_c1_719_1450 242
754 3300050512 nmdc:mga0n895_217147_c1 nmdc:mga0n895_217147_c1_99_833 242
755 3300050513 nmdc:mga0rr50_364557_c1 nmdc:mga0rr50_364557_c1_22_753 242
756 3300050515 nmdc:mga0a205_24407_c1 nmdc:mga0a205_24407_c1_2492_3223 242
757 3300050515 nmdc:mga0a205_267608_c1 nmdc:mga0a205_267608_c1_459_1193 242
758 3300050515 nmdc:mga0a205_31937_c1 nmdc:mga0a205_31937_c1_3589_4323 242
759 3300050515 nmdc:mga0a205_48678_c1 nmdc:mga0a205_48678_c1_13_744 242
760 2162886007 SwRhRL2b_contig_3011979 SwRhRL2b_0681.00007730 243
761 3300005289 Ga0065704_10077781 Ga0065704_100777815 243
762 3300005289 Ga0065704_10154614 Ga0065704_101546142 243
763 3300005290 Ga0065712_10008362 Ga0065712_100083623 243
764 3300005295 Ga0065707_10002026 Ga0065707_100020266 243
765 3300005295 Ga0065707_10126370 Ga0065707_101263702 243
766 3300005330 Ga0070690_100008805 Ga0070690_1000088052 243
767 3300005331 Ga0070670_100136269 Ga0070670_1001362692 243
768 3300005333 Ga0070677_10018755 Ga0070677_100187552 243
769 3300005335 Ga0070666_10005057 Ga0070666_100050576 243
770 3300005336 Ga0070680_100003154 Ga0070680_1000031545 243
771 3300005338 Ga0068868_100044308 Ga0068868_1000443084 243
772 3300005338 Ga0068868_100399916 Ga0068868_1003999162 243
773 3300005340 Ga0070689_100021304 Ga0070689_1000213043 243
774 3300005343 Ga0070687_100005050 Ga0070687_1000050506 243
775 3300005345 Ga0070692_10157841 Ga0070692_101578412 243
776 3300005353 Ga0070669_100705031 Ga0070669_1007050311 243
777 3300005364 Ga0070673_100086206 Ga0070673_1000862063 243
778 3300005366 Ga0070659_100001747 Ga0070659_10000174712 243
779 3300005367 Ga0070667_100114751 Ga0070667_1001147513 243
780 3300005440 Ga0070705_100061510 Ga0070705_1000615103 243
781 3300005444 Ga0070694_100046232 Ga0070694_1000462323 243
782 3300005457 Ga0070662_100284294 Ga0070662_1002842942 243
783 3300005458 Ga0070681_10001035 Ga0070681_100010357 243
784 3300005459 Ga0068867_100010249 Ga0068867_1000102494 243
785 3300005466 Ga0070685_10012338 Ga0070685_100123383 243
786 3300005466 Ga0070685_10104802 Ga0070685_101048022 243
787 3300005471 Ga0070698_100026906 Ga0070698_1000269063 243
788 3300005530 Ga0070679_100000253 Ga0070679_10000025322 243
789 3300005536 Ga0070697_100114304 Ga0070697_1001143042 243
790 3300005539 Ga0068853_100142995 Ga0068853_1001429953 243
791 3300005539 Ga0068853_100250915 Ga0068853_1002509151 243
792 3300005543 Ga0070672_100003999 Ga0070672_10000399910 243
793 3300005543 Ga0070672_100034146 Ga0070672_1000341464 243
794 3300005544 Ga0070686_100002097 Ga0070686_1000020976 243
795 3300005545 Ga0070695_100086747 Ga0070695_1000867472 243
796 3300005546 Ga0070696_100125694 Ga0070696_1001256942 243
797 3300005546 Ga0070696_100145368 Ga0070696_1001453682 243
798 3300005577 Ga0068857_100077435 Ga0068857_1000774353 243
799 3300005578 Ga0068854_100088056 Ga0068854_1000880562 243
800 3300005614 Ga0068856_100026318 Ga0068856_1000263185 243
801 3300005615 Ga0070702_100007113 Ga0070702_1000071132 243
802 3300005616 Ga0068852_100292069 Ga0068852_1002920692 243
803 3300005617 Ga0068859_100021332 Ga0068859_1000213327 243
804 3300005617 Ga0068859_100129625 Ga0068859_1001296253 243
805 3300005618 Ga0068864_100062858 Ga0068864_1000628583 243
806 3300005718 Ga0068866_10007529 Ga0068866_100075292 243
807 3300005840 Ga0068870_10031917 Ga0068870_100319173 243
808 3300005841 Ga0068863_100083374 Ga0068863_1000833743 243
809 3300005842 Ga0068858_100272913 Ga0068858_1002729133 243
810 3300005843 Ga0068860_100009809 Ga0068860_1000098093 243
811 3300005843 Ga0068860_100032323 Ga0068860_1000323232 243
812 3300005843 Ga0068860_100575065 Ga0068860_1005750652 243
813 3300005844 Ga0068862_100125430 Ga0068862_1001254303 243
814 3300006237 Ga0097621_100010498 Ga0097621_1000104987 243
815 3300006358 Ga0068871_100006422 Ga0068871_1000064225 243
816 3300006844 Ga0075428_100188055 Ga0075428_1001880552 243
817 3300006871 Ga0075434_100155923 Ga0075434_1001559232 243
818 3300006881 Ga0068865_100021295 Ga0068865_1000212952 243
819 3300006931 Ga0097620_100021332 Ga0097620_1000213327 243
820 3300006931 Ga0097620_100129625 Ga0097620_1001296253 243
821 3300009148 Ga0105243_10015532 Ga0105243_100155324 243
822 3300009174 Ga0105241_10221769 Ga0105241_102217692 243
823 3300009174 Ga0105241_10238386 Ga0105241_102383862 243
824 3300009176 Ga0105242_10020124 Ga0105242_100201245 243
825 3300009177 Ga0105248_10007824 Ga0105248_100078243 243
826 3300009177 Ga0105248_10107562 Ga0105248_101075623 243
827 3300009553 Ga0105249_10004186 Ga0105249_1000418611 243
828 3300009553 Ga0105249_10493700 Ga0105249_104937002 243
829 3300010375 Ga0105239_10038591 Ga0105239_100385912 243
830 3300010375 Ga0105239_10243218 Ga0105239_102432181 243
831 3300011119 Ga0105246_10292028 Ga0105246_102920282 243
832 3300013297 Ga0157378_10032365 Ga0157378_100323655 243
833 3300013297 Ga0157378_10152807 Ga0157378_101528072 243
834 3300013306 Ga0163162_10018042 Ga0163162_100180423 243
835 3300013306 Ga0163162_10034927 Ga0163162_100349274 243
836 3300014325 Ga0163163_10002387 Ga0163163_1000238712 243
837 3300014325 Ga0163163_10274999 Ga0163163_102749992 243
838 3300014326 Ga0157380_10015660 Ga0157380_100156604 243
839 3300014968 Ga0157379_10147467 Ga0157379_101474671 243
840 3300014969 Ga0157376_10008850 Ga0157376_100088505 243
841 3300017792 Ga0163161_10004077 Ga0163161_100040777 243
842 3300025315 Ga0207697_10010841 Ga0207697_100108412 243
843 3300025903 Ga0207680_10101131 Ga0207680_101011311 243
844 3300025907 Ga0207645_10088695 Ga0207645_100886952 243
845 3300025908 Ga0207643_10042201 Ga0207643_100422013 243
846 3300025911 Ga0207654_10081638 Ga0207654_100816382 243
847 3300025911 Ga0207654_10137003 Ga0207654_101370032 243
848 3300025912 Ga0207707_10000142 Ga0207707_1000014233 243
849 3300025914 Ga0207671_10058927 Ga0207671_100589273 243
850 3300025917 Ga0207660_10002786 Ga0207660_100027863 243
851 3300025918 Ga0207662_10010043 Ga0207662_100100435 243
852 3300025921 Ga0207652_10000361 Ga0207652_1000036134 243
853 3300025922 Ga0207646_10284974 Ga0207646_102849742 243
854 3300025923 Ga0207681_10113607 Ga0207681_101136072 243
855 3300025934 Ga0207686_10066718 Ga0207686_100667182 243
856 3300025935 Ga0207709_10011773 Ga0207709_100117734 243
857 3300025936 Ga0207670_10160762 Ga0207670_101607622 243
858 3300025938 Ga0207704_10046734 Ga0207704_100467342 243
859 3300025940 Ga0207691_10000900 Ga0207691_1000090019 243
860 3300025940 Ga0207691_10101924 Ga0207691_101019242 243
861 3300025941 Ga0207711_10009470 Ga0207711_100094706 243
862 3300025941 Ga0207711_10104861 Ga0207711_101048612 243
863 3300025942 Ga0207689_10005258 Ga0207689_100052588 243
864 3300025960 Ga0207651_10003013 Ga0207651_100030136 243
865 3300025961 Ga0207712_10033030 Ga0207712_100330302 243
866 3300025961 Ga0207712_10164949 Ga0207712_101649493 243
867 3300025986 Ga0207658_10136522 Ga0207658_101365222 243
868 3300026035 Ga0207703_10075988 Ga0207703_100759883 243
869 3300026041 Ga0207639_10167671 Ga0207639_101676712 243
870 3300026078 Ga0207702_10411385 Ga0207702_104113852 243
871 3300026088 Ga0207641_10065626 Ga0207641_100656263 243
872 3300026089 Ga0207648_10010767 Ga0207648_100107675 243
873 3300026095 Ga0207676_10055713 Ga0207676_100557133 243
874 3300026118 Ga0207675_100085625 Ga0207675_1000856252 243
875 3300026118 Ga0207675_100568033 Ga0207675_1005680332 243
876 3300027907 Ga0207428_10009062 Ga0207428_100090624 243
877 3300028381 Ga0268264_10009332 Ga0268264_100093323 243
878 3300028381 Ga0268264_10679371 Ga0268264_106793711 243
879 3300031852 Ga0307410_10075240 Ga0307410_100752402 243
880 3300031901 Ga0307406_10068185 Ga0307406_100681853 243
881 3300031911 Ga0307412_10045781 Ga0307412_100457813 243
882 3300032005 Ga0307411_10177398 Ga0307411_101773982 243
883 3300032126 Ga0307415_100026563 Ga0307415_1000265633 243
884 3300046615 Ga0495656_0246557 Ga0495656_0246557_45_779 243
885 3300046684 Ga0495669_0152306 Ga0495669_0152306_174_908 243
886 3300048916 Ga0496113_0282661 Ga0496113_0282661_300_1031 243
887 3300049515 Ga0501292_005738 Ga0501292_005738_881_1624 243
888 3300049519 Ga0501296_000385 Ga0501296_000385_2566_3309 243
889 3300049521 Ga0501298_002662 Ga0501298_002662_185_928 243
890 3300049522 Ga0501299_030963 Ga0501299_030963_83_826 243
891 3300049574 Ga0501038_0002990 Ga0501038_0002990_3289_4032 243
892 3300049655 Ga0501208_016359 Ga0501208_016359_123_866 243
893 3300049660 Ga0501216_003973 Ga0501216_003973_589_1332 243
894 3300049661 Ga0501217_000999 Ga0501217_000999_3638_4381 243
895 3300049668 Ga0501233_050116 Ga0501233_050116_223_966 243
896 3300049686 Ga0501257_011757 Ga0501257_011757_1053_1796 243
897 3300049690 Ga0501261_004238 Ga0501261_004238_778_1521 243
898 3300049705 Ga0501225_0005408 Ga0501225_0005408_2895_3638 243
899 3300049707 Ga0501234_007201 Ga0501234_007201_548_1291 243
900 3300049757 Ga0501232_003194 Ga0501232_003194_179_922 243
901 3300049769 Ga0501272_000969 Ga0501272_000969_1422_2165 243
902 3300050513 nmdc:mga0rr50_439611_c1 nmdc:mga0rr50_439611_c1_159_893 243
903 3300050515 nmdc:mga0a205_13389_c1 nmdc:mga0a205_13389_c1_2071_2805 243
904 3300050515 nmdc:mga0a205_489906_c1 nmdc:mga0a205_489906_c1_336_1067 243

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01936

NYN

NYN domain

53

201

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jro-assembly1.cif.gz_C crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.772 108 148
4jro-assembly1.cif.gz_D crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ 0.7567 108 146
6ux3-assembly1.cif.gz_A crystal structure of acetoin dehydrogenase from enterobacter cloacae 0.7463 111 150
6won-assembly2.cif.gz_G crystal structure of acetoin dehydrogenase yohf from salmonella typhimurium 0.7189 111 150
6nrp-assembly1.cif.gz_B putative short-chain dehydrogenase/reductase (sdr) from acinetobacter baumannii 0.6816 105 148
ID Description Score Start End Superfamily
4jigA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7563 108 148 3.40.50.720
af_Q2G0E1_2_140_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7366 92 146 3.40.50.720
af_P32675_21_290_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7308 108 149 3.20.20.70
af_O53816_3_249_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.7268 105 146 3.40.605.10
1dohA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7238 111 150 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2D6A8U5-F1-model_v4 NYN domain-containing protein 0.7012 19 177 GO:0004540
AF-A0A257B365-F1-model_v4 NYN domain-containing protein 0.6856 17 177 GO:0004540
AF-A0A3M9Z022-F1-model_v4 NYN domain-containing protein 0.6843 16 180 GO:0004540
AF-A0A7T3FVY9-F1-model_v4 NYN domain-containing protein 0.6825 19 176 GO:0004540
AF-A0A1F6SQI4-F1-model_v4 NYN domain-containing protein 0.6825 17 179 GO:0004540

Feature Viewer

pLDDT pTM Quality
60.99 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map