F485273

General Info

Members Datasets Scaffolds Average Seq Length
904 775 1808 428

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10197418|Ga0105238_101974182
Length 464
Sequence MQTFIVYFQWLDIFVIWHSPCDVPHALTEGKNMTTRRGLLKSAAAFAAVAATMGLPQYAFADGETIKVGILHSLSGTMAISETTLKDVMLMLIDQQNAKGGLLGKKLEGVVVDPASNWPLFAEKARELISKDKCVAVFGCWTSVSRKSVLPVFEELNSLLFYPVQYEGEESQKNVFYTGAAPNQQAIPAVDYLAAQGVKRWVLAGTDYVYPRTTNKILETYLKDILKVAPDDIMINYTPFGQSDWQSIVSDIKKFGSAGKKTAVVSTINGDANVPFYKELGSQGIKATDIPVCAFSVGEEEIAGIDRKPLVGHLAAWNYFMSVDTPINKDFIKSWQAYTKNPKRVSNDPMEAHFIGFNMWVGAVTKAGTTDTDPVLDAIIGVSVPNLTGGYATMMPNHHITKPVYIGEIQEDGQFDIVWQTPGLVAGDEWSDYLPGSKDLISDWRKPLSCGNFNVKTGKCGGAT

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
65 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
66 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
72 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
79 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
82 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
83 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
85 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
122 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
124 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
128 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
132 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
133 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
134 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
137 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
138 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
139 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
142 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
146 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
147 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
154 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
157 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
158 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
159 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
160 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
161 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
162 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
163 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
164 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
167 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
170 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
171 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
176 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
177 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
178 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
181 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
182 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
193 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
194 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
195 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
196 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
197 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
201 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
202 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
203 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
204 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
205 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
206 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
207 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
208 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
209 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
216 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
217 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
218 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
219 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
220 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
221 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
222 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
223 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
224 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
225 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
226 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
227 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
228 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
229 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
230 2512875024
231 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
232 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
233 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
234 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
235 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
236 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
237 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
238 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
239 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
240 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
241 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
242 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
243 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
244 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
245 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
246 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
247 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
248 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
249 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
250 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
251 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
252 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
253 2519899620 Rhizobium sp. Pop5 Isolate Nodule
254 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
255 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
256 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
257 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
258 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
259 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
260 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
261 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
262 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
263 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
264 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
265 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
266 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
267 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
268 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
269 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
270 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
271 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
272 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
273 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
274 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
275 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
276 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
277 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
278 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
279 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
280 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
281 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
282 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
283 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
284 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
285 2643221558 Rhizobium sp. Root149 Isolate Unclassified
286 2643221568 Rhizobium sp. Root564 Isolate Unclassified
287 2643221582 Rhizobium sp. Root651 Isolate Unclassified
288 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
289 2643221599 Rhizobium sp. Root708 Isolate Unclassified
290 2643221607 Rhizobium sp. Root73 Isolate Unclassified
291 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
292 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
293 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
294 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
295 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
296 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
297 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
298 2643221693 Rhizobium sp. Root491 Isolate Unclassified
299 2643221719 Rhizobium sp. Root274 Isolate Unclassified
300 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
301 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
302 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
303 2718217882 Rhizobium sp. N741 Isolate Nodule
304 2718217927 Rhizobium sp. N324 Isolate Nodule
305 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
306 2718218009 Rhizobium sp. N561 Isolate Nodule
307 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
308 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
309 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
310 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
311 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
312 2718218363 Rhizobium sp. N113 Isolate Nodule
313 2718218365 Rhizobium sp. N731 Isolate Nodule
314 2718218366 Rhizobium sp. N621 Isolate Nodule
315 2718218423 Rhizobium sp. N941 Isolate Nodule
316 2721755514 Rhizobium sp. N6212 Isolate Nodule
317 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
318 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
319 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
320 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
321 2721755809 Rhizobium sp. N541 Isolate Nodule
322 2721755810 Rhizobium sp. N871 Isolate Nodule
323 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
324 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
325 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
326 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
327 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
328 2728369365 Rhizobium sp. N1341 Isolate Nodule
329 2728369397 Rhizobium sp. N1314 Isolate Nodule
330 2738541293 Rhizobium sp. GV031 Isolate Unclassified
331 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
332 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
333 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
334 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
335 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
336 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
337 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
338 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
339 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
340 2791355256 Rhizobium sp. M10 Isolate Nodule
341 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
342 2791355260 Rhizobium sp. L9 Isolate Nodule
343 2791355261 Rhizobium sp. J15 Isolate Nodule
344 2791355262 Rhizobium sp. M1 Isolate Nodule
345 2791355263 Rhizobium chutanense C5 Isolate Nodule
346 2791355264 Rhizobium sp. S9 Isolate Nodule
347 2791355265 Rhizobium sp. H4 Isolate Nodule
348 2791355266 Rhizobium sp. L43 Isolate Nodule
349 2791355267 Rhizobium sp. L18 Isolate Nodule
350 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
351 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
352 2802429633 Rhizobium anhuiense J3 Isolate Nodule
353 2802429634 Rhizobium anhuiense S10 Isolate Nodule
354 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
355 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
356 2802429637 Rhizobium anhuiense C15 Isolate Nodule
357 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
358 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
359 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
360 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
361 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
362 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
363 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
364 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
365 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
366 2838048938 Rhizobium pisi 27/80 Isolate Nodule
367 2838061910 Rhizobium phaseoli L15 Isolate Nodule
368 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
369 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
370 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
371 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
372 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
373 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
374 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
375 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
376 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
377 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
378 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
379 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
380 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
381 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
382 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
383 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
384 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
385 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
386 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
387 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
388 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
389 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
390 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
391 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
392 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
393 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
394 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
395 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
396 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
397 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
398 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
399 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
400 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
401 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
402 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
403 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
404 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
405 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
406 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
407 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
408 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
409 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
410 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
411 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
412 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
413 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
414 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
415 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
416 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
417 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
418 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
419 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
420 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
421 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
422 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
423 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
424 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
425 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
426 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
427 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
428 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
429 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
430 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
431 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
432 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
433 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
434 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
435 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
436 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
437 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
438 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
439 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
440 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
441 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
442 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
443 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
444 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
445 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
446 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
447 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
448 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
449 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
450 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
451 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
452 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
453 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
454 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
455 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
456 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
457 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
458 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
459 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
460 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
461 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
462 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
463 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
464 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
465 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
466 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
467 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
468 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
469 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
470 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
471 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
472 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
473 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
474 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
475 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
476 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
477 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
478 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
479 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
480 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
481 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
482 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
483 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
484 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
485 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
486 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
487 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
488 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
489 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
490 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
491 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
492 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
493 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
494 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
495 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
496 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
497 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
498 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
499 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
500 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
501 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
502 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
503 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
504 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
505 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
506 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
507 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
508 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
509 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
510 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
511 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
512 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
513 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
514 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
515 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
516 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
517 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
518 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
519 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
520 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
521 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
522 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
523 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
524 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
525 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
526 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
527 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
528 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
529 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
530 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
531 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
532 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
533 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
534 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
535 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
536 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
537 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
538 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
539 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
540 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
541 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
542 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
543 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
544 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
545 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
546 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
547 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
548 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
549 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
550 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
551 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
552 2909042592 Labrys sp. LIt4 Isolate Nodule
553 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
554 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
555 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
556 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
557 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
558 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
559 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
560 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
561 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
562 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
563 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
564 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
565 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
566 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
567 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
568 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
569 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
570 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
571 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
572 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
573 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
574 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
575 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
576 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
577 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
578 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
579 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
580 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
581 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
582 2933599457 Rhizobium phaseoli M3 Isolate Nodule
583 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
584 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
585 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
586 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
587 2936381700 Rhizobium chutanense C16 Isolate Unclassified
588 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
589 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
590 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
591 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
592 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
593 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
594 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
595 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
596 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
597 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
598 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
599 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
600 2952252522 Salinicola sp. DM10 Isolate Unclassified
601 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
602 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
603 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
604 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
605 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
606 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
607 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
608 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
609 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
610 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
611 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
612 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
613 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
614 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
615 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
616 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
617 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
618 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
619 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
620 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
621 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
622 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
623 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
624 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
625 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
626 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
627 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
628 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
629 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
630 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
631 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
632 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
633 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
634 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
635 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
636 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
637 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
638 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
639 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
640 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
641 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
642 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
643 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
644 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
645 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
646 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
647 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
648 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
649 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
650 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
651 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
652 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
653 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
654 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
655 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
656 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
657 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
658 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
659 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
660 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
661 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
662 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
663 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
664 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
665 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
666 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
667 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
668 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
669 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
670 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
671 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
672 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
673 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
674 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
675 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
676 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
677 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
678 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
679 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
680 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
681 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
682 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
683 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
684 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
685 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
686 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
687 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
688 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
689 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
690 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
691 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
692 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
693 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
694 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
695 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
696 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
697 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
698 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
699 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
700 2996887358 Rhizobium sp. R711 Isolate Nodule
701 2996893221 Rhizobium sp. R635 Isolate Nodule
702 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
703 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
704 3004167301 Mesorhizobium loti 582 Isolate Unclassified
705 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
706 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
707 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
708 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
709 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
710 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
711 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
712 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
713 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
714 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
715 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
716 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
717 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
718 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
719 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
720 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
721 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
722 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
723 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
724 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
725 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
726 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
727 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
728 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
729 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
730 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
731 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
732 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
733 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
734 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
735 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
736 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
737 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
738 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
739 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
740 8005258706 Rhizobium sp. R693 Isolate Nodule
741 8005275841 Rhizobium sp. N4311 Isolate Nodule
742 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
743 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
744 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
745 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
746 8005321885 Rhizobium sp. R72 Isolate Nodule
747 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
748 8005382845 Rhizobium sp. R634 Isolate Nodule
749 8005395548 Rhizobium sp. R339 Isolate Nodule
750 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
751 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
752 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
753 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
754 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
755 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
756 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
757 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
758 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
759 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
760 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
761 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
762 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
763 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
764 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
765 8018176218 Rhizobium sp. N122 Isolate Nodule
766 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
767 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
768 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
769 8024501048 Rhizobium sp. H4 Isolate Nodule
770 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
771 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
772 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
773 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
774 8056382006 Rhizobium croatiense 13T Isolate Nodule
775 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 36.73
Metatranscriptomes 1.11
Isolates 62.17

Biome Distribution

Category Percentage (%)
Aerial Root 0.55
Bulb 0
Endosphere 14.16
Nodule 47.46
Rhizoplane 1.22
Rhizosphere 23.01
Stem 0
Stem Tuber 0
Unclassified 0.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10197418 3300009551 Bacteria 1988
2 JGI24740J21852_10014562 3300001979 Bacteria 2896
3 JGI24739J22299_10014864 3300001989 Bacteria 2830
4 JGI25156J39149_1005061 3300002705 Bacteria 3889
5 JGI25158J39367_1000041 3300002739 Bacteria 29153
6 JGI25157J39369_1001294 3300002741 Bacteria 10022
7 JGI25150J39212_1000091 3300002774 Bacteria 52487
8 JGI25159J45721_1000319 3300002987 Bacteria 22419
9 JGI25151J46595_10000027 3300003187 Bacteria 208739
10 JGI25151J46595_10000737 3300003187 Bacteria 26948
11 JGI25151J46595_10026094 3300003187 Bacteria 2363
12 JGI25406J46586_10003935 3300003203 Bacteria 6942
13 JGI25153J46596_10002597 3300003215 Bacteria 10356
14 JGI25160J50197_1010867 3300003354 Bacteria 3265
15 JGI25161J50226_1000490 3300003374 Bacteria 17851
16 JGI25161J50226_1006269 3300003374 Bacteria 2177
17 Ga0055542_1000775 3300003762 Bacteria 24034
18 Ga0055526_1002973 3300003771 Bacteria 11098
19 Ga0055526_1014194 3300003771 Bacteria 3296
20 Ga0055526_1020962 3300003771 Bacteria 2296
21 Ga0055524_1001190 3300003775 Bacteria 15475
22 Ga0055524_1003326 3300003775 Bacteria 7847
23 Ga0055524_1011470 3300003775 Bacteria 3464
24 Ga0055524_1015026 3300003775 Bacteria 2841
25 Ga0055528_1001127 3300003790 Bacteria 17528
26 Ga0055528_1001342 3300003790 Bacteria 15269
27 Ga0055528_1020020 3300003790 Bacteria 2188
28 Ga0055540_1000483 3300003792 Bacteria 30602
29 Ga0055540_1011537 3300003792 Bacteria 2840
30 Ga0055540_1015478 3300003792 Bacteria 2218
31 Ga0055543_1000108 3300004625 Bacteria 71519
32 Ga0055543_1000220 3300004625 Bacteria 45860
33 Ga0065165_1001643 3300005262 Bacteria 22733
34 Ga0065165_1011374 3300005262 Bacteria 3723
35 Ga0065165_1018735 3300005262 Bacteria 2495
36 Ga0070658_10040058 3300005327 Bacteria 3780
37 Ga0070670_100000279 3300005331 Bacteria 44846
38 Ga0068869_100037893 3300005334 Bacteria 3431
39 Ga0070660_100058872 3300005339 Bacteria 2978
40 Ga0070668_100098147 3300005347 Bacteria 2318
41 Ga0070668_100204641 3300005347 Bacteria 1621
42 Ga0070669_100210130 3300005353 Bacteria 1535
43 Ga0070671_100011606 3300005355 Bacteria 7086
44 Ga0070659_100124108 3300005366 Bacteria 2094
45 Ga0070701_10003680 3300005438 Bacteria 6110
46 Ga0070705_100000010 3300005440 Bacteria 102079
47 Ga0070694_100000843 3300005444 Bacteria 17266
48 Ga0070663_100029103 3300005455 Bacteria 3770
49 Ga0070663_100146862 3300005455 Bacteria 1805
50 Ga0070662_100063675 3300005457 Bacteria 2698
51 Ga0070681_10081176 3300005458 Bacteria 3199
52 Ga0070706_100032893 3300005467 Bacteria 4784
53 Ga0070706_100086383 3300005467 Bacteria 2907
54 Ga0070707_100008667 3300005468 Bacteria 9437
55 Ga0070699_100001267 3300005518 Bacteria 23288
56 Ga0070679_100298614 3300005530 Bacteria 1561
57 Ga0068853_100004973 3300005539 Bacteria 10360
58 Ga0068853_100024886 3300005539 Bacteria 5022
59 Ga0070695_100001386 3300005545 Bacteria 13460
60 Ga0070696_100000088 3300005546 Bacteria 45502
61 Ga0070665_100006064 3300005548 Bacteria 12354
62 Ga0070665_100010771 3300005548 Bacteria 9249
63 Ga0070665_100073491 3300005548 Bacteria 3425
64 Ga0070704_100008846 3300005549 Bacteria 6061
65 Ga0068855_100347384 3300005563 Bacteria 1635
66 Ga0068857_100013328 3300005577 Bacteria 7159
67 Ga0068852_100021910 3300005616 Bacteria 5113
68 Ga0068859_100034899 3300005617 Bacteria 5047
69 Ga0068861_100187167 3300005719 Bacteria 1727
70 Ga0068863_100086016 3300005841 Bacteria 2979
71 Ga0068862_100000484 3300005844 Bacteria 42509
72 Ga0081455_10051537 3300005937 Bacteria 3530
73 Ga0081539_10003789 3300005985 Bacteria 17853
74 Ga0075365_10002331 3300006038 Bacteria 9244
75 Ga0075365_10003140 3300006038 Bacteria 8421
76 Ga0075365_10077627 3300006038 Bacteria 2244
77 Ga0075365_10079034 3300006038 Bacteria 2225
78 Ga0075363_100026546 3300006048 Bacteria 2963
79 Ga0075364_10000526 3300006051 Bacteria 19481
80 Ga0075364_10002812 3300006051 Bacteria 9793
81 Ga0075364_10073163 3300006051 Bacteria 2259
82 Ga0075362_10000338 3300006177 Bacteria 13379
83 Ga0075362_10012056 3300006177 Bacteria 3421
84 Ga0075367_10003998 3300006178 Bacteria 7126
85 Ga0075367_10006008 3300006178 Bacteria 6099
86 Ga0075367_10037562 3300006178 Bacteria 2815
87 Ga0075367_10129276 3300006178 Unclassified 1561
88 Ga0075369_10014564 3300006186 Bacteria 3144
89 Ga0075369_10017700 3300006186 Bacteria 2893
90 Ga0075366_10008187 3300006195 Bacteria 5801
91 Ga0075370_10000834 3300006353 Bacteria 12448
92 Ga0075370_10034761 3300006353 Bacteria 2826
93 Ga0075430_100000066 3300006846 Bacteria 56729
94 Ga0075430_100005392 3300006846 Bacteria 10800
95 Ga0075431_100032995 3300006847 Bacteria 5336
96 Ga0097620_100034899 3300006931 Bacteria 5047
97 Ga0079104_1000015 3300006946 Bacteria 321803
98 Ga0099826_10000404 3300006948 Bacteria 20366
99 Ga0105250_10008178 3300009092 Bacteria 4455
100 Ga0105240_10227199 3300009093 Bacteria 2171
101 Ga0105240_10235679 3300009093 Bacteria 2124
102 Ga0105242_10113135 3300009176 Bacteria 2317
103 Ga0105237_10000768 3300009545 Bacteria 43904
104 Ga0105237_10178441 3300009545 Bacteria 2124
105 Ga0105238_10057029 3300009551 Bacteria 3917
106 Ga0105238_10061076 3300009551 Bacteria 3772
107 Ga0105249_10002652 3300009553 Bacteria 15471
108 Ga0105249_10157942 3300009553 Bacteria 2189
109 Ga0123341_1000018 3300009765 Bacteria 81421
110 Ga0123342_1014715 3300009766 Bacteria 7372
111 Ga0105239_10000846 3300010375 Bacteria 43563
112 Ga0157371_10000165 3300013102 Bacteria 96321
113 Ga0157370_10000295 3300013104 Bacteria 63297
114 Ga0157370_10125303 3300013104 Bacteria 2398
115 Ga0213873_10001551 3300021358 Bacteria 3837
116 Ga0213876_10000302 3300021384 Bacteria 44239
117 Ga0213876_10000852 3300021384 Bacteria 20544
118 Ga0209436_100098 3300025208 Bacteria 42522
119 Ga0209563_103818 3300025230 Bacteria 3018
120 Ga0207427_104599 3300025231 Bacteria 2250
121 Ga0207425_1000043 3300025245 Bacteria 208791
122 Ga0207425_1000495 3300025245 Bacteria 24691
123 Ga0209026_1000002 3300025250 Bacteria 1136158
124 Ga0209148_1000072 3300025254 Bacteria 325292
125 Ga0209148_1000409 3300025254 Bacteria 49427
126 Ga0209759_1000062 3300025256 Bacteria 197996
127 Ga0209129_1000072 3300025258 Bacteria 208805
128 Ga0209129_1000702 3300025258 Bacteria 21824
129 Ga0209129_1001401 3300025258 Bacteria 13486
130 Ga0209129_1005279 3300025258 Bacteria 4652
131 Ga0209233_1000480 3300025261 Bacteria 24397
132 Ga0209565_1010788 3300025263 Bacteria 2253
133 Ga0209455_1000133 3300025272 Bacteria 155670
134 Ga0209455_1001295 3300025272 Bacteria 11666
135 Ga0209673_1000125 3300025273 Bacteria 168465
136 Ga0209673_1000256 3300025273 Bacteria 100514
137 Ga0209673_1001106 3300025273 Bacteria 30133
138 Ga0209673_1002335 3300025273 Bacteria 13427
139 Ga0209673_1010784 3300025273 Bacteria 3823
140 Ga0209130_1000023 3300025284 Bacteria 359355
141 Ga0209675_1018186 3300025291 Bacteria 1975
142 Ga0209676_1013842 3300025292 Bacteria 3075
143 Ga0209676_1031197 3300025292 Bacteria 1620
144 Ga0209025_1000120 3300025294 Bacteria 208791
145 Ga0209025_1000154 3300025294 Bacteria 170288
146 Ga0209025_1000537 3300025294 Bacteria 71838
147 Ga0209025_1001251 3300025294 Bacteria 35202
148 Ga0209025_1024316 3300025294 Bacteria 3130
149 Ga0209564_1000259 3300025295 Bacteria 112570
150 Ga0209564_1000393 3300025295 Bacteria 78338
151 Ga0209564_1000778 3300025295 Bacteria 44316
152 Ga0209564_1002080 3300025295 Bacteria 17184
153 Ga0209758_1000111 3300025297 Bacteria 208790
154 Ga0209758_1000666 3300025297 Bacteria 51353
155 Ga0209758_1001689 3300025297 Bacteria 24856
156 Ga0209758_1001847 3300025297 Bacteria 23247
157 Ga0209758_1001921 3300025297 Bacteria 22607
158 Ga0209758_1003699 3300025297 Bacteria 13571
159 Ga0209758_1011532 3300025297 Bacteria 5101
160 Ga0209758_1011608 3300025297 Bacteria 5071
161 Ga0209050_1010067 3300025298 Bacteria 4720
162 Ga0209256_1000283 3300025299 Bacteria 89387
163 Ga0209256_1001708 3300025299 Bacteria 21121
164 Ga0209256_1003508 3300025299 Bacteria 10927
165 Ga0209256_1004429 3300025299 Bacteria 8828
166 Ga0209256_1014154 3300025299 Bacteria 2896
167 Ga0207426_1000087 3300025302 Bacteria 288870
168 Ga0207426_1000386 3300025302 Bacteria 75890
169 Ga0207426_1001078 3300025302 Bacteria 25542
170 Ga0209051_1000434 3300025303 Bacteria 56673
171 Ga0209051_1004281 3300025303 Bacteria 8879
172 Ga0209051_1004651 3300025303 Bacteria 8360
173 Ga0209051_1005167 3300025303 Bacteria 7734
174 Ga0207653_10000769 3300025885 Bacteria 10875
175 Ga0207705_10087709 3300025909 Bacteria 2275
176 Ga0207684_10089819 3300025910 Bacteria 2617
177 Ga0207707_10076643 3300025912 Bacteria 2918
178 Ga0207695_10191311 3300025913 Bacteria 1964
179 Ga0207671_10000361 3300025914 Bacteria 64792
180 Ga0207671_10022024 3300025914 Bacteria 4825
181 Ga0207671_10055832 3300025914 Bacteria 2926
182 Ga0207671_10067844 3300025914 Bacteria 2657
183 Ga0207660_10192387 3300025917 Bacteria 1589
184 Ga0207657_10052118 3300025919 Bacteria 3553
185 Ga0207657_10064910 3300025919 Bacteria 3114
186 Ga0207652_10117003 3300025921 Bacteria 2368
187 Ga0207652_10151830 3300025921 Bacteria 2074
188 Ga0207646_10102996 3300025922 Bacteria 2559
189 Ga0207694_10084407 3300025924 Bacteria 2498
190 Ga0207644_10178420 3300025931 Bacteria 1663
191 Ga0207689_10061330 3300025942 Bacteria 3092
192 Ga0207667_10055496 3300025949 Bacteria 4164
193 Ga0207667_10105914 3300025949 Bacteria 2901
194 Ga0207712_10002216 3300025961 Bacteria 12663
195 Ga0207639_10021714 3300026041 Bacteria 4614
196 Ga0207678_10012628 3300026067 Bacteria 7420
197 Ga0207678_10128737 3300026067 Bacteria 2159
198 Ga0207708_10042496 3300026075 Bacteria 3465
199 Ga0207674_10042394 3300026116 Bacteria 4700
200 Ga0207675_100059175 3300026118 Bacteria 3575
201 Ga0207698_10066661 3300026142 Bacteria 2835
202 Ga0209281_1000068 3300027111 Bacteria 280238
203 Ga0209371_1000022 3300027312 Bacteria 536342
204 Ga0209371_1001584 3300027312 Bacteria 14844
205 Ga0209282_1002300 3300027666 Bacteria 10951
206 Ga0209282_1011356 3300027666 Bacteria 5650
207 Ga0209813_10006253 3300027866 Bacteria 2935
208 Ga0268266_10000086 3300028379 Bacteria 199443
209 Ga0268266_10003387 3300028379 Bacteria 15955
210 Ga0268266_10047891 3300028379 Bacteria 3663
211 Ga0268266_10075231 3300028379 Bacteria 2933
212 Ga0268266_10297873 3300028379 Bacteria 1504
213 Ga0268265_10002000 3300028380 Bacteria 16092
214 Ga0265319_1000212 3300028563 Bacteria 43934
215 Ga0265318_10001820 3300028577 Bacteria 12085
216 Ga0307515_10000017 3300028794 Bacteria 550465
217 Ga0307515_10001155 3300028794 Bacteria 60447
218 Ga0307515_10009128 3300028794 Bacteria 19231
219 Ga0265338_10145826 3300028800 Bacteria 1846
220 Ga0268256_1000019 3300030500 Bacteria 587949
221 Ga0268256_1001866 3300030500 Bacteria 11664
222 Ga0265325_10001826 3300031241 Bacteria 14714
223 Ga0265325_10010189 3300031241 Bacteria 5453
224 Ga0265325_10024758 3300031241 Bacteria 3262
225 Ga0265339_10000228 3300031249 Bacteria 45435
226 Ga0265327_10000986 3300031251 Bacteria 40541
227 Ga0265316_10000951 3300031344 Bacteria 31569
228 Ga0307513_10000852 3300031456 Bacteria 44393
229 Ga0307513_10024615 3300031456 Bacteria 6999
230 Ga0265313_10000203 3300031595 Bacteria 63977
231 Ga0265313_10003693 3300031595 Bacteria 12198
232 Ga0265342_10000290 3300031712 Bacteria 56854
233 Ga0265342_10055882 3300031712 Bacteria 2342
234 Ga0316577_10001499 3300031733 Bacteria 11058
235 Ga0307414_10052824 3300032004 Bacteria 2830
236 Ga0316580_10026732 3300032139 Bacteria 1784
237 Ga0316593_10006338 3300032168 Bacteria 3184
238 Ga0316593_10010619 3300032168 Bacteria 2648
239 Ga0316588_1006292 3300033528 Bacteria 2366
240 Ga0316596_1003478 3300033541 Bacteria 3458
241 Ga0316574_0008927 3300035398 Bacteria 5595
242 Ga0316582_0005305 3300036647 Bacteria 6620
243 Ga0316582_0029195 3300036647 Bacteria 3348
244 Ga0316584_0003224 3300036712 Bacteria 10566
245 Ga0316584_0026509 3300036712 Bacteria 4261
246 Ga0395899_0009756 3300037312 Bacteria 7368
247 Ga0395900_0107113 3300037418 Bacteria 2871
248 Ga0395900_0219433 3300037418 Bacteria 1917
249 Ga0395898_0197673 3300037466 Bacteria 1920
250 Ga0395905_0000314 3300037471 Bacteria 70335
251 Ga0395905_0020280 3300037471 Bacteria 6298
252 Ga0395905_0027398 3300037471 Bacteria 5374
253 Ga0395905_0041557 3300037471 Bacteria 4314
254 Ga0395901_0106415 3300038443 Bacteria 2944
255 Ga0395901_0135291 3300038443 Bacteria 2590
256 Ga0400490_07209 3300038726 Bacteria 7521
257 Ga0400490_25275 3300038726 Bacteria 13474
258 Ga0400490_59697 3300038726 Bacteria 94606
259 Ga0400487_12220 3300039110 Bacteria 3878
260 Ga0436365_0495756 3300039437 Bacteria 19208
261 Ga0436365_0981941 3300039437 Bacteria 54107
262 Ga0436360_0590348 3300039438 Bacteria 1739
263 Ga0436361_0162094 3300039447 Bacteria 4300
264 Ga0436361_0880457 3300039447 Bacteria 2574
265 Ga0436363_0959743 3300039450 Bacteria 5077
266 Ga0436362_0733671 3300039453 Bacteria 7219
267 Ga0436362_1154506 3300039453 Bacteria 2026
268 Ga0451835_0558767 3300041492 Bacteria 2685
269 Ga0451847_0443818 3300041503 Bacteria 4452
270 Ga0451851_0406472 3300041507 Bacteria 4105
271 Ga0451853_0415754 3300041512 Bacteria 5640
272 Ga0466960_0040172 3300044901 Bacteria 2211
273 Ga0451576_0000262 3300045051 Bacteria 128472
274 Ga0495638_0121515 3300046460 Bacteria 1542
275 Ga0495597_0029702 3300046542 Bacteria 2495
276 Ga0495625_0059199 3300046660 Bacteria 2718
277 Ga0495625_0062401 3300046660 Bacteria 2634
278 Ga0495600_0027937 3300046809 Bacteria 3648
279 Ga0495660_0089748 3300046810 Bacteria 1600
280 Ga0495672_0049929 3300047320 Bacteria 2474
281 Ga0496102_0011790 3300048905 Bacteria 7543
282 Ga0496104_0073732 3300048907 Bacteria 3248
283 Ga0496104_0127653 3300048907 Bacteria 2442
284 Ga0496106_0013486 3300048909 Bacteria 6034
285 Ga0496116_0000105 3300048919 Bacteria 192704
286 Ga0496117_0000002 3300048920 Bacteria 2483758
287 Ga0496118_0000736 3300048921 Bacteria 52853
288 Ga0496118_0025305 3300048921 Bacteria 5095
289 Ga0496120_0000534 3300048923 Bacteria 58507
290 Ga0496121_0003279 3300048924 Bacteria 23226
291 Ga0496122_0000004 3300048925 Bacteria 645283
292 Ga0496122_0000042 3300048925 Bacteria 280482
293 Ga0496123_0000007 3300048926 Bacteria 645283
294 Ga0496123_0000030 3300048926 Bacteria 291764
295 Ga0496125_0094962 3300048928 Bacteria 2219
296 Ga0496125_0124069 3300048928 Bacteria 1835
297 Ga0496126_0002286 3300048929 Bacteria 26407
298 Ga0496126_0270069 3300048929 Bacteria 1411
299 Ga0501031_0002222 3300049568 Bacteria 12267
300 Ga0501033_0042981 3300049570 Bacteria 3367
301 Ga0501034_0021138 3300049571 Bacteria 6639
302 Ga0501038_0108801 3300049574 Bacteria 2298
303 Ga0501047_0295055 3300049581 Bacteria 1464
304 Ga0501070_0019982 3300049586 Bacteria 5616
305 Ga0501083_0125378 3300049744 Bacteria 1683
306 Ga0501044_0055712 3300049823 Bacteria 4060
307 Ga0501044_0067124 3300049823 Bacteria 3655
308 Ga0501044_0083916 3300049823 Bacteria 3220
309 nmdc:mga03683_19386_c1 3300050489 Bacteria 2596
310 nmdc:mga03683_9237_c1 3300050489 Bacteria 3499
311 nmdc:mga03n38_75982_c1 3300050490 Unclassified 1566
312 nmdc:mga00v17_35321_c1 3300050491 Bacteria 2973
313 nmdc:mga00v17_35_c1 3300050491 Bacteria 85646
314 nmdc:mga00v17_6991_c1 3300050491 Bacteria 6004
315 nmdc:mga00v17_7_c1 3300050491 Bacteria 167228
316 nmdc:mga0yw44_2996_c1 3300050492 Bacteria 7373
317 nmdc:mga0yw44_4395_c1 3300050492 Bacteria 6455
318 nmdc:mga0yw44_46333_c1 3300050492 Bacteria 2610
319 nmdc:mga0yw44_5189_c1 3300050492 Bacteria 6107
320 nmdc:mga06z11_103455_c1 3300050494 Unclassified 1566
321 nmdc:mga06z11_13756_c1 3300050494 Bacteria 3564
322 nmdc:mga07m45_23938_c1 3300050496 Bacteria 2664
323 nmdc:mga0qj67_221_c1 3300050509 Bacteria 38873
324 nmdc:mga0qj67_93187_c1 3300050509 Bacteria 2422
325 nmdc:mga06r32_16561_c1 3300050510 Bacteria 6720
326 nmdc:mga0sz30_13136_c1 3300050516 Bacteria 3236
327 nmdc:mga0sz30_7173_c1 3300050516 Bacteria 4172
328 Ga0500610_0068809 3300053079 Bacteria 1846
329 Ga0500572_006143 3300053111 Bacteria 2744
330 Ga0500618_004854 3300053125 Bacteria 4198
331 Ga0500561_0003558 3300053137 Bacteria 2740
332 Ga0500568_0000035 3300053139 Bacteria 137912
333 Ga0500616_0001264 3300053153 Bacteria 25261
334 Ga0500616_0027210 3300053153 Bacteria 3159
335 Ga0500634_0000041 3300053161 Bacteria 59177
336 Ga0500636_0000374 3300053177 Bacteria 24550
337 Ga0587077_008300 3300059493 Bacteria 1543
338 Ga0587088_002953 3300059508 Bacteria 2007
339 Ga0587068_010185 3300059641 Bacteria 1397
340 Ga0587072_004634 3300059643 Bacteria 2011
341 Ga0587075_006411 3300059644 Bacteria 1444
342 Ga0587076_002969 3300059645 Bacteria 1969
343 2503202210 2503198000 Bacteria 6884444
344 2509117015 2508501123 Bacteria 6283661
345 2509140641 2508501127 Bacteria 7037543
346 2509370713 2509276018 Bacteria 6910194
347 2509390132 2509276021 Bacteria 7634384
348 2509396858 2509276022 Bacteria 6200534
349 2509447581 2509276033 Bacteria 7180565
350 2510134410 2510065019 Bacteria 6903379
351 2510317504 2510065059 Bacteria 6847884
352 2510839302 2510461069 Bacteria 5505000
353 2510895834 2510461076 Bacteria 8618824
354 2511182693 2510917028 Bacteria 6185411
355 2511195271 2510917030 Bacteria 7460662
356 2511388416 2511231027 Bacteria 5013807
357 2512930891 2512875016 Bacteria 6529530
358 2512958617 2512875024 Bacteria 7195110
359 2513567475 2513237084 Bacteria 7231967
360 2513577812 2513237085 Bacteria 7695351
361 2513598365 2513237088 Bacteria 6927906
362 2513609929 2513237090 Bacteria 7096802
363 2513632042 2513237093 Bacteria 7545552
364 2513712488 2513237103 Bacteria 7647401
365 2513868880 2513237138 Bacteria 7368160
366 2513910603 2513237144 Bacteria 7530820
367 2513928050 2513237146 Bacteria 7166346
368 2513997525 2513237159 Bacteria 6810126
369 2514017859 2513237162 Bacteria 7468464
370 2514034968 2513237164 Bacteria 7563725
371 2514418930 2513237305 Bacteria 7293571
372 2515113572 2515075009 Bacteria 7288508
373 2515635286 2515154113 Bacteria 7807172
374 2515643808 2515154114 Bacteria 7848616
375 2515654896 2515154116 Bacteria 7552979
376 2515739929 2515154134 Bacteria 7220242
377 2517037188 2516653077 Bacteria 7555578
378 2517077526 2516653085 Bacteria 7346596
379 2517096296 2517093000 Bacteria 7412387
380 2517408155 2517287029 Bacteria 6905599
381 2520381995 2519899620 Bacteria 6499161
382 2523468591 2523231067 Bacteria 5230452
383 2530646346 2529292951 Bacteria 6916614
384 2535518246 2534681796 Bacteria 7146037
385 2537873916 2537561587 Bacteria 5425293
386 2554248554 2554235003 Bacteria 5877155
387 2559295642 2558860242 Bacteria 5568029
388 2585167602 2582581283 Bacteria 6030556
389 2585205062 2582581294 Bacteria 6626667
390 2585225213 2582581298 Bacteria 7315509
391 2585230719 2582581299 Bacteria 6518058
392 2585259158 2582581304 Bacteria 5831370
393 2585265833 2582581306 Bacteria 6450535
394 2585390023 2582581865 Bacteria 6644329
395 2585395226 2582581866 Bacteria 6859583
396 2585404199 2582581867 Bacteria 7184437
397 2585524955 2585427526 Bacteria 7258840
398 2585542741 2585427528 Bacteria 6842387
399 2585547769 2585427529 Bacteria 7395659
400 2585820637 2585427590 Bacteria 6824633
401 2585841383 2585427593 Bacteria 7141551
402 2585847745 2585427594 Bacteria 6180594
403 2588516571 2588253730 Bacteria 6881675
404 2597814099 2597489875 Bacteria 7010078
405 2599421058 2599185170 Bacteria 7295545
406 2599601967 2599185210 Bacteria 5624189
407 2599722277 2599185236 Bacteria 6875203
408 2599938081 2599185301 Bacteria 6161860
409 2600373978 2600254933 Bacteria 4750527
410 2601609779 2600255279 Bacteria 5605316
411 2601746554 2600255308 Bacteria 5611129
412 2616296611 2615840624 Bacteria 6557588
413 2643811077 2643221558 Bacteria 5460675
414 2643856445 2643221568 Bacteria 5187270
415 2643920039 2643221582 Bacteria 5804683
416 2643989386 2643221595 Bacteria 6565519
417 2644002954 2643221599 Bacteria 6292121
418 2644052094 2643221607 Bacteria 6314006
419 2644152958 2643221627 Bacteria 6761570
420 2644196704 2643221634 Bacteria 6705461
421 2644204887 2643221636 Bacteria 6583769
422 2644237935 2643221643 Bacteria 5749658
423 2644299036 2643221653 Bacteria 4569637
424 2644484837 2643221686 Bacteria 6310811
425 2644500604 2643221689 Bacteria 6042950
426 2644523391 2643221693 Bacteria 5513853
427 2644657264 2643221719 Bacteria 4568197
428 2688599428 2687453392 Bacteria 6880454
429 2694632214 2693429783 Bacteria 7019804
430 2694634378 2693429784 Bacteria 7241525
431 2719182289 2718217882 Bacteria 6556348
432 2719386880 2718217927 Bacteria 6972593
433 2719666616 2718217997 Bacteria 6740740
434 2719733005 2718218009 Bacteria 6478651
435 2720493036 2718218199 Bacteria 6740745
436 2720614515 2718218232 Bacteria 6720332
437 2720621289 2718218233 Bacteria 6662049
438 2720632615 2718218235 Bacteria 6630699
439 2720776339 2718218269 Bacteria 6906114
440 2721148402 2718218363 Bacteria 6524337
441 2721159788 2718218365 Bacteria 6274507
442 2721165216 2718218366 Bacteria 6425255
443 2721400603 2718218423 Bacteria 6438183
444 2722841386 2721755514 Bacteria 6424414
445 2723027928 2721755556 Bacteria 6745503
446 2723561558 2721755684 Bacteria 6859907
447 2723568187 2721755685 Bacteria 6704835
448 2723576388 2721755686 Bacteria 7343952
449 2724039416 2721755809 Bacteria 6438790
450 2724045761 2721755810 Bacteria 6479005
451 2724090946 2721755819 Bacteria 6906405
452 2724105452 2721755822 Bacteria 6726041
453 2724111277 2721755823 Bacteria 6752556
454 2725949254 2724679232 Bacteria 7646494
455 2730108864 2728369352 Bacteria 6745171
456 2730165524 2728369365 Bacteria 6555560
457 2730299420 2728369397 Bacteria 6274511
458 2738803331 2738541293 Bacteria 7065685
459 2739033278 2738541333 Bacteria 7106503
460 2739352067 2738543031 Bacteria 5769731
461 2756675903 2756170246 Bacteria 7451806
462 2765464401 2765235802 Bacteria 5618596
463 2766066326 2765235942 Bacteria 7445910
464 2776272450 2775506902 Bacteria 6208009
465 2776284390 2775506904 Bacteria 5954060
466 2792748541 2791355123 Bacteria 8049106
467 2793283793 2791355253 Bacteria 5171699
468 2793293973 2791355256 Bacteria 6798008
469 2793314351 2791355259 Bacteria 7254731
470 2793323840 2791355260 Bacteria 6598818
471 2793329744 2791355261 Bacteria 6661293
472 2793335068 2791355262 Bacteria 6774204
473 2793342344 2791355263 Bacteria 6872478
474 2793349712 2791355264 Bacteria 6429314
475 2793355363 2791355265 Bacteria 6539969
476 2793363053 2791355266 Bacteria 7116587
477 2793369922 2791355267 Bacteria 7222458
478 2805929579 2802429605 Bacteria 6875453
479 2805936884 2802429606 Bacteria 6346811
480 2806047480 2802429633 Bacteria 7341974
481 2806055170 2802429634 Bacteria 7083200
482 2806063020 2802429635 Bacteria 7650140
483 2806069755 2802429636 Bacteria 7597525
484 2806075684 2802429637 Bacteria 7067217
485 2808987625 2808606387 Bacteria 5697198
486 2819240945 2818991272 Bacteria 4622173
487 2819559360 2818991439 Bacteria 6907412
488 2819685403 2818991461 Bacteria 7026071
489 2821125929 2821123053 Bacteria 7836056
490 2838019892 2838016132 Bacteria 6577831
491 2838023397 2838022645 Bacteria 6494267
492 2838041421 2838035591 Bacteria 7166484
493 2838045657 2838042994 Bacteria 6046894
494 2838052701 2838048938 Bacteria 6044578
495 2838064958 2838061910 Bacteria 6794874
496 2838069685 2838068647 Bacteria 6208656
497 2838665811 2838661181 Bacteria 7385261
498 2838671812 2838668709 Bacteria 6671819
499 2838675468 2838675328 Bacteria 4909118
500 2838682984 2838680041 Bacteria 6545511
501 2838686595 2838686498 Bacteria 7807632
502 2838698073 2838694306 Bacteria 6853137
503 2838704491 2838701080 Bacteria 6669771
504 2838711187 2838707686 Bacteria 6619912
505 2838714349 2838714209 Bacteria 5525906
506 2838721849 2838719591 Bacteria 5523910
507 2838725110 2838724970 Bacteria 4908691
508 2838734837 2838729681 Bacteria 7400765
509 2838737594 2838736955 Bacteria 5760694
510 2838747452 2838742623 Bacteria 7396178
511 2839994312 2839993093 Bacteria 5512535
512 2841740011 2841734538 Bacteria 6784580
513 2841842037 2841840854 Bacteria 5761912
514 2841848832 2841846520 Bacteria 5345850
515 2841854424 2841851746 Bacteria 7532261
516 2841862504 2841859092 Bacteria 5436171
517 2841867431 2841864319 Bacteria 6742987
518 2842079363 2842077413 Bacteria 6508645
519 2842115532 2842110456 Bacteria 7656360
520 2842118127 2842118031 Bacteria 7033875
521 2842125137 2842124991 Bacteria 5346824
522 2842130363 2842130223 Bacteria 4909145
523 2842141816 2842140634 Bacteria 5759631
524 2842149709 2842146304 Bacteria 5957337
525 2842154467 2842152218 Bacteria 4908957
526 2842158557 2842156927 Bacteria 6894975
527 2842168997 2842163707 Bacteria 6916235
528 2842170592 2842170452 Bacteria 5525737
529 2842178087 2842175837 Bacteria 4908771
530 2842182171 2842180545 Bacteria 6888678
531 2842187458 2842187318 Bacteria 5524014
532 2842195588 2842192696 Bacteria 6147454
533 2842198911 2842198810 Bacteria 6608673
534 2842210908 2842205361 Bacteria 6340321
535 2842211769 2842211629 Bacteria 5523832
536 2842218404 2842217011 Bacteria 7497767
537 2842226611 2842224351 Bacteria 5524473
538 2842229829 2842229732 Bacteria 7475766
539 2842240040 2842237096 Bacteria 6620661
540 2842243718 2842243621 Bacteria 7421798
541 2842254124 2842250916 Bacteria 6579627
542 2842258197 2842257432 Bacteria 7401195
543 2842268951 2842264693 Bacteria 6472963
544 2842271867 2842271015 Bacteria 7807131
545 2842284361 2842278818 Bacteria 6340002
546 2842285148 2842285085 Bacteria 6011953
547 2842293025 2842291075 Bacteria 7076806
548 2842305480 2842304105 Bacteria 7023636
549 2842314204 2842311132 Bacteria 6616990
550 2842320007 2842317721 Bacteria 6793725
551 2842347598 2842341865 Bacteria 7003929
552 2842368752 2842363717 Bacteria 6844742
553 2842373613 2842370503 Bacteria 7038661
554 2842379422 2842377471 Bacteria 7140707
555 2842384637 2842384541 Bacteria 7057858
556 2842400541 2842395702 Bacteria 6780583
557 2842402506 2842402390 Bacteria 6681310
558 2842410123 2842409023 Bacteria 6687331
559 2842416771 2842415677 Bacteria 6596907
560 2842423299 2842422224 Bacteria 6239196
561 2842433127 2842428310 Bacteria 6767288
562 2842439432 2842434925 Bacteria 6502746
563 2842446061 2842441272 Bacteria 6769273
564 2842449089 2842447887 Bacteria 6754142
565 2842467334 2842462802 Bacteria 6588055
566 2842474129 2842469257 Bacteria 6752936
567 2842493452 2842489311 Bacteria 6620893
568 2842497603 2842495871 Bacteria 6820686
569 2842519288 2842515876 Bacteria 5436280
570 2842522233 2842521101 Bacteria 6569494
571 2842875475 2842871566 Bacteria 4827117
572 2844006435 2844002411 Bacteria 7168230
573 2844014706 2844009547 Bacteria 6728125
574 2844457893 2844454524 Bacteria 7952546
575 2847672509 2847670302 Bacteria 6165597
576 2847688729 2847686936 Bacteria 6278406
577 2854685498 2854681122 Bacteria 4548679
578 2854900494 2854896431 Bacteria 5869725
579 2854917459 2854916844 Bacteria 5725939
580 2856315516 2856314179 Bacteria 6477897
581 2856325842 2856320880 Bacteria 7263508
582 2856328980 2856328259 Bacteria 6528202
583 2856340022 2856334872 Bacteria 7037011
584 2856343178 2856342000 Bacteria 7176905
585 2856353121 2856349417 Bacteria 6230045
586 2856368817 2856364286 Bacteria 6939991
587 2857350211 2857349434 Bacteria 7926032
588 2857370536 2857367948 Bacteria 6965560
589 2857516964 2857516855 Bacteria 7787325
590 2857532491 2857531043 Bacteria 6754041
591 2869165260 2869162929 Bacteria 6399702
592 2869173628 2869169390 Bacteria 6659796
593 2869236180 2869234852 Bacteria 6654993
594 2869246894 2869242130 Bacteria 6609239
595 2869252193 2869249662 Bacteria 6868783
596 2869262537 2869256925 Bacteria 6981691
597 2869268178 2869264136 Bacteria 6880765
598 2869271803 2869271264 Bacteria 6908218
599 2869278622 2869278585 Bacteria 7077053
600 2869291312 2869285874 Bacteria 6901219
601 2871433592 2871429161 Bacteria 6547891
602 2871447223 2871444079 Bacteria 6423508
603 2871454476 2871451962 Bacteria 7336357
604 2871466363 2871459585 Bacteria 6866887
605 2871473869 2871466892 Bacteria 6923287
606 2871475305 2871474448 Bacteria 6806570
607 2871482836 2871481445 Bacteria 6700002
608 2871495786 2871488783 Bacteria 6929816
609 2871502994 2871495908 Bacteria 6935695
610 2874107631 2874102143 Bacteria 6342645
611 2874112919 2874109183 Bacteria 6517025
612 2874117829 2874116593 Bacteria 6674494
613 2874126001 2874123672 Bacteria 7238285
614 2874132036 2874131515 Bacteria 6820270
615 2874145208 2874139085 Bacteria 7021506
616 2874153193 2874146452 Bacteria 7533118
617 2874160458 2874155637 Bacteria 6724144
618 2874167280 2874162495 Bacteria 6174670
619 2874176198 2874168670 Bacteria 8062617
620 2876365437 2876363079 Bacteria 6544991
621 2876376243 2876369609 Bacteria 6807521
622 2876383247 2876377896 Bacteria 6565995
623 2876386083 2876386047 Bacteria 6698674
624 2876394967 2876392853 Bacteria 6660880
625 2876405859 2876399893 Bacteria 6927900
626 2876410917 2876406927 Bacteria 6191900
627 2876419484 2876413966 Bacteria 6831344
628 2876426512 2876420981 Bacteria 6687741
629 2878037189 2878035449 Bacteria 6555736
630 2878733476 2878730984 Bacteria 6380721
631 2878743405 2878738818 Bacteria 7136951
632 2878751203 2878745973 Bacteria 6867388
633 2878753415 2878753008 Bacteria 6922523
634 2878766883 2878760144 Bacteria 6823465
635 2878774081 2878767105 Bacteria 6898628
636 2878776606 2878774303 Bacteria 6108671
637 2878789767 2878788777 Bacteria 6567085
638 2881152869 2881147464 Bacteria 7779814
639 2881156362 2881155292 Bacteria 6461656
640 2881168306 2881161766 Bacteria 7127907
641 2881847752 2881845957 Bacteria 6611900
642 2881857744 2881853255 Bacteria 6698367
643 2881863393 2881861095 Bacteria 7128710
644 2882637882 2882632389 Bacteria 8154593
645 2882917219 2882912400 Bacteria 6801539
646 2883354945 2883354860 Bacteria 5865246
647 2885310302 2885305155 Bacteria 7348390
648 2885317114 2885312484 Bacteria 6415165
649 2885319191 2885318864 Bacteria 6729568
650 2885330182 2885326080 Bacteria 7134805
651 2885339765 2885334103 Bacteria 7216818
652 2885346016 2885342637 Bacteria 7011821
653 2885350757 2885350715 Bacteria 6787678
654 2888340138 2888337043 Bacteria 6629336
655 2888347463 2888343758 Bacteria 6611049
656 2889011454 2889010040 Bacteria 6749192
657 2889016816 2889016732 Bacteria 6700763
658 2894819691 2894817345 Bacteria 4892941
659 2899795814 2899792073 Bacteria 4926588
660 2899806677 2899803654 Bacteria 5577784
661 2899847275 2899845264 Bacteria 5672268
662 2903455603 2903448605 Bacteria 7357801
663 2903495270 2903492973 Bacteria 13473544
664 2903501701 2903492973 Bacteria 13473544
665 2903522793 2903521522 Bacteria 6525694
666 2903532983 2903528002 Bacteria 6586099
667 2903548183 2903540706 Bacteria 7062119
668 2904579012 2904578770 Bacteria 5302906
669 2904661598 2904659560 Bacteria 6685615
670 2906313144 2906308376 Bacteria 6841989
671 2906325855 2906321335 Bacteria 6579571
672 2906331889 2906328253 Bacteria 6585166
673 2906364571 2906363423 Bacteria 6856682
674 2906370799 2906370794 Bacteria 6881062
675 2906378445 2906378014 Bacteria 6911440
676 2906390334 2906386501 Bacteria 5977019
677 2906396984 2906393657 Bacteria 6790866
678 2906403002 2906401398 Bacteria 6693206
679 2906412640 2906408224 Bacteria 6162342
680 2906415653 2906414383 Bacteria 6580790
681 2909046295 2909042592 Bacteria 6499737
682 2917556172 2917554339 Bacteria 4987857
683 2919105635 2919100787 Bacteria 7710546
684 2919114380 2919114240 Bacteria 5700270
685 2919122161 2919119836 Bacteria 5208557
686 2919169684 2919166419 Bacteria 4952238
687 2922152787 2922151315 Bacteria 6902399
688 2922163036 2922158528 Bacteria 6573167
689 2922177109 2922172374 Bacteria 6167644
690 2922183055 2922178524 Bacteria 6025201
691 2922188397 2922185730 Bacteria 7113964
692 2923561417 2923556063 Bacteria 6793593
693 2924723992 2924718760 Bacteria 6331356
694 2924732082 2924726620 Bacteria 6271473
695 2924736253 2924733363 Bacteria 7574837
696 2924746258 2924741084 Bacteria 6661321
697 2924749734 2924748358 Bacteria 6154725
698 2924759687 2924754689 Bacteria 6774424
699 2924768985 2924762789 Bacteria 6561353
700 2924781217 2924776078 Bacteria 7492003
701 2924789670 2924784321 Bacteria 7416538
702 2926755400 2926754445 Bacteria 5964435
703 2926762510 2926760298 Bacteria 5505990
704 2928525928 2928521798 Bacteria 4960112
705 2933009112 2933006813 Bacteria 4912075
706 2933014541 2933011516 Bacteria 5439334
707 2933023705 2933016740 Bacteria 6355406
708 2933571287 2933570622 Bacteria 7023390
709 2933591947 2933586486 Bacteria 7667493
710 2933596289 2933594066 Bacteria 5594265
711 2933600492 2933599457 Bacteria 5858799
712 2935896544 2935894831 Bacteria 6620579
713 2935901439 2935901341 Bacteria 7341747
714 2936371584 2936367885 Bacteria 7324495
715 2936376957 2936375103 Bacteria 6652732
716 2936383457 2936381700 Bacteria 7006523
717 2937820705 2937813078 Bacteria 7783518
718 2937827305 2937822353 Bacteria 7290551
719 2937837766 2937836603 Bacteria 6811263
720 2937849138 2937848649 Bacteria 6983481
721 2937866847 2937861824 Bacteria 6660327
722 2937876723 2937868953 Bacteria 6639878
723 2937878978 2937877337 Bacteria 7246526
724 2937895565 2937891427 Bacteria 6357007
725 2937975276 2937972304 Bacteria 7532020
726 2937983688 2937980651 Bacteria 6517427
727 2938002008 2937994558 Bacteria 7036190
728 2938017388 2938014810 Bacteria 6700592
729 2952254673 2952252522 Bacteria 4171745
730 2954011985 2954011201 Bacteria 4762601
731 2958034738 2958034702 Bacteria 6989922
732 2958043134 2958041894 Bacteria 13082850
733 2958066986 2958064165 Bacteria 7158582
734 2958077505 2958071322 Bacteria 6815895
735 2958086152 2958084443 Bacteria 7312792
736 2958100177 2958092219 Bacteria 6861151
737 2958103057 2958100919 Bacteria 6800575
738 2958109471 2958108152 Bacteria 6681128
739 2958121497 2958115193 Bacteria 6923548
740 2958123713 2958122699 Bacteria 7280457
741 2958135712 2958130278 Bacteria 6897202
742 2958141785 2958137437 Bacteria 6050276
743 2958145589 2958144490 Bacteria 6677056
744 2958160171 2958158011 Bacteria 6058449
745 2958172062 2958165035 Bacteria 6906348
746 2958174795 2958172287 Bacteria 6716688
747 2958185203 2958179912 Bacteria 6874908
748 2961083470 2961077736 Bacteria 7079850
749 2961116751 2961114664 Bacteria 6680456
750 2961132796 2961127735 Bacteria 7196641
751 2961142698 2961136820 Bacteria 6775228
752 2961170509 2961163497 Bacteria 6901077
753 2961177859 2961170736 Bacteria 7072258
754 2963648334 2963644680 Bacteria 6530403
755 2965025256 2965018300 Bacteria 6883036
756 2965029529 2965025482 Bacteria 6532201
757 2965037242 2965032056 Bacteria 6887443
758 2965049236 2965047637 Bacteria 6623551
759 2965065776 2965062239 Bacteria 7412989
760 2965095794 2965089291 Bacteria 6866420
761 2965103063 2965102966 Bacteria 6800987
762 2965111925 2965110997 Bacteria 6693150
763 2965120339 2965119406 Bacteria 6956431
764 2968003126 2967996073 Bacteria 6787468
765 2968003952 2968003550 Bacteria 6929263
766 2968017854 2968016561 Bacteria 7022047
767 2968084847 2968083720 Bacteria 7351627
768 2968095317 2968091066 Bacteria 6052692
769 2968103125 2968097103 Bacteria 6107094
770 2968112658 2968110612 Bacteria 6814636
771 2968123108 2968117919 Bacteria 6536078
772 2968128565 2968128360 Bacteria 6270294
773 2968143477 2968138860 Bacteria 6605449
774 2968178895 2968171901 Bacteria 6894245
775 2970471971 2970469710 Bacteria 6969209
776 2970495817 2970489779 Bacteria 6517260
777 2970510535 2970503327 Bacteria 7099517
778 2970512667 2970510686 Bacteria 7006402
779 2970531709 2970524798 Bacteria 6840927
780 2970535851 2970532167 Bacteria 6553173
781 2970542137 2970540015 Bacteria 6977556
782 2970550033 2970547951 Bacteria 6931819
783 2970561739 2970554993 Bacteria 6814252
784 2970593218 2970593180 Bacteria 7073582
785 2970622221 2970619444 Bacteria 6986144
786 2970629981 2970627176 Bacteria 6680862
787 2977822645 2977821940 Bacteria 6906439
788 2977849003 2977843712 Bacteria 6753583
789 2977858097 2977851361 Bacteria 6694324
790 2977861632 2977858184 Bacteria 6215359
791 2977872510 2977864932 Bacteria 7534097
792 2977873524 2977872689 Bacteria 7270173
793 2977912191 2977907340 Bacteria 6577984
794 2977917921 2977915119 Bacteria 6829656
795 2977923083 2977922695 Bacteria 6956781
796 2977941402 2977935797 Bacteria 6252826
797 2977948251 2977942078 Bacteria 7570577
798 2977951391 2977950692 Bacteria 6893264
799 2977962893 2977957713 Bacteria 6877875
800 2977978307 2977971508 Bacteria 7472917
801 2977991873 2977986579 Bacteria 6581278
802 2978972048 2978969890 Bacteria 5400756
803 2979092222 2979089926 Bacteria 5670289
804 2979100389 2979095461 Bacteria 5669583
805 2979104210 2979100975 Bacteria 5423623
806 2979713687 2979710463 Bacteria 6785254
807 2979747646 2979742915 Bacteria 7301278
808 2979768056 2979764755 Bacteria 6610066
809 2979784883 2979779861 Bacteria 6219781
810 2979795491 2979793036 Bacteria 6808957
811 2979815409 2979808191 Bacteria 7179355
812 2984511211 2984509177 Bacteria 5274802
813 2984522427 2984518228 Bacteria 5277463
814 2984541729 2984537506 Bacteria 5277481
815 2984590331 2984587000 Bacteria 5263363
816 2984604087 2984601300 Bacteria 5455244
817 2987637399 2987636660 Bacteria 8088555
818 2987648977 2987645492 Bacteria 6117018
819 2987656177 2987652177 Bacteria 6969023
820 2987666749 2987659509 Bacteria 6966464
821 2987670663 2987666974 Bacteria 6509233
822 2987676200 2987673487 Bacteria 6884027
823 2989779609 2989776772 Bacteria 4843317
824 2995394128 2995392953 Bacteria 4539380
825 2996314773 2996310559 Bacteria 6357320
826 2996345401 2996341866 Bacteria 6643098
827 2996350904 2996348954 Bacteria 7239054
828 2996392562 2996386984 Bacteria 6978667
829 2996892572 2996887358 Bacteria 5795980
830 2996898095 2996893221 Bacteria 5823108
831 3000138493 3000135777 Bacteria 6891109
832 3002142719 3002141150 Bacteria 5254435
833 3004169584 3004167301 Bacteria 8330599
834 3004195752 3004188549 Bacteria 6952365
835 3004201662 3004195979 Bacteria 6776956
836 3004206204 3004203850 Bacteria 7307914
837 3004211687 3004211236 Bacteria 7417683
838 3004218934 3004218560 Bacteria 7421728
839 3004238897 3004232784 Bacteria 6662140
840 3004255675 3004248173 Bacteria 6563236
841 3004275197 3004268573 Bacteria 7043476
842 3004277602 3004275668 Bacteria 7114440
843 3004289859 3004289098 Bacteria 6135450
844 3004341006 3004334049 Bacteria 8449246
845 3005416354 3005409236 Bacteria 7188837
846 3005448875 3005445848 Bacteria 6906074
847 3005455093 3005452660 Bacteria 5889319
848 637073937 637000159 Bacteria 7596297
849 639649616 639633055 Bacteria 7751309
850 649873932 649633066 Bacteria 6690028
851 650740852 650716007 Bacteria 5573770
852 8001525921 8001522603 Bacteria 4726425
853 8002745794 8002745576 Bacteria 4840272
854 8003571927 8003570095 Bacteria 5747666
855 8004307156 8004300914 Bacteria 6132239
856 8004313111 8004312739 Bacteria 7444653
857 8004364480 8004361976 Bacteria 6858373
858 8004374987 8004374579 Bacteria 6898112
859 8004394132 8004387939 Bacteria 7049250
860 8004402560 8004395343 Bacteria 6620908
861 8004449872 8004445564 Bacteria 6322258
862 8004634078 8004633249 Bacteria 6723080
863 8004646670 8004640170 Bacteria 6723001
864 8004696343 8004695233 Bacteria 6731676
865 8004713230 8004703790 Bacteria 8006957
866 8004719401 8004714634 Bacteria 6776161
867 8004729288 8004727605 Bacteria 6643904
868 8005249778 8005246636 Bacteria 4933972
869 8005264801 8005258706 Bacteria 6184835
870 8005281692 8005275841 Bacteria 6929066
871 8005284349 8005282627 Bacteria 6675747
872 8005289601 8005289223 Bacteria 6634003
873 8005303604 8005301065 Bacteria 6614431
874 8005314115 8005307578 Bacteria 7395396
875 8005327099 8005321885 Bacteria 5795980
876 8005382643 8005376324 Bacteria 6590079
877 8005384605 8005382845 Bacteria 6732062
878 8005395634 8005395548 Bacteria 6806915
879 8005433871 8005430974 Bacteria 6689030
880 8005464260 8005460587 Bacteria 7157962
881 8005501365 8005497431 Bacteria 6477605
882 8005549136 8005542996 Bacteria 7077758
883 8005561674 8005556819 Bacteria 6908598
884 8005568452 8005563573 Bacteria 7153261
885 8005573011 8005570704 Bacteria 6957481
886 8005622727 8005619151 Bacteria 7030230
887 8005630242 8005626139 Bacteria 6534237
888 8005672784 8005668836 Bacteria 6953162
889 8005691617 8005688590 Bacteria 6610080
890 8005696753 8005695170 Bacteria 6912330
891 8018127613 8018127388 Bacteria 7351159
892 8018154067 8018150411 Bacteria 5549903
893 8018163306 8018163183 Bacteria 7277977
894 8018178996 8018176218 Bacteria 6896178
895 8023682714 8023680758 Bacteria 7729763
896 8024486070 8024479707 Bacteria 6954785
897 8024488468 8024486573 Bacteria 6540512
898 8024501147 8024501048 Bacteria 6427847
899 8054005377 8054002106 Bacteria 7987183
900 8054463266 8054460903 Bacteria 4872905
901 8055621525 8055617313 Bacteria 7548464
902 8056377057 8056375014 Bacteria 7006639
903 8056387381 8056382006 Bacteria 6408074
904 8057881883 8057874678 Bacteria 7494653
905 Ga0105238_10197418
906 JGI24740J21852_10014562
907 JGI24739J22299_10014864
908 JGI25156J39149_1005061
909 JGI25158J39367_1000041
910 JGI25157J39369_1001294
911 JGI25150J39212_1000091
912 JGI25159J45721_1000319
913 JGI25151J46595_10000027
914 JGI25151J46595_10000737
915 JGI25151J46595_10026094
916 JGI25406J46586_10003935
917 JGI25153J46596_10002597
918 JGI25160J50197_1010867
919 JGI25161J50226_1000490
920 JGI25161J50226_1006269
921 Ga0055542_1000775
922 Ga0055526_1002973
923 Ga0055526_1014194
924 Ga0055526_1020962
925 Ga0055524_1001190
926 Ga0055524_1003326
927 Ga0055524_1011470
928 Ga0055524_1015026
929 Ga0055528_1001127
930 Ga0055528_1001342
931 Ga0055528_1020020
932 Ga0055540_1000483
933 Ga0055540_1011537
934 Ga0055540_1015478
935 Ga0055543_1000108
936 Ga0055543_1000220
937 Ga0065165_1001643
938 Ga0065165_1011374
939 Ga0065165_1018735
940 Ga0070658_10040058
941 Ga0070670_100000279
942 Ga0068869_100037893
943 Ga0070660_100058872
944 Ga0070668_100098147
945 Ga0070668_100204641
946 Ga0070669_100210130
947 Ga0070671_100011606
948 Ga0070659_100124108
949 Ga0070701_10003680
950 Ga0070705_100000010
951 Ga0070694_100000843
952 Ga0070663_100029103
953 Ga0070663_100146862
954 Ga0070662_100063675
955 Ga0070681_10081176
956 Ga0070706_100032893
957 Ga0070706_100086383
958 Ga0070707_100008667
959 Ga0070699_100001267
960 Ga0070679_100298614
961 Ga0068853_100004973
962 Ga0068853_100024886
963 Ga0070695_100001386
964 Ga0070696_100000088
965 Ga0070665_100006064
966 Ga0070665_100010771
967 Ga0070665_100073491
968 Ga0070704_100008846
969 Ga0068855_100347384
970 Ga0068857_100013328
971 Ga0068852_100021910
972 Ga0068859_100034899
973 Ga0068861_100187167
974 Ga0068863_100086016
975 Ga0068862_100000484
976 Ga0081455_10051537
977 Ga0081539_10003789
978 Ga0075365_10002331
979 Ga0075365_10003140
980 Ga0075365_10077627
981 Ga0075365_10079034
982 Ga0075363_100026546
983 Ga0075364_10000526
984 Ga0075364_10002812
985 Ga0075364_10073163
986 Ga0075362_10000338
987 Ga0075362_10012056
988 Ga0075367_10003998
989 Ga0075367_10006008
990 Ga0075367_10037562
991 Ga0075367_10129276
992 Ga0075369_10014564
993 Ga0075369_10017700
994 Ga0075366_10008187
995 Ga0075370_10000834
996 Ga0075370_10034761
997 Ga0075430_100000066
998 Ga0075430_100005392
999 Ga0075431_100032995
1000 Ga0097620_100034899
1001 Ga0079104_1000015
1002 Ga0099826_10000404
1003 Ga0105250_10008178
1004 Ga0105240_10227199
1005 Ga0105240_10235679
1006 Ga0105242_10113135
1007 Ga0105237_10000768
1008 Ga0105237_10178441
1009 Ga0105238_10057029
1010 Ga0105238_10061076
1011 Ga0105249_10002652
1012 Ga0105249_10157942
1013 Ga0123341_1000018
1014 Ga0123342_1014715
1015 Ga0105239_10000846
1016 Ga0157371_10000165
1017 Ga0157370_10000295
1018 Ga0157370_10125303
1019 Ga0213873_10001551
1020 Ga0213876_10000302
1021 Ga0213876_10000852
1022 Ga0209436_100098
1023 Ga0209563_103818
1024 Ga0207427_104599
1025 Ga0207425_1000043
1026 Ga0207425_1000495
1027 Ga0209026_1000002
1028 Ga0209148_1000072
1029 Ga0209148_1000409
1030 Ga0209759_1000062
1031 Ga0209129_1000072
1032 Ga0209129_1000702
1033 Ga0209129_1001401
1034 Ga0209129_1005279
1035 Ga0209233_1000480
1036 Ga0209565_1010788
1037 Ga0209455_1000133
1038 Ga0209455_1001295
1039 Ga0209673_1000125
1040 Ga0209673_1000256
1041 Ga0209673_1001106
1042 Ga0209673_1002335
1043 Ga0209673_1010784
1044 Ga0209130_1000023
1045 Ga0209675_1018186
1046 Ga0209676_1013842
1047 Ga0209676_1031197
1048 Ga0209025_1000120
1049 Ga0209025_1000154
1050 Ga0209025_1000537
1051 Ga0209025_1001251
1052 Ga0209025_1024316
1053 Ga0209564_1000259
1054 Ga0209564_1000393
1055 Ga0209564_1000778
1056 Ga0209564_1002080
1057 Ga0209758_1000111
1058 Ga0209758_1000666
1059 Ga0209758_1001689
1060 Ga0209758_1001847
1061 Ga0209758_1001921
1062 Ga0209758_1003699
1063 Ga0209758_1011532
1064 Ga0209758_1011608
1065 Ga0209050_1010067
1066 Ga0209256_1000283
1067 Ga0209256_1001708
1068 Ga0209256_1003508
1069 Ga0209256_1004429
1070 Ga0209256_1014154
1071 Ga0207426_1000087
1072 Ga0207426_1000386
1073 Ga0207426_1001078
1074 Ga0209051_1000434
1075 Ga0209051_1004281
1076 Ga0209051_1004651
1077 Ga0209051_1005167
1078 Ga0207653_10000769
1079 Ga0207705_10087709
1080 Ga0207684_10089819
1081 Ga0207707_10076643
1082 Ga0207695_10191311
1083 Ga0207671_10000361
1084 Ga0207671_10022024
1085 Ga0207671_10055832
1086 Ga0207671_10067844
1087 Ga0207660_10192387
1088 Ga0207657_10052118
1089 Ga0207657_10064910
1090 Ga0207652_10117003
1091 Ga0207652_10151830
1092 Ga0207646_10102996
1093 Ga0207694_10084407
1094 Ga0207644_10178420
1095 Ga0207689_10061330
1096 Ga0207667_10055496
1097 Ga0207667_10105914
1098 Ga0207712_10002216
1099 Ga0207639_10021714
1100 Ga0207678_10012628
1101 Ga0207678_10128737
1102 Ga0207708_10042496
1103 Ga0207674_10042394
1104 Ga0207675_100059175
1105 Ga0207698_10066661
1106 Ga0209281_1000068
1107 Ga0209371_1000022
1108 Ga0209371_1001584
1109 Ga0209282_1002300
1110 Ga0209282_1011356
1111 Ga0209813_10006253
1112 Ga0268266_10000086
1113 Ga0268266_10003387
1114 Ga0268266_10047891
1115 Ga0268266_10075231
1116 Ga0268266_10297873
1117 Ga0268265_10002000
1118 Ga0265319_1000212
1119 Ga0265318_10001820
1120 Ga0307515_10000017
1121 Ga0307515_10001155
1122 Ga0307515_10009128
1123 Ga0265338_10145826
1124 Ga0268256_1000019
1125 Ga0268256_1001866
1126 Ga0265325_10001826
1127 Ga0265325_10010189
1128 Ga0265325_10024758
1129 Ga0265339_10000228
1130 Ga0265327_10000986
1131 Ga0265316_10000951
1132 Ga0307513_10000852
1133 Ga0307513_10024615
1134 Ga0265313_10000203
1135 Ga0265313_10003693
1136 Ga0265342_10000290
1137 Ga0265342_10055882
1138 Ga0316577_10001499
1139 Ga0307414_10052824
1140 Ga0316580_10026732
1141 Ga0316593_10006338
1142 Ga0316593_10010619
1143 Ga0316588_1006292
1144 Ga0316596_1003478
1145 Ga0316574_0008927
1146 Ga0316582_0005305
1147 Ga0316582_0029195
1148 Ga0316584_0003224
1149 Ga0316584_0026509
1150 Ga0395899_0009756
1151 Ga0395900_0107113
1152 Ga0395900_0219433
1153 Ga0395898_0197673
1154 Ga0395905_0000314
1155 Ga0395905_0020280
1156 Ga0395905_0027398
1157 Ga0395905_0041557
1158 Ga0395901_0106415
1159 Ga0395901_0135291
1160 Ga0400490_07209
1161 Ga0400490_25275
1162 Ga0400490_59697
1163 Ga0400487_12220
1164 Ga0436365_0495756
1165 Ga0436365_0981941
1166 Ga0436360_0590348
1167 Ga0436361_0162094
1168 Ga0436361_0880457
1169 Ga0436363_0959743
1170 Ga0436362_0733671
1171 Ga0436362_1154506
1172 Ga0451835_0558767
1173 Ga0451847_0443818
1174 Ga0451851_0406472
1175 Ga0451853_0415754
1176 Ga0466960_0040172
1177 Ga0451576_0000262
1178 Ga0495638_0121515
1179 Ga0495597_0029702
1180 Ga0495625_0059199
1181 Ga0495625_0062401
1182 Ga0495600_0027937
1183 Ga0495660_0089748
1184 Ga0495672_0049929
1185 Ga0496102_0011790
1186 Ga0496104_0073732
1187 Ga0496104_0127653
1188 Ga0496106_0013486
1189 Ga0496116_0000105
1190 Ga0496117_0000002
1191 Ga0496118_0000736
1192 Ga0496118_0025305
1193 Ga0496120_0000534
1194 Ga0496121_0003279
1195 Ga0496122_0000004
1196 Ga0496122_0000042
1197 Ga0496123_0000007
1198 Ga0496123_0000030
1199 Ga0496125_0094962
1200 Ga0496125_0124069
1201 Ga0496126_0002286
1202 Ga0496126_0270069
1203 Ga0501031_0002222
1204 Ga0501033_0042981
1205 Ga0501034_0021138
1206 Ga0501038_0108801
1207 Ga0501047_0295055
1208 Ga0501070_0019982
1209 Ga0501083_0125378
1210 Ga0501044_0055712
1211 Ga0501044_0067124
1212 Ga0501044_0083916
1213 nmdc:mga03683_19386_c1
1214 nmdc:mga03683_9237_c1
1215 nmdc:mga03n38_75982_c1
1216 nmdc:mga00v17_35321_c1
1217 nmdc:mga00v17_35_c1
1218 nmdc:mga00v17_6991_c1
1219 nmdc:mga00v17_7_c1
1220 nmdc:mga0yw44_2996_c1
1221 nmdc:mga0yw44_4395_c1
1222 nmdc:mga0yw44_46333_c1
1223 nmdc:mga0yw44_5189_c1
1224 nmdc:mga06z11_103455_c1
1225 nmdc:mga06z11_13756_c1
1226 nmdc:mga07m45_23938_c1
1227 nmdc:mga0qj67_221_c1
1228 nmdc:mga0qj67_93187_c1
1229 nmdc:mga06r32_16561_c1
1230 nmdc:mga0sz30_13136_c1
1231 nmdc:mga0sz30_7173_c1
1232 Ga0500610_0068809
1233 Ga0500572_006143
1234 Ga0500618_004854
1235 Ga0500561_0003558
1236 Ga0500568_0000035
1237 Ga0500616_0001264
1238 Ga0500616_0027210
1239 Ga0500634_0000041
1240 Ga0500636_0000374
1241 Ga0587077_008300
1242 Ga0587088_002953
1243 Ga0587068_010185
1244 Ga0587072_004634
1245 Ga0587075_006411
1246 Ga0587076_002969
1247 2503202210
1248 2509117015
1249 2509140641
1250 2509370713
1251 2509390132
1252 2509396858
1253 2509447581
1254 2510134410
1255 2510317504
1256 2510839302
1257 2510895834
1258 2511182693
1259 2511195271
1260 2511388416
1261 2512930891
1262 2512958617
1263 2513567475
1264 2513577812
1265 2513598365
1266 2513609929
1267 2513632042
1268 2513712488
1269 2513868880
1270 2513910603
1271 2513928050
1272 2513997525
1273 2514017859
1274 2514034968
1275 2514418930
1276 2515113572
1277 2515635286
1278 2515643808
1279 2515654896
1280 2515739929
1281 2517037188
1282 2517077526
1283 2517096296
1284 2517408155
1285 2520381995
1286 2523468591
1287 2530646346
1288 2535518246
1289 2537873916
1290 2554248554
1291 2559295642
1292 2585167602
1293 2585205062
1294 2585225213
1295 2585230719
1296 2585259158
1297 2585265833
1298 2585390023
1299 2585395226
1300 2585404199
1301 2585524955
1302 2585542741
1303 2585547769
1304 2585820637
1305 2585841383
1306 2585847745
1307 2588516571
1308 2597814099
1309 2599421058
1310 2599601967
1311 2599722277
1312 2599938081
1313 2600373978
1314 2601609779
1315 2601746554
1316 2616296611
1317 2643811077
1318 2643856445
1319 2643920039
1320 2643989386
1321 2644002954
1322 2644052094
1323 2644152958
1324 2644196704
1325 2644204887
1326 2644237935
1327 2644299036
1328 2644484837
1329 2644500604
1330 2644523391
1331 2644657264
1332 2688599428
1333 2694632214
1334 2694634378
1335 2719182289
1336 2719386880
1337 2719666616
1338 2719733005
1339 2720493036
1340 2720614515
1341 2720621289
1342 2720632615
1343 2720776339
1344 2721148402
1345 2721159788
1346 2721165216
1347 2721400603
1348 2722841386
1349 2723027928
1350 2723561558
1351 2723568187
1352 2723576388
1353 2724039416
1354 2724045761
1355 2724090946
1356 2724105452
1357 2724111277
1358 2725949254
1359 2730108864
1360 2730165524
1361 2730299420
1362 2738803331
1363 2739033278
1364 2739352067
1365 2756675903
1366 2765464401
1367 2766066326
1368 2776272450
1369 2776284390
1370 2792748541
1371 2793283793
1372 2793293973
1373 2793314351
1374 2793323840
1375 2793329744
1376 2793335068
1377 2793342344
1378 2793349712
1379 2793355363
1380 2793363053
1381 2793369922
1382 2805929579
1383 2805936884
1384 2806047480
1385 2806055170
1386 2806063020
1387 2806069755
1388 2806075684
1389 2808987625
1390 2819240945
1391 2819559360
1392 2819685403
1393 2821125929
1394 2838019892
1395 2838023397
1396 2838041421
1397 2838045657
1398 2838052701
1399 2838064958
1400 2838069685
1401 2838665811
1402 2838671812
1403 2838675468
1404 2838682984
1405 2838686595
1406 2838698073
1407 2838704491
1408 2838711187
1409 2838714349
1410 2838721849
1411 2838725110
1412 2838734837
1413 2838737594
1414 2838747452
1415 2839994312
1416 2841740011
1417 2841842037
1418 2841848832
1419 2841854424
1420 2841862504
1421 2841867431
1422 2842079363
1423 2842115532
1424 2842118127
1425 2842125137
1426 2842130363
1427 2842141816
1428 2842149709
1429 2842154467
1430 2842158557
1431 2842168997
1432 2842170592
1433 2842178087
1434 2842182171
1435 2842187458
1436 2842195588
1437 2842198911
1438 2842210908
1439 2842211769
1440 2842218404
1441 2842226611
1442 2842229829
1443 2842240040
1444 2842243718
1445 2842254124
1446 2842258197
1447 2842268951
1448 2842271867
1449 2842284361
1450 2842285148
1451 2842293025
1452 2842305480
1453 2842314204
1454 2842320007
1455 2842347598
1456 2842368752
1457 2842373613
1458 2842379422
1459 2842384637
1460 2842400541
1461 2842402506
1462 2842410123
1463 2842416771
1464 2842423299
1465 2842433127
1466 2842439432
1467 2842446061
1468 2842449089
1469 2842467334
1470 2842474129
1471 2842493452
1472 2842497603
1473 2842519288
1474 2842522233
1475 2842875475
1476 2844006435
1477 2844014706
1478 2844457893
1479 2847672509
1480 2847688729
1481 2854685498
1482 2854900494
1483 2854917459
1484 2856315516
1485 2856325842
1486 2856328980
1487 2856340022
1488 2856343178
1489 2856353121
1490 2856368817
1491 2857350211
1492 2857370536
1493 2857516964
1494 2857532491
1495 2869165260
1496 2869173628
1497 2869236180
1498 2869246894
1499 2869252193
1500 2869262537
1501 2869268178
1502 2869271803
1503 2869278622
1504 2869291312
1505 2871433592
1506 2871447223
1507 2871454476
1508 2871466363
1509 2871473869
1510 2871475305
1511 2871482836
1512 2871495786
1513 2871502994
1514 2874107631
1515 2874112919
1516 2874117829
1517 2874126001
1518 2874132036
1519 2874145208
1520 2874153193
1521 2874160458
1522 2874167280
1523 2874176198
1524 2876365437
1525 2876376243
1526 2876383247
1527 2876386083
1528 2876394967
1529 2876405859
1530 2876410917
1531 2876419484
1532 2876426512
1533 2878037189
1534 2878733476
1535 2878743405
1536 2878751203
1537 2878753415
1538 2878766883
1539 2878774081
1540 2878776606
1541 2878789767
1542 2881152869
1543 2881156362
1544 2881168306
1545 2881847752
1546 2881857744
1547 2881863393
1548 2882637882
1549 2882917219
1550 2883354945
1551 2885310302
1552 2885317114
1553 2885319191
1554 2885330182
1555 2885339765
1556 2885346016
1557 2885350757
1558 2888340138
1559 2888347463
1560 2889011454
1561 2889016816
1562 2894819691
1563 2899795814
1564 2899806677
1565 2899847275
1566 2903455603
1567 2903495270
1568 2903501701
1569 2903522793
1570 2903532983
1571 2903548183
1572 2904579012
1573 2904661598
1574 2906313144
1575 2906325855
1576 2906331889
1577 2906364571
1578 2906370799
1579 2906378445
1580 2906390334
1581 2906396984
1582 2906403002
1583 2906412640
1584 2906415653
1585 2909046295
1586 2917556172
1587 2919105635
1588 2919114380
1589 2919122161
1590 2919169684
1591 2922152787
1592 2922163036
1593 2922177109
1594 2922183055
1595 2922188397
1596 2923561417
1597 2924723992
1598 2924732082
1599 2924736253
1600 2924746258
1601 2924749734
1602 2924759687
1603 2924768985
1604 2924781217
1605 2924789670
1606 2926755400
1607 2926762510
1608 2928525928
1609 2933009112
1610 2933014541
1611 2933023705
1612 2933571287
1613 2933591947
1614 2933596289
1615 2933600492
1616 2935896544
1617 2935901439
1618 2936371584
1619 2936376957
1620 2936383457
1621 2937820705
1622 2937827305
1623 2937837766
1624 2937849138
1625 2937866847
1626 2937876723
1627 2937878978
1628 2937895565
1629 2937975276
1630 2937983688
1631 2938002008
1632 2938017388
1633 2952254673
1634 2954011985
1635 2958034738
1636 2958043134
1637 2958066986
1638 2958077505
1639 2958086152
1640 2958100177
1641 2958103057
1642 2958109471
1643 2958121497
1644 2958123713
1645 2958135712
1646 2958141785
1647 2958145589
1648 2958160171
1649 2958172062
1650 2958174795
1651 2958185203
1652 2961083470
1653 2961116751
1654 2961132796
1655 2961142698
1656 2961170509
1657 2961177859
1658 2963648334
1659 2965025256
1660 2965029529
1661 2965037242
1662 2965049236
1663 2965065776
1664 2965095794
1665 2965103063
1666 2965111925
1667 2965120339
1668 2968003126
1669 2968003952
1670 2968017854
1671 2968084847
1672 2968095317
1673 2968103125
1674 2968112658
1675 2968123108
1676 2968128565
1677 2968143477
1678 2968178895
1679 2970471971
1680 2970495817
1681 2970510535
1682 2970512667
1683 2970531709
1684 2970535851
1685 2970542137
1686 2970550033
1687 2970561739
1688 2970593218
1689 2970622221
1690 2970629981
1691 2977822645
1692 2977849003
1693 2977858097
1694 2977861632
1695 2977872510
1696 2977873524
1697 2977912191
1698 2977917921
1699 2977923083
1700 2977941402
1701 2977948251
1702 2977951391
1703 2977962893
1704 2977978307
1705 2977991873
1706 2978972048
1707 2979092222
1708 2979100389
1709 2979104210
1710 2979713687
1711 2979747646
1712 2979768056
1713 2979784883
1714 2979795491
1715 2979815409
1716 2984511211
1717 2984522427
1718 2984541729
1719 2984590331
1720 2984604087
1721 2987637399
1722 2987648977
1723 2987656177
1724 2987666749
1725 2987670663
1726 2987676200
1727 2989779609
1728 2995394128
1729 2996314773
1730 2996345401
1731 2996350904
1732 2996392562
1733 2996892572
1734 2996898095
1735 3000138493
1736 3002142719
1737 3004169584
1738 3004195752
1739 3004201662
1740 3004206204
1741 3004211687
1742 3004218934
1743 3004238897
1744 3004255675
1745 3004275197
1746 3004277602
1747 3004289859
1748 3004341006
1749 3005416354
1750 3005448875
1751 3005455093
1752 637073937
1753 639649616
1754 649873932
1755 650740852
1756 8001525921
1757 8002745794
1758 8003571927
1759 8004307156
1760 8004313111
1761 8004364480
1762 8004374987
1763 8004394132
1764 8004402560
1765 8004449872
1766 8004634078
1767 8004646670
1768 8004696343
1769 8004713230
1770 8004719401
1771 8004729288
1772 8005249778
1773 8005264801
1774 8005281692
1775 8005284349
1776 8005289601
1777 8005303604
1778 8005314115
1779 8005327099
1780 8005382643
1781 8005384605
1782 8005395634
1783 8005433871
1784 8005464260
1785 8005501365
1786 8005549136
1787 8005561674
1788 8005568452
1789 8005573011
1790 8005622727
1791 8005630242
1792 8005672784
1793 8005691617
1794 8005696753
1795 8018127613
1796 8018154067
1797 8018163306
1798 8018178996
1799 8023682714
1800 8024486070
1801 8024488468
1802 8024501147
1803 8054005377
1804 8054463266
1805 8055621525
1806 8056377057
1807 8056387381
1808 8057881883

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13433

Peripla_BP_5

Periplasmic binding protein domain

66

436

0.97

PF13458

Peripla_BP_6

Periplasmic binding protein

65

414

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7s6e-assembly1.cif.gz_A crystal structure of urta from synechococcus cc9311 in complex with urea and calcium 0.9346 31 418
8hic-assembly1.cif.gz_A crystal structure of urta from prochlorococcus marinus str. mit 9313 in complex with urea and calcium 0.9302 31 418
7s6f-assembly1.cif.gz_A crystal structure of urta1 from synechococcus wh8102 in complex with urea and calcium 0.9293 31 418
1qnl-assembly1.cif.gz_A amide receptor/negative regulator of the amidase operon of pseudomonas aeruginosa (amic) complexed with butyramide 0.9214 35 399
8hic-assembly1.cif.gz_A crystal structure of urta from prochlorococcus marinus str. mit 9313 in complex with urea and calcium 0.9098 31 418
ID Description Score Start End Superfamily
1qo0B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9348 35 370 3.40.50.2300
af_A0A0R0JFH4_66_156_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9211 73 130 3.40.50.2300
1qo0B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9162 35 370 3.40.50.2300
af_A0A0R0JSN9_31_182_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9118 35 130 3.40.50.2300
af_Q69L07_59_152_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8913 73 130 3.40.50.2300
ID Description Score Start End GO Terms
AF-F4MVB3-F1-model_v4 Aliphatic amidase expression-regulating protein 0.9767 60 301
AF-A0A2N2SKZ0-F1-model_v4 Urea ABC transporter substrate-binding protein 0.9765 57 405
AF-A0A439KL30-F1-model_v4 Urea ABC transporter substrate-binding protein 0.9765 277 384
AF-A0A7C1HSL2-F1-model_v4 Urea ABC transporter substrate-binding protein 0.9764 31 147
AF-A0A833USZ4-F1-model_v4 Aliphatic amidase expression-regulating protein 0.976 89 405

Map