F485275
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 904 | 284 | 904 | 242 |
Family's Representative Sequence
| Representative Sequence | 3300013306|Ga0163162_10034927|Ga0163162_100349274 |
| Length | 278 |
| Sequence | LWLADLPFCLTNQLQKQHSKNSEEQGDFVEPFMNNNNYDPTNNVSWQLGHRGRVAVFIDGNNLFHAARFHNIDIDYNKLLRVLLGDGRLLRAFFYTGVDVGAERQQGFLLWMRRNGFRVIQKELKTFYDGTRKANLDVEIAVDMLSLAGRYDTAVLVSGDEDFVYAVNAVAYKGCRVEIAGFRSNTAPKLIDVADYFIDLGEIADKVRKEMTHGGARYDERDLHDHLPHQYLQEPLHMQDAPPDAFQAAMRVVIEAEIEEDAAEFQASTEFIRVTDDH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 4 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 124 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 178 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 181 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 183 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 184 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 185 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 186 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 187 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 188 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 189 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 190 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 191 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 192 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 193 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 197 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 199 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 200 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 201 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 202 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 203 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 204 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 205 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 206 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 207 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 208 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 209 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 210 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 211 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 220 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 221 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 222 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 225 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 226 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 227 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 228 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 229 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 230 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 231 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 232 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 233 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 234 | 3300049525 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control | Metagenome | Rhizosphere |
| 235 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 236 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 238 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 239 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 240 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 241 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 242 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 243 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 244 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 245 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 246 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 247 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 248 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 249 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 250 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 251 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 252 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 253 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 254 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 255 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 256 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 257 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 258 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 259 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 260 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 261 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 262 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 264 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 265 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 266 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 267 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 268 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 269 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 270 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 271 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 272 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 273 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 284 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.11 |
| Nodule | 0 |
| Rhizoplane | 1.66 |
| Rhizosphere | 97.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3011979 | 2162886007 | Unclassified | 1042 |
| 2 | CNAas_1000478 | 3300000532 | Bacteria | 3901 |
| 3 | JGI24748J21848_1000008 | 3300002074 | Bacteria | 191483 |
| 4 | JGI24749J21850_1015254 | 3300002076 | Bacteria | 1078 |
| 5 | JGI24034J26672_10000002 | 3300002239 | Bacteria | 925353 |
| 6 | JGI24751J29686_10000099 | 3300002459 | Bacteria | 47837 |
| 7 | JGI25406J46586_10002315 | 3300003203 | Bacteria | 8996 |
| 8 | JGI25406J46586_10004596 | 3300003203 | Bacteria | 6424 |
| 9 | rootL2_10068297 | 3300003322 | Bacteria | 1323 |
| 10 | Ga0065714_10014729 | 3300005288 | Bacteria | 2110 |
| 11 | Ga0065714_10064424 | 3300005288 | Bacteria | 236118 |
| 12 | Ga0065704_10009481 | 3300005289 | Bacteria | 2134 |
| 13 | Ga0065704_10077781 | 3300005289 | Unclassified | 4621 |
| 14 | Ga0065704_10093396 | 3300005289 | Bacteria | 2595 |
| 15 | Ga0065704_10154614 | 3300005289 | Unclassified | 1401 |
| 16 | Ga0065712_10000117 | 3300005290 | Bacteria | 235194 |
| 17 | Ga0065712_10008362 | 3300005290 | Bacteria | 3354 |
| 18 | Ga0065712_10074270 | 3300005290 | Bacteria | 4108 |
| 19 | Ga0065712_10085397 | 3300005290 | Bacteria | 2700 |
| 20 | Ga0065712_10243771 | 3300005290 | Unclassified | 977 |
| 21 | Ga0065715_10000523 | 3300005293 | Bacteria | 10848 |
| 22 | Ga0065715_10019608 | 3300005293 | Bacteria | 2387 |
| 23 | Ga0065715_10107615 | 3300005293 | Bacteria | 2762 |
| 24 | Ga0065715_10109566 | 3300005293 | Bacteria | 2663 |
| 25 | Ga0065715_10148450 | 3300005293 | Bacteria | 1759 |
| 26 | Ga0065715_10161319 | 3300005293 | Bacteria | 1569 |
| 27 | Ga0065715_10167384 | 3300005293 | Bacteria | 1575 |
| 28 | Ga0065715_10197836 | 3300005293 | Bacteria | 1378 |
| 29 | Ga0065715_10211093 | 3300005293 | Bacteria | 1309 |
| 30 | Ga0065715_10233378 | 3300005293 | Bacteria | 1222 |
| 31 | Ga0065707_10002026 | 3300005295 | Bacteria | 9025 |
| 32 | Ga0065707_10126370 | 3300005295 | Unclassified | 2004 |
| 33 | Ga0065707_10287383 | 3300005295 | Bacteria | 1033 |
| 34 | Ga0065707_10336285 | 3300005295 | Bacteria | 941 |
| 35 | Ga0070658_10191196 | 3300005327 | Bacteria | 1725 |
| 36 | Ga0070683_100156087 | 3300005329 | Bacteria | 2164 |
| 37 | Ga0070683_100471866 | 3300005329 | Bacteria | 1198 |
| 38 | Ga0070690_100000586 | 3300005330 | Bacteria | 18332 |
| 39 | Ga0070690_100001671 | 3300005330 | Bacteria | 11669 |
| 40 | Ga0070690_100008805 | 3300005330 | Bacteria | 5829 |
| 41 | Ga0070690_100156539 | 3300005330 | Bacteria | 1558 |
| 42 | Ga0070670_100000297 | 3300005331 | Bacteria | 43678 |
| 43 | Ga0070670_100002514 | 3300005331 | Bacteria | 15120 |
| 44 | Ga0070670_100110509 | 3300005331 | Bacteria | 2368 |
| 45 | Ga0070670_100136269 | 3300005331 | Bacteria | 2122 |
| 46 | Ga0070677_10018755 | 3300005333 | Bacteria | 2496 |
| 47 | Ga0068869_100003815 | 3300005334 | Bacteria | 9293 |
| 48 | Ga0068869_100095699 | 3300005334 | Bacteria | 2241 |
| 49 | Ga0068869_100145361 | 3300005334 | Bacteria | 1834 |
| 50 | Ga0070666_10005057 | 3300005335 | Bacteria | 8067 |
| 51 | Ga0070680_100003154 | 3300005336 | Bacteria | 12253 |
| 52 | Ga0070680_100139028 | 3300005336 | Viruses | 2036 |
| 53 | Ga0070680_100193837 | 3300005336 | Unclassified | 1713 |
| 54 | Ga0070682_100032646 | 3300005337 | Bacteria | 3158 |
| 55 | Ga0070682_100069047 | 3300005337 | Bacteria | 2256 |
| 56 | Ga0068868_100044308 | 3300005338 | Bacteria | 3478 |
| 57 | Ga0068868_100099889 | 3300005338 | Bacteria | 2348 |
| 58 | Ga0068868_100399916 | 3300005338 | Unclassified | 1185 |
| 59 | Ga0068868_100676395 | 3300005338 | Unclassified | 921 |
| 60 | Ga0070689_100000425 | 3300005340 | Bacteria | 24906 |
| 61 | Ga0070689_100005978 | 3300005340 | Bacteria | 8378 |
| 62 | Ga0070689_100008912 | 3300005340 | Bacteria | 7095 |
| 63 | Ga0070689_100021304 | 3300005340 | Bacteria | 4823 |
| 64 | Ga0070689_100060971 | 3300005340 | Bacteria | 2933 |
| 65 | Ga0070689_100063432 | 3300005340 | Bacteria | 2876 |
| 66 | Ga0070689_100253736 | 3300005340 | Unclassified | 1452 |
| 67 | Ga0070687_100005050 | 3300005343 | Bacteria | 5319 |
| 68 | Ga0070687_100216181 | 3300005343 | Unclassified | 1171 |
| 69 | Ga0070687_100248487 | 3300005343 | Unclassified | 1104 |
| 70 | Ga0070687_100252496 | 3300005343 | Bacteria | 1096 |
| 71 | Ga0070661_100076305 | 3300005344 | Bacteria | 2470 |
| 72 | Ga0070661_100099213 | 3300005344 | Bacteria | 2164 |
| 73 | Ga0070661_100138665 | 3300005344 | Bacteria | 1831 |
| 74 | Ga0070692_10003268 | 3300005345 | Bacteria | 6537 |
| 75 | Ga0070692_10021801 | 3300005345 | Bacteria | 3121 |
| 76 | Ga0070692_10031990 | 3300005345 | Unclassified | 2642 |
| 77 | Ga0070692_10157841 | 3300005345 | Bacteria | 1297 |
| 78 | Ga0070668_100010711 | 3300005347 | Bacteria | 6818 |
| 79 | Ga0070668_100246991 | 3300005347 | Unclassified | 1480 |
| 80 | Ga0070669_100025762 | 3300005353 | Bacteria | 4225 |
| 81 | Ga0070669_100049747 | 3300005353 | Bacteria | 3061 |
| 82 | Ga0070669_100705031 | 3300005353 | Unclassified | 852 |
| 83 | Ga0070671_100016473 | 3300005355 | Bacteria | 5975 |
| 84 | Ga0070671_100069648 | 3300005355 | Bacteria | 2934 |
| 85 | Ga0070671_100079341 | 3300005355 | Bacteria | 2744 |
| 86 | Ga0070671_100123203 | 3300005355 | Bacteria | 2182 |
| 87 | Ga0070673_100036706 | 3300005364 | Bacteria | 3728 |
| 88 | Ga0070673_100038484 | 3300005364 | Unclassified | 3653 |
| 89 | Ga0070673_100054380 | 3300005364 | Bacteria | 3149 |
| 90 | Ga0070673_100064557 | 3300005364 | Bacteria | 2917 |
| 91 | Ga0070673_100083506 | 3300005364 | Bacteria | 2595 |
| 92 | Ga0070673_100086206 | 3300005364 | Bacteria | 2558 |
| 93 | Ga0070673_100185583 | 3300005364 | Bacteria | 1783 |
| 94 | Ga0070673_100542617 | 3300005364 | Bacteria | 1056 |
| 95 | Ga0070688_100206569 | 3300005365 | Bacteria | 1377 |
| 96 | Ga0070688_100316283 | 3300005365 | Bacteria | 1133 |
| 97 | Ga0070659_100001747 | 3300005366 | Bacteria | 15600 |
| 98 | Ga0070659_100317167 | 3300005366 | Bacteria | 1303 |
| 99 | Ga0070667_100114751 | 3300005367 | Bacteria | 2339 |
| 100 | Ga0070667_100519001 | 3300005367 | Bacteria | 1093 |
| 101 | Ga0070703_10004244 | 3300005406 | Bacteria | 4034 |
| 102 | Ga0070703_10206557 | 3300005406 | Bacteria | 774 |
| 103 | Ga0070701_10154103 | 3300005438 | Bacteria | 1326 |
| 104 | Ga0070701_10316323 | 3300005438 | Bacteria | 964 |
| 105 | Ga0070705_100005473 | 3300005440 | Bacteria | 6190 |
| 106 | Ga0070705_100056223 | 3300005440 | Unclassified | 2316 |
| 107 | Ga0070705_100061510 | 3300005440 | Bacteria | 2232 |
| 108 | Ga0070705_100181824 | 3300005440 | Bacteria | 1425 |
| 109 | Ga0070700_100000087 | 3300005441 | Bacteria | 62003 |
| 110 | Ga0070700_100021734 | 3300005441 | Bacteria | 3733 |
| 111 | Ga0070700_100032947 | 3300005441 | Bacteria | 3119 |
| 112 | Ga0070700_100049244 | 3300005441 | Unclassified | 2615 |
| 113 | Ga0070700_100195633 | 3300005441 | Bacteria | 1417 |
| 114 | Ga0070700_100202744 | 3300005441 | Bacteria | 1394 |
| 115 | Ga0070694_100000781 | 3300005444 | Bacteria | 17791 |
| 116 | Ga0070694_100028768 | 3300005444 | Bacteria | 3619 |
| 117 | Ga0070694_100046232 | 3300005444 | Bacteria | 2921 |
| 118 | Ga0070694_100066085 | 3300005444 | Unclassified | 2480 |
| 119 | Ga0070694_100143014 | 3300005444 | Bacteria | 1739 |
| 120 | Ga0070694_100199823 | 3300005444 | Bacteria | 1489 |
| 121 | Ga0070694_100290935 | 3300005444 | Bacteria | 1248 |
| 122 | Ga0070694_100351504 | 3300005444 | Bacteria | 1142 |
| 123 | Ga0070694_100408277 | 3300005444 | Bacteria | 1065 |
| 124 | Ga0070708_100000281 | 3300005445 | Bacteria | 38291 |
| 125 | Ga0070708_100021762 | 3300005445 | Bacteria | 5429 |
| 126 | Ga0070708_100437422 | 3300005445 | Bacteria | 1234 |
| 127 | Ga0070708_100528633 | 3300005445 | Unclassified | 1113 |
| 128 | Ga0070663_100458645 | 3300005455 | Bacteria | 1052 |
| 129 | Ga0070662_100023433 | 3300005457 | Unclassified | 4240 |
| 130 | Ga0070662_100032856 | 3300005457 | Bacteria | 3650 |
| 131 | Ga0070662_100284294 | 3300005457 | Bacteria | 1339 |
| 132 | Ga0070681_10001035 | 3300005458 | Bacteria | 23588 |
| 133 | Ga0070681_10006412 | 3300005458 | Bacteria | 11446 |
| 134 | Ga0068867_100010249 | 3300005459 | Bacteria | 6611 |
| 135 | Ga0068867_100044438 | 3300005459 | Bacteria | 3255 |
| 136 | Ga0068867_100144220 | 3300005459 | Bacteria | 1864 |
| 137 | Ga0068867_100228819 | 3300005459 | Bacteria | 1502 |
| 138 | Ga0068867_100270792 | 3300005459 | Bacteria | 1388 |
| 139 | Ga0070685_10012338 | 3300005466 | Bacteria | 4489 |
| 140 | Ga0070685_10104802 | 3300005466 | Unclassified | 1732 |
| 141 | Ga0070706_100000146 | 3300005467 | Bacteria | 89818 |
| 142 | Ga0070706_100001677 | 3300005467 | Bacteria | 23063 |
| 143 | Ga0070706_100003498 | 3300005467 | Bacteria | 15433 |
| 144 | Ga0070706_100011659 | 3300005467 | Bacteria | 8165 |
| 145 | Ga0070706_100148069 | 3300005467 | Unclassified | 2192 |
| 146 | Ga0070706_100184375 | 3300005467 | Unclassified | 1949 |
| 147 | Ga0070706_100210199 | 3300005467 | Bacteria | 1817 |
| 148 | Ga0070707_100002790 | 3300005468 | Bacteria | 16625 |
| 149 | Ga0070707_100054355 | 3300005468 | Unclassified | 3838 |
| 150 | Ga0070707_100112338 | 3300005468 | Bacteria | 2642 |
| 151 | Ga0070698_100001335 | 3300005471 | Bacteria | 27442 |
| 152 | Ga0070698_100007291 | 3300005471 | Bacteria | 11974 |
| 153 | Ga0070698_100008222 | 3300005471 | Bacteria | 11286 |
| 154 | Ga0070698_100009193 | 3300005471 | Bacteria | 10606 |
| 155 | Ga0070698_100018185 | 3300005471 | Bacteria | 7400 |
| 156 | Ga0070698_100026906 | 3300005471 | Bacteria | 5981 |
| 157 | Ga0070698_100049187 | 3300005471 | Bacteria | 4305 |
| 158 | Ga0070698_100055583 | 3300005471 | Bacteria | 4012 |
| 159 | Ga0070699_100001043 | 3300005518 | Bacteria | 25801 |
| 160 | Ga0070699_100009689 | 3300005518 | Bacteria | 8340 |
| 161 | Ga0070699_100064874 | 3300005518 | Bacteria | 3168 |
| 162 | Ga0070699_100342736 | 3300005518 | Unclassified | 1345 |
| 163 | Ga0070679_100000253 | 3300005530 | Bacteria | 44883 |
| 164 | Ga0070679_100016260 | 3300005530 | Bacteria | 7169 |
| 165 | Ga0070679_100041381 | 3300005530 | Unclassified | 4586 |
| 166 | Ga0070679_100184479 | 3300005530 | Unclassified | 2058 |
| 167 | Ga0070684_100026876 | 3300005535 | Bacteria | 4852 |
| 168 | Ga0070697_100000135 | 3300005536 | Bacteria | 59315 |
| 169 | Ga0070697_100000976 | 3300005536 | Bacteria | 21590 |
| 170 | Ga0070697_100022130 | 3300005536 | Bacteria | 5044 |
| 171 | Ga0070697_100050242 | 3300005536 | Bacteria | 3385 |
| 172 | Ga0070697_100053292 | 3300005536 | Bacteria | 3288 |
| 173 | Ga0070697_100065615 | 3300005536 | Unclassified | 2967 |
| 174 | Ga0070697_100114304 | 3300005536 | Bacteria | 2252 |
| 175 | Ga0070697_100116781 | 3300005536 | Bacteria | 2229 |
| 176 | Ga0070697_100215403 | 3300005536 | Bacteria | 1636 |
| 177 | Ga0068853_100048451 | 3300005539 | Bacteria | 3649 |
| 178 | Ga0068853_100048498 | 3300005539 | Bacteria | 3648 |
| 179 | Ga0068853_100142995 | 3300005539 | Bacteria | 2148 |
| 180 | Ga0068853_100250915 | 3300005539 | Bacteria | 1623 |
| 181 | Ga0068853_100377510 | 3300005539 | Unclassified | 1323 |
| 182 | Ga0070672_100003999 | 3300005543 | Bacteria | 9610 |
| 183 | Ga0070672_100034146 | 3300005543 | Bacteria | 3859 |
| 184 | Ga0070672_100442008 | 3300005543 | Bacteria | 1119 |
| 185 | Ga0070686_100002097 | 3300005544 | Bacteria | 10998 |
| 186 | Ga0070686_100022113 | 3300005544 | Bacteria | 3785 |
| 187 | Ga0070686_100137052 | 3300005544 | Bacteria | 1699 |
| 188 | Ga0070695_100012598 | 3300005545 | Bacteria | 5078 |
| 189 | Ga0070695_100086747 | 3300005545 | Bacteria | 2081 |
| 190 | Ga0070695_100091079 | 3300005545 | Bacteria | 2036 |
| 191 | Ga0070695_100127482 | 3300005545 | Bacteria | 1750 |
| 192 | Ga0070695_100185034 | 3300005545 | Bacteria | 1479 |
| 193 | Ga0070695_100257988 | 3300005545 | Unclassified | 1272 |
| 194 | Ga0070695_100312825 | 3300005545 | Bacteria | 1165 |
| 195 | Ga0070695_100552136 | 3300005545 | Unclassified | 898 |
| 196 | Ga0070696_100007058 | 3300005546 | Bacteria | 7500 |
| 197 | Ga0070696_100013848 | 3300005546 | Bacteria | 5414 |
| 198 | Ga0070696_100071749 | 3300005546 | Bacteria | 2437 |
| 199 | Ga0070696_100125694 | 3300005546 | Unclassified | 1860 |
| 200 | Ga0070696_100130947 | 3300005546 | Unclassified | 1825 |
| 201 | Ga0070696_100145368 | 3300005546 | Bacteria | 1736 |
| 202 | Ga0070696_100150820 | 3300005546 | Unclassified | 1706 |
| 203 | Ga0070696_100359696 | 3300005546 | Bacteria | 1129 |
| 204 | Ga0070693_100005553 | 3300005547 | Bacteria | 6067 |
| 205 | Ga0070693_100006262 | 3300005547 | Bacteria | 5767 |
| 206 | Ga0070693_100052201 | 3300005547 | Bacteria | 2343 |
| 207 | Ga0070693_100179153 | 3300005547 | Bacteria | 1363 |
| 208 | Ga0070693_100441813 | 3300005547 | Unclassified | 911 |
| 209 | Ga0070665_100015048 | 3300005548 | Bacteria | 7766 |
| 210 | Ga0070665_100424870 | 3300005548 | Bacteria | 1338 |
| 211 | Ga0070704_100001584 | 3300005549 | Bacteria | 12287 |
| 212 | Ga0070704_100017738 | 3300005549 | Unclassified | 4536 |
| 213 | Ga0070704_100019042 | 3300005549 | Unclassified | 4403 |
| 214 | Ga0070704_100039611 | 3300005549 | Unclassified | 3236 |
| 215 | Ga0070704_100049855 | 3300005549 | Bacteria | 2939 |
| 216 | Ga0070704_100137681 | 3300005549 | Bacteria | 1901 |
| 217 | Ga0070704_100178618 | 3300005549 | Unclassified | 1696 |
| 218 | Ga0070704_100185070 | 3300005549 | Unclassified | 1669 |
| 219 | Ga0070704_100423242 | 3300005549 | Bacteria | 1141 |
| 220 | Ga0068855_100159977 | 3300005563 | Bacteria | 2557 |
| 221 | Ga0070664_100010132 | 3300005564 | Bacteria | 7642 |
| 222 | Ga0070664_100052355 | 3300005564 | Bacteria | 3458 |
| 223 | Ga0070664_100284655 | 3300005564 | Bacteria | 1491 |
| 224 | Ga0068857_100001808 | 3300005577 | Bacteria | 17204 |
| 225 | Ga0068857_100077435 | 3300005577 | Unclassified | 2967 |
| 226 | Ga0068857_100145335 | 3300005577 | Unclassified | 2146 |
| 227 | Ga0068857_100408414 | 3300005577 | Bacteria | 1264 |
| 228 | Ga0068854_100053767 | 3300005578 | Unclassified | 2893 |
| 229 | Ga0068854_100083876 | 3300005578 | Bacteria | 2357 |
| 230 | Ga0068854_100088056 | 3300005578 | Bacteria | 2305 |
| 231 | Ga0068854_100145429 | 3300005578 | Bacteria | 1823 |
| 232 | Ga0068854_100199672 | 3300005578 | Unclassified | 1571 |
| 233 | Ga0068854_100260121 | 3300005578 | Unclassified | 1389 |
| 234 | Ga0068856_100026318 | 3300005614 | Bacteria | 5673 |
| 235 | Ga0068856_100689821 | 3300005614 | Unclassified | 1042 |
| 236 | Ga0070702_100007113 | 3300005615 | Bacteria | 5343 |
| 237 | Ga0070702_100010986 | 3300005615 | Unclassified | 4488 |
| 238 | Ga0070702_100026802 | 3300005615 | Bacteria | 3102 |
| 239 | Ga0070702_100038735 | 3300005615 | Bacteria | 2656 |
| 240 | Ga0070702_100041770 | 3300005615 | Bacteria | 2574 |
| 241 | Ga0070702_100097811 | 3300005615 | Unclassified | 1794 |
| 242 | Ga0068852_100037636 | 3300005616 | Bacteria | 4058 |
| 243 | Ga0068852_100082560 | 3300005616 | Bacteria | 2856 |
| 244 | Ga0068852_100292069 | 3300005616 | Unclassified | 1575 |
| 245 | Ga0068852_100364776 | 3300005616 | Unclassified | 1414 |
| 246 | Ga0068859_100007476 | 3300005617 | Bacteria | 11092 |
| 247 | Ga0068859_100021332 | 3300005617 | Archaea | 6500 |
| 248 | Ga0068859_100023588 | 3300005617 | Bacteria | 6175 |
| 249 | Ga0068859_100087979 | 3300005617 | Bacteria | 3155 |
| 250 | Ga0068859_100103724 | 3300005617 | Bacteria | 2902 |
| 251 | Ga0068859_100129625 | 3300005617 | Unclassified | 2593 |
| 252 | Ga0068859_100204665 | 3300005617 | Bacteria | 2059 |
| 253 | Ga0068859_100246767 | 3300005617 | Bacteria | 1875 |
| 254 | Ga0068864_100007609 | 3300005618 | Bacteria | 8920 |
| 255 | Ga0068864_100046576 | 3300005618 | Bacteria | 3721 |
| 256 | Ga0068864_100062858 | 3300005618 | Bacteria | 3217 |
| 257 | Ga0068864_100109445 | 3300005618 | Bacteria | 2460 |
| 258 | Ga0068864_100146065 | 3300005618 | Bacteria | 2138 |
| 259 | Ga0068864_100193288 | 3300005618 | Bacteria | 1866 |
| 260 | Ga0068864_100213827 | 3300005618 | Bacteria | 1776 |
| 261 | Ga0068864_100316615 | 3300005618 | Bacteria | 1464 |
| 262 | Ga0068864_100412452 | 3300005618 | Bacteria | 1285 |
| 263 | Ga0068866_10007529 | 3300005718 | Bacteria | 4562 |
| 264 | Ga0068861_100008148 | 3300005719 | Bacteria | 7208 |
| 265 | Ga0068861_100051532 | 3300005719 | Bacteria | 3125 |
| 266 | Ga0068861_100068272 | 3300005719 | Bacteria | 2747 |
| 267 | Ga0068861_100079766 | 3300005719 | Bacteria | 2560 |
| 268 | Ga0068851_10076656 | 3300005834 | Bacteria | 1739 |
| 269 | Ga0068851_10216519 | 3300005834 | Unclassified | 1074 |
| 270 | Ga0068870_10002880 | 3300005840 | Bacteria | 7243 |
| 271 | Ga0068870_10031917 | 3300005840 | Bacteria | 2672 |
| 272 | Ga0068870_10062967 | 3300005840 | Unclassified | 1999 |
| 273 | Ga0068870_10153923 | 3300005840 | Bacteria | 1357 |
| 274 | Ga0068863_100083374 | 3300005841 | Bacteria | 3029 |
| 275 | Ga0068863_100137722 | 3300005841 | Bacteria | 2332 |
| 276 | Ga0068863_100328218 | 3300005841 | Unclassified | 1487 |
| 277 | Ga0068863_100473311 | 3300005841 | Bacteria | 1231 |
| 278 | Ga0068858_100000300 | 3300005842 | Bacteria | 53038 |
| 279 | Ga0068858_100028604 | 3300005842 | Bacteria | 5176 |
| 280 | Ga0068858_100064512 | 3300005842 | Bacteria | 3390 |
| 281 | Ga0068858_100108487 | 3300005842 | Bacteria | 2591 |
| 282 | Ga0068858_100214827 | 3300005842 | Unclassified | 1820 |
| 283 | Ga0068858_100243520 | 3300005842 | Bacteria | 1707 |
| 284 | Ga0068858_100272913 | 3300005842 | Bacteria | 1609 |
| 285 | Ga0068858_100411793 | 3300005842 | Bacteria | 1299 |
| 286 | Ga0068860_100009809 | 3300005843 | Bacteria | 9505 |
| 287 | Ga0068860_100017487 | 3300005843 | Bacteria | 6987 |
| 288 | Ga0068860_100031178 | 3300005843 | Bacteria | 5126 |
| 289 | Ga0068860_100032323 | 3300005843 | Bacteria | 5028 |
| 290 | Ga0068860_100056848 | 3300005843 | Bacteria | 3718 |
| 291 | Ga0068860_100098417 | 3300005843 | Bacteria | 2789 |
| 292 | Ga0068860_100243806 | 3300005843 | Bacteria | 1748 |
| 293 | Ga0068860_100320671 | 3300005843 | Bacteria | 1521 |
| 294 | Ga0068860_100575065 | 3300005843 | Unclassified | 1130 |
| 295 | Ga0068860_100987627 | 3300005843 | Unclassified | 859 |
| 296 | Ga0068862_100047231 | 3300005844 | Unclassified | 3674 |
| 297 | Ga0068862_100076747 | 3300005844 | Bacteria | 2892 |
| 298 | Ga0068862_100086255 | 3300005844 | Bacteria | 2729 |
| 299 | Ga0068862_100091340 | 3300005844 | Bacteria | 2652 |
| 300 | Ga0068862_100125430 | 3300005844 | Bacteria | 2266 |
| 301 | Ga0068862_100320809 | 3300005844 | Bacteria | 1430 |
| 302 | Ga0068862_100342648 | 3300005844 | Bacteria | 1385 |
| 303 | Ga0068862_100380669 | 3300005844 | Bacteria | 1316 |
| 304 | Ga0068862_100566137 | 3300005844 | Bacteria | 1087 |
| 305 | Ga0081539_10000073 | 3300005985 | Bacteria | 231470 |
| 306 | Ga0081539_10000537 | 3300005985 | Bacteria | 78553 |
| 307 | Ga0081539_10001715 | 3300005985 | Bacteria | 35136 |
| 308 | Ga0081539_10005214 | 3300005985 | Bacteria | 13468 |
| 309 | Ga0081539_10038097 | 3300005985 | Bacteria | 2853 |
| 310 | Ga0070716_100007698 | 3300006173 | Bacteria | 5317 |
| 311 | Ga0070716_100380921 | 3300006173 | Unclassified | 1008 |
| 312 | Ga0097621_100004289 | 3300006237 | Bacteria | 9902 |
| 313 | Ga0097621_100010498 | 3300006237 | Bacteria | 6781 |
| 314 | Ga0097621_100014340 | 3300006237 | Bacteria | 5928 |
| 315 | Ga0097621_100020722 | 3300006237 | Bacteria | 5071 |
| 316 | Ga0097621_100102742 | 3300006237 | Bacteria | 2407 |
| 317 | Ga0068871_100002162 | 3300006358 | Bacteria | 13342 |
| 318 | Ga0068871_100006422 | 3300006358 | Bacteria | 8315 |
| 319 | Ga0068871_100012458 | 3300006358 | Bacteria | 6271 |
| 320 | Ga0068871_100152698 | 3300006358 | Bacteria | 1970 |
| 321 | Ga0068871_100165898 | 3300006358 | Bacteria | 1891 |
| 322 | Ga0068871_100466771 | 3300006358 | Bacteria | 1133 |
| 323 | Ga0075428_100100612 | 3300006844 | Unclassified | 3152 |
| 324 | Ga0075428_100118600 | 3300006844 | Bacteria | 2881 |
| 325 | Ga0075428_100188055 | 3300006844 | Bacteria | 2234 |
| 326 | Ga0075431_100064456 | 3300006847 | Unclassified | 3783 |
| 327 | Ga0075431_100186618 | 3300006847 | Unclassified | 2126 |
| 328 | Ga0075433_10013013 | 3300006852 | Bacteria | 6746 |
| 329 | Ga0075433_10039767 | 3300006852 | Unclassified | 4068 |
| 330 | Ga0075433_10068108 | 3300006852 | Unclassified | 3124 |
| 331 | Ga0075433_10187089 | 3300006852 | Unclassified | 1842 |
| 332 | Ga0075433_10410053 | 3300006852 | Bacteria | 1195 |
| 333 | Ga0075434_100016372 | 3300006871 | Bacteria | 7126 |
| 334 | Ga0075434_100053330 | 3300006871 | Unclassified | 4018 |
| 335 | Ga0075434_100065989 | 3300006871 | Bacteria | 3605 |
| 336 | Ga0075434_100155923 | 3300006871 | Bacteria | 2302 |
| 337 | Ga0075434_100238946 | 3300006871 | Bacteria | 1837 |
| 338 | Ga0075429_100040781 | 3300006880 | Bacteria | 4042 |
| 339 | Ga0075429_100094296 | 3300006880 | Unclassified | 2610 |
| 340 | Ga0068865_100021295 | 3300006881 | Bacteria | 4214 |
| 341 | Ga0068865_100251450 | 3300006881 | Bacteria | 1395 |
| 342 | Ga0068865_100353928 | 3300006881 | Bacteria | 1190 |
| 343 | Ga0075436_100178566 | 3300006914 | Unclassified | 1500 |
| 344 | Ga0097620_100007476 | 3300006931 | Bacteria | 11092 |
| 345 | Ga0097620_100021332 | 3300006931 | Archaea | 6500 |
| 346 | Ga0097620_100023588 | 3300006931 | Bacteria | 6175 |
| 347 | Ga0097620_100087961 | 3300006931 | Bacteria | 3155 |
| 348 | Ga0097620_100103723 | 3300006931 | Bacteria | 2902 |
| 349 | Ga0097620_100129625 | 3300006931 | Unclassified | 2593 |
| 350 | Ga0097620_100204658 | 3300006931 | Bacteria | 2059 |
| 351 | Ga0097620_100246767 | 3300006931 | Bacteria | 1875 |
| 352 | Ga0075435_100016854 | 3300007076 | Bacteria | 5516 |
| 353 | Ga0105251_10083198 | 3300009011 | Bacteria | 1478 |
| 354 | Ga0105251_10109763 | 3300009011 | Viruses | 1257 |
| 355 | Ga0105250_10105234 | 3300009092 | Unclassified | 1153 |
| 356 | Ga0105240_10033643 | 3300009093 | Bacteria | 6618 |
| 357 | Ga0105240_10090698 | 3300009093 | Bacteria | 3735 |
| 358 | Ga0105240_10321544 | 3300009093 | Bacteria | 1763 |
| 359 | Ga0105240_10494646 | 3300009093 | Bacteria | 1361 |
| 360 | Ga0105240_10524349 | 3300009093 | Bacteria | 1314 |
| 361 | Ga0111539_10000228 | 3300009094 | Bacteria | 67465 |
| 362 | Ga0105245_10580807 | 3300009098 | Unclassified | 1145 |
| 363 | Ga0105247_10000001 | 3300009101 | Bacteria | 739726 |
| 364 | Ga0105247_10000944 | 3300009101 | Bacteria | 21912 |
| 365 | Ga0105247_10212765 | 3300009101 | Bacteria | 1305 |
| 366 | Ga0105247_10402434 | 3300009101 | Unclassified | 976 |
| 367 | Ga0114129_10009329 | 3300009147 | Bacteria | 13999 |
| 368 | Ga0114129_10010021 | 3300009147 | Bacteria | 13509 |
| 369 | Ga0114129_10036140 | 3300009147 | Bacteria | 6976 |
| 370 | Ga0114129_10043736 | 3300009147 | Bacteria | 6301 |
| 371 | Ga0114129_10070255 | 3300009147 | Bacteria | 4882 |
| 372 | Ga0114129_10104964 | 3300009147 | Bacteria | 3905 |
| 373 | Ga0114129_10222357 | 3300009147 | Bacteria | 2546 |
| 374 | Ga0114129_10256404 | 3300009147 | Bacteria | 2346 |
| 375 | Ga0114129_10284886 | 3300009147 | Bacteria | 2207 |
| 376 | Ga0114129_10290623 | 3300009147 | Bacteria | 2181 |
| 377 | Ga0114129_10299469 | 3300009147 | Bacteria | 2144 |
| 378 | Ga0114129_10421697 | 3300009147 | Bacteria | 1755 |
| 379 | Ga0114129_11039024 | 3300009147 | Bacteria | 1029 |
| 380 | Ga0105243_10009655 | 3300009148 | Bacteria | 7345 |
| 381 | Ga0105243_10015532 | 3300009148 | Bacteria | 5755 |
| 382 | Ga0105243_10154001 | 3300009148 | Bacteria | 1975 |
| 383 | Ga0105243_10242299 | 3300009148 | Unclassified | 1605 |
| 384 | Ga0105243_10332241 | 3300009148 | Bacteria | 1389 |
| 385 | Ga0105243_10484654 | 3300009148 | Bacteria | 1168 |
| 386 | Ga0105243_10749931 | 3300009148 | Bacteria | 957 |
| 387 | Ga0105241_10039156 | 3300009174 | Unclassified | 3575 |
| 388 | Ga0105241_10042488 | 3300009174 | Bacteria | 3439 |
| 389 | Ga0105241_10054835 | 3300009174 | Bacteria | 3052 |
| 390 | Ga0105241_10097826 | 3300009174 | Unclassified | 2327 |
| 391 | Ga0105241_10126473 | 3300009174 | Bacteria | 2064 |
| 392 | Ga0105241_10213673 | 3300009174 | Bacteria | 1617 |
| 393 | Ga0105241_10221769 | 3300009174 | Unclassified | 1590 |
| 394 | Ga0105241_10238386 | 3300009174 | Bacteria | 1536 |
| 395 | Ga0105241_10311307 | 3300009174 | Bacteria | 1355 |
| 396 | Ga0105241_10362202 | 3300009174 | Unclassified | 1262 |
| 397 | Ga0105241_10434586 | 3300009174 | Bacteria | 1158 |
| 398 | Ga0105241_10539184 | 3300009174 | Unclassified | 1046 |
| 399 | Ga0105242_10020124 | 3300009176 | Bacteria | 5230 |
| 400 | Ga0105242_10119011 | 3300009176 | Unclassified | 2263 |
| 401 | Ga0105242_10266237 | 3300009176 | Bacteria | 1550 |
| 402 | Ga0105242_10367094 | 3300009176 | Bacteria | 1334 |
| 403 | Ga0105242_10457641 | 3300009176 | Bacteria | 1204 |
| 404 | Ga0105248_10007824 | 3300009177 | Bacteria | 11735 |
| 405 | Ga0105248_10030836 | 3300009177 | Bacteria | 5990 |
| 406 | Ga0105248_10084506 | 3300009177 | Bacteria | 3570 |
| 407 | Ga0105248_10092032 | 3300009177 | Bacteria | 3415 |
| 408 | Ga0105248_10107562 | 3300009177 | Bacteria | 3145 |
| 409 | Ga0105248_10146472 | 3300009177 | Bacteria | 2665 |
| 410 | Ga0105248_10282269 | 3300009177 | Bacteria | 1869 |
| 411 | Ga0105248_10666141 | 3300009177 | Bacteria | 1174 |
| 412 | Ga0105248_10695795 | 3300009177 | Bacteria | 1147 |
| 413 | Ga0105237_10003830 | 3300009545 | Bacteria | 17683 |
| 414 | Ga0105237_10064552 | 3300009545 | Bacteria | 3657 |
| 415 | Ga0105237_10167781 | 3300009545 | Unclassified | 2195 |
| 416 | Ga0105238_10023042 | 3300009551 | Bacteria | 6349 |
| 417 | Ga0105238_10029980 | 3300009551 | Bacteria | 5537 |
| 418 | Ga0105249_10000082 | 3300009553 | Bacteria | 137479 |
| 419 | Ga0105249_10004186 | 3300009553 | Bacteria | 12459 |
| 420 | Ga0105249_10041991 | 3300009553 | Unclassified | 4159 |
| 421 | Ga0105249_10070421 | 3300009553 | Bacteria | 3228 |
| 422 | Ga0105249_10082712 | 3300009553 | Bacteria | 2987 |
| 423 | Ga0105249_10493700 | 3300009553 | Bacteria | 1268 |
| 424 | Ga0105239_10025224 | 3300010375 | Bacteria | 6547 |
| 425 | Ga0105239_10038591 | 3300010375 | Bacteria | 5235 |
| 426 | Ga0105239_10243218 | 3300010375 | Bacteria | 2020 |
| 427 | Ga0105239_10673004 | 3300010375 | Unclassified | 1183 |
| 428 | Ga0105246_10061162 | 3300011119 | Bacteria | 2619 |
| 429 | Ga0105246_10144930 | 3300011119 | Bacteria | 1791 |
| 430 | Ga0105246_10168951 | 3300011119 | Bacteria | 1673 |
| 431 | Ga0105246_10243114 | 3300011119 | Bacteria | 1424 |
| 432 | Ga0105246_10292028 | 3300011119 | Bacteria | 1312 |
| 433 | Ga0157373_10001858 | 3300013100 | Bacteria | 16027 |
| 434 | Ga0157373_10034607 | 3300013100 | Unclassified | 3628 |
| 435 | Ga0157373_10052993 | 3300013100 | Bacteria | 2885 |
| 436 | Ga0157373_10073759 | 3300013100 | Bacteria | 2408 |
| 437 | Ga0157373_10147792 | 3300013100 | Bacteria | 1653 |
| 438 | Ga0157373_10156345 | 3300013100 | Bacteria | 1604 |
| 439 | Ga0157371_10606367 | 3300013102 | Unclassified | 815 |
| 440 | Ga0157370_10165512 | 3300013104 | Unclassified | 2056 |
| 441 | Ga0157369_10063904 | 3300013105 | Bacteria | 3965 |
| 442 | Ga0157374_10035586 | 3300013296 | Bacteria | 4556 |
| 443 | Ga0157374_10175646 | 3300013296 | Bacteria | 2091 |
| 444 | Ga0157378_10001322 | 3300013297 | Bacteria | 22280 |
| 445 | Ga0157378_10032365 | 3300013297 | Bacteria | 4621 |
| 446 | Ga0157378_10042818 | 3300013297 | Unclassified | 4019 |
| 447 | Ga0157378_10046208 | 3300013297 | Bacteria | 3871 |
| 448 | Ga0157378_10152807 | 3300013297 | Unclassified | 2152 |
| 449 | Ga0157378_10211766 | 3300013297 | Unclassified | 1838 |
| 450 | Ga0157378_10255179 | 3300013297 | Bacteria | 1680 |
| 451 | Ga0157378_10405347 | 3300013297 | Bacteria | 1345 |
| 452 | Ga0157378_10596690 | 3300013297 | Bacteria | 1115 |
| 453 | Ga0163162_10000002 | 3300013306 | Bacteria | 717331 |
| 454 | Ga0163162_10001013 | 3300013306 | Bacteria | 26117 |
| 455 | Ga0163162_10018042 | 3300013306 | Bacteria | 6906 |
| 456 | Ga0163162_10019028 | 3300013306 | Bacteria | 6734 |
| 457 | Ga0163162_10034927 | 3300013306 | Bacteria | 5005 |
| 458 | Ga0163162_10036450 | 3300013306 | Bacteria | 4903 |
| 459 | Ga0163162_10064268 | 3300013306 | Bacteria | 3714 |
| 460 | Ga0163162_10071625 | 3300013306 | Unclassified | 3520 |
| 461 | Ga0163162_10167414 | 3300013306 | Bacteria | 2322 |
| 462 | Ga0163162_10738049 | 3300013306 | Bacteria | 1105 |
| 463 | Ga0157372_10016757 | 3300013307 | Bacteria | 7866 |
| 464 | Ga0157372_10033719 | 3300013307 | Bacteria | 5626 |
| 465 | Ga0157372_10081450 | 3300013307 | Bacteria | 3664 |
| 466 | Ga0157372_10132186 | 3300013307 | Bacteria | 2872 |
| 467 | Ga0157372_10522260 | 3300013307 | Bacteria | 1384 |
| 468 | Ga0157372_11180763 | 3300013307 | Unclassified | 885 |
| 469 | Ga0157375_10024922 | 3300013308 | Bacteria | 5546 |
| 470 | Ga0157375_10060852 | 3300013308 | Bacteria | 3747 |
| 471 | Ga0157375_10107277 | 3300013308 | Viruses | 2886 |
| 472 | Ga0157375_10285441 | 3300013308 | Unclassified | 1814 |
| 473 | Ga0157375_10345755 | 3300013308 | Viruses | 1653 |
| 474 | Ga0163163_10000792 | 3300014325 | Bacteria | 26791 |
| 475 | Ga0163163_10001129 | 3300014325 | Bacteria | 22678 |
| 476 | Ga0163163_10002387 | 3300014325 | Bacteria | 15897 |
| 477 | Ga0163163_10006454 | 3300014325 | Bacteria | 10257 |
| 478 | Ga0163163_10052870 | 3300014325 | Bacteria | 4008 |
| 479 | Ga0163163_10056305 | 3300014325 | Bacteria | 3886 |
| 480 | Ga0163163_10105660 | 3300014325 | Bacteria | 2841 |
| 481 | Ga0163163_10201794 | 3300014325 | Bacteria | 2037 |
| 482 | Ga0163163_10274999 | 3300014325 | Bacteria | 1735 |
| 483 | Ga0163163_10329416 | 3300014325 | Unclassified | 1581 |
| 484 | Ga0163163_10513014 | 3300014325 | Bacteria | 1261 |
| 485 | Ga0163163_10536805 | 3300014325 | Bacteria | 1232 |
| 486 | Ga0163163_10766147 | 3300014325 | Bacteria | 1028 |
| 487 | Ga0163163_10944930 | 3300014325 | Unclassified | 925 |
| 488 | Ga0157380_10001721 | 3300014326 | Bacteria | 14423 |
| 489 | Ga0157380_10003861 | 3300014326 | Bacteria | 10330 |
| 490 | Ga0157380_10015660 | 3300014326 | Bacteria | 5574 |
| 491 | Ga0182008_10094903 | 3300014497 | Bacteria | 1472 |
| 492 | Ga0157377_10045491 | 3300014745 | Unclassified | 2452 |
| 493 | Ga0157377_10270408 | 3300014745 | Unclassified | 1110 |
| 494 | Ga0157379_10071775 | 3300014968 | Bacteria | 3097 |
| 495 | Ga0157379_10099444 | 3300014968 | Bacteria | 2611 |
| 496 | Ga0157379_10147467 | 3300014968 | Bacteria | 2122 |
| 497 | Ga0157379_10428276 | 3300014968 | Unclassified | 1219 |
| 498 | Ga0157376_10008850 | 3300014969 | Bacteria | 7283 |
| 499 | Ga0163161_10004077 | 3300017792 | Bacteria | 10217 |
| 500 | Ga0213876_10000456 | 3300021384 | Bacteria | 32826 |
| 501 | Ga0213876_10001307 | 3300021384 | Bacteria | 15671 |
| 502 | Ga0213876_10007222 | 3300021384 | Bacteria | 6057 |
| 503 | Ga0207672_1000167 | 3300025223 | Bacteria | 9023 |
| 504 | Ga0207697_10010841 | 3300025315 | Bacteria | 3877 |
| 505 | Ga0207697_10117111 | 3300025315 | Bacteria | 1144 |
| 506 | Ga0207653_10002903 | 3300025885 | Bacteria | 5445 |
| 507 | Ga0207710_10000003 | 3300025900 | Bacteria | 1071597 |
| 508 | Ga0207710_10002921 | 3300025900 | Bacteria | 7768 |
| 509 | Ga0207688_10080761 | 3300025901 | Bacteria | 1856 |
| 510 | Ga0207680_10101131 | 3300025903 | Bacteria | 1852 |
| 511 | Ga0207680_10222257 | 3300025903 | Bacteria | 1295 |
| 512 | Ga0207647_10002055 | 3300025904 | Bacteria | 15381 |
| 513 | Ga0207647_10077733 | 3300025904 | Unclassified | 1994 |
| 514 | Ga0207647_10182677 | 3300025904 | Unclassified | 1217 |
| 515 | Ga0207647_10243138 | 3300025904 | Unclassified | 1033 |
| 516 | Ga0207645_10088695 | 3300025907 | Bacteria | 1989 |
| 517 | Ga0207643_10003641 | 3300025908 | Bacteria | 8303 |
| 518 | Ga0207643_10012630 | 3300025908 | Unclassified | 4561 |
| 519 | Ga0207643_10042201 | 3300025908 | Bacteria | 2571 |
| 520 | Ga0207643_10166848 | 3300025908 | Bacteria | 1327 |
| 521 | Ga0207643_10170511 | 3300025908 | Unclassified | 1313 |
| 522 | Ga0207684_10000327 | 3300025910 | Bacteria | 67005 |
| 523 | Ga0207684_10006374 | 3300025910 | Bacteria | 10757 |
| 524 | Ga0207684_10011158 | 3300025910 | Bacteria | 7867 |
| 525 | Ga0207684_10019280 | 3300025910 | Bacteria | 5836 |
| 526 | Ga0207684_10075799 | 3300025910 | Unclassified | 2859 |
| 527 | Ga0207654_10061504 | 3300025911 | Unclassified | 2197 |
| 528 | Ga0207654_10081638 | 3300025911 | Unclassified | 1947 |
| 529 | Ga0207654_10137003 | 3300025911 | Bacteria | 1556 |
| 530 | Ga0207654_10231527 | 3300025911 | Bacteria | 1231 |
| 531 | Ga0207654_10363727 | 3300025911 | Unclassified | 999 |
| 532 | Ga0207654_10624022 | 3300025911 | Bacteria | 770 |
| 533 | Ga0207707_10000142 | 3300025912 | Bacteria | 74613 |
| 534 | Ga0207707_10008860 | 3300025912 | Bacteria | 8737 |
| 535 | Ga0207707_10013516 | 3300025912 | Bacteria | 7115 |
| 536 | Ga0207707_10134238 | 3300025912 | Bacteria | 2164 |
| 537 | Ga0207707_10247811 | 3300025912 | Bacteria | 1548 |
| 538 | Ga0207695_10145025 | 3300025913 | Bacteria | 2319 |
| 539 | Ga0207671_10008571 | 3300025914 | Bacteria | 8650 |
| 540 | Ga0207671_10021278 | 3300025914 | Bacteria | 4922 |
| 541 | Ga0207671_10027714 | 3300025914 | Unclassified | 4235 |
| 542 | Ga0207671_10058927 | 3300025914 | Bacteria | 2847 |
| 543 | Ga0207671_10234845 | 3300025914 | Bacteria | 1439 |
| 544 | Ga0207660_10002786 | 3300025917 | Bacteria | 11453 |
| 545 | Ga0207660_10052273 | 3300025917 | Bacteria | 2908 |
| 546 | Ga0207660_10094914 | 3300025917 | Viruses | 2218 |
| 547 | Ga0207662_10010043 | 3300025918 | Bacteria | 5220 |
| 548 | Ga0207662_10015191 | 3300025918 | Bacteria | 4329 |
| 549 | Ga0207662_10086136 | 3300025918 | Bacteria | 1925 |
| 550 | Ga0207662_10088016 | 3300025918 | Unclassified | 1906 |
| 551 | Ga0207662_10146703 | 3300025918 | Bacteria | 1498 |
| 552 | Ga0207662_10211930 | 3300025918 | Bacteria | 1258 |
| 553 | Ga0207649_10053965 | 3300025920 | Bacteria | 2500 |
| 554 | Ga0207649_10083594 | 3300025920 | Bacteria | 2073 |
| 555 | Ga0207652_10000361 | 3300025921 | Bacteria | 47204 |
| 556 | Ga0207652_10045654 | 3300025921 | Bacteria | 3735 |
| 557 | Ga0207652_10069092 | 3300025921 | Bacteria | 3066 |
| 558 | Ga0207652_10263533 | 3300025921 | Unclassified | 1555 |
| 559 | Ga0207646_10003588 | 3300025922 | Bacteria | 17390 |
| 560 | Ga0207646_10194872 | 3300025922 | Bacteria | 1830 |
| 561 | Ga0207646_10284974 | 3300025922 | Unclassified | 1493 |
| 562 | Ga0207681_10041364 | 3300025923 | Bacteria | 3072 |
| 563 | Ga0207681_10113607 | 3300025923 | Bacteria | 1974 |
| 564 | Ga0207694_10058438 | 3300025924 | Bacteria | 2999 |
| 565 | Ga0207694_10071133 | 3300025924 | Bacteria | 2718 |
| 566 | Ga0207650_10000313 | 3300025925 | Bacteria | 47889 |
| 567 | Ga0207650_10088474 | 3300025925 | Unclassified | 2362 |
| 568 | Ga0207650_10127877 | 3300025925 | Bacteria | 1985 |
| 569 | Ga0207659_10670811 | 3300025926 | Unclassified | 887 |
| 570 | Ga0207644_10006242 | 3300025931 | Bacteria | 7768 |
| 571 | Ga0207644_10039335 | 3300025931 | Bacteria | 3338 |
| 572 | Ga0207644_10073028 | 3300025931 | Bacteria | 2514 |
| 573 | Ga0207644_10351120 | 3300025931 | Bacteria | 1198 |
| 574 | Ga0207690_10002898 | 3300025932 | Bacteria | 10336 |
| 575 | Ga0207690_10386069 | 3300025932 | Unclassified | 1114 |
| 576 | Ga0207706_10034806 | 3300025933 | Bacteria | 4481 |
| 577 | Ga0207706_10179685 | 3300025933 | Unclassified | 1858 |
| 578 | Ga0207686_10066718 | 3300025934 | Bacteria | 2299 |
| 579 | Ga0207686_10422081 | 3300025934 | Bacteria | 1020 |
| 580 | Ga0207709_10009750 | 3300025935 | Bacteria | 5292 |
| 581 | Ga0207709_10011773 | 3300025935 | Bacteria | 4822 |
| 582 | Ga0207709_10211531 | 3300025935 | Bacteria | 1392 |
| 583 | Ga0207670_10002988 | 3300025936 | Bacteria | 8925 |
| 584 | Ga0207670_10005837 | 3300025936 | Bacteria | 6796 |
| 585 | Ga0207670_10095794 | 3300025936 | Bacteria | 2109 |
| 586 | Ga0207670_10160762 | 3300025936 | Bacteria | 1676 |
| 587 | Ga0207670_10239436 | 3300025936 | Unclassified | 1397 |
| 588 | Ga0207704_10046734 | 3300025938 | Bacteria | 2582 |
| 589 | Ga0207665_10053071 | 3300025939 | Unclassified | 2732 |
| 590 | Ga0207665_10132920 | 3300025939 | Unclassified | 1768 |
| 591 | Ga0207665_10198050 | 3300025939 | Bacteria | 1462 |
| 592 | Ga0207665_10472188 | 3300025939 | Unclassified | 965 |
| 593 | Ga0207691_10000900 | 3300025940 | Bacteria | 29470 |
| 594 | Ga0207691_10001099 | 3300025940 | Bacteria | 26879 |
| 595 | Ga0207691_10101924 | 3300025940 | Unclassified | 2561 |
| 596 | Ga0207691_10147009 | 3300025940 | Bacteria | 2074 |
| 597 | Ga0207691_10348630 | 3300025940 | Bacteria | 1267 |
| 598 | Ga0207711_10009470 | 3300025941 | Bacteria | 8127 |
| 599 | Ga0207711_10060499 | 3300025941 | Bacteria | 3264 |
| 600 | Ga0207711_10104861 | 3300025941 | Bacteria | 2506 |
| 601 | Ga0207711_10255243 | 3300025941 | Bacteria | 1611 |
| 602 | Ga0207711_10312417 | 3300025941 | Bacteria | 1451 |
| 603 | Ga0207711_10598697 | 3300025941 | Bacteria | 1028 |
| 604 | Ga0207689_10005258 | 3300025942 | Bacteria | 11605 |
| 605 | Ga0207689_10007541 | 3300025942 | Bacteria | 9541 |
| 606 | Ga0207689_10035808 | 3300025942 | Bacteria | 4121 |
| 607 | Ga0207689_10077303 | 3300025942 | Bacteria | 2736 |
| 608 | Ga0207689_10122646 | 3300025942 | Bacteria | 2137 |
| 609 | Ga0207689_10122918 | 3300025942 | Bacteria | 2135 |
| 610 | Ga0207689_10191300 | 3300025942 | Unclassified | 1688 |
| 611 | Ga0207689_10561898 | 3300025942 | Unclassified | 959 |
| 612 | Ga0207661_10351934 | 3300025944 | Bacteria | 1329 |
| 613 | Ga0207679_10011061 | 3300025945 | Bacteria | 5828 |
| 614 | Ga0207679_10140743 | 3300025945 | Bacteria | 1950 |
| 615 | Ga0207667_10201046 | 3300025949 | Bacteria | 2044 |
| 616 | Ga0207651_10003013 | 3300025960 | Bacteria | 8160 |
| 617 | Ga0207651_10004834 | 3300025960 | Bacteria | 6860 |
| 618 | Ga0207651_10041794 | 3300025960 | Bacteria | 3046 |
| 619 | Ga0207651_10075570 | 3300025960 | Bacteria | 2405 |
| 620 | Ga0207651_10179882 | 3300025960 | Bacteria | 1677 |
| 621 | Ga0207651_10188311 | 3300025960 | Bacteria | 1644 |
| 622 | Ga0207651_10243078 | 3300025960 | Bacteria | 1468 |
| 623 | Ga0207651_10285664 | 3300025960 | Unclassified | 1366 |
| 624 | Ga0207651_10288624 | 3300025960 | Bacteria | 1359 |
| 625 | Ga0207712_10000075 | 3300025961 | Bacteria | 120693 |
| 626 | Ga0207712_10005296 | 3300025961 | Bacteria | 8148 |
| 627 | Ga0207712_10033030 | 3300025961 | Bacteria | 3496 |
| 628 | Ga0207712_10070098 | 3300025961 | Bacteria | 2517 |
| 629 | Ga0207712_10164949 | 3300025961 | Bacteria | 1726 |
| 630 | Ga0207712_10463546 | 3300025961 | Bacteria | 1077 |
| 631 | Ga0207668_10094155 | 3300025972 | Bacteria | 2208 |
| 632 | Ga0207640_10052429 | 3300025981 | Bacteria | 2657 |
| 633 | Ga0207640_10238404 | 3300025981 | Unclassified | 1404 |
| 634 | Ga0207658_10136522 | 3300025986 | Bacteria | 1979 |
| 635 | Ga0207658_10724769 | 3300025986 | Unclassified | 900 |
| 636 | Ga0207703_10000118 | 3300026035 | Bacteria | 95317 |
| 637 | Ga0207703_10048587 | 3300026035 | Bacteria | 3426 |
| 638 | Ga0207703_10075988 | 3300026035 | Bacteria | 2785 |
| 639 | Ga0207703_10181224 | 3300026035 | Unclassified | 1859 |
| 640 | Ga0207703_10433600 | 3300026035 | Bacteria | 1225 |
| 641 | Ga0207703_10498915 | 3300026035 | Bacteria | 1142 |
| 642 | Ga0207639_10012957 | 3300026041 | Bacteria | 5818 |
| 643 | Ga0207639_10013199 | 3300026041 | Bacteria | 5776 |
| 644 | Ga0207639_10167671 | 3300026041 | Bacteria | 1857 |
| 645 | Ga0207639_10273744 | 3300026041 | Unclassified | 1482 |
| 646 | Ga0207639_10319434 | 3300026041 | Bacteria | 1378 |
| 647 | Ga0207639_10417970 | 3300026041 | Bacteria | 1212 |
| 648 | Ga0207678_10611512 | 3300026067 | Unclassified | 956 |
| 649 | Ga0207708_10000149 | 3300026075 | Bacteria | 56107 |
| 650 | Ga0207708_10032572 | 3300026075 | Bacteria | 3958 |
| 651 | Ga0207708_10035028 | 3300026075 | Bacteria | 3820 |
| 652 | Ga0207708_10095463 | 3300026075 | Bacteria | 2297 |
| 653 | Ga0207702_10411385 | 3300026078 | Bacteria | 1306 |
| 654 | Ga0207702_10506417 | 3300026078 | Unclassified | 1177 |
| 655 | Ga0207641_10065626 | 3300026088 | Bacteria | 3105 |
| 656 | Ga0207641_10069708 | 3300026088 | Bacteria | 3020 |
| 657 | Ga0207641_10092706 | 3300026088 | Bacteria | 2646 |
| 658 | Ga0207641_10303643 | 3300026088 | Bacteria | 1508 |
| 659 | Ga0207641_10440741 | 3300026088 | Unclassified | 1257 |
| 660 | Ga0207641_11163525 | 3300026088 | Bacteria | 771 |
| 661 | Ga0207648_10010767 | 3300026089 | Bacteria | 8641 |
| 662 | Ga0207648_10099781 | 3300026089 | Bacteria | 2543 |
| 663 | Ga0207648_10236459 | 3300026089 | Bacteria | 1626 |
| 664 | Ga0207648_10329851 | 3300026089 | Unclassified | 1372 |
| 665 | Ga0207648_10339380 | 3300026089 | Bacteria | 1353 |
| 666 | Ga0207676_10030219 | 3300026095 | Bacteria | 4064 |
| 667 | Ga0207676_10055713 | 3300026095 | Bacteria | 3105 |
| 668 | Ga0207676_10071960 | 3300026095 | Bacteria | 2777 |
| 669 | Ga0207676_10094810 | 3300026095 | Bacteria | 2460 |
| 670 | Ga0207676_10136198 | 3300026095 | Bacteria | 2095 |
| 671 | Ga0207676_10280528 | 3300026095 | Bacteria | 1512 |
| 672 | Ga0207676_10902141 | 3300026095 | Unclassified | 867 |
| 673 | Ga0207674_10000115 | 3300026116 | Bacteria | 93114 |
| 674 | Ga0207674_10052508 | 3300026116 | Unclassified | 4157 |
| 675 | Ga0207674_10081385 | 3300026116 | Bacteria | 3241 |
| 676 | Ga0207674_10081537 | 3300026116 | Bacteria | 3237 |
| 677 | Ga0207674_10183079 | 3300026116 | Bacteria | 2046 |
| 678 | Ga0207674_10309286 | 3300026116 | Unclassified | 1529 |
| 679 | Ga0207674_10403195 | 3300026116 | Unclassified | 1321 |
| 680 | Ga0207674_10451493 | 3300026116 | Unclassified | 1242 |
| 681 | Ga0207674_10467076 | 3300026116 | Bacteria | 1220 |
| 682 | Ga0207674_10475087 | 3300026116 | Bacteria | 1208 |
| 683 | Ga0207674_10529639 | 3300026116 | Bacteria | 1138 |
| 684 | Ga0207675_100004070 | 3300026118 | Bacteria | 14154 |
| 685 | Ga0207675_100054853 | 3300026118 | Unclassified | 3718 |
| 686 | Ga0207675_100067857 | 3300026118 | Bacteria | 3334 |
| 687 | Ga0207675_100085625 | 3300026118 | Bacteria | 2958 |
| 688 | Ga0207675_100087553 | 3300026118 | Bacteria | 2925 |
| 689 | Ga0207675_100097610 | 3300026118 | Bacteria | 2767 |
| 690 | Ga0207675_100110978 | 3300026118 | Unclassified | 2588 |
| 691 | Ga0207675_100385111 | 3300026118 | Bacteria | 1379 |
| 692 | Ga0207675_100568033 | 3300026118 | Unclassified | 1135 |
| 693 | Ga0207698_10151975 | 3300026142 | Bacteria | 2011 |
| 694 | Ga0207698_10165393 | 3300026142 | Bacteria | 1941 |
| 695 | Ga0207428_10009062 | 3300027907 | Bacteria | 8949 |
| 696 | Ga0268265_10085360 | 3300028380 | Bacteria | 2505 |
| 697 | Ga0268265_10144162 | 3300028380 | Viruses | 1998 |
| 698 | Ga0268265_10368297 | 3300028380 | Bacteria | 1318 |
| 699 | Ga0268265_10389014 | 3300028380 | Bacteria | 1285 |
| 700 | Ga0268264_10009332 | 3300028381 | Bacteria | 8123 |
| 701 | Ga0268264_10014553 | 3300028381 | Bacteria | 6462 |
| 702 | Ga0268264_10117979 | 3300028381 | Bacteria | 2335 |
| 703 | Ga0268264_10212015 | 3300028381 | Bacteria | 1778 |
| 704 | Ga0268264_10362442 | 3300028381 | Unclassified | 1383 |
| 705 | Ga0268264_10679371 | 3300028381 | Bacteria | 1021 |
| 706 | Ga0268264_11217815 | 3300028381 | Unclassified | 762 |
| 707 | Ga0307408_100013368 | 3300031548 | Bacteria | 5446 |
| 708 | Ga0307408_100051065 | 3300031548 | Unclassified | 2977 |
| 709 | Ga0307408_100929913 | 3300031548 | Bacteria | 797 |
| 710 | Ga0307405_10028822 | 3300031731 | Bacteria | 3238 |
| 711 | Ga0307405_10662984 | 3300031731 | Unclassified | 859 |
| 712 | Ga0307413_10016901 | 3300031824 | Bacteria | 3786 |
| 713 | Ga0307413_10237889 | 3300031824 | Bacteria | 1342 |
| 714 | Ga0307410_10012790 | 3300031852 | Bacteria | 4869 |
| 715 | Ga0307410_10037850 | 3300031852 | Bacteria | 3155 |
| 716 | Ga0307410_10057723 | 3300031852 | Unclassified | 2644 |
| 717 | Ga0307410_10075240 | 3300031852 | Unclassified | 2354 |
| 718 | Ga0307410_10508618 | 3300031852 | Unclassified | 992 |
| 719 | Ga0307406_10010023 | 3300031901 | Bacteria | 5332 |
| 720 | Ga0307406_10013760 | 3300031901 | Unclassified | 4641 |
| 721 | Ga0307406_10068185 | 3300031901 | Unclassified | 2322 |
| 722 | Ga0307406_10294236 | 3300031901 | Bacteria | 1244 |
| 723 | Ga0307406_10349934 | 3300031901 | Unclassified | 1154 |
| 724 | Ga0307407_10016091 | 3300031903 | Bacteria | 3715 |
| 725 | Ga0307407_10070884 | 3300031903 | Unclassified | 2073 |
| 726 | Ga0307412_10045781 | 3300031911 | Unclassified | 2862 |
| 727 | Ga0307412_10065581 | 3300031911 | Bacteria | 2458 |
| 728 | Ga0307412_10087522 | 3300031911 | Bacteria | 2170 |
| 729 | Ga0307409_100000663 | 3300031995 | Bacteria | 15255 |
| 730 | Ga0307409_100138670 | 3300031995 | Bacteria | 2092 |
| 731 | Ga0307409_100298806 | 3300031995 | Bacteria | 1497 |
| 732 | Ga0307416_100071864 | 3300032002 | Bacteria | 2877 |
| 733 | Ga0307416_100503468 | 3300032002 | Bacteria | 1276 |
| 734 | Ga0307416_100906647 | 3300032002 | Bacteria | 982 |
| 735 | Ga0307416_101036095 | 3300032002 | Unclassified | 924 |
| 736 | Ga0307414_10006298 | 3300032004 | Bacteria | 6603 |
| 737 | Ga0307414_10039321 | 3300032004 | Bacteria | 3185 |
| 738 | Ga0307411_10013130 | 3300032005 | Bacteria | 4555 |
| 739 | Ga0307411_10019309 | 3300032005 | Bacteria | 3935 |
| 740 | Ga0307411_10053741 | 3300032005 | Bacteria | 2641 |
| 741 | Ga0307411_10071903 | 3300032005 | Bacteria | 2347 |
| 742 | Ga0307411_10158877 | 3300032005 | Bacteria | 1690 |
| 743 | Ga0307411_10177398 | 3300032005 | Unclassified | 1613 |
| 744 | Ga0307415_100005152 | 3300032126 | Bacteria | 6896 |
| 745 | Ga0307415_100026563 | 3300032126 | Unclassified | 3654 |
| 746 | Ga0307415_100048519 | 3300032126 | Bacteria | 2866 |
| 747 | Ga0307415_100145386 | 3300032126 | Unclassified | 1817 |
| 748 | Ga0373949_0015015 | 3300035090 | Bacteria | 1727 |
| 749 | Ga0373951_0002234 | 3300035091 | Bacteria | 4921 |
| 750 | Ga0373942_0056745 | 3300035207 | Unclassified | 1112 |
| 751 | Ga0373961_0081109 | 3300035241 | Bacteria | 1021 |
| 752 | Ga0373962_0013515 | 3300035242 | Bacteria | 2070 |
| 753 | Ga0373931_0065689 | 3300035691 | Unclassified | 1967 |
| 754 | Ga0395900_0128868 | 3300037418 | Bacteria | 2594 |
| 755 | Ga0395900_0292844 | 3300037418 | Bacteria | 1616 |
| 756 | Ga0395898_0072037 | 3300037466 | Bacteria | 3339 |
| 757 | Ga0395898_0541380 | 3300037466 | Bacteria | 1106 |
| 758 | Ga0395905_0015010 | 3300037471 | Bacteria | 7383 |
| 759 | Ga0395905_0480250 | 3300037471 | Bacteria | 1142 |
| 760 | Ga0436364_1261410 | 3300037853 | Bacteria | 2421 |
| 761 | Ga0395901_0907650 | 3300038443 | Bacteria | 862 |
| 762 | Ga0242422_00406 | 3300038699 | Bacteria | 2692 |
| 763 | Ga0436365_0475046 | 3300039437 | Unclassified | 1634 |
| 764 | Ga0436365_1035707 | 3300039437 | Bacteria | 53176 |
| 765 | Ga0436365_1254673 | 3300039437 | Bacteria | 6056 |
| 766 | Ga0436365_1522569 | 3300039437 | Bacteria | 30271 |
| 767 | Ga0436365_1814617 | 3300039437 | Bacteria | 1893 |
| 768 | Ga0439439_0060500 | 3300041406 | Unclassified | 1005 |
| 769 | Ga0439455_0018825 | 3300042012 | Bacteria | 1623 |
| 770 | Ga0439446_0058904 | 3300042156 | Bacteria | 1159 |
| 771 | Ga0439458_0011023 | 3300042157 | Bacteria | 2018 |
| 772 | Ga0439434_0053027 | 3300042435 | Bacteria | 1259 |
| 773 | Ga0439460_0016911 | 3300042461 | Unclassified | 1948 |
| 774 | Ga0495582_0253697 | 3300046473 | Bacteria | 1009 |
| 775 | Ga0495663_0000250 | 3300046525 | Bacteria | 20919 |
| 776 | Ga0495598_0000324 | 3300046537 | Bacteria | 8561 |
| 777 | Ga0495621_0000620 | 3300046539 | Bacteria | 8926 |
| 778 | Ga0495645_0084295 | 3300046543 | Bacteria | 2276 |
| 779 | Ga0495656_0246557 | 3300046615 | Bacteria | 901 |
| 780 | Ga0495668_0092278 | 3300046616 | Bacteria | 1659 |
| 781 | Ga0495669_0152306 | 3300046684 | Bacteria | 1095 |
| 782 | Ga0496104_0196700 | 3300048907 | Bacteria | 1928 |
| 783 | Ga0496104_0241948 | 3300048907 | Unclassified | 1717 |
| 784 | Ga0496106_0110556 | 3300048909 | Bacteria | 2139 |
| 785 | Ga0496107_0605884 | 3300048910 | Unclassified | 809 |
| 786 | Ga0496108_0696700 | 3300048911 | Bacteria | 881 |
| 787 | Ga0496109_0386309 | 3300048912 | Bacteria | 1323 |
| 788 | Ga0496110_0540762 | 3300048913 | Unclassified | 1059 |
| 789 | Ga0496110_0552282 | 3300048913 | Bacteria | 1047 |
| 790 | Ga0496112_0220922 | 3300048915 | Unclassified | 1851 |
| 791 | Ga0496112_0228025 | 3300048915 | Bacteria | 1818 |
| 792 | Ga0496112_0363818 | 3300048915 | Bacteria | 1388 |
| 793 | Ga0496112_0653568 | 3300048915 | Bacteria | 981 |
| 794 | Ga0496113_0018347 | 3300048916 | Bacteria | 4871 |
| 795 | Ga0496113_0237208 | 3300048916 | Bacteria | 1455 |
| 796 | Ga0496113_0282661 | 3300048916 | Bacteria | 1327 |
| 797 | Ga0501291_002148 | 3300049514 | Unclassified | 2338 |
| 798 | Ga0501291_024371 | 3300049514 | Bacteria | 983 |
| 799 | Ga0501292_005738 | 3300049515 | Unclassified | 1741 |
| 800 | Ga0501292_011067 | 3300049515 | Bacteria | 1360 |
| 801 | Ga0501292_052455 | 3300049515 | Unclassified | 725 |
| 802 | Ga0501295_033862 | 3300049518 | Unclassified | 1024 |
| 803 | Ga0501296_000385 | 3300049519 | Unclassified | 4432 |
| 804 | Ga0501296_003153 | 3300049519 | Unclassified | 1752 |
| 805 | Ga0501297_010357 | 3300049520 | Unclassified | 1054 |
| 806 | Ga0501298_002662 | 3300049521 | Unclassified | 2719 |
| 807 | Ga0501298_006179 | 3300049521 | Unclassified | 1950 |
| 808 | Ga0501298_050066 | 3300049521 | Unclassified | 865 |
| 809 | Ga0501299_009132 | 3300049522 | Unclassified | 1628 |
| 810 | Ga0501299_030963 | 3300049522 | Bacteria | 1032 |
| 811 | Ga0501302_001276 | 3300049525 | Unclassified | 1377 |
| 812 | Ga0501303_006396 | 3300049526 | Unclassified | 1027 |
| 813 | Ga0501038_0002990 | 3300049574 | Bacteria | 15762 |
| 814 | Ga0501198_004236 | 3300049649 | Bacteria | 1986 |
| 815 | Ga0501202_045306 | 3300049652 | Unclassified | 961 |
| 816 | Ga0501206_009230 | 3300049653 | Unclassified | 1310 |
| 817 | Ga0501207_007861 | 3300049654 | Unclassified | 1530 |
| 818 | Ga0501207_025630 | 3300049654 | Unclassified | 968 |
| 819 | Ga0501208_016359 | 3300049655 | Bacteria | 1153 |
| 820 | Ga0501216_001287 | 3300049660 | Bacteria | 3359 |
| 821 | Ga0501216_003973 | 3300049660 | Unclassified | 2178 |
| 822 | Ga0501216_005192 | 3300049660 | Unclassified | 1953 |
| 823 | Ga0501217_000999 | 3300049661 | Bacteria | 5114 |
| 824 | Ga0501217_003179 | 3300049661 | Bacteria | 3295 |
| 825 | Ga0501217_007155 | 3300049661 | Unclassified | 2387 |
| 826 | Ga0501217_011956 | 3300049661 | Bacteria | 1927 |
| 827 | Ga0501223_011764 | 3300049663 | Unclassified | 1756 |
| 828 | Ga0501224_001194 | 3300049664 | Bacteria | 3408 |
| 829 | Ga0501224_006398 | 3300049664 | Bacteria | 1707 |
| 830 | Ga0501227_001750 | 3300049665 | Bacteria | 4819 |
| 831 | Ga0501227_005350 | 3300049665 | Bacteria | 2747 |
| 832 | Ga0501228_007948 | 3300049666 | Unclassified | 1004 |
| 833 | Ga0501233_002330 | 3300049668 | Bacteria | 3343 |
| 834 | Ga0501233_002767 | 3300049668 | Bacteria | 3112 |
| 835 | Ga0501233_050116 | 3300049668 | Bacteria | 1009 |
| 836 | Ga0501233_058559 | 3300049668 | Bacteria | 951 |
| 837 | Ga0501235_009168 | 3300049669 | Bacteria | 2162 |
| 838 | Ga0501235_010494 | 3300049669 | Unclassified | 2024 |
| 839 | Ga0501236_018163 | 3300049670 | Bacteria | 1012 |
| 840 | Ga0501242_014433 | 3300049674 | Unclassified | 978 |
| 841 | Ga0501243_018322 | 3300049675 | Bacteria | 1140 |
| 842 | Ga0501249_011636 | 3300049679 | Unclassified | 1850 |
| 843 | Ga0501253_023569 | 3300049683 | Unclassified | 1108 |
| 844 | Ga0501257_011757 | 3300049686 | Bacteria | 2000 |
| 845 | Ga0501257_013698 | 3300049686 | Bacteria | 1860 |
| 846 | Ga0501257_030136 | 3300049686 | Bacteria | 1305 |
| 847 | Ga0501259_000994 | 3300049688 | Unclassified | 4712 |
| 848 | Ga0501261_004238 | 3300049690 | Unclassified | 1767 |
| 849 | Ga0501225_0003206 | 3300049705 | Unclassified | 4998 |
| 850 | Ga0501225_0005408 | 3300049705 | Bacteria | 3752 |
| 851 | Ga0501225_0005503 | 3300049705 | Bacteria | 3715 |
| 852 | Ga0501225_0049288 | 3300049705 | Unclassified | 1171 |
| 853 | Ga0501225_0081332 | 3300049705 | Bacteria | 930 |
| 854 | Ga0501229_017520 | 3300049706 | Unclassified | 935 |
| 855 | Ga0501234_004139 | 3300049707 | Unclassified | 2277 |
| 856 | Ga0501234_007201 | 3300049707 | Unclassified | 1742 |
| 857 | Ga0501234_020238 | 3300049707 | Bacteria | 1058 |
| 858 | Ga0501245_010136 | 3300049708 | Unclassified | 1359 |
| 859 | Ga0501245_037458 | 3300049708 | Unclassified | 823 |
| 860 | Ga0501080_0409654 | 3300049742 | Bacteria | 1219 |
| 861 | Ga0501232_003194 | 3300049757 | Bacteria | 1480 |
| 862 | Ga0501241_021038 | 3300049758 | Bacteria | 1202 |
| 863 | Ga0501268_011948 | 3300049765 | Unclassified | 1381 |
| 864 | Ga0501270_016125 | 3300049767 | Unclassified | 1076 |
| 865 | Ga0501272_000969 | 3300049769 | Unclassified | 2629 |
| 866 | Ga0501273_019455 | 3300049770 | Bacteria | 910 |
| 867 | Ga0501274_010100 | 3300049771 | Unclassified | 866 |
| 868 | Ga0501283_000500 | 3300049779 | Bacteria | 5167 |
| 869 | Ga0501283_006315 | 3300049779 | Bacteria | 1657 |
| 870 | Ga0501212_000526 | 3300049851 | Bacteria | 3771 |
| 871 | Ga0501212_005485 | 3300049851 | Bacteria | 1676 |
| 872 | Ga0501226_001467 | 3300049853 | Bacteria | 3013 |
| 873 | nmdc:mga05p37_102787_c1 | 3300050507 | Bacteria | 3518 |
| 874 | nmdc:mga05p37_106883_c1 | 3300050507 | Bacteria | 3443 |
| 875 | nmdc:mga05p37_229121_c1 | 3300050507 | Bacteria | 2239 |
| 876 | nmdc:mga05p37_233694_c1 | 3300050507 | Bacteria | 2214 |
| 877 | nmdc:mga05p37_358293_c1 | 3300050507 | Bacteria | 1715 |
| 878 | nmdc:mga05p37_396484_c1 | 3300050507 | Bacteria | 1612 |
| 879 | nmdc:mga05p37_458242_c1 | 3300050507 | Bacteria | 1474 |
| 880 | nmdc:mga05p37_491371_c1 | 3300050507 | Bacteria | 1411 |
| 881 | nmdc:mga05p37_63333_c1 | 3300050507 | Bacteria | 4550 |
| 882 | nmdc:mga09592_123925_c1 | 3300050508 | Bacteria | 2221 |
| 883 | nmdc:mga0qj67_203653_c1 | 3300050509 | Bacteria | 1608 |
| 884 | nmdc:mga06r32_209432_c1 | 3300050510 | Bacteria | 1937 |
| 885 | nmdc:mga06r32_605969_c1 | 3300050510 | Bacteria | 1066 |
| 886 | nmdc:mga06r32_76972_c1 | 3300050510 | Unclassified | 3240 |
| 887 | nmdc:mga08y16_15514_c1 | 3300050511 | Bacteria | 8011 |
| 888 | nmdc:mga0n895_217147_c1 | 3300050512 | Bacteria | 1942 |
| 889 | nmdc:mga0n895_33535_c1 | 3300050512 | Bacteria | 4936 |
| 890 | nmdc:mga0rr50_364557_c1 | 3300050513 | Bacteria | 1217 |
| 891 | nmdc:mga0rr50_439611_c1 | 3300050513 | Unclassified | 1105 |
| 892 | nmdc:mga08x19_166377_c1 | 3300050514 | Unclassified | 1500 |
| 893 | nmdc:mga0a205_13389_c1 | 3300050515 | Bacteria | 7636 |
| 894 | nmdc:mga0a205_24407_c1 | 3300050515 | Bacteria | 5749 |
| 895 | nmdc:mga0a205_267608_c1 | 3300050515 | Unclassified | 1586 |
| 896 | nmdc:mga0a205_31937_c1 | 3300050515 | Bacteria | 5047 |
| 897 | nmdc:mga0a205_48678_c1 | 3300050515 | Unclassified | 4092 |
| 898 | nmdc:mga0a205_489906_c1 | 3300050515 | Bacteria | 1087 |
| 899 | nmdc:mga0a205_538296_c1 | 3300050515 | Unclassified | 1023 |
| 900 | nmdc:mga0a205_727360_c1 | 3300050515 | Bacteria | 842 |
| 901 | nmdc:mga0a205_72874_c1 | 3300050515 | Bacteria | 3318 |
| 902 | Ga0495601_0039808 | 3300053077 | Unclassified | 2944 |
| 903 | Ga0500616_0002784 | 3300053153 | Bacteria | 14088 |
| 904 | Ga0530510_0139104 | 3300061734 | Bacteria | 1788 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049683 | Ga0501253_023569 | Ga0501253_023569_497_1087 | 194 |
| 2 | 3300009147 | Ga0114129_10009329 | Ga0114129_1000932912 | 208 |
| 3 | 3300050507 | nmdc:mga05p37_106883_c1 | nmdc:mga05p37_106883_c1_1122_1907 | 208 |
| 4 | 3300031901 | Ga0307406_10013760 | Ga0307406_100137605 | 212 |
| 5 | 3300039437 | Ga0436365_1522569 | Ga0436365_1522569_10266_11009 | 212 |
| 6 | 3300006852 | Ga0075433_10068108 | Ga0075433_100681082 | 216 |
| 7 | 3300006871 | Ga0075434_100053330 | Ga0075434_1000533304 | 216 |
| 8 | 3300025911 | Ga0207654_10363727 | Ga0207654_103637272 | 216 |
| 9 | 3300039437 | Ga0436365_1035707 | Ga0436365_1035707_39528_40271 | 216 |
| 10 | 3300009093 | Ga0105240_10524349 | Ga0105240_105243492 | 217 |
| 11 | 3300009174 | Ga0105241_10213673 | Ga0105241_102136732 | 217 |
| 12 | 3300013307 | Ga0157372_10132186 | Ga0157372_101321862 | 217 |
| 13 | 3300049515 | Ga0501292_011067 | Ga0501292_011067_326_1000 | 217 |
| 14 | 3300050512 | nmdc:mga0n895_33535_c1 | nmdc:mga0n895_33535_c1_277_1023 | 217 |
| 15 | 3300031824 | Ga0307413_10016901 | Ga0307413_100169014 | 218 |
| 16 | 3300031852 | Ga0307410_10012790 | Ga0307410_100127904 | 218 |
| 17 | 3300031903 | Ga0307407_10016091 | Ga0307407_100160913 | 218 |
| 18 | 3300031911 | Ga0307412_10065581 | Ga0307412_100655813 | 218 |
| 19 | 3300031995 | Ga0307409_100000663 | Ga0307409_1000006634 | 218 |
| 20 | 3300032004 | Ga0307414_10039321 | Ga0307414_100393213 | 218 |
| 21 | 3300032005 | Ga0307411_10013130 | Ga0307411_100131302 | 218 |
| 22 | 3300042156 | Ga0439446_0058904 | Ga0439446_0058904_389_1147 | 218 |
| 23 | 3300031548 | Ga0307408_100051065 | Ga0307408_1000510653 | 219 |
| 24 | 3300031901 | Ga0307406_10294236 | Ga0307406_102942361 | 219 |
| 25 | 3300025936 | Ga0207670_10005837 | Ga0207670_100058375 | 220 |
| 26 | 3300049514 | Ga0501291_002148 | Ga0501291_002148_1635_2303 | 220 |
| 27 | 3300049515 | Ga0501292_052455 | Ga0501292_052455_44_712 | 220 |
| 28 | 3300049518 | Ga0501295_033862 | Ga0501295_033862_334_1002 | 220 |
| 29 | 3300049521 | Ga0501298_006179 | Ga0501298_006179_37_705 | 220 |
| 30 | 3300049522 | Ga0501299_009132 | Ga0501299_009132_17_685 | 220 |
| 31 | 3300049525 | Ga0501302_001276 | Ga0501302_001276_696_1364 | 220 |
| 32 | 3300049526 | Ga0501303_006396 | Ga0501303_006396_324_992 | 220 |
| 33 | 3300049674 | Ga0501242_014433 | Ga0501242_014433_254_922 | 220 |
| 34 | 3300049771 | Ga0501274_010100 | Ga0501274_010100_68_736 | 220 |
| 35 | 3300005293 | Ga0065715_10109566 | Ga0065715_101095662 | 221 |
| 36 | 3300005327 | Ga0070658_10191196 | Ga0070658_101911963 | 221 |
| 37 | 3300005329 | Ga0070683_100156087 | Ga0070683_1001560872 | 221 |
| 38 | 3300005344 | Ga0070661_100138665 | Ga0070661_1001386652 | 221 |
| 39 | 3300005355 | Ga0070671_100123203 | Ga0070671_1001232032 | 221 |
| 40 | 3300005455 | Ga0070663_100458645 | Ga0070663_1004586452 | 221 |
| 41 | 3300005535 | Ga0070684_100026876 | Ga0070684_1000268764 | 221 |
| 42 | 3300005564 | Ga0070664_100052355 | Ga0070664_1000523553 | 221 |
| 43 | 3300005578 | Ga0068854_100083876 | Ga0068854_1000838762 | 221 |
| 44 | 3300005616 | Ga0068852_100037636 | Ga0068852_1000376363 | 221 |
| 45 | 3300005834 | Ga0068851_10076656 | Ga0068851_100766561 | 221 |
| 46 | 3300009147 | Ga0114129_10036140 | Ga0114129_100361406 | 221 |
| 47 | 3300009177 | Ga0105248_10695795 | Ga0105248_106957952 | 221 |
| 48 | 3300013297 | Ga0157378_10255179 | Ga0157378_102551792 | 221 |
| 49 | 3300013306 | Ga0163162_10036450 | Ga0163162_100364501 | 221 |
| 50 | 3300013308 | Ga0157375_10060852 | Ga0157375_100608526 | 221 |
| 51 | 3300013308 | Ga0157375_10345755 | Ga0157375_103457554 | 221 |
| 52 | 3300025920 | Ga0207649_10083594 | Ga0207649_100835943 | 221 |
| 53 | 3300025940 | Ga0207691_10001099 | Ga0207691_1000109910 | 221 |
| 54 | 3300025941 | Ga0207711_10598697 | Ga0207711_105986972 | 221 |
| 55 | 3300025960 | Ga0207651_10041794 | Ga0207651_100417943 | 221 |
| 56 | 3300026067 | Ga0207678_10611512 | Ga0207678_106115122 | 221 |
| 57 | 3300031731 | Ga0307405_10662984 | Ga0307405_106629841 | 221 |
| 58 | 3300031852 | Ga0307410_10508618 | Ga0307410_105086182 | 221 |
| 59 | 3300031995 | Ga0307409_100138670 | Ga0307409_1001386702 | 221 |
| 60 | 3300031995 | Ga0307409_100298806 | Ga0307409_1002988062 | 221 |
| 61 | 3300032002 | Ga0307416_101036095 | Ga0307416_1010360952 | 221 |
| 62 | 3300032005 | Ga0307411_10158877 | Ga0307411_101588772 | 221 |
| 63 | 3300032126 | Ga0307415_100048519 | Ga0307415_1000485193 | 221 |
| 64 | 3300049521 | Ga0501298_050066 | Ga0501298_050066_45_755 | 221 |
| 65 | 3300050507 | nmdc:mga05p37_229121_c1 | nmdc:mga05p37_229121_c1_1125_1874 | 221 |
| 66 | 3300005330 | Ga0070690_100156539 | Ga0070690_1001565392 | 222 |
| 67 | 3300005530 | Ga0070679_100041381 | Ga0070679_1000413812 | 222 |
| 68 | 3300005539 | Ga0068853_100377510 | Ga0068853_1003775102 | 222 |
| 69 | 3300005564 | Ga0070664_100284655 | Ga0070664_1002846552 | 222 |
| 70 | 3300005577 | Ga0068857_100145335 | Ga0068857_1001453352 | 222 |
| 71 | 3300005578 | Ga0068854_100199672 | Ga0068854_1001996722 | 222 |
| 72 | 3300005614 | Ga0068856_100689821 | Ga0068856_1006898211 | 222 |
| 73 | 3300005616 | Ga0068852_100082560 | Ga0068852_1000825603 | 222 |
| 74 | 3300005834 | Ga0068851_10216519 | Ga0068851_102165192 | 222 |
| 75 | 3300005842 | Ga0068858_100411793 | Ga0068858_1004117931 | 222 |
| 76 | 3300005843 | Ga0068860_100320671 | Ga0068860_1003206712 | 222 |
| 77 | 3300005844 | Ga0068862_100566137 | Ga0068862_1005661372 | 222 |
| 78 | 3300006173 | Ga0070716_100380921 | Ga0070716_1003809212 | 222 |
| 79 | 3300006358 | Ga0068871_100152698 | Ga0068871_1001526982 | 222 |
| 80 | 3300009093 | Ga0105240_10090698 | Ga0105240_100906982 | 222 |
| 81 | 3300009174 | Ga0105241_10042488 | Ga0105241_100424883 | 222 |
| 82 | 3300009545 | Ga0105237_10064552 | Ga0105237_100645524 | 222 |
| 83 | 3300010375 | Ga0105239_10025224 | Ga0105239_100252243 | 222 |
| 84 | 3300013100 | Ga0157373_10073759 | Ga0157373_100737593 | 222 |
| 85 | 3300013104 | Ga0157370_10165512 | Ga0157370_101655122 | 222 |
| 86 | 3300013105 | Ga0157369_10063904 | Ga0157369_100639042 | 222 |
| 87 | 3300013307 | Ga0157372_10033719 | Ga0157372_100337192 | 222 |
| 88 | 3300013307 | Ga0157372_10081450 | Ga0157372_100814504 | 222 |
| 89 | 3300025911 | Ga0207654_10061504 | Ga0207654_100615042 | 222 |
| 90 | 3300025912 | Ga0207707_10008860 | Ga0207707_100088602 | 222 |
| 91 | 3300025913 | Ga0207695_10145025 | Ga0207695_101450253 | 222 |
| 92 | 3300025914 | Ga0207671_10021278 | Ga0207671_100212784 | 222 |
| 93 | 3300025921 | Ga0207652_10069092 | Ga0207652_100690921 | 222 |
| 94 | 3300025940 | Ga0207691_10348630 | Ga0207691_103486302 | 222 |
| 95 | 3300025981 | Ga0207640_10238404 | Ga0207640_102384042 | 222 |
| 96 | 3300026078 | Ga0207702_10506417 | Ga0207702_105064171 | 222 |
| 97 | 3300026116 | Ga0207674_10081385 | Ga0207674_100813852 | 222 |
| 98 | 3300026116 | Ga0207674_10309286 | Ga0207674_103092862 | 222 |
| 99 | 3300031852 | Ga0307410_10057723 | Ga0307410_100577233 | 222 |
| 100 | 3300031903 | Ga0307407_10070884 | Ga0307407_100708842 | 222 |
| 101 | 3300046473 | Ga0495582_0253697 | Ga0495582_0253697_236_949 | 222 |
| 102 | 3300046543 | Ga0495645_0084295 | Ga0495645_0084295_1489_2202 | 222 |
| 103 | 3300048913 | Ga0496110_0540762 | Ga0496110_0540762_300_974 | 222 |
| 104 | 3300053077 | Ga0495601_0039808 | Ga0495601_0039808_944_1657 | 222 |
| 105 | 3300003203 | JGI25406J46586_10002315 | JGI25406J46586_100023156 | 223 |
| 106 | 3300005985 | Ga0081539_10000073 | Ga0081539_10000073135 | 223 |
| 107 | 3300037471 | Ga0395905_0015010 | Ga0395905_0015010_3074_3868 | 223 |
| 108 | 3300005340 | Ga0070689_100005978 | Ga0070689_1000059783 | 224 |
| 109 | 3300005618 | Ga0068864_100193288 | Ga0068864_1001932882 | 224 |
| 110 | 3300005843 | Ga0068860_100056848 | Ga0068860_1000568482 | 224 |
| 111 | 3300005844 | Ga0068862_100047231 | Ga0068862_1000472313 | 224 |
| 112 | 3300006237 | Ga0097621_100102742 | Ga0097621_1001027422 | 224 |
| 113 | 3300009553 | Ga0105249_10041991 | Ga0105249_100419912 | 224 |
| 114 | 3300013306 | Ga0163162_10071625 | Ga0163162_100716252 | 224 |
| 115 | 3300025942 | Ga0207689_10035808 | Ga0207689_100358084 | 224 |
| 116 | 3300026088 | Ga0207641_10303643 | Ga0207641_103036432 | 224 |
| 117 | 3300026095 | Ga0207676_10071960 | Ga0207676_100719602 | 224 |
| 118 | 3300005467 | Ga0070706_100003498 | Ga0070706_1000034982 | 225 |
| 119 | 3300006914 | Ga0075436_100178566 | Ga0075436_1001785662 | 225 |
| 120 | 3300025910 | Ga0207684_10006374 | Ga0207684_100063744 | 225 |
| 121 | 3300050514 | nmdc:mga08x19_166377_c1 | nmdc:mga08x19_166377_c1_615_1343 | 225 |
| 122 | 3300050515 | nmdc:mga0a205_538296_c1 | nmdc:mga0a205_538296_c1_201_950 | 226 |
| 123 | 3300005545 | Ga0070695_100127482 | Ga0070695_1001274822 | 227 |
| 124 | 3300005445 | Ga0070708_100021762 | Ga0070708_1000217623 | 229 |
| 125 | 3300005471 | Ga0070698_100008222 | Ga0070698_1000082226 | 229 |
| 126 | 3300049514 | Ga0501291_024371 | Ga0501291_024371_34_729 | 229 |
| 127 | 3300002459 | JGI24751J29686_10000099 | JGI24751J29686_1000009933 | 230 |
| 128 | 3300005331 | Ga0070670_100000297 | Ga0070670_10000029715 | 230 |
| 129 | 3300005355 | Ga0070671_100016473 | Ga0070671_1000164734 | 230 |
| 130 | 3300014325 | Ga0163163_10000792 | Ga0163163_1000079215 | 230 |
| 131 | 3300021384 | Ga0213876_10000456 | Ga0213876_1000045613 | 230 |
| 132 | 3300025925 | Ga0207650_10000313 | Ga0207650_1000031333 | 230 |
| 133 | 3300025931 | Ga0207644_10006242 | Ga0207644_100062427 | 230 |
| 134 | 3300037471 | Ga0395905_0480250 | Ga0395905_0480250_177_1004 | 230 |
| 135 | 3300053153 | Ga0500616_0002784 | Ga0500616_0002784_8278_9006 | 231 |
| 136 | 3300009093 | Ga0105240_10494646 | Ga0105240_104946462 | 232 |
| 137 | 3300005985 | Ga0081539_10001715 | Ga0081539_100017157 | 233 |
| 138 | 3300025925 | Ga0207650_10088474 | Ga0207650_100884742 | 233 |
| 139 | 3300009147 | Ga0114129_10284886 | Ga0114129_102848862 | 234 |
| 140 | 3300021384 | Ga0213876_10001307 | Ga0213876_100013073 | 234 |
| 141 | 3300005347 | Ga0070668_100010711 | Ga0070668_1000107112 | 235 |
| 142 | 3300005547 | Ga0070693_100441813 | Ga0070693_1004418131 | 235 |
| 143 | 3300005617 | Ga0068859_100007476 | Ga0068859_1000074767 | 235 |
| 144 | 3300006931 | Ga0097620_100007476 | Ga0097620_1000074767 | 235 |
| 145 | 3300009098 | Ga0105245_10580807 | Ga0105245_105808071 | 235 |
| 146 | 3300009148 | Ga0105243_10242299 | Ga0105243_102422991 | 235 |
| 147 | 3300009553 | Ga0105249_10000082 | Ga0105249_1000008229 | 235 |
| 148 | 3300013306 | Ga0163162_10000002 | Ga0163162_10000002514 | 235 |
| 149 | 3300025935 | Ga0207709_10211531 | Ga0207709_102115312 | 235 |
| 150 | 3300025941 | Ga0207711_10255243 | Ga0207711_102552432 | 235 |
| 151 | 3300025960 | Ga0207651_10179882 | Ga0207651_101798823 | 235 |
| 152 | 3300025961 | Ga0207712_10000075 | Ga0207712_1000007563 | 235 |
| 153 | 3300025972 | Ga0207668_10094155 | Ga0207668_100941552 | 235 |
| 154 | 3300026075 | Ga0207708_10000149 | Ga0207708_1000014930 | 235 |
| 155 | 3300026088 | Ga0207641_10440741 | Ga0207641_104407413 | 235 |
| 156 | 3300031548 | Ga0307408_100013368 | Ga0307408_1000133684 | 235 |
| 157 | 3300031731 | Ga0307405_10028822 | Ga0307405_100288222 | 235 |
| 158 | 3300031824 | Ga0307413_10237889 | Ga0307413_102378892 | 235 |
| 159 | 3300031852 | Ga0307410_10037850 | Ga0307410_100378503 | 235 |
| 160 | 3300031901 | Ga0307406_10010023 | Ga0307406_100100234 | 235 |
| 161 | 3300031911 | Ga0307412_10087522 | Ga0307412_100875222 | 235 |
| 162 | 3300032004 | Ga0307414_10006298 | Ga0307414_100062982 | 235 |
| 163 | 3300032005 | Ga0307411_10053741 | Ga0307411_100537413 | 235 |
| 164 | 3300032126 | Ga0307415_100005152 | Ga0307415_1000051526 | 235 |
| 165 | 3300005293 | Ga0065715_10161319 | Ga0065715_101613192 | 236 |
| 166 | 3300005406 | Ga0070703_10206557 | Ga0070703_102065571 | 236 |
| 167 | 3300005441 | Ga0070700_100000087 | Ga0070700_10000008738 | 236 |
| 168 | 3300005518 | Ga0070699_100001043 | Ga0070699_10000104310 | 236 |
| 169 | 3300005536 | Ga0070697_100022130 | Ga0070697_1000221304 | 236 |
| 170 | 3300005545 | Ga0070695_100012598 | Ga0070695_1000125984 | 236 |
| 171 | 3300005549 | Ga0070704_100019042 | Ga0070704_1000190422 | 236 |
| 172 | 3300005617 | Ga0068859_100246767 | Ga0068859_1002467672 | 236 |
| 173 | 3300006931 | Ga0097620_100246767 | Ga0097620_1002467673 | 236 |
| 174 | 3300009545 | Ga0105237_10167781 | Ga0105237_101677812 | 236 |
| 175 | 3300013100 | Ga0157373_10156345 | Ga0157373_101563452 | 236 |
| 176 | 3300014325 | Ga0163163_10766147 | Ga0163163_107661472 | 236 |
| 177 | 3300014497 | Ga0182008_10094903 | Ga0182008_100949032 | 236 |
| 178 | 3300021384 | Ga0213876_10007222 | Ga0213876_100072222 | 236 |
| 179 | 3300025912 | Ga0207707_10247811 | Ga0207707_102478112 | 236 |
| 180 | 3300025914 | Ga0207671_10027714 | Ga0207671_100277144 | 236 |
| 181 | 3300026035 | Ga0207703_10433600 | Ga0207703_104336002 | 236 |
| 182 | 3300026088 | Ga0207641_11163525 | Ga0207641_111635251 | 236 |
| 183 | 3300026116 | Ga0207674_10529639 | Ga0207674_105296392 | 236 |
| 184 | 3300037418 | Ga0395900_0292844 | Ga0395900_0292844_347_1063 | 236 |
| 185 | 3300037466 | Ga0395898_0541380 | Ga0395898_0541380_289_1005 | 236 |
| 186 | 3300038443 | Ga0395901_0907650 | Ga0395901_0907650_71_787 | 236 |
| 187 | 3300039437 | Ga0436365_1254673 | Ga0436365_1254673_4924_5664 | 236 |
| 188 | 3300042435 | Ga0439434_0053027 | Ga0439434_0053027_520_1239 | 236 |
| 189 | 3300048915 | Ga0496112_0363818 | Ga0496112_0363818_76_792 | 236 |
| 190 | 3300049649 | Ga0501198_004236 | Ga0501198_004236_1048_1779 | 236 |
| 191 | 3300049660 | Ga0501216_001287 | Ga0501216_001287_2071_2802 | 236 |
| 192 | 3300049661 | Ga0501217_003179 | Ga0501217_003179_2011_2742 | 236 |
| 193 | 3300049664 | Ga0501224_001194 | Ga0501224_001194_2069_2800 | 236 |
| 194 | 3300049665 | Ga0501227_001750 | Ga0501227_001750_2037_2768 | 236 |
| 195 | 3300049668 | Ga0501233_002767 | Ga0501233_002767_355_1086 | 236 |
| 196 | 3300049670 | Ga0501236_018163 | Ga0501236_018163_204_935 | 236 |
| 197 | 3300049686 | Ga0501257_013698 | Ga0501257_013698_986_1717 | 236 |
| 198 | 3300049688 | Ga0501259_000994 | Ga0501259_000994_1340_2071 | 236 |
| 199 | 3300049705 | Ga0501225_0003206 | Ga0501225_0003206_1852_2583 | 236 |
| 200 | 3300049758 | Ga0501241_021038 | Ga0501241_021038_418_1149 | 236 |
| 201 | 3300049851 | Ga0501212_000526 | Ga0501212_000526_1025_1756 | 236 |
| 202 | 3300049853 | Ga0501226_001467 | Ga0501226_001467_2052_2783 | 236 |
| 203 | 3300050510 | nmdc:mga06r32_209432_c1 | nmdc:mga06r32_209432_c1_249_980 | 236 |
| 204 | 3300005295 | Ga0065707_10287383 | Ga0065707_102873832 | 237 |
| 205 | 3300005549 | Ga0070704_100049855 | Ga0070704_1000498552 | 237 |
| 206 | 3300009174 | Ga0105241_10434586 | Ga0105241_104345862 | 237 |
| 207 | 3300025911 | Ga0207654_10624022 | Ga0207654_106240221 | 237 |
| 208 | 3300037853 | Ga0436364_1261410 | Ga0436364_1261410_826_1560 | 237 |
| 209 | 3300039437 | Ga0436365_1814617 | Ga0436365_1814617_1021_1755 | 237 |
| 210 | 3300005364 | Ga0070673_100036706 | Ga0070673_1000367062 | 238 |
| 211 | 3300005468 | Ga0070707_100002790 | Ga0070707_10000279015 | 238 |
| 212 | 3300005549 | Ga0070704_100001584 | Ga0070704_1000015849 | 238 |
| 213 | 3300025922 | Ga0207646_10003588 | Ga0207646_100035888 | 238 |
| 214 | 3300025960 | Ga0207651_10004834 | Ga0207651_100048344 | 238 |
| 215 | 3300037418 | Ga0395900_0128868 | Ga0395900_0128868_824_1564 | 238 |
| 216 | 3300002074 | JGI24748J21848_1000008 | JGI24748J21848_1000008134 | 239 |
| 217 | 3300002076 | JGI24749J21850_1015254 | JGI24749J21850_10152542 | 239 |
| 218 | 3300002239 | JGI24034J26672_10000002 | JGI24034J26672_10000002343 | 239 |
| 219 | 3300005293 | Ga0065715_10233378 | Ga0065715_102333782 | 239 |
| 220 | 3300005353 | Ga0070669_100049747 | Ga0070669_1000497472 | 239 |
| 221 | 3300005438 | Ga0070701_10316323 | Ga0070701_103163231 | 239 |
| 222 | 3300005441 | Ga0070700_100202744 | Ga0070700_1002027442 | 239 |
| 223 | 3300005444 | Ga0070694_100290935 | Ga0070694_1002909352 | 239 |
| 224 | 3300005459 | Ga0068867_100270792 | Ga0068867_1002707922 | 239 |
| 225 | 3300005536 | Ga0070697_100116781 | Ga0070697_1001167813 | 239 |
| 226 | 3300005544 | Ga0070686_100137052 | Ga0070686_1001370522 | 239 |
| 227 | 3300005842 | Ga0068858_100000300 | Ga0068858_1000003002 | 239 |
| 228 | 3300005843 | Ga0068860_100243806 | Ga0068860_1002438061 | 239 |
| 229 | 3300005985 | Ga0081539_10038097 | Ga0081539_100380973 | 239 |
| 230 | 3300006881 | Ga0068865_100353928 | Ga0068865_1003539281 | 239 |
| 231 | 3300009011 | Ga0105251_10109763 | Ga0105251_101097632 | 239 |
| 232 | 3300009092 | Ga0105250_10105234 | Ga0105250_101052342 | 239 |
| 233 | 3300009093 | Ga0105240_10321544 | Ga0105240_103215443 | 239 |
| 234 | 3300009101 | Ga0105247_10000001 | Ga0105247_10000001303 | 239 |
| 235 | 3300009174 | Ga0105241_10097826 | Ga0105241_100978262 | 239 |
| 236 | 3300009177 | Ga0105248_10146472 | Ga0105248_101464722 | 239 |
| 237 | 3300009551 | Ga0105238_10023042 | Ga0105238_100230427 | 239 |
| 238 | 3300009553 | Ga0105249_10070421 | Ga0105249_100704212 | 239 |
| 239 | 3300013102 | Ga0157371_10606367 | Ga0157371_106063671 | 239 |
| 240 | 3300013297 | Ga0157378_10596690 | Ga0157378_105966902 | 239 |
| 241 | 3300013306 | Ga0163162_10019028 | Ga0163162_100190286 | 239 |
| 242 | 3300014326 | Ga0157380_10001721 | Ga0157380_100017212 | 239 |
| 243 | 3300025223 | Ga0207672_1000167 | Ga0207672_10001673 | 239 |
| 244 | 3300025315 | Ga0207697_10117111 | Ga0207697_101171111 | 239 |
| 245 | 3300025900 | Ga0207710_10000003 | Ga0207710_10000003334 | 239 |
| 246 | 3300025901 | Ga0207688_10080761 | Ga0207688_100807612 | 239 |
| 247 | 3300025904 | Ga0207647_10182677 | Ga0207647_101826772 | 239 |
| 248 | 3300025910 | Ga0207684_10011158 | Ga0207684_100111588 | 239 |
| 249 | 3300025911 | Ga0207654_10231527 | Ga0207654_102315272 | 239 |
| 250 | 3300025914 | Ga0207671_10234845 | Ga0207671_102348452 | 239 |
| 251 | 3300025923 | Ga0207681_10041364 | Ga0207681_100413643 | 239 |
| 252 | 3300025924 | Ga0207694_10071133 | Ga0207694_100711334 | 239 |
| 253 | 3300025926 | Ga0207659_10670811 | Ga0207659_106708111 | 239 |
| 254 | 3300025934 | Ga0207686_10422081 | Ga0207686_104220812 | 239 |
| 255 | 3300025940 | Ga0207691_10147009 | Ga0207691_101470092 | 239 |
| 256 | 3300025941 | Ga0207711_10060499 | Ga0207711_100604994 | 239 |
| 257 | 3300025945 | Ga0207679_10140743 | Ga0207679_101407431 | 239 |
| 258 | 3300025961 | Ga0207712_10005296 | Ga0207712_100052961 | 239 |
| 259 | 3300026035 | Ga0207703_10000118 | Ga0207703_100001184 | 239 |
| 260 | 3300026041 | Ga0207639_10319434 | Ga0207639_103194341 | 239 |
| 261 | 3300026118 | Ga0207675_100087553 | Ga0207675_1000875532 | 239 |
| 262 | 3300028381 | Ga0268264_11217815 | Ga0268264_112178151 | 239 |
| 263 | 3300035241 | Ga0373961_0081109 | Ga0373961_0081109_32_757 | 239 |
| 264 | 3300035242 | Ga0373962_0013515 | Ga0373962_0013515_1133_1858 | 239 |
| 265 | 3300049742 | Ga0501080_0409654 | Ga0501080_0409654_299_1051 | 239 |
| 266 | 3300005293 | Ga0065715_10197836 | Ga0065715_101978362 | 240 |
| 267 | 3300005330 | Ga0070690_100000586 | Ga0070690_1000005868 | 240 |
| 268 | 3300005337 | Ga0070682_100032646 | Ga0070682_1000326464 | 240 |
| 269 | 3300005343 | Ga0070687_100216181 | Ga0070687_1002161811 | 240 |
| 270 | 3300005345 | Ga0070692_10003268 | Ga0070692_100032687 | 240 |
| 271 | 3300005406 | Ga0070703_10004244 | Ga0070703_100042443 | 240 |
| 272 | 3300005440 | Ga0070705_100005473 | Ga0070705_1000054736 | 240 |
| 273 | 3300005444 | Ga0070694_100028768 | Ga0070694_1000287683 | 240 |
| 274 | 3300005459 | Ga0068867_100144220 | Ga0068867_1001442201 | 240 |
| 275 | 3300005471 | Ga0070698_100001335 | Ga0070698_1000013355 | 240 |
| 276 | 3300005518 | Ga0070699_100064874 | Ga0070699_1000648743 | 240 |
| 277 | 3300005518 | Ga0070699_100342736 | Ga0070699_1003427362 | 240 |
| 278 | 3300005536 | Ga0070697_100000135 | Ga0070697_10000013520 | 240 |
| 279 | 3300005544 | Ga0070686_100022113 | Ga0070686_1000221132 | 240 |
| 280 | 3300005546 | Ga0070696_100007058 | Ga0070696_1000070584 | 240 |
| 281 | 3300005546 | Ga0070696_100013848 | Ga0070696_1000138486 | 240 |
| 282 | 3300005547 | Ga0070693_100006262 | Ga0070693_1000062624 | 240 |
| 283 | 3300005549 | Ga0070704_100017738 | Ga0070704_1000177384 | 240 |
| 284 | 3300005616 | Ga0068852_100364776 | Ga0068852_1003647762 | 240 |
| 285 | 3300005617 | Ga0068859_100204665 | Ga0068859_1002046652 | 240 |
| 286 | 3300005719 | Ga0068861_100068272 | Ga0068861_1000682722 | 240 |
| 287 | 3300005842 | Ga0068858_100028604 | Ga0068858_1000286045 | 240 |
| 288 | 3300005842 | Ga0068858_100243520 | Ga0068858_1002435202 | 240 |
| 289 | 3300006931 | Ga0097620_100204658 | Ga0097620_1002046582 | 240 |
| 290 | 3300009176 | Ga0105242_10266237 | Ga0105242_102662372 | 240 |
| 291 | 3300009545 | Ga0105237_10003830 | Ga0105237_1000383010 | 240 |
| 292 | 3300013297 | Ga0157378_10046208 | Ga0157378_100462084 | 240 |
| 293 | 3300013297 | Ga0157378_10405347 | Ga0157378_104053472 | 240 |
| 294 | 3300013306 | Ga0163162_10167414 | Ga0163162_101674142 | 240 |
| 295 | 3300014968 | Ga0157379_10428276 | Ga0157379_104282762 | 240 |
| 296 | 3300025885 | Ga0207653_10002903 | Ga0207653_100029031 | 240 |
| 297 | 3300025904 | Ga0207647_10243138 | Ga0207647_102431381 | 240 |
| 298 | 3300025914 | Ga0207671_10008571 | Ga0207671_100085716 | 240 |
| 299 | 3300025918 | Ga0207662_10015191 | Ga0207662_100151913 | 240 |
| 300 | 3300025918 | Ga0207662_10088016 | Ga0207662_100880163 | 240 |
| 301 | 3300025939 | Ga0207665_10198050 | Ga0207665_101980502 | 240 |
| 302 | 3300026075 | Ga0207708_10032572 | Ga0207708_100325722 | 240 |
| 303 | 3300026089 | Ga0207648_10099781 | Ga0207648_100997812 | 240 |
| 304 | 3300026118 | Ga0207675_100097610 | Ga0207675_1000976103 | 240 |
| 305 | 3300026142 | Ga0207698_10165393 | Ga0207698_101653933 | 240 |
| 306 | 3300048916 | Ga0496113_0018347 | Ga0496113_0018347_208_933 | 240 |
| 307 | 3300050515 | nmdc:mga0a205_727360_c1 | nmdc:mga0a205_727360_c1_23_748 | 240 |
| 308 | 3300005290 | Ga0065712_10085397 | Ga0065712_100853972 | 241 |
| 309 | 3300005290 | Ga0065712_10243771 | Ga0065712_102437711 | 241 |
| 310 | 3300005334 | Ga0068869_100145361 | Ga0068869_1001453612 | 241 |
| 311 | 3300005336 | Ga0070680_100193837 | Ga0070680_1001938372 | 241 |
| 312 | 3300005340 | Ga0070689_100253736 | Ga0070689_1002537362 | 241 |
| 313 | 3300005343 | Ga0070687_100252496 | Ga0070687_1002524962 | 241 |
| 314 | 3300005345 | Ga0070692_10031990 | Ga0070692_100319902 | 241 |
| 315 | 3300005355 | Ga0070671_100079341 | Ga0070671_1000793413 | 241 |
| 316 | 3300005364 | Ga0070673_100038484 | Ga0070673_1000384842 | 241 |
| 317 | 3300005364 | Ga0070673_100083506 | Ga0070673_1000835063 | 241 |
| 318 | 3300005364 | Ga0070673_100542617 | Ga0070673_1005426172 | 241 |
| 319 | 3300005365 | Ga0070688_100206569 | Ga0070688_1002065692 | 241 |
| 320 | 3300005441 | Ga0070700_100021734 | Ga0070700_1000217342 | 241 |
| 321 | 3300005441 | Ga0070700_100195633 | Ga0070700_1001956332 | 241 |
| 322 | 3300005444 | Ga0070694_100000781 | Ga0070694_1000007812 | 241 |
| 323 | 3300005444 | Ga0070694_100066085 | Ga0070694_1000660852 | 241 |
| 324 | 3300005444 | Ga0070694_100199823 | Ga0070694_1001998232 | 241 |
| 325 | 3300005457 | Ga0070662_100032856 | Ga0070662_1000328562 | 241 |
| 326 | 3300005459 | Ga0068867_100228819 | Ga0068867_1002288192 | 241 |
| 327 | 3300005471 | Ga0070698_100049187 | Ga0070698_1000491873 | 241 |
| 328 | 3300005536 | Ga0070697_100050242 | Ga0070697_1000502423 | 241 |
| 329 | 3300005546 | Ga0070696_100150820 | Ga0070696_1001508202 | 241 |
| 330 | 3300005548 | Ga0070665_100015048 | Ga0070665_1000150488 | 241 |
| 331 | 3300005548 | Ga0070665_100424870 | Ga0070665_1004248702 | 241 |
| 332 | 3300005549 | Ga0070704_100039611 | Ga0070704_1000396112 | 241 |
| 333 | 3300005549 | Ga0070704_100178618 | Ga0070704_1001786182 | 241 |
| 334 | 3300005563 | Ga0068855_100159977 | Ga0068855_1001599773 | 241 |
| 335 | 3300005578 | Ga0068854_100053767 | Ga0068854_1000537672 | 241 |
| 336 | 3300005615 | Ga0070702_100026802 | Ga0070702_1000268024 | 241 |
| 337 | 3300005615 | Ga0070702_100097811 | Ga0070702_1000978111 | 241 |
| 338 | 3300005617 | Ga0068859_100087979 | Ga0068859_1000879794 | 241 |
| 339 | 3300005618 | Ga0068864_100146065 | Ga0068864_1001460653 | 241 |
| 340 | 3300005840 | Ga0068870_10153923 | Ga0068870_101539232 | 241 |
| 341 | 3300005843 | Ga0068860_100031178 | Ga0068860_1000311786 | 241 |
| 342 | 3300005844 | Ga0068862_100086255 | Ga0068862_1000862553 | 241 |
| 343 | 3300005844 | Ga0068862_100320809 | Ga0068862_1003208092 | 241 |
| 344 | 3300005844 | Ga0068862_100342648 | Ga0068862_1003426482 | 241 |
| 345 | 3300006237 | Ga0097621_100004289 | Ga0097621_1000042894 | 241 |
| 346 | 3300006358 | Ga0068871_100002162 | Ga0068871_1000021626 | 241 |
| 347 | 3300006358 | Ga0068871_100466771 | Ga0068871_1004667711 | 241 |
| 348 | 3300006844 | Ga0075428_100100612 | Ga0075428_1001006123 | 241 |
| 349 | 3300006844 | Ga0075428_100118600 | Ga0075428_1001186003 | 241 |
| 350 | 3300006847 | Ga0075431_100186618 | Ga0075431_1001866182 | 241 |
| 351 | 3300006852 | Ga0075433_10039767 | Ga0075433_100397674 | 241 |
| 352 | 3300006871 | Ga0075434_100065989 | Ga0075434_1000659893 | 241 |
| 353 | 3300006880 | Ga0075429_100094296 | Ga0075429_1000942961 | 241 |
| 354 | 3300006931 | Ga0097620_100087961 | Ga0097620_1000879614 | 241 |
| 355 | 3300009093 | Ga0105240_10033643 | Ga0105240_100336437 | 241 |
| 356 | 3300009101 | Ga0105247_10212765 | Ga0105247_102127653 | 241 |
| 357 | 3300009147 | Ga0114129_10043736 | Ga0114129_100437365 | 241 |
| 358 | 3300009147 | Ga0114129_10299469 | Ga0114129_102994692 | 241 |
| 359 | 3300009177 | Ga0105248_10030836 | Ga0105248_100308365 | 241 |
| 360 | 3300009177 | Ga0105248_10084506 | Ga0105248_100845064 | 241 |
| 361 | 3300009177 | Ga0105248_10666141 | Ga0105248_106661412 | 241 |
| 362 | 3300010375 | Ga0105239_10673004 | Ga0105239_106730042 | 241 |
| 363 | 3300013296 | Ga0157374_10035586 | Ga0157374_100355863 | 241 |
| 364 | 3300013297 | Ga0157378_10001322 | Ga0157378_100013227 | 241 |
| 365 | 3300013297 | Ga0157378_10211766 | Ga0157378_102117661 | 241 |
| 366 | 3300013306 | Ga0163162_10001013 | Ga0163162_100010133 | 241 |
| 367 | 3300013306 | Ga0163162_10738049 | Ga0163162_107380492 | 241 |
| 368 | 3300013307 | Ga0157372_10016757 | Ga0157372_100167573 | 241 |
| 369 | 3300013308 | Ga0157375_10024922 | Ga0157375_100249222 | 241 |
| 370 | 3300013308 | Ga0157375_10285441 | Ga0157375_102854412 | 241 |
| 371 | 3300014325 | Ga0163163_10001129 | Ga0163163_1000112913 | 241 |
| 372 | 3300014745 | Ga0157377_10045491 | Ga0157377_100454912 | 241 |
| 373 | 3300014968 | Ga0157379_10071775 | Ga0157379_100717752 | 241 |
| 374 | 3300025903 | Ga0207680_10222257 | Ga0207680_102222571 | 241 |
| 375 | 3300025917 | Ga0207660_10052273 | Ga0207660_100522734 | 241 |
| 376 | 3300025918 | Ga0207662_10086136 | Ga0207662_100861363 | 241 |
| 377 | 3300025933 | Ga0207706_10034806 | Ga0207706_100348062 | 241 |
| 378 | 3300025939 | Ga0207665_10053071 | Ga0207665_100530713 | 241 |
| 379 | 3300025939 | Ga0207665_10472188 | Ga0207665_104721881 | 241 |
| 380 | 3300025941 | Ga0207711_10312417 | Ga0207711_103124171 | 241 |
| 381 | 3300025942 | Ga0207689_10122646 | Ga0207689_101226462 | 241 |
| 382 | 3300025949 | Ga0207667_10201046 | Ga0207667_102010462 | 241 |
| 383 | 3300025960 | Ga0207651_10075570 | Ga0207651_100755702 | 241 |
| 384 | 3300025960 | Ga0207651_10288624 | Ga0207651_102886242 | 241 |
| 385 | 3300025981 | Ga0207640_10052429 | Ga0207640_100524292 | 241 |
| 386 | 3300026035 | Ga0207703_10498915 | Ga0207703_104989152 | 241 |
| 387 | 3300026041 | Ga0207639_10417970 | Ga0207639_104179701 | 241 |
| 388 | 3300026075 | Ga0207708_10095463 | Ga0207708_100954632 | 241 |
| 389 | 3300026089 | Ga0207648_10236459 | Ga0207648_102364592 | 241 |
| 390 | 3300026089 | Ga0207648_10329851 | Ga0207648_103298511 | 241 |
| 391 | 3300026089 | Ga0207648_10339380 | Ga0207648_103393802 | 241 |
| 392 | 3300028380 | Ga0268265_10085360 | Ga0268265_100853602 | 241 |
| 393 | 3300028380 | Ga0268265_10368297 | Ga0268265_103682972 | 241 |
| 394 | 3300028381 | Ga0268264_10362442 | Ga0268264_103624421 | 241 |
| 395 | 3300032002 | Ga0307416_100503468 | Ga0307416_1005034682 | 241 |
| 396 | 3300035691 | Ga0373931_0065689 | Ga0373931_0065689_391_1119 | 241 |
| 397 | 3300039437 | Ga0436365_0475046 | Ga0436365_0475046_169_909 | 241 |
| 398 | 3300042012 | Ga0439455_0018825 | Ga0439455_0018825_160_906 | 241 |
| 399 | 3300042157 | Ga0439458_0011023 | Ga0439458_0011023_37_783 | 241 |
| 400 | 3300046525 | Ga0495663_0000250 | Ga0495663_0000250_9522_10250 | 241 |
| 401 | 3300046537 | Ga0495598_0000324 | Ga0495598_0000324_5327_6055 | 241 |
| 402 | 3300046539 | Ga0495621_0000620 | Ga0495621_0000620_619_1347 | 241 |
| 403 | 3300046616 | Ga0495668_0092278 | Ga0495668_0092278_345_1073 | 241 |
| 404 | 3300048907 | Ga0496104_0196700 | Ga0496104_0196700_824_1555 | 241 |
| 405 | 3300048912 | Ga0496109_0386309 | Ga0496109_0386309_175_903 | 241 |
| 406 | 3300048915 | Ga0496112_0220922 | Ga0496112_0220922_626_1357 | 241 |
| 407 | 3300049520 | Ga0501297_010357 | Ga0501297_010357_213_941 | 241 |
| 408 | 3300049654 | Ga0501207_025630 | Ga0501207_025630_163_891 | 241 |
| 409 | 3300049661 | Ga0501217_007155 | Ga0501217_007155_1375_2103 | 241 |
| 410 | 3300049665 | Ga0501227_005350 | Ga0501227_005350_219_947 | 241 |
| 411 | 3300049666 | Ga0501228_007948 | Ga0501228_007948_172_900 | 241 |
| 412 | 3300049668 | Ga0501233_058559 | Ga0501233_058559_192_920 | 241 |
| 413 | 3300049675 | Ga0501243_018322 | Ga0501243_018322_148_876 | 241 |
| 414 | 3300049686 | Ga0501257_030136 | Ga0501257_030136_25_753 | 241 |
| 415 | 3300049705 | Ga0501225_0081332 | Ga0501225_0081332_139_867 | 241 |
| 416 | 3300049706 | Ga0501229_017520 | Ga0501229_017520_94_822 | 241 |
| 417 | 3300049707 | Ga0501234_020238 | Ga0501234_020238_59_787 | 241 |
| 418 | 3300049708 | Ga0501245_037458 | Ga0501245_037458_78_806 | 241 |
| 419 | 3300049765 | Ga0501268_011948 | Ga0501268_011948_529_1257 | 241 |
| 420 | 3300050507 | nmdc:mga05p37_63333_c1 | nmdc:mga05p37_63333_c1_1735_2463 | 241 |
| 421 | 3300050510 | nmdc:mga06r32_605969_c1 | nmdc:mga06r32_605969_c1_29_754 | 241 |
| 422 | 3300050515 | nmdc:mga0a205_72874_c1 | nmdc:mga0a205_72874_c1_2136_2867 | 241 |
| 423 | 3300061734 | Ga0530510_0139104 | Ga0530510_0139104_286_1014 | 241 |
| 424 | 3300000532 | CNAas_1000478 | CNAas_10004783 | 242 |
| 425 | 3300003203 | JGI25406J46586_10004596 | JGI25406J46586_100045965 | 242 |
| 426 | 3300003322 | rootL2_10068297 | rootL2_100682972 | 242 |
| 427 | 3300005288 | Ga0065714_10014729 | Ga0065714_100147293 | 242 |
| 428 | 3300005288 | Ga0065714_10064424 | Ga0065714_10064424109 | 242 |
| 429 | 3300005289 | Ga0065704_10009481 | Ga0065704_100094812 | 242 |
| 430 | 3300005289 | Ga0065704_10093396 | Ga0065704_100933963 | 242 |
| 431 | 3300005290 | Ga0065712_10000117 | Ga0065712_10000117109 | 242 |
| 432 | 3300005290 | Ga0065712_10074270 | Ga0065712_100742704 | 242 |
| 433 | 3300005293 | Ga0065715_10000523 | Ga0065715_100005232 | 242 |
| 434 | 3300005293 | Ga0065715_10019608 | Ga0065715_100196082 | 242 |
| 435 | 3300005293 | Ga0065715_10107615 | Ga0065715_101076153 | 242 |
| 436 | 3300005293 | Ga0065715_10148450 | Ga0065715_101484502 | 242 |
| 437 | 3300005293 | Ga0065715_10167384 | Ga0065715_101673842 | 242 |
| 438 | 3300005293 | Ga0065715_10211093 | Ga0065715_102110932 | 242 |
| 439 | 3300005295 | Ga0065707_10336285 | Ga0065707_103362851 | 242 |
| 440 | 3300005329 | Ga0070683_100471866 | Ga0070683_1004718662 | 242 |
| 441 | 3300005330 | Ga0070690_100001671 | Ga0070690_1000016713 | 242 |
| 442 | 3300005331 | Ga0070670_100002514 | Ga0070670_1000025142 | 242 |
| 443 | 3300005331 | Ga0070670_100110509 | Ga0070670_1001105092 | 242 |
| 444 | 3300005334 | Ga0068869_100003815 | Ga0068869_1000038152 | 242 |
| 445 | 3300005334 | Ga0068869_100095699 | Ga0068869_1000956991 | 242 |
| 446 | 3300005336 | Ga0070680_100139028 | Ga0070680_1001390282 | 242 |
| 447 | 3300005337 | Ga0070682_100069047 | Ga0070682_1000690472 | 242 |
| 448 | 3300005338 | Ga0068868_100099889 | Ga0068868_1000998892 | 242 |
| 449 | 3300005338 | Ga0068868_100676395 | Ga0068868_1006763951 | 242 |
| 450 | 3300005340 | Ga0070689_100000425 | Ga0070689_10000042512 | 242 |
| 451 | 3300005340 | Ga0070689_100008912 | Ga0070689_1000089123 | 242 |
| 452 | 3300005340 | Ga0070689_100060971 | Ga0070689_1000609712 | 242 |
| 453 | 3300005340 | Ga0070689_100063432 | Ga0070689_1000634322 | 242 |
| 454 | 3300005343 | Ga0070687_100248487 | Ga0070687_1002484872 | 242 |
| 455 | 3300005344 | Ga0070661_100076305 | Ga0070661_1000763053 | 242 |
| 456 | 3300005344 | Ga0070661_100099213 | Ga0070661_1000992132 | 242 |
| 457 | 3300005345 | Ga0070692_10021801 | Ga0070692_100218014 | 242 |
| 458 | 3300005347 | Ga0070668_100246991 | Ga0070668_1002469912 | 242 |
| 459 | 3300005353 | Ga0070669_100025762 | Ga0070669_1000257622 | 242 |
| 460 | 3300005355 | Ga0070671_100069648 | Ga0070671_1000696482 | 242 |
| 461 | 3300005364 | Ga0070673_100054380 | Ga0070673_1000543804 | 242 |
| 462 | 3300005364 | Ga0070673_100064557 | Ga0070673_1000645574 | 242 |
| 463 | 3300005364 | Ga0070673_100185583 | Ga0070673_1001855831 | 242 |
| 464 | 3300005365 | Ga0070688_100316283 | Ga0070688_1003162832 | 242 |
| 465 | 3300005366 | Ga0070659_100317167 | Ga0070659_1003171672 | 242 |
| 466 | 3300005367 | Ga0070667_100519001 | Ga0070667_1005190011 | 242 |
| 467 | 3300005438 | Ga0070701_10154103 | Ga0070701_101541032 | 242 |
| 468 | 3300005440 | Ga0070705_100056223 | Ga0070705_1000562232 | 242 |
| 469 | 3300005440 | Ga0070705_100181824 | Ga0070705_1001818242 | 242 |
| 470 | 3300005441 | Ga0070700_100032947 | Ga0070700_1000329472 | 242 |
| 471 | 3300005441 | Ga0070700_100049244 | Ga0070700_1000492443 | 242 |
| 472 | 3300005444 | Ga0070694_100143014 | Ga0070694_1001430142 | 242 |
| 473 | 3300005444 | Ga0070694_100351504 | Ga0070694_1003515042 | 242 |
| 474 | 3300005444 | Ga0070694_100408277 | Ga0070694_1004082772 | 242 |
| 475 | 3300005445 | Ga0070708_100000281 | Ga0070708_10000028124 | 242 |
| 476 | 3300005445 | Ga0070708_100437422 | Ga0070708_1004374221 | 242 |
| 477 | 3300005445 | Ga0070708_100528633 | Ga0070708_1005286331 | 242 |
| 478 | 3300005457 | Ga0070662_100023433 | Ga0070662_1000234334 | 242 |
| 479 | 3300005458 | Ga0070681_10006412 | Ga0070681_100064127 | 242 |
| 480 | 3300005459 | Ga0068867_100044438 | Ga0068867_1000444382 | 242 |
| 481 | 3300005467 | Ga0070706_100000146 | Ga0070706_10000014662 | 242 |
| 482 | 3300005467 | Ga0070706_100001677 | Ga0070706_10000167725 | 242 |
| 483 | 3300005467 | Ga0070706_100011659 | Ga0070706_1000116598 | 242 |
| 484 | 3300005467 | Ga0070706_100148069 | Ga0070706_1001480692 | 242 |
| 485 | 3300005467 | Ga0070706_100184375 | Ga0070706_1001843751 | 242 |
| 486 | 3300005467 | Ga0070706_100210199 | Ga0070706_1002101992 | 242 |
| 487 | 3300005468 | Ga0070707_100054355 | Ga0070707_1000543555 | 242 |
| 488 | 3300005468 | Ga0070707_100112338 | Ga0070707_1001123382 | 242 |
| 489 | 3300005471 | Ga0070698_100007291 | Ga0070698_1000072916 | 242 |
| 490 | 3300005471 | Ga0070698_100009193 | Ga0070698_1000091933 | 242 |
| 491 | 3300005471 | Ga0070698_100018185 | Ga0070698_1000181856 | 242 |
| 492 | 3300005471 | Ga0070698_100055583 | Ga0070698_1000555832 | 242 |
| 493 | 3300005518 | Ga0070699_100009689 | Ga0070699_1000096894 | 242 |
| 494 | 3300005530 | Ga0070679_100016260 | Ga0070679_1000162606 | 242 |
| 495 | 3300005530 | Ga0070679_100184479 | Ga0070679_1001844792 | 242 |
| 496 | 3300005536 | Ga0070697_100000976 | Ga0070697_1000009766 | 242 |
| 497 | 3300005536 | Ga0070697_100053292 | Ga0070697_1000532922 | 242 |
| 498 | 3300005536 | Ga0070697_100065615 | Ga0070697_1000656152 | 242 |
| 499 | 3300005536 | Ga0070697_100215403 | Ga0070697_1002154032 | 242 |
| 500 | 3300005539 | Ga0068853_100048451 | Ga0068853_1000484513 | 242 |
| 501 | 3300005539 | Ga0068853_100048498 | Ga0068853_1000484983 | 242 |
| 502 | 3300005543 | Ga0070672_100442008 | Ga0070672_1004420082 | 242 |
| 503 | 3300005545 | Ga0070695_100091079 | Ga0070695_1000910791 | 242 |
| 504 | 3300005545 | Ga0070695_100185034 | Ga0070695_1001850342 | 242 |
| 505 | 3300005545 | Ga0070695_100257988 | Ga0070695_1002579882 | 242 |
| 506 | 3300005545 | Ga0070695_100312825 | Ga0070695_1003128251 | 242 |
| 507 | 3300005545 | Ga0070695_100552136 | Ga0070695_1005521361 | 242 |
| 508 | 3300005546 | Ga0070696_100071749 | Ga0070696_1000717493 | 242 |
| 509 | 3300005546 | Ga0070696_100130947 | Ga0070696_1001309472 | 242 |
| 510 | 3300005546 | Ga0070696_100359696 | Ga0070696_1003596961 | 242 |
| 511 | 3300005547 | Ga0070693_100005553 | Ga0070693_1000055536 | 242 |
| 512 | 3300005547 | Ga0070693_100052201 | Ga0070693_1000522013 | 242 |
| 513 | 3300005547 | Ga0070693_100179153 | Ga0070693_1001791532 | 242 |
| 514 | 3300005549 | Ga0070704_100137681 | Ga0070704_1001376813 | 242 |
| 515 | 3300005549 | Ga0070704_100185070 | Ga0070704_1001850702 | 242 |
| 516 | 3300005549 | Ga0070704_100423242 | Ga0070704_1004232422 | 242 |
| 517 | 3300005564 | Ga0070664_100010132 | Ga0070664_1000101326 | 242 |
| 518 | 3300005577 | Ga0068857_100001808 | Ga0068857_1000018088 | 242 |
| 519 | 3300005577 | Ga0068857_100408414 | Ga0068857_1004084142 | 242 |
| 520 | 3300005578 | Ga0068854_100145429 | Ga0068854_1001454292 | 242 |
| 521 | 3300005578 | Ga0068854_100260121 | Ga0068854_1002601211 | 242 |
| 522 | 3300005615 | Ga0070702_100010986 | Ga0070702_1000109864 | 242 |
| 523 | 3300005615 | Ga0070702_100038735 | Ga0070702_1000387352 | 242 |
| 524 | 3300005615 | Ga0070702_100041770 | Ga0070702_1000417703 | 242 |
| 525 | 3300005617 | Ga0068859_100023588 | Ga0068859_1000235886 | 242 |
| 526 | 3300005617 | Ga0068859_100103724 | Ga0068859_1001037242 | 242 |
| 527 | 3300005618 | Ga0068864_100007609 | Ga0068864_1000076097 | 242 |
| 528 | 3300005618 | Ga0068864_100046576 | Ga0068864_1000465764 | 242 |
| 529 | 3300005618 | Ga0068864_100109445 | Ga0068864_1001094453 | 242 |
| 530 | 3300005618 | Ga0068864_100213827 | Ga0068864_1002138272 | 242 |
| 531 | 3300005618 | Ga0068864_100316615 | Ga0068864_1003166152 | 242 |
| 532 | 3300005618 | Ga0068864_100412452 | Ga0068864_1004124521 | 242 |
| 533 | 3300005719 | Ga0068861_100008148 | Ga0068861_1000081483 | 242 |
| 534 | 3300005719 | Ga0068861_100051532 | Ga0068861_1000515324 | 242 |
| 535 | 3300005719 | Ga0068861_100079766 | Ga0068861_1000797662 | 242 |
| 536 | 3300005840 | Ga0068870_10002880 | Ga0068870_100028803 | 242 |
| 537 | 3300005840 | Ga0068870_10062967 | Ga0068870_100629672 | 242 |
| 538 | 3300005841 | Ga0068863_100137722 | Ga0068863_1001377222 | 242 |
| 539 | 3300005841 | Ga0068863_100328218 | Ga0068863_1003282182 | 242 |
| 540 | 3300005841 | Ga0068863_100473311 | Ga0068863_1004733112 | 242 |
| 541 | 3300005842 | Ga0068858_100064512 | Ga0068858_1000645122 | 242 |
| 542 | 3300005842 | Ga0068858_100108487 | Ga0068858_1001084873 | 242 |
| 543 | 3300005842 | Ga0068858_100214827 | Ga0068858_1002148272 | 242 |
| 544 | 3300005843 | Ga0068860_100017487 | Ga0068860_1000174873 | 242 |
| 545 | 3300005843 | Ga0068860_100098417 | Ga0068860_1000984173 | 242 |
| 546 | 3300005843 | Ga0068860_100987627 | Ga0068860_1009876271 | 242 |
| 547 | 3300005844 | Ga0068862_100076747 | Ga0068862_1000767472 | 242 |
| 548 | 3300005844 | Ga0068862_100091340 | Ga0068862_1000913402 | 242 |
| 549 | 3300005844 | Ga0068862_100380669 | Ga0068862_1003806692 | 242 |
| 550 | 3300005985 | Ga0081539_10000537 | Ga0081539_1000053733 | 242 |
| 551 | 3300005985 | Ga0081539_10005214 | Ga0081539_100052143 | 242 |
| 552 | 3300006173 | Ga0070716_100007698 | Ga0070716_1000076982 | 242 |
| 553 | 3300006237 | Ga0097621_100014340 | Ga0097621_1000143402 | 242 |
| 554 | 3300006237 | Ga0097621_100020722 | Ga0097621_1000207222 | 242 |
| 555 | 3300006358 | Ga0068871_100012458 | Ga0068871_1000124583 | 242 |
| 556 | 3300006358 | Ga0068871_100165898 | Ga0068871_1001658982 | 242 |
| 557 | 3300006847 | Ga0075431_100064456 | Ga0075431_1000644562 | 242 |
| 558 | 3300006852 | Ga0075433_10013013 | Ga0075433_100130134 | 242 |
| 559 | 3300006852 | Ga0075433_10187089 | Ga0075433_101870891 | 242 |
| 560 | 3300006852 | Ga0075433_10410053 | Ga0075433_104100532 | 242 |
| 561 | 3300006871 | Ga0075434_100016372 | Ga0075434_1000163726 | 242 |
| 562 | 3300006871 | Ga0075434_100238946 | Ga0075434_1002389462 | 242 |
| 563 | 3300006880 | Ga0075429_100040781 | Ga0075429_1000407812 | 242 |
| 564 | 3300006881 | Ga0068865_100251450 | Ga0068865_1002514502 | 242 |
| 565 | 3300006931 | Ga0097620_100023588 | Ga0097620_1000235882 | 242 |
| 566 | 3300006931 | Ga0097620_100103723 | Ga0097620_1001037233 | 242 |
| 567 | 3300007076 | Ga0075435_100016854 | Ga0075435_1000168542 | 242 |
| 568 | 3300009011 | Ga0105251_10083198 | Ga0105251_100831982 | 242 |
| 569 | 3300009094 | Ga0111539_10000228 | Ga0111539_1000022823 | 242 |
| 570 | 3300009101 | Ga0105247_10000944 | Ga0105247_100009445 | 242 |
| 571 | 3300009101 | Ga0105247_10402434 | Ga0105247_104024341 | 242 |
| 572 | 3300009147 | Ga0114129_10010021 | Ga0114129_1001002114 | 242 |
| 573 | 3300009147 | Ga0114129_10070255 | Ga0114129_100702553 | 242 |
| 574 | 3300009147 | Ga0114129_10104964 | Ga0114129_101049644 | 242 |
| 575 | 3300009147 | Ga0114129_10222357 | Ga0114129_102223573 | 242 |
| 576 | 3300009147 | Ga0114129_10256404 | Ga0114129_102564043 | 242 |
| 577 | 3300009147 | Ga0114129_10290623 | Ga0114129_102906233 | 242 |
| 578 | 3300009147 | Ga0114129_10421697 | Ga0114129_104216972 | 242 |
| 579 | 3300009147 | Ga0114129_11039024 | Ga0114129_110390242 | 242 |
| 580 | 3300009148 | Ga0105243_10009655 | Ga0105243_100096556 | 242 |
| 581 | 3300009148 | Ga0105243_10154001 | Ga0105243_101540013 | 242 |
| 582 | 3300009148 | Ga0105243_10332241 | Ga0105243_103322412 | 242 |
| 583 | 3300009148 | Ga0105243_10484654 | Ga0105243_104846542 | 242 |
| 584 | 3300009148 | Ga0105243_10749931 | Ga0105243_107499311 | 242 |
| 585 | 3300009174 | Ga0105241_10039156 | Ga0105241_100391562 | 242 |
| 586 | 3300009174 | Ga0105241_10054835 | Ga0105241_100548353 | 242 |
| 587 | 3300009174 | Ga0105241_10126473 | Ga0105241_101264731 | 242 |
| 588 | 3300009174 | Ga0105241_10311307 | Ga0105241_103113072 | 242 |
| 589 | 3300009174 | Ga0105241_10362202 | Ga0105241_103622022 | 242 |
| 590 | 3300009174 | Ga0105241_10539184 | Ga0105241_105391841 | 242 |
| 591 | 3300009176 | Ga0105242_10119011 | Ga0105242_101190112 | 242 |
| 592 | 3300009176 | Ga0105242_10367094 | Ga0105242_103670942 | 242 |
| 593 | 3300009176 | Ga0105242_10457641 | Ga0105242_104576411 | 242 |
| 594 | 3300009177 | Ga0105248_10092032 | Ga0105248_100920322 | 242 |
| 595 | 3300009177 | Ga0105248_10282269 | Ga0105248_102822692 | 242 |
| 596 | 3300009551 | Ga0105238_10029980 | Ga0105238_100299801 | 242 |
| 597 | 3300009553 | Ga0105249_10082712 | Ga0105249_100827123 | 242 |
| 598 | 3300011119 | Ga0105246_10061162 | Ga0105246_100611623 | 242 |
| 599 | 3300011119 | Ga0105246_10144930 | Ga0105246_101449301 | 242 |
| 600 | 3300011119 | Ga0105246_10168951 | Ga0105246_101689512 | 242 |
| 601 | 3300011119 | Ga0105246_10243114 | Ga0105246_102431141 | 242 |
| 602 | 3300013100 | Ga0157373_10001858 | Ga0157373_100018585 | 242 |
| 603 | 3300013100 | Ga0157373_10034607 | Ga0157373_100346073 | 242 |
| 604 | 3300013100 | Ga0157373_10052993 | Ga0157373_100529933 | 242 |
| 605 | 3300013100 | Ga0157373_10147792 | Ga0157373_101477922 | 242 |
| 606 | 3300013296 | Ga0157374_10175646 | Ga0157374_101756462 | 242 |
| 607 | 3300013297 | Ga0157378_10042818 | Ga0157378_100428183 | 242 |
| 608 | 3300013306 | Ga0163162_10064268 | Ga0163162_100642682 | 242 |
| 609 | 3300013307 | Ga0157372_10522260 | Ga0157372_105222602 | 242 |
| 610 | 3300013307 | Ga0157372_11180763 | Ga0157372_111807631 | 242 |
| 611 | 3300013308 | Ga0157375_10107277 | Ga0157375_101072772 | 242 |
| 612 | 3300014325 | Ga0163163_10006454 | Ga0163163_1000645410 | 242 |
| 613 | 3300014325 | Ga0163163_10052870 | Ga0163163_100528703 | 242 |
| 614 | 3300014325 | Ga0163163_10056305 | Ga0163163_100563053 | 242 |
| 615 | 3300014325 | Ga0163163_10105660 | Ga0163163_101056602 | 242 |
| 616 | 3300014325 | Ga0163163_10201794 | Ga0163163_102017941 | 242 |
| 617 | 3300014325 | Ga0163163_10329416 | Ga0163163_103294162 | 242 |
| 618 | 3300014325 | Ga0163163_10513014 | Ga0163163_105130141 | 242 |
| 619 | 3300014325 | Ga0163163_10536805 | Ga0163163_105368052 | 242 |
| 620 | 3300014325 | Ga0163163_10944930 | Ga0163163_109449302 | 242 |
| 621 | 3300014326 | Ga0157380_10003861 | Ga0157380_100038618 | 242 |
| 622 | 3300014745 | Ga0157377_10270408 | Ga0157377_102704082 | 242 |
| 623 | 3300014968 | Ga0157379_10099444 | Ga0157379_100994443 | 242 |
| 624 | 3300025900 | Ga0207710_10002921 | Ga0207710_100029214 | 242 |
| 625 | 3300025904 | Ga0207647_10002055 | Ga0207647_100020556 | 242 |
| 626 | 3300025904 | Ga0207647_10077733 | Ga0207647_100777332 | 242 |
| 627 | 3300025908 | Ga0207643_10003641 | Ga0207643_100036412 | 242 |
| 628 | 3300025908 | Ga0207643_10012630 | Ga0207643_100126304 | 242 |
| 629 | 3300025908 | Ga0207643_10166848 | Ga0207643_101668482 | 242 |
| 630 | 3300025908 | Ga0207643_10170511 | Ga0207643_101705112 | 242 |
| 631 | 3300025910 | Ga0207684_10000327 | Ga0207684_1000032744 | 242 |
| 632 | 3300025910 | Ga0207684_10019280 | Ga0207684_100192806 | 242 |
| 633 | 3300025910 | Ga0207684_10075799 | Ga0207684_100757993 | 242 |
| 634 | 3300025912 | Ga0207707_10013516 | Ga0207707_100135166 | 242 |
| 635 | 3300025912 | Ga0207707_10134238 | Ga0207707_101342383 | 242 |
| 636 | 3300025917 | Ga0207660_10094914 | Ga0207660_100949141 | 242 |
| 637 | 3300025918 | Ga0207662_10146703 | Ga0207662_101467032 | 242 |
| 638 | 3300025918 | Ga0207662_10211930 | Ga0207662_102119302 | 242 |
| 639 | 3300025920 | Ga0207649_10053965 | Ga0207649_100539651 | 242 |
| 640 | 3300025921 | Ga0207652_10045654 | Ga0207652_100456542 | 242 |
| 641 | 3300025921 | Ga0207652_10263533 | Ga0207652_102635332 | 242 |
| 642 | 3300025922 | Ga0207646_10194872 | Ga0207646_101948722 | 242 |
| 643 | 3300025924 | Ga0207694_10058438 | Ga0207694_100584384 | 242 |
| 644 | 3300025925 | Ga0207650_10127877 | Ga0207650_101278772 | 242 |
| 645 | 3300025931 | Ga0207644_10039335 | Ga0207644_100393353 | 242 |
| 646 | 3300025931 | Ga0207644_10073028 | Ga0207644_100730283 | 242 |
| 647 | 3300025931 | Ga0207644_10351120 | Ga0207644_103511202 | 242 |
| 648 | 3300025932 | Ga0207690_10002898 | Ga0207690_100028986 | 242 |
| 649 | 3300025932 | Ga0207690_10386069 | Ga0207690_103860692 | 242 |
| 650 | 3300025933 | Ga0207706_10179685 | Ga0207706_101796852 | 242 |
| 651 | 3300025935 | Ga0207709_10009750 | Ga0207709_100097504 | 242 |
| 652 | 3300025936 | Ga0207670_10002988 | Ga0207670_100029887 | 242 |
| 653 | 3300025936 | Ga0207670_10095794 | Ga0207670_100957942 | 242 |
| 654 | 3300025936 | Ga0207670_10239436 | Ga0207670_102394362 | 242 |
| 655 | 3300025939 | Ga0207665_10132920 | Ga0207665_101329203 | 242 |
| 656 | 3300025942 | Ga0207689_10007541 | Ga0207689_100075418 | 242 |
| 657 | 3300025942 | Ga0207689_10077303 | Ga0207689_100773032 | 242 |
| 658 | 3300025942 | Ga0207689_10122918 | Ga0207689_101229182 | 242 |
| 659 | 3300025942 | Ga0207689_10191300 | Ga0207689_101913001 | 242 |
| 660 | 3300025942 | Ga0207689_10561898 | Ga0207689_105618982 | 242 |
| 661 | 3300025944 | Ga0207661_10351934 | Ga0207661_103519342 | 242 |
| 662 | 3300025945 | Ga0207679_10011061 | Ga0207679_100110614 | 242 |
| 663 | 3300025960 | Ga0207651_10188311 | Ga0207651_101883111 | 242 |
| 664 | 3300025960 | Ga0207651_10243078 | Ga0207651_102430782 | 242 |
| 665 | 3300025960 | Ga0207651_10285664 | Ga0207651_102856642 | 242 |
| 666 | 3300025961 | Ga0207712_10070098 | Ga0207712_100700982 | 242 |
| 667 | 3300025961 | Ga0207712_10463546 | Ga0207712_104635462 | 242 |
| 668 | 3300025986 | Ga0207658_10724769 | Ga0207658_107247691 | 242 |
| 669 | 3300026035 | Ga0207703_10048587 | Ga0207703_100485874 | 242 |
| 670 | 3300026035 | Ga0207703_10181224 | Ga0207703_101812242 | 242 |
| 671 | 3300026041 | Ga0207639_10012957 | Ga0207639_100129573 | 242 |
| 672 | 3300026041 | Ga0207639_10013199 | Ga0207639_100131993 | 242 |
| 673 | 3300026041 | Ga0207639_10273744 | Ga0207639_102737442 | 242 |
| 674 | 3300026075 | Ga0207708_10035028 | Ga0207708_100350282 | 242 |
| 675 | 3300026088 | Ga0207641_10069708 | Ga0207641_100697083 | 242 |
| 676 | 3300026088 | Ga0207641_10092706 | Ga0207641_100927063 | 242 |
| 677 | 3300026095 | Ga0207676_10030219 | Ga0207676_100302193 | 242 |
| 678 | 3300026095 | Ga0207676_10094810 | Ga0207676_100948104 | 242 |
| 679 | 3300026095 | Ga0207676_10136198 | Ga0207676_101361982 | 242 |
| 680 | 3300026095 | Ga0207676_10280528 | Ga0207676_102805282 | 242 |
| 681 | 3300026095 | Ga0207676_10902141 | Ga0207676_109021411 | 242 |
| 682 | 3300026116 | Ga0207674_10000115 | Ga0207674_1000011543 | 242 |
| 683 | 3300026116 | Ga0207674_10052508 | Ga0207674_100525084 | 242 |
| 684 | 3300026116 | Ga0207674_10081537 | Ga0207674_100815374 | 242 |
| 685 | 3300026116 | Ga0207674_10183079 | Ga0207674_101830792 | 242 |
| 686 | 3300026116 | Ga0207674_10403195 | Ga0207674_104031952 | 242 |
| 687 | 3300026116 | Ga0207674_10451493 | Ga0207674_104514931 | 242 |
| 688 | 3300026116 | Ga0207674_10467076 | Ga0207674_104670762 | 242 |
| 689 | 3300026116 | Ga0207674_10475087 | Ga0207674_104750872 | 242 |
| 690 | 3300026118 | Ga0207675_100004070 | Ga0207675_10000407010 | 242 |
| 691 | 3300026118 | Ga0207675_100054853 | Ga0207675_1000548532 | 242 |
| 692 | 3300026118 | Ga0207675_100067857 | Ga0207675_1000678572 | 242 |
| 693 | 3300026118 | Ga0207675_100110978 | Ga0207675_1001109784 | 242 |
| 694 | 3300026118 | Ga0207675_100385111 | Ga0207675_1003851112 | 242 |
| 695 | 3300026142 | Ga0207698_10151975 | Ga0207698_101519752 | 242 |
| 696 | 3300028380 | Ga0268265_10144162 | Ga0268265_101441622 | 242 |
| 697 | 3300028380 | Ga0268265_10389014 | Ga0268265_103890142 | 242 |
| 698 | 3300028381 | Ga0268264_10014553 | Ga0268264_100145536 | 242 |
| 699 | 3300028381 | Ga0268264_10117979 | Ga0268264_101179792 | 242 |
| 700 | 3300028381 | Ga0268264_10212015 | Ga0268264_102120152 | 242 |
| 701 | 3300031548 | Ga0307408_100929913 | Ga0307408_1009299131 | 242 |
| 702 | 3300031901 | Ga0307406_10349934 | Ga0307406_103499342 | 242 |
| 703 | 3300032002 | Ga0307416_100071864 | Ga0307416_1000718643 | 242 |
| 704 | 3300032002 | Ga0307416_100906647 | Ga0307416_1009066471 | 242 |
| 705 | 3300032005 | Ga0307411_10019309 | Ga0307411_100193092 | 242 |
| 706 | 3300032005 | Ga0307411_10071903 | Ga0307411_100719033 | 242 |
| 707 | 3300032126 | Ga0307415_100145386 | Ga0307415_1001453862 | 242 |
| 708 | 3300035090 | Ga0373949_0015015 | Ga0373949_0015015_956_1690 | 242 |
| 709 | 3300035091 | Ga0373951_0002234 | Ga0373951_0002234_3744_4478 | 242 |
| 710 | 3300035207 | Ga0373942_0056745 | Ga0373942_0056745_126_860 | 242 |
| 711 | 3300037466 | Ga0395898_0072037 | Ga0395898_0072037_1984_2718 | 242 |
| 712 | 3300038699 | Ga0242422_00406 | Ga0242422_00406_55_789 | 242 |
| 713 | 3300041406 | Ga0439439_0060500 | Ga0439439_0060500_159_896 | 242 |
| 714 | 3300042461 | Ga0439460_0016911 | Ga0439460_0016911_865_1602 | 242 |
| 715 | 3300048907 | Ga0496104_0241948 | Ga0496104_0241948_543_1274 | 242 |
| 716 | 3300048909 | Ga0496106_0110556 | Ga0496106_0110556_525_1259 | 242 |
| 717 | 3300048910 | Ga0496107_0605884 | Ga0496107_0605884_52_783 | 242 |
| 718 | 3300048911 | Ga0496108_0696700 | Ga0496108_0696700_12_749 | 242 |
| 719 | 3300048913 | Ga0496110_0552282 | Ga0496110_0552282_298_1032 | 242 |
| 720 | 3300048915 | Ga0496112_0228025 | Ga0496112_0228025_941_1675 | 242 |
| 721 | 3300048915 | Ga0496112_0653568 | Ga0496112_0653568_96_827 | 242 |
| 722 | 3300048916 | Ga0496113_0237208 | Ga0496113_0237208_102_836 | 242 |
| 723 | 3300049519 | Ga0501296_003153 | Ga0501296_003153_654_1391 | 242 |
| 724 | 3300049652 | Ga0501202_045306 | Ga0501202_045306_136_873 | 242 |
| 725 | 3300049653 | Ga0501206_009230 | Ga0501206_009230_202_939 | 242 |
| 726 | 3300049654 | Ga0501207_007861 | Ga0501207_007861_596_1333 | 242 |
| 727 | 3300049660 | Ga0501216_005192 | Ga0501216_005192_224_961 | 242 |
| 728 | 3300049661 | Ga0501217_011956 | Ga0501217_011956_826_1557 | 242 |
| 729 | 3300049663 | Ga0501223_011764 | Ga0501223_011764_806_1543 | 242 |
| 730 | 3300049664 | Ga0501224_006398 | Ga0501224_006398_806_1537 | 242 |
| 731 | 3300049668 | Ga0501233_002330 | Ga0501233_002330_425_1156 | 242 |
| 732 | 3300049669 | Ga0501235_009168 | Ga0501235_009168_397_1128 | 242 |
| 733 | 3300049669 | Ga0501235_010494 | Ga0501235_010494_24_761 | 242 |
| 734 | 3300049679 | Ga0501249_011636 | Ga0501249_011636_34_771 | 242 |
| 735 | 3300049705 | Ga0501225_0005503 | Ga0501225_0005503_2105_2836 | 242 |
| 736 | 3300049705 | Ga0501225_0049288 | Ga0501225_0049288_181_918 | 242 |
| 737 | 3300049707 | Ga0501234_004139 | Ga0501234_004139_1302_2039 | 242 |
| 738 | 3300049708 | Ga0501245_010136 | Ga0501245_010136_156_893 | 242 |
| 739 | 3300049767 | Ga0501270_016125 | Ga0501270_016125_187_924 | 242 |
| 740 | 3300049770 | Ga0501273_019455 | Ga0501273_019455_22_753 | 242 |
| 741 | 3300049779 | Ga0501283_000500 | Ga0501283_000500_3205_3942 | 242 |
| 742 | 3300049779 | Ga0501283_006315 | Ga0501283_006315_469_1200 | 242 |
| 743 | 3300049851 | Ga0501212_005485 | Ga0501212_005485_924_1655 | 242 |
| 744 | 3300050507 | nmdc:mga05p37_102787_c1 | nmdc:mga05p37_102787_c1_1640_2371 | 242 |
| 745 | 3300050507 | nmdc:mga05p37_233694_c1 | nmdc:mga05p37_233694_c1_197_928 | 242 |
| 746 | 3300050507 | nmdc:mga05p37_358293_c1 | nmdc:mga05p37_358293_c1_948_1682 | 242 |
| 747 | 3300050507 | nmdc:mga05p37_396484_c1 | nmdc:mga05p37_396484_c1_429_1160 | 242 |
| 748 | 3300050507 | nmdc:mga05p37_458242_c1 | nmdc:mga05p37_458242_c1_706_1437 | 242 |
| 749 | 3300050507 | nmdc:mga05p37_491371_c1 | nmdc:mga05p37_491371_c1_603_1340 | 242 |
| 750 | 3300050508 | nmdc:mga09592_123925_c1 | nmdc:mga09592_123925_c1_718_1449 | 242 |
| 751 | 3300050509 | nmdc:mga0qj67_203653_c1 | nmdc:mga0qj67_203653_c1_555_1286 | 242 |
| 752 | 3300050510 | nmdc:mga06r32_76972_c1 | nmdc:mga06r32_76972_c1_305_1036 | 242 |
| 753 | 3300050511 | nmdc:mga08y16_15514_c1 | nmdc:mga08y16_15514_c1_719_1450 | 242 |
| 754 | 3300050512 | nmdc:mga0n895_217147_c1 | nmdc:mga0n895_217147_c1_99_833 | 242 |
| 755 | 3300050513 | nmdc:mga0rr50_364557_c1 | nmdc:mga0rr50_364557_c1_22_753 | 242 |
| 756 | 3300050515 | nmdc:mga0a205_24407_c1 | nmdc:mga0a205_24407_c1_2492_3223 | 242 |
| 757 | 3300050515 | nmdc:mga0a205_267608_c1 | nmdc:mga0a205_267608_c1_459_1193 | 242 |
| 758 | 3300050515 | nmdc:mga0a205_31937_c1 | nmdc:mga0a205_31937_c1_3589_4323 | 242 |
| 759 | 3300050515 | nmdc:mga0a205_48678_c1 | nmdc:mga0a205_48678_c1_13_744 | 242 |
| 760 | 2162886007 | SwRhRL2b_contig_3011979 | SwRhRL2b_0681.00007730 | 243 |
| 761 | 3300005289 | Ga0065704_10077781 | Ga0065704_100777815 | 243 |
| 762 | 3300005289 | Ga0065704_10154614 | Ga0065704_101546142 | 243 |
| 763 | 3300005290 | Ga0065712_10008362 | Ga0065712_100083623 | 243 |
| 764 | 3300005295 | Ga0065707_10002026 | Ga0065707_100020266 | 243 |
| 765 | 3300005295 | Ga0065707_10126370 | Ga0065707_101263702 | 243 |
| 766 | 3300005330 | Ga0070690_100008805 | Ga0070690_1000088052 | 243 |
| 767 | 3300005331 | Ga0070670_100136269 | Ga0070670_1001362692 | 243 |
| 768 | 3300005333 | Ga0070677_10018755 | Ga0070677_100187552 | 243 |
| 769 | 3300005335 | Ga0070666_10005057 | Ga0070666_100050576 | 243 |
| 770 | 3300005336 | Ga0070680_100003154 | Ga0070680_1000031545 | 243 |
| 771 | 3300005338 | Ga0068868_100044308 | Ga0068868_1000443084 | 243 |
| 772 | 3300005338 | Ga0068868_100399916 | Ga0068868_1003999162 | 243 |
| 773 | 3300005340 | Ga0070689_100021304 | Ga0070689_1000213043 | 243 |
| 774 | 3300005343 | Ga0070687_100005050 | Ga0070687_1000050506 | 243 |
| 775 | 3300005345 | Ga0070692_10157841 | Ga0070692_101578412 | 243 |
| 776 | 3300005353 | Ga0070669_100705031 | Ga0070669_1007050311 | 243 |
| 777 | 3300005364 | Ga0070673_100086206 | Ga0070673_1000862063 | 243 |
| 778 | 3300005366 | Ga0070659_100001747 | Ga0070659_10000174712 | 243 |
| 779 | 3300005367 | Ga0070667_100114751 | Ga0070667_1001147513 | 243 |
| 780 | 3300005440 | Ga0070705_100061510 | Ga0070705_1000615103 | 243 |
| 781 | 3300005444 | Ga0070694_100046232 | Ga0070694_1000462323 | 243 |
| 782 | 3300005457 | Ga0070662_100284294 | Ga0070662_1002842942 | 243 |
| 783 | 3300005458 | Ga0070681_10001035 | Ga0070681_100010357 | 243 |
| 784 | 3300005459 | Ga0068867_100010249 | Ga0068867_1000102494 | 243 |
| 785 | 3300005466 | Ga0070685_10012338 | Ga0070685_100123383 | 243 |
| 786 | 3300005466 | Ga0070685_10104802 | Ga0070685_101048022 | 243 |
| 787 | 3300005471 | Ga0070698_100026906 | Ga0070698_1000269063 | 243 |
| 788 | 3300005530 | Ga0070679_100000253 | Ga0070679_10000025322 | 243 |
| 789 | 3300005536 | Ga0070697_100114304 | Ga0070697_1001143042 | 243 |
| 790 | 3300005539 | Ga0068853_100142995 | Ga0068853_1001429953 | 243 |
| 791 | 3300005539 | Ga0068853_100250915 | Ga0068853_1002509151 | 243 |
| 792 | 3300005543 | Ga0070672_100003999 | Ga0070672_10000399910 | 243 |
| 793 | 3300005543 | Ga0070672_100034146 | Ga0070672_1000341464 | 243 |
| 794 | 3300005544 | Ga0070686_100002097 | Ga0070686_1000020976 | 243 |
| 795 | 3300005545 | Ga0070695_100086747 | Ga0070695_1000867472 | 243 |
| 796 | 3300005546 | Ga0070696_100125694 | Ga0070696_1001256942 | 243 |
| 797 | 3300005546 | Ga0070696_100145368 | Ga0070696_1001453682 | 243 |
| 798 | 3300005577 | Ga0068857_100077435 | Ga0068857_1000774353 | 243 |
| 799 | 3300005578 | Ga0068854_100088056 | Ga0068854_1000880562 | 243 |
| 800 | 3300005614 | Ga0068856_100026318 | Ga0068856_1000263185 | 243 |
| 801 | 3300005615 | Ga0070702_100007113 | Ga0070702_1000071132 | 243 |
| 802 | 3300005616 | Ga0068852_100292069 | Ga0068852_1002920692 | 243 |
| 803 | 3300005617 | Ga0068859_100021332 | Ga0068859_1000213327 | 243 |
| 804 | 3300005617 | Ga0068859_100129625 | Ga0068859_1001296253 | 243 |
| 805 | 3300005618 | Ga0068864_100062858 | Ga0068864_1000628583 | 243 |
| 806 | 3300005718 | Ga0068866_10007529 | Ga0068866_100075292 | 243 |
| 807 | 3300005840 | Ga0068870_10031917 | Ga0068870_100319173 | 243 |
| 808 | 3300005841 | Ga0068863_100083374 | Ga0068863_1000833743 | 243 |
| 809 | 3300005842 | Ga0068858_100272913 | Ga0068858_1002729133 | 243 |
| 810 | 3300005843 | Ga0068860_100009809 | Ga0068860_1000098093 | 243 |
| 811 | 3300005843 | Ga0068860_100032323 | Ga0068860_1000323232 | 243 |
| 812 | 3300005843 | Ga0068860_100575065 | Ga0068860_1005750652 | 243 |
| 813 | 3300005844 | Ga0068862_100125430 | Ga0068862_1001254303 | 243 |
| 814 | 3300006237 | Ga0097621_100010498 | Ga0097621_1000104987 | 243 |
| 815 | 3300006358 | Ga0068871_100006422 | Ga0068871_1000064225 | 243 |
| 816 | 3300006844 | Ga0075428_100188055 | Ga0075428_1001880552 | 243 |
| 817 | 3300006871 | Ga0075434_100155923 | Ga0075434_1001559232 | 243 |
| 818 | 3300006881 | Ga0068865_100021295 | Ga0068865_1000212952 | 243 |
| 819 | 3300006931 | Ga0097620_100021332 | Ga0097620_1000213327 | 243 |
| 820 | 3300006931 | Ga0097620_100129625 | Ga0097620_1001296253 | 243 |
| 821 | 3300009148 | Ga0105243_10015532 | Ga0105243_100155324 | 243 |
| 822 | 3300009174 | Ga0105241_10221769 | Ga0105241_102217692 | 243 |
| 823 | 3300009174 | Ga0105241_10238386 | Ga0105241_102383862 | 243 |
| 824 | 3300009176 | Ga0105242_10020124 | Ga0105242_100201245 | 243 |
| 825 | 3300009177 | Ga0105248_10007824 | Ga0105248_100078243 | 243 |
| 826 | 3300009177 | Ga0105248_10107562 | Ga0105248_101075623 | 243 |
| 827 | 3300009553 | Ga0105249_10004186 | Ga0105249_1000418611 | 243 |
| 828 | 3300009553 | Ga0105249_10493700 | Ga0105249_104937002 | 243 |
| 829 | 3300010375 | Ga0105239_10038591 | Ga0105239_100385912 | 243 |
| 830 | 3300010375 | Ga0105239_10243218 | Ga0105239_102432181 | 243 |
| 831 | 3300011119 | Ga0105246_10292028 | Ga0105246_102920282 | 243 |
| 832 | 3300013297 | Ga0157378_10032365 | Ga0157378_100323655 | 243 |
| 833 | 3300013297 | Ga0157378_10152807 | Ga0157378_101528072 | 243 |
| 834 | 3300013306 | Ga0163162_10018042 | Ga0163162_100180423 | 243 |
| 835 | 3300013306 | Ga0163162_10034927 | Ga0163162_100349274 | 243 |
| 836 | 3300014325 | Ga0163163_10002387 | Ga0163163_1000238712 | 243 |
| 837 | 3300014325 | Ga0163163_10274999 | Ga0163163_102749992 | 243 |
| 838 | 3300014326 | Ga0157380_10015660 | Ga0157380_100156604 | 243 |
| 839 | 3300014968 | Ga0157379_10147467 | Ga0157379_101474671 | 243 |
| 840 | 3300014969 | Ga0157376_10008850 | Ga0157376_100088505 | 243 |
| 841 | 3300017792 | Ga0163161_10004077 | Ga0163161_100040777 | 243 |
| 842 | 3300025315 | Ga0207697_10010841 | Ga0207697_100108412 | 243 |
| 843 | 3300025903 | Ga0207680_10101131 | Ga0207680_101011311 | 243 |
| 844 | 3300025907 | Ga0207645_10088695 | Ga0207645_100886952 | 243 |
| 845 | 3300025908 | Ga0207643_10042201 | Ga0207643_100422013 | 243 |
| 846 | 3300025911 | Ga0207654_10081638 | Ga0207654_100816382 | 243 |
| 847 | 3300025911 | Ga0207654_10137003 | Ga0207654_101370032 | 243 |
| 848 | 3300025912 | Ga0207707_10000142 | Ga0207707_1000014233 | 243 |
| 849 | 3300025914 | Ga0207671_10058927 | Ga0207671_100589273 | 243 |
| 850 | 3300025917 | Ga0207660_10002786 | Ga0207660_100027863 | 243 |
| 851 | 3300025918 | Ga0207662_10010043 | Ga0207662_100100435 | 243 |
| 852 | 3300025921 | Ga0207652_10000361 | Ga0207652_1000036134 | 243 |
| 853 | 3300025922 | Ga0207646_10284974 | Ga0207646_102849742 | 243 |
| 854 | 3300025923 | Ga0207681_10113607 | Ga0207681_101136072 | 243 |
| 855 | 3300025934 | Ga0207686_10066718 | Ga0207686_100667182 | 243 |
| 856 | 3300025935 | Ga0207709_10011773 | Ga0207709_100117734 | 243 |
| 857 | 3300025936 | Ga0207670_10160762 | Ga0207670_101607622 | 243 |
| 858 | 3300025938 | Ga0207704_10046734 | Ga0207704_100467342 | 243 |
| 859 | 3300025940 | Ga0207691_10000900 | Ga0207691_1000090019 | 243 |
| 860 | 3300025940 | Ga0207691_10101924 | Ga0207691_101019242 | 243 |
| 861 | 3300025941 | Ga0207711_10009470 | Ga0207711_100094706 | 243 |
| 862 | 3300025941 | Ga0207711_10104861 | Ga0207711_101048612 | 243 |
| 863 | 3300025942 | Ga0207689_10005258 | Ga0207689_100052588 | 243 |
| 864 | 3300025960 | Ga0207651_10003013 | Ga0207651_100030136 | 243 |
| 865 | 3300025961 | Ga0207712_10033030 | Ga0207712_100330302 | 243 |
| 866 | 3300025961 | Ga0207712_10164949 | Ga0207712_101649493 | 243 |
| 867 | 3300025986 | Ga0207658_10136522 | Ga0207658_101365222 | 243 |
| 868 | 3300026035 | Ga0207703_10075988 | Ga0207703_100759883 | 243 |
| 869 | 3300026041 | Ga0207639_10167671 | Ga0207639_101676712 | 243 |
| 870 | 3300026078 | Ga0207702_10411385 | Ga0207702_104113852 | 243 |
| 871 | 3300026088 | Ga0207641_10065626 | Ga0207641_100656263 | 243 |
| 872 | 3300026089 | Ga0207648_10010767 | Ga0207648_100107675 | 243 |
| 873 | 3300026095 | Ga0207676_10055713 | Ga0207676_100557133 | 243 |
| 874 | 3300026118 | Ga0207675_100085625 | Ga0207675_1000856252 | 243 |
| 875 | 3300026118 | Ga0207675_100568033 | Ga0207675_1005680332 | 243 |
| 876 | 3300027907 | Ga0207428_10009062 | Ga0207428_100090624 | 243 |
| 877 | 3300028381 | Ga0268264_10009332 | Ga0268264_100093323 | 243 |
| 878 | 3300028381 | Ga0268264_10679371 | Ga0268264_106793711 | 243 |
| 879 | 3300031852 | Ga0307410_10075240 | Ga0307410_100752402 | 243 |
| 880 | 3300031901 | Ga0307406_10068185 | Ga0307406_100681853 | 243 |
| 881 | 3300031911 | Ga0307412_10045781 | Ga0307412_100457813 | 243 |
| 882 | 3300032005 | Ga0307411_10177398 | Ga0307411_101773982 | 243 |
| 883 | 3300032126 | Ga0307415_100026563 | Ga0307415_1000265633 | 243 |
| 884 | 3300046615 | Ga0495656_0246557 | Ga0495656_0246557_45_779 | 243 |
| 885 | 3300046684 | Ga0495669_0152306 | Ga0495669_0152306_174_908 | 243 |
| 886 | 3300048916 | Ga0496113_0282661 | Ga0496113_0282661_300_1031 | 243 |
| 887 | 3300049515 | Ga0501292_005738 | Ga0501292_005738_881_1624 | 243 |
| 888 | 3300049519 | Ga0501296_000385 | Ga0501296_000385_2566_3309 | 243 |
| 889 | 3300049521 | Ga0501298_002662 | Ga0501298_002662_185_928 | 243 |
| 890 | 3300049522 | Ga0501299_030963 | Ga0501299_030963_83_826 | 243 |
| 891 | 3300049574 | Ga0501038_0002990 | Ga0501038_0002990_3289_4032 | 243 |
| 892 | 3300049655 | Ga0501208_016359 | Ga0501208_016359_123_866 | 243 |
| 893 | 3300049660 | Ga0501216_003973 | Ga0501216_003973_589_1332 | 243 |
| 894 | 3300049661 | Ga0501217_000999 | Ga0501217_000999_3638_4381 | 243 |
| 895 | 3300049668 | Ga0501233_050116 | Ga0501233_050116_223_966 | 243 |
| 896 | 3300049686 | Ga0501257_011757 | Ga0501257_011757_1053_1796 | 243 |
| 897 | 3300049690 | Ga0501261_004238 | Ga0501261_004238_778_1521 | 243 |
| 898 | 3300049705 | Ga0501225_0005408 | Ga0501225_0005408_2895_3638 | 243 |
| 899 | 3300049707 | Ga0501234_007201 | Ga0501234_007201_548_1291 | 243 |
| 900 | 3300049757 | Ga0501232_003194 | Ga0501232_003194_179_922 | 243 |
| 901 | 3300049769 | Ga0501272_000969 | Ga0501272_000969_1422_2165 | 243 |
| 902 | 3300050513 | nmdc:mga0rr50_439611_c1 | nmdc:mga0rr50_439611_c1_159_893 | 243 |
| 903 | 3300050515 | nmdc:mga0a205_13389_c1 | nmdc:mga0a205_13389_c1_2071_2805 | 243 |
| 904 | 3300050515 | nmdc:mga0a205_489906_c1 | nmdc:mga0a205_489906_c1_336_1067 | 243 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4jro-assembly1.cif.gz_C | crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ | 0.772 | 108 | 148 |
| 4jro-assembly1.cif.gz_D | crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg)from listeria monocytogenes in complex with nadp+ | 0.7567 | 108 | 146 |
| 6ux3-assembly1.cif.gz_A | crystal structure of acetoin dehydrogenase from enterobacter cloacae | 0.7463 | 111 | 150 |
| 6won-assembly2.cif.gz_G | crystal structure of acetoin dehydrogenase yohf from salmonella typhimurium | 0.7189 | 111 | 150 |
| 6nrp-assembly1.cif.gz_B | putative short-chain dehydrogenase/reductase (sdr) from acinetobacter baumannii | 0.6816 | 105 | 148 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4jigA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.7563 | 108 | 148 | 3.40.50.720 |
| af_Q2G0E1_2_140_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.7366 | 92 | 146 | 3.40.50.720 |
| af_P32675_21_290_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7308 | 108 | 149 | 3.20.20.70 |
| af_O53816_3_249_3.40.605.10 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 | 0.7268 | 105 | 146 | 3.40.605.10 |
| 1dohA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.7238 | 111 | 150 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2D6A8U5-F1-model_v4 | NYN domain-containing protein | 0.7012 | 19 | 177 |
GO:0004540
|
| AF-A0A257B365-F1-model_v4 | NYN domain-containing protein | 0.6856 | 17 | 177 |
GO:0004540
|
| AF-A0A3M9Z022-F1-model_v4 | NYN domain-containing protein | 0.6843 | 16 | 180 |
GO:0004540
|
| AF-A0A7T3FVY9-F1-model_v4 | NYN domain-containing protein | 0.6825 | 19 | 176 |
GO:0004540
|
| AF-A0A1F6SQI4-F1-model_v4 | NYN domain-containing protein | 0.6825 | 17 | 179 |
GO:0004540
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar